2QY0A

Active dimeric structure of the catalytic domain of c1r reveals enzyme-product like contacts
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
154
Chain Sequence
QACPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C1r subcomponent
publication title Revisiting the mechanism of the autoactivation of the complement protease C1r in the C1 complex: Structure of the active catalytic region of C1r.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 27
structure length 154
sequence length 157
chains with identical sequence C
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2qy0A01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2qy0A02
1TPMA 1CKLA 1GHQB 3EJHA 1SS2A 1H2QP 1H04P 5HYTB 4AYIA 3TVJA 2JGXA 2W80A 1HFIA 2BZMA 2RLPA 3ERBA 3O8EB 2KMSA 2XRDA 3RJ3D 2KRIA 1U5MA 1OJYA 1UOTP 2IZ3A 1QUBA 1O9AA 4CSYA 3OEDC 4LOSA 2ERJA 2MCYA 4JHSA 2XQWC 1VVCA 1QGBA 4MUCA 1LY2A 3M7PA 1GKGA 5HYUB 1TPGA 4A5WB 2RKYA 2XRBA 3INBC 2UWNA 1E5GA 2YBYA 2W81A 3CALA 2RKZA 2MCZA 1H03P 3ZD2A 1HCCA 2O39C 2CG6A 1G4FA 4WJG2 4PZ5A 4IGDA 4YNXA 4AYEA 1OK9A 3T5OA 3ZD1A 5JPMG 2XWBF 2EC3A 1FBRA 4LOTA 2RL0A 1C1ZA 2G7IA 5I0QB 1VVDA 1OK2A 1Z92B 5FO8C 4ZH1D 5HZPB 1MD7A 2CKUA 4AYDA 5HYPA 1GPZA 1HFHA 1Q3XA 1GKNA 1H2PP 1ELVA 2XWJI 2V8EA 3IX0A 3KZJA 2CG7A 2A55A 1OK1A 3NFPI 1OJWA 3R62A 1SRZA 1TPNA 2IZ4A 4KKDA 3MQLA 3IU3I 2WIIC 3KXVA 1QO6A 2B5ID 2QY0A 4ONTD 2JRAA 3GOVA 4AYMA 2LOJA 2JGWA 4K12A 4C16A 4J38B 1OJVA 1E8BA 2RLQA 1NWVA 4B2SA 3ZRZA 3OXUD 1OK3A 3SW0X 1PPQA 1G4GA 4B2RA 3GXEA 3L89M 3OP8A 1E88A 2YRAA 4DJZA 1MD8A 4F4OC 4FXGG 1ZJKA 2EHFA
chains in the Genus database with same CATH superfamily
5DN4A 1TPMA 1CKLA 1GHQB 3EJHA 1SS2A 4BWCA 1H2QP 1H04P 5HYTB 4AYIA 2ZYCA 3TVJA 2JGXA 2W80A 1HFIA 2BZMA 2RLPA 5DN5A 3ERBA 3O8EB 2KMSA 3CI0J 2XRDA 3RJ3D 2KRIA 1U5MA 1OJYA 1UOTP 2IZ3A 1QUBA 1O9AA 2X2ZA 3OEDC 4LOSA 4CSYA 2ERJA 2MCYA 4JHSA 2XQWC 1VVCA 2Y8SA 1QGBA 4MUCA 1LY2A 3M7PA 1GKGA 5HYUB 1TPGA 4A5WB 2RKYA 2XRBA 3INBC 2UWNA 2Y8RA 3ZLEA 2YBYA 1E5GA 2W81A 3CALA 2RKZA 2MCZA 1H03P 3ZD2A 3WSXA 1HCCA 2O39C 2CG6A 1G4FA 4WJG2 4PZ5A 4IGDA 4YNXA 3FGRA 4AYEA 1OK9A 3T5OA 3ZD1A 5JPMG 2I2LA 2XWBF 2EC3A 1FBRA 4LOTA 3K3TA 2RL0A 1C1ZA 3FGTA 2G7IA 5I0QB 1VVDA 1OK2A 1Z92B 3VWOA 5FO8C 4ZH1D 5HZPB 1MD7A 4N7EA 2CKUA 3NJAA 4AYDA 5HYPA 1GPZA 1HFHA 1Q3XA 1GKNA 1H2PP 1ELVA 4APLA 2XWJI 2V8EA 3IX0A 3KZJA 1RLHA 2CG7A 2A55A 1OK1A 2Y8TA 3NFPI 1OJWA 3R62A 1SRZA 1TPNA 2IZ4A 4KKDA 3MQLA 3IU3I 2WIIC 3F6KA 3KXVA 4MSLA 1QO6A 2B5ID 4PO7A 2QY0A 4ONTD 2JRAA 3GOVA 4AYMA 2LOJA 2JGWA 3WSYA 4K12A 4C16A 4J38B 1OJVA 3ZLDA 1E8BA 2RLQA 1NWVA 4B2SA 3ZRZA 4YIZA 3OXUD 1OK3A 3SW0X 1PPQA 1G4GA 4B2RA 3GXEA 3L89M 3OP8A 1E88A 2YRAA 4DJZA 1MD8A 4F4OC 4FXGG 1ZJKA 2EHFA
chains in the Genus database with same CATH topology
1TPMA 1CKLA 1GHQB 3EJHA 1SS2A 1H2QP 1H04P 5HYTB 4AYIA 3TVJA 2JGXA 2W80A 1HFIA 2BZMA 2RLPA 3ERBA 3O8EB 2KMSA 2XRDA 3RJ3D 2KRIA 1U5MA 1OJYA 1UOTP 2IZ3A 1QUBA 1O9AA 4CSYA 3OEDC 4LOSA 2ERJA 2MCYA 4JHSA 2XQWC 1VVCA 1QGBA 4MUCA 1LY2A 3M7PA 1GKGA 5HYUB 1TPGA 4A5WB 2RKYA 2XRBA 3INBC 2UWNA 1E5GA 2YBYA 2W81A 3CALA 2RKZA 2MCZA 1H03P 3ZD2A 1HCCA 2O39C 2CG6A 1G4FA 4WJG2 4PZ5A 4IGDA 4YNXA 4AYEA 1OK9A 3T5OA 3ZD1A 5JPMG 2XWBF 2EC3A 1FBRA 4LOTA 2RL0A 1C1ZA 2G7IA 5I0QB 1VVDA 1OK2A 1Z92B 5FO8C 4ZH1D 5HZPB 1MD7A 2CKUA 4AYDA 5HYPA 1GPZA 1HFHA 1Q3XA 1GKNA 1H2PP 1ELVA 2XWJI 2V8EA 3IX0A 3KZJA 2CG7A 2A55A 1OK1A 3NFPI 1OJWA 3R62A 1SRZA 1TPNA 2IZ4A 4KKDA 3MQLA 3IU3I 2WIIC 3KXVA 1QO6A 2B5ID 2QY0A 4ONTD 2JRAA 3GOVA 4AYMA 2LOJA 2JGWA 4K12A 4C16A 4J38B 1OJVA 1E8BA 2RLQA 1NWVA 4B2SA 3ZRZA 3OXUD 1OK3A 3SW0X 1PPQA 1G4GA 4B2RA 3GXEA 3L89M 3OP8A 1E88A 2YRAA 4DJZA 1MD8A 4F4OC 4FXGG 1ZJKA 2EHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TPM A;  1CKL A;  1GHQ B;  3EJH A;  1SS2 A;  1H2Q P;  1H04 P;  5HYT B;  4AYI A;  3TVJ A;  2JGX A;  2W80 A;  1HFI A;  2BZM A;  2RLP A;  3ERB A;  3O8E B;  2KMS A;  2XRD A;  3RJ3 D;  2KRI A;  1U5M A;  1OJY A;  1UOT P;  2IZ3 A;  1QUB A;  1O9A A;  4CSY A;  3OED C;  4LOS A;  2ERJ A;  2MCY A;  4JHS A;  2XQW C;  1VVC A;  1QGB A;  4MUC A;  1LY2 A;  3M7P A;  1GKG A;  5HYU B;  1TPG A;  4A5W B;  2RKY A;  2XRB A;  3INB C;  2UWN A;  1E5G A;  2YBY A;  2W81 A;  3CAL A;  2RKZ A;  2MCZ A;  1H03 P;  3ZD2 A;  1HCC A;  2O39 C;  2CG6 A;  1G4F A;  4WJG 2;  4PZ5 A;  4IGD A;  4YNX A;  4AYE A;  1OK9 A;  3T5O A;  3ZD1 A;  5JPM G;  2XWB F;  2EC3 A;  1FBR A;  4LOT A;  2RL0 A;  1C1Z A;  2G7I A;  5I0Q B;  1VVD A;  1OK2 A;  1Z92 B;  5FO8 C;  4ZH1 D;  5HZP B;  1MD7 A;  2CKU A;  4AYD A;  5HYP A;  1GPZ A;  1HFH A;  1Q3X A;  1GKN A;  1H2P P;  1ELV A;  2XWJ I;  2V8E A;  3IX0 A;  3KZJ A;  2CG7 A;  2A55 A;  1OK1 A;  3NFP I;  1OJW A;  3R62 A;  1SRZ A;  1TPN A;  2IZ4 A;  4KKD A;  3MQL A;  3IU3 I;  2WII C;  3KXV A;  1QO6 A;  2B5I D;  2QY0 A;  4ONT D;  2JRA A;  3GOV A;  4AYM A;  2LOJ A;  2JGW A;  4K12 A;  4C16 A;  4J38 B;  1OJV A;  1E8B A;  2RLQ A;  1NWV A;  4B2S A;  3ZRZ A;  3OXU D;  1OK3 A;  3SW0 X;  1PPQ A;  1G4G A;  4B2R A;  3GXE A;  3L89 M;  3OP8 A;  1E88 A;  2YRA A;  4DJZ A;  1MD8 A;  4F4O C;  4FXG G;  1ZJK A;  2EHF A; 
#chains in the Genus database with same CATH topology
 5DN4 A;  1TPM A;  1CKL A;  1GHQ B;  3EJH A;  1SS2 A;  4BWC A;  1H2Q P;  1H04 P;  5HYT B;  4AYI A;  2ZYC A;  3TVJ A;  2JGX A;  2W80 A;  1HFI A;  2BZM A;  2RLP A;  5DN5 A;  3ERB A;  3O8E B;  2KMS A;  3CI0 J;  2XRD A;  3RJ3 D;  2KRI A;  1U5M A;  1OJY A;  1UOT P;  2IZ3 A;  1QUB A;  1O9A A;  2X2Z A;  3OED C;  4LOS A;  4CSY A;  2ERJ A;  2MCY A;  4JHS A;  2XQW C;  1VVC A;  2Y8S A;  1QGB A;  4MUC A;  1LY2 A;  3M7P A;  1GKG A;  5HYU B;  1TPG A;  4A5W B;  2RKY A;  2XRB A;  3INB C;  2UWN A;  2Y8R A;  3ZLE A;  2YBY A;  1E5G A;  2W81 A;  3CAL A;  2RKZ A;  2MCZ A;  1H03 P;  3ZD2 A;  3WSX A;  1HCC A;  2O39 C;  2CG6 A;  1G4F A;  4WJG 2;  4PZ5 A;  4IGD A;  4YNX A;  3FGR A;  4AYE A;  1OK9 A;  3T5O A;  3ZD1 A;  5JPM G;  2I2L A;  2XWB F;  2EC3 A;  1FBR A;  4LOT A;  3K3T A;  2RL0 A;  1C1Z A;  3FGT A;  2G7I A;  5I0Q B;  1VVD A;  1OK2 A;  1Z92 B;  3VWO A;  5FO8 C;  4ZH1 D;  5HZP B;  1MD7 A;  4N7E A;  2CKU A;  3NJA A;  4AYD A;  5HYP A;  1GPZ A;  1HFH A;  1Q3X A;  1GKN A;  1H2P P;  1ELV A;  4APL A;  2XWJ I;  2V8E A;  3IX0 A;  3KZJ A;  1RLH A;  2CG7 A;  2A55 A;  1OK1 A;  2Y8T A;  3NFP I;  1OJW A;  3R62 A;  1SRZ A;  1TPN A;  2IZ4 A;  4KKD A;  3MQL A;  3IU3 I;  2WII C;  3F6K A;  3KXV A;  4MSL A;  1QO6 A;  2B5I D;  4PO7 A;  2QY0 A;  4ONT D;  2JRA A;  3GOV A;  4AYM A;  2LOJ A;  2JGW A;  3WSY A;  4K12 A;  4C16 A;  4J38 B;  1OJV A;  3ZLD A;  1E8B A;  2RLQ A;  1NWV A;  4B2S A;  3ZRZ A;  4YIZ A;  3OXU D;  1OK3 A;  3SW0 X;  1PPQ A;  1G4G A;  4B2R A;  3GXE A;  3L89 M;  3OP8 A;  1E88 A;  2YRA A;  4DJZ A;  1MD8 A;  4F4O C;  4FXG G;  1ZJK A;  2EHF A; 
#chains in the Genus database with same CATH homology
 1TPM A;  1CKL A;  1GHQ B;  3EJH A;  1SS2 A;  1H2Q P;  1H04 P;  5HYT B;  4AYI A;  3TVJ A;  2JGX A;  2W80 A;  1HFI A;  2BZM A;  2RLP A;  3ERB A;  3O8E B;  2KMS A;  2XRD A;  3RJ3 D;  2KRI A;  1U5M A;  1OJY A;  1UOT P;  2IZ3 A;  1QUB A;  1O9A A;  4CSY A;  3OED C;  4LOS A;  2ERJ A;  2MCY A;  4JHS A;  2XQW C;  1VVC A;  1QGB A;  4MUC A;  1LY2 A;  3M7P A;  1GKG A;  5HYU B;  1TPG A;  4A5W B;  2RKY A;  2XRB A;  3INB C;  2UWN A;  1E5G A;  2YBY A;  2W81 A;  3CAL A;  2RKZ A;  2MCZ A;  1H03 P;  3ZD2 A;  1HCC A;  2O39 C;  2CG6 A;  1G4F A;  4WJG 2;  4PZ5 A;  4IGD A;  4YNX A;  4AYE A;  1OK9 A;  3T5O A;  3ZD1 A;  5JPM G;  2XWB F;  2EC3 A;  1FBR A;  4LOT A;  2RL0 A;  1C1Z A;  2G7I A;  5I0Q B;  1VVD A;  1OK2 A;  1Z92 B;  5FO8 C;  4ZH1 D;  5HZP B;  1MD7 A;  2CKU A;  4AYD A;  5HYP A;  1GPZ A;  1HFH A;  1Q3X A;  1GKN A;  1H2P P;  1ELV A;  2XWJ I;  2V8E A;  3IX0 A;  3KZJ A;  2CG7 A;  2A55 A;  1OK1 A;  3NFP I;  1OJW A;  3R62 A;  1SRZ A;  1TPN A;  2IZ4 A;  4KKD A;  3MQL A;  3IU3 I;  2WII C;  3KXV A;  1QO6 A;  2B5I D;  2QY0 A;  4ONT D;  2JRA A;  3GOV A;  4AYM A;  2LOJ A;  2JGW A;  4K12 A;  4C16 A;  4J38 B;  1OJV A;  1E8B A;  2RLQ A;  1NWV A;  4B2S A;  3ZRZ A;  3OXU D;  1OK3 A;  3SW0 X;  1PPQ A;  1G4G A;  4B2R A;  3GXE A;  3L89 M;  3OP8 A;  1E88 A;  2YRA A;  4DJZ A;  1MD8 A;  4F4O C;  4FXG G;  1ZJK A;  2EHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...