2QYBA

Crystal structure of the gaf domain region of putative membrane protein from geobacter sulfurreducens pca
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
SEIMNRTLDLQIIMDDLLNLLLKEFKLDLAVIRLVDEKGVLRVRSYSGKGIAGIAGKDWEPEIETYIGEAFLSNRLQFVNDTQYMTKPLTRELMQKEGIKSFAHIPISRKGEPPFGILSVFSRTIVGLFNEPFLNLLESLAGQLAQAVKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane protein, putative
publication title Crystal structure of the GAF domain region of putative membrane protein from Geobacter sulfurreducens PCA.
rcsb
source organism Geobacter sulfurreducens pca
molecule tags Membrane protein
total genus 42
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qybA00
2O9CA 5DFXA 3KSFA 3O5YA 4LRZE 3TRCA 4EUVA 1YKDA 2VKSA 5TJJA 3NOTC 5DFYA 1ZTUA 3MMHA 3KO6A 4IUKA 1YSPA 4Y2FA 2IA2A 5HL6A 3OOVA 3MQ0A 1MKMA 2OOLA 3S7NA 3E98A 3LFVA 2W1TB 3KSGA 4FOFA 3S7QA 2Y79A 5LBRA 3CITA 3K2NA 2O0YA 3BJNA 4G3KA 3NOUC 2W3DA 4Q0HA 5AJGA 1TF1A 4BWIA 2K2NA 5HPIA 4O8GA 2VEAA 1TD5A 4DN0A 2VZWA 4PAUA 1F5MA 4O01A 5I5LA 5HPFA 3ZQ5A 3EEAA 2LB9A 4MDZA 4YOFA 5L8MA 2W1RA 2M7VA 2M7UA 3E0YA 1MC0A 4O0PA 3D3OA 3W2ZA 2K31A 4LRXC 4GLQA 4R6LA 2B18A 4MN7A 2W3GA 4Y5FA 3MF0A 3S7OA 2XSSA 3C2WA 5C5KA 4GW9A 3CI6A 2O9BA 5HSQA 2KLIA 2KOIA 2Y8HA 4Q0JA 2GX5A 2ZMFA 3DBAA 4G3WA 4Q0IA 3KSHA 4IUHA 1YSQA 4ZRRA 4ME4A 2W3HA 2HGVA 3HCYA 4CQHA 2VJWA 2W1TA 4MCWA 4MMNA 1STZA 5K5BA 3IBRA 4LRYC 2G7UA 3R4KA 4YNRA 4Z1WA 4G3VA 3NOPC 4RQ9A 4R70A 4IJGA 4DMZA 2W3FA 2W3EA 2QYBA 4ETXA 4E04A 2XRNA 2O99A 4EU0A 3OBFA 3IBJA 4Y3IA 3VV4A 3RFBA 2O9AA 2LB5A 3G6OA 4ETZA 4QPRA 1VHMA 2XROA 3KSIA 3NHQA 3S7PA
chains in the Genus database with same CATH superfamily
1A0KA 2JKTI 3N8RA 3NDGA 4I3IA 2HJEA 5CX7A 1QMEA 5HFOA 3GRJA 2PT7A 3S22A 5F83A 2P9VB 2J3TC 5CRFA 2ZMAA 3A3IA 5HWWA 3HREA 3LR5A 2HP6A 3HLEA 2Y79A 4CPKA 3T4QA 2INWA 1PZPA 4GDBA 1XP4A 4XT2A 4Q0HA 5D3OA 1TD5A 1P9RA 5TBMA 3P7NA 4EBPA 2WKRA 4PAUA 3H82B 2WUQA 2LB9A 4YOFA 2DNSA 2PD7A 1JTDA 3PYPA 2EA9A 3UDFA 3ZHHA 1DJCA 4I3AA 3Q1FA 1K6RA 3T4KA 3S4XA 4GJ4A 4R3BA 3CUEA 4KZ6A 3HBRA 2J3WA 1VEUA 3G2YA 2XFTA 1FQGA 4K0XA 4R4SA 5A90A 1I2SA 1IKGA 5KMWA 1MWRA 3HJKA 1OMEA 1TVFA 2PD8A 2WYXA 4NG2A 3NY4A 3UE0A 4JBFA 3R4KA 4OOLA 3OLOA 3LO7A 4E04A 1HTZA 4PKYG 5FI6A 1K55A 2JN7A 3ISGA 5AVEA 4HP9A 5J8XA 1H0MA 3I7JA 1L0FA 4GD6A 3FKVA 3W4QA 3SS5A 4OPRA 3AGFA 2B5RA 3FPVA 1OTAA 4L9EA 4CLCD 5HL6A 1XJ2A 4BMWA 3KSGA 3N6IA 2V0WA 4OLDA 4YWZA 5HX9A 5LBRA 3UB9A 5DKKA 3K2NA 1X0OA 2CC1A 1YMXA 2EFXA 2JHEA 3FG8A 3UN7A 1TF1A 4QU3A 3PTEA 1ESUA 2XA7M 4HH2A 3TW8A 2Y55A 2XFSA 1NYYA 2EX8A 2ZQCA 4U3TA 1NY0A 2W1RA 3K3CA 4FUWA 3RTYA 4O0PA 1PIOA 3PBTA 3ZG5A 1NJ4A 3P09A 1SKOB 1ZKJA 3HLWA 3BEBA 1OJ5A 1W7FA 3E4PA 1DY6A 3Q7VB 2OWJA 1OJGA 3NC8A 1LI0A 5DVAA 4NK3A 2V2FF 4Q0IA 3SOIA 4BD0A 4R0QA 5GL9A 5FA7A 1IFQA 1SDEA 5HW3A 1NRFA 3ZG9B 3HCYA 4H8RA 1ERMA 4MCWA 4KUKA 1VM1A 5CHUA 3AGEA 2VA0A 4KQRA 2M1CA 3MXSA 5HD3A 5HDCA 4YNRA 1KVMA 4WMCD 4NEED 1V9ZA 3LYXA 1SKFA 1K25A 3E4OA 2D01A 4N9KA 3EOIA 1EI5A 3G6OA 2LB5A 3BLMA 3ZG8B 3QP2A 1JVJA 1N9OA 1P0ZA 1LL5A 5FL3A 4E3IA 5FAPA 3OC2A 2ZQ9A 2Y2HA 3C8CA 1Z09A 1W63Q 5E2HA 1F2KA 4S2NA 3MQ0A 5F5YA 1MKMA 5G4YA 3E98A 3PBSA 1PW8A 4HP4A 1YLZA 3T1RA 3LIAA 5FDSA 1G6OA 2FFYA 4OP5A 5DTSA 4DXBA 3FWLA 5HPIA 3WRZA 5M19A 3ZVWA 1K4FA 4O01A 4ZJ2A 3HLBA 2ZLYA 1W8QA 4UA7A 1YM1A 2J3TD 2WKHA 3O88A 1MC0A 3ULFA 4ARZA 1L3LA 5HAPA 2VV7A 4OQ0A 3E2KA 1ES5A 3KYEA 3BY9A 1XXMA 2ZMVA 3WS5A 4OKPA 3BWLA 3L9KA 4IBXA 2GX5A 3SS3A 1ES4A 4LENA 4XUXA 2H10A 4X55A 3UB6A 1CI9A 4HNBA 4ZAMA 2WAEA 1PWDA 4PM9A 4CQHA 4BBTA 2Y2PA 3MFDA 2H5SA 3IBRA 1LL9A 3IF5A 4LRYC 4L9FA 3FPWA 2WGWB 4R70A 2C5WB 3F1OB 5A92A 3R7WA 5HZHA 2WK0A 3MZEA 4UA6A 2R78A 2BG1A 2KDKA 3A3JA 3E4QA 3O5YA 1ACFA 4EUVA 4EQ1A 4EBLA 3EWKA 3T4TA 1LHYA 3MS6A 4JXWA 4S2OA 3HUOA 4OPYA 4GHIB 4JGPA 3A0SA 4LV2A 5CECA 1Y54A 2EFUA 3SZTA 1LSVA 2PR5A 4NXBA 1S66L 4O8GA 1KDSA 5FQIA 1E3UA 3PR6A 3IF6A 2OLVA 3ZCZA 3T12B 4NXFA 3SS4A 1D7EA 3UY6A 1YLWA 3D9YA 1K55C 2J8YA 4S2LA 4X6TA 5FSRA 4DF6A 3SH7A 1S4SA 5E43A 3A3FA 1GSVA 3DTMA 3VSKA 3A3DA 1VB6A 5J4EA 3GQZA 3QNCA 1Q2QA 4E6XA 1CK3A 5HARA 1TEMA 2XDMA 2XQZA 4IUHA 1YSQA 3ICYA 1RCJA 5CGSA 3B33A 3DTKA 3IHBA 5TR7A 1ONHA 4MMNA 5CTMA 3ZGAB 1ALQA 5EVLA 3WS4A 1H8MA 4BBVA 1NWZA 3C4OA 4CJNA 2QYBA 1BLPA 4ETXA 2O99A 1F98A 4GB7A 3UNWA 3BLSA 4QPRA 1SCWA 5CERA 4JLFA 5DFXA 4ZDXA 1ERQA 4EERA 3KYQA 1PZOA 2L0WA 3NOTC 4FCFA 1JTGA 3U4LP 1O07A 1Y4OA 1YPRA 2ZD8A 4L0LA 5L10A 3S7QA 3LI8A 3MFXA 2OAQ1 2EX2A 2PHYA 4JF4A 5EE8A 4BWIA 3OPLA 5IT5A 2K2NA 2GJ3A 2Y2NA 4S2MA 2D02A 1G28A 4NXGA 4BD1A 3IXBA 4RVAA 3GSGA 1XFNA 5HDDA 2JKGA 1I5QA 3EEHA 4R6LA 4N92A 3G30A 2PRFA 1YT4A 3T4OA 5FI2A 2QHKA 2KOIA 3Q81A 3CG5A 4OH0A 2P9VA 5TGFA 4ME4A 1FSYA 3Q82A 2XK1A 2R9XA 1CI8A 1HD8A 2VJWA 3M6BA 1CJFA 4LCMA 2XD1A 2G7UA 4DDSA 4QJGA 1BULA 4H6JB 4G3VA 3F1NA 4OQGA 2W3FA 1FILA 2X71A 3LY3A 4C6YA 5JYPA 4FH4A 3LIDA 4EUZA 2V8FA 5DF7A 4MBFA 3VOLA 3IS2B 1S1ZA 2Z6DA 3AGDA 2J9OA 1NYMA 2IWBA 1XJ3A 4HESA 5EOEA 4WZ4A 3IX4A 1TS6A 4M4XA 2QKPA 2WKPA 5DFYA 1CEGA 4X53A 1K54C 1KGEA 4R23A 3RXWA 5IS1A 1KE0A 5FATA 3FZCA 1CQAA 4OOMA 3GECA 3LFVA 3CHWP 4EEPA 5HWVA 2RL3A 4KQDA 3N8LA 3NOUC 2QPNA 3BM6A 1PRQA 1YMSA 5EOOA 1MKIA 3MQQA 2V9AA 5M18A 4UQIS 1J9MA 3JPUA 3UMEA 2Q9MA 2VGJA 1KVLA 1BLSA 4YFMA 2PYPA 4O7DA 4DDYA 3MF0A 3C2WA 3DTIA 4GW9A 5AQBA 4WEKA 4F94A 5FI7A 3VP1A 5F1GA 4R4RA 1DJAA 3CZDA 2J80A 2W27A 3P01A 2QWSA 4XUZA 4EESA 4ID4A 2VGKA 3DAVA 2WZZA 3EQVA 5DF8A 3HJIA 3NOPC 3IF6C 3IXGA 1OTBA 4Y0TA 2XRNA 4ZTKA 1T18A 3ITAA 3V3RA 5CHJA 1Q2PA 3KSIA 2P74A 2FZ0A 4DE2A 1UWPX 4RX2A 3KSFA 1SKOA 5EVIB 1ES2A 4PHTA 5EM0A 5HAIA 3Q7VA 2A3UA 2B02A 1L0EA 2OOLA 3G31A 2XF3A 4JXSA 1XA7A 4UAAA 2HF6A 1K38A 4IHQA 1MY8A 2O0YA 2PU2A 3MXQA 2OAP1 5CEDA 1WE4A 3OZHA 2ZBBA 2BASA 2Y2GA 3L7HA 4GN2A 3M2KA 1E4DA 1F5MA 4KZ5A 1HZOA 5L07A 1ZG6A 3V67A 2M7VA 4BJPA 3JVUA 4XT2B 2BTFP 2HDRA 4MN7A 1P97A 3S7OA 4GCZA 4HBTA 2NUTC 4QHCA 3MJQA 1YQSA 3HUNA 4KG2A 4II7A 3PBQA 4G3WA 4WF0A 3UPOA 4X68A 3UB5P 5CHMA 2XA7S 2HJ9C 1JWZA 4MLLA 2PU4A 2A24A 1FCOA 4C3QA 3MR0A 1P9WA 3BYDA 2XH9A 4E6WA 5EV0A 4WN5A 4P85A 4Y13A 4DRTA 3H7WB 1GHIA 5GHYA 1W5DA 4WUJA 4L9GA 3G2ZA 3QP4A 2XEPA 3OPRA 2VV8A 3JYIA 4LRZE 4FD8A 1WA9A 1XFQA 4P6ZS 4UA9A 1MWSA 2Z2MB 3OCNA 4N1XA 2W0NA 2I9VA 4MNRA 1NZOA 3IWOA 2PYRA 4RA7A 3OOVA 3S7NA 4LCLA 5FDHA 3LR4A 4FOFA 4B93A 2YKHA 3E2LA 4OQIA 3CLOA 5EECA 1GSWA 1G5UA 4I39A 1MBLA 3NULA 1K6SA 2WGWA 3QP6A 3F1OA 1SDNA 5F6AA 5HPFA 4X56A 1CEFA 2EXBA 4KZAA 3M2JA 4N9LA 4K0WA 2PBDP 2K31A 2E8JA 4Y5FA 5F82A 5E2FA 3T1QB 3TG9A 1HLUP 2Z6CA 4NKPA 4KQOA 1MPLA 2ZMFA 3CJMA 5G4ZA 5FEGA 4P87A 1H8ZA 4GHIA 1ONGA 4HQAA 2X02A 1BT5A 3MBZA 1NRJA 5K5BA 3T4SA 2CMNA 3SW1A 4CLCB 2UV0E 3MZFA 3CMZA 1AWIA 4DMZA 1K54A 1OT9A 1VQQA 3LR3A 1Y28A 4R38A 3Q7ZA 1IELA 5CGWA 2XROA 4B9OA 2A49A 1TDLA 3F1PB 4OLGA 4D60A 4KZ7A 3BFGA 1FR1A 4IEDA 1YKDA 1S0WA 2WZXA 2HP9A 1EWZA 4C75A 5TJJA 1E3UD 4CLCE 4GS9A 4QWOA 4S2PA 3MQOA 4X1MA 1PW1A 1DP9A 5JYOA 4BL3A 1VETB 2W1TB 3O3VA 3VMAA 4F3LB 2ZQ8A 3QP5A 1PWCA 5F68A 4E3LA 2VEAA 1GCEA 4HH3A 4Y0UA 3D72A 4Y15A 5DJUA 2EX9A 1AXBA 4PKYA 4JXGA 1IYPA 2IWCA 2M7UA 3G35A 1KDWA 2BLSA 3SH8A 3GVBA 1RP5A 1ODVA 2HP5A 4I3JA 2PAVP 3IH8A 3PAEA 4B4ZA 1GHPA 3A0RA 1K56A 1DP6A 1RGYA 4QY5A 1N4OA 2J9PA 3W4OA 2YKFA 3T4JA 1T1CA 3T50A 3N4IA 1BUEA 4JKTA 1ZG4A 4RQ9A 2PR6A 1MXOA 1HVBA 2R9WA 4K08A 2Z2LB 4DE0A 2H0TA 1EW0A 1WYCA 1UWNX 3OBFA 1BLHA 3H9WA 2H0YA 4K91A 2ZC3B 3LR0A 3G34A 3BQ8A 1W63M 4AFIA 4R3JA 3R7WB 3IXDA 1OTDA 4X69A 1E25A 4IUKA 5CTNA 3IXHA 1EROA 4WL9A 1PI5A 4B4XA 1I2WA 3FKWA 3UB7A 3UO9A 3CITA 3WWXA 3PHYA 5GLDA 4G3KA 1NLZA 3WS0A 2Y59A 5E2GA 2WGVA 2ZJ9A 1M40A 3EGDC 3BFDA 3LCEA 1PYYA 2WADA 4Q8IA 1S1YA 2L1MA 5GLBA 1KGGA 3D4FA 3W2ZA 4OPQA 1XJ6A 1IEMA 1XX2A 1KE3A 4HI4A 3BY8A 1NLYA 2C6WB 4KUOA 3TE8A 1T19A 2HDSA 1W8YA 2L4RA 5HAQA 4JGOA 3K3DA 1D06A 4EV4A 3CAXA 3HLCA 1XGIA 4Y7PA 3RJUA 5GHZA 1PFLA 4HEFA 1JWVA 3BQAA 1V9YA 3PBNA 1ZHHB 1YLJA 4LV3A 4HHDA 4EBNA 4JXVA 3NJAA 3IBJA 3RFBA 1VHMA 4KQQA 5A8BA 3C5AA 4M3KA 1GA0A 2FFFB 4DE1A 2G2UA 1K57A 4WZ5A 3TJZC 5FEFA 5L09A 4IVKA 2ZC4B 1MWTA 1RGZA 1W79A 3FYZA 3BFEA 4Y2FA 1O7EA 4KG5A 4Y0OA 4HY8A 5HWTA 3O87A 3H82A 2ZL1B 3UDXA 4X25A 2FH5A 4A5RA 1OTEA 4QD4A 4U0XA 2Y91A 5FAQA 4LPZA 4LLOB 3IWIA 2J7VA 1GA9A 2AVXA 5E2EA 2ZC5B 4MEZA 5DF9A 3ZQ5A 4MDZA 2V8CA 1MWUA 2IWDA 3G4PA 4UHUA 4LRXC 2ACGA 2B18A 3IT9A 4OOYA 4ESPA 3OCLA 1OPXA 2I72A 3UB8A 5IU1A 4NETA 2KLIA 5EVIA 2X01A 2VGLS 2GNXA 3VP2A 1IYQA 3DBAA 2Q9NA 3PAGA 4ZRRA 4BLMA 3CPTB 4S2IA 4JGRA 4MBKA 5U47A 1STZA 2WGIA 4GDNA 1KE4A 3RH8B 4PPRA 4Z1WA 5M1AA 2RCXA 4OPZA 1PI4A 4HIAA 1BZAA 2PDRA 1PWGA 4IBRA 1DJBA 4KZ4A 2HV1A 4GZBA 3FC7A 5FAOA 4I5SA 4D2OA 1XGJA 3QNBA 4KG6A 2OSUA 3F1NB 3GMWA 3ZFZA 5GHXA 2ZQ7A 5IHVA 4FH2A 5MC7A 5GLCA 3QP8A 5FQMA 4EXOA 4QY6A 2Y4AA 3BJNA 3MKFA 5G18A 2OV5A 3WRTA 2MJ6A 4DN0A 1FSWA 2VZWA 3BRMA 3OPHA 3V50A 2OLUA 1G6AA 3EEAA 4U0TA 2VK3A 3H7WA 5FQKA 3LUQA 4S2KA 2ZC6B 4JF5A 2WAFA 3B47A 3UPNA 3W8KA 5KZHA 1LT0A 3IQAA 4N1HA 3OPPA 2P04A 2Y8HA 4GD8A 3P98A 2ZQAA 4IVIA 1S67L 1BLCA 4HJ3A 3EQUA 4RX3A 1YAXA 5DKLA 3BFFA 5L2FA 4OQHA 1L2SA 5TBMB 2ZM0A 2XLNA 4I38A 4EWFA 3UE1A 3B42A 3V3SA 3NBLA 3IH9A 3NCKA 5EFWA 3GV9A 2VX8A 3BW6A 5AQ7A 2A2LA 3S7PA 2O9CA 4MN5A 2VLGA 4ZJ1A 3JVVA 1BYWA 5EUAA 5J3WA 4NXEA 4E3MA 4JF6A 3ITBA 1VEUB 1SHVA 3KO6A 1NZUA 4UEYA 2Y2OA 3SH9A 4OONA 4KZ9A 1K0KA 1CF0A 2ZOHA 2W3DA 3T4LA 3NI9A 3DWKA 4ZJ3A 2WKQA 2XGNA 2WKIA 3UMDA 2JCHA 4CLCA 5A91A 4P6ZM 4DJ2A 3U2AA 1H3QA 4DJ3A 1D1JA 1JWPA 5L8MA 4RYEA 4R1GA 5HD5A 1FCNA 1LL8A 4GLQA 1IKIA 2Q0OA 3QHYA 1T1BA 4GNUA 4WLAA 3F1PA 3VFFA 1T1AA 1K57C 2ZQDA 2QJ5A 4WZ5C 4Z9QA 2H28A 3GR2A 3HL9A 5F69A 3T1XA 4Y17A 1XPBA 4DE3A 4KZBA 1XA1A 3VP4A 5AQ9A 3KSHA 2VV6A 5AQAA 1VETA 3HLFA 2W3HA 2EWVA 2V1ZA 3M6HA 4HOIA 2W1TA 3LICA 1LSWA 4P6BA 4PM6A 1M6KA 4F3LA 1KGFA 2KX6A 1DP8A 3TSGA 3A0VA 1LLBA 3TOIA 3LI9A 3VE4A 5EPHA 4EU0A 2DRWA 4PM7A 4HJ6A 2A24B 4Y3IA 1U60A 1YLPA 2Y2QA 3NHQA 1LSXA 2V20A 3S1YA 5KIZA 3LIEA 3PXPA 4WMCA 3ZYTA 2WKEA 2EWWA 1JNUA 2HDUA 5EVIC 3MMHA 3C30A 1YSPA 3MZDA 5J7EA 2K7SA 1XKZA 2OWHA 3PBRA 3MSHA 3WS2A 2Y2MA 3BFCA 3W4PA 3MXRA 4FTXA 1L0GA 3VE3A 5AJGA 4GOGA 3CWFA 3NIAA 4B88A 3LEQA 3HLDA 1PNEA 1F9IA 2EX6A 3LEZA 1ZC2A 1K56D 1J3WA 3UDIA 5KSHA 5CEBA 2DCFA 3D3OA 3KX0X 1MZUA 3UE3A 3DW0A 2QJ7A 2O9BA 4E3JA 4HJ4A 3VP0A 5KSCA 3GTCA 1IYOA 3IX3A 4PM5A 2JBFA 1H5XA 5GLAA 1DRMA 4E3NA 3IX8A 4PMAA 2DMWA 1TDGA 1GHMA 3FV7A 4JGQA 3CUEC 3GDIA 4WEJA 1FOFA 4BENA 4WBGA 5EM1A 1TS0A 4WYYA 5EVEA 4ARZB 2O9AA 3C7VA 2XR0A 3B3XA 4R3AA 3LGOA 3V5MA 4MN6A 4KZ8A 2ZC7A 2JKRM 2V1AA 3TRCA 5FQQA 2Y2IA 2V0UA 1C3BA 5FQJA 1N9LA 1XJ4A 3ZNTA 3N8SA 2UWXA 5DTTA 2PBYA 5AVFA 1TS8A 4MBHA 4OP8A 4X1LA 1H8YA 4LFUA 3V39A 5BOHA 2GZAA 3HUMA 3C4PA 4GS9B 2ZM2A 3C38A 1ES3A 4XXRA 5F1FA 5HDSA 2GDNA 5HL1A 3NECA 5I5LA 2QMIA 4DKIA 1KOUA 3E0YA 1N9NA 4KENB 5I94A 1FCMA 3QP1A 3ZNYA 5DTKA 4BBUA 3WS1A 5C5KA 1ESIA 5HSQA 4P0MA 2Y2JA 4Q0JA 5TFQA 4H6JA 3RXXA 4WELA 1LI9A 1IOUA 3KYZA 2HGVA 2NUPC 5FASA 1NXYA 3UPPA 4LGWA 3LY4A 3Q07A 1WYBA 3IS2A 2ZL1A 1N9BA 3IF6B 4OVDA 4EEUA 1BSGA 1L0DA 3IHAA 4CLCC 1S6RA 3UE6A 3IWQA 4QB8A 1S4RA 4EW7A 1OTIA 2JKTM 1YLTA 3NDEA 2Y2KA 4YINA 2JKRI 2ZM8A 4PM8A 5FQ9A 2G2WA 3A3EA 2JE5A 2VKSA 4WM9A 3ZG0A 3VSLA 2E8IA 4KZ3A 1ZTUA 4E3OA 2HDQA 2QZ6A 2IA2A 3EGXC 4ZBEA 3VOYA 3G32A 2ZOIA 2HPBA 3O86A 1FR6A 1G68A 3BECA 3CPTA 3HVFA 4LV1A 3VFHA 3DTEA 2JKFA 1TS7A 5EVID 4FSFA 4EQIA 4HBUA 2V1BA 2P7JA 4S2NC 4GKUA 1YLYA 1SZVA 3ZG7B 3T1SA 2EXAA 3HLGA 4S2JA 1BTLA 2XD5A 3ZDJA 1Z6FA 2W3GA 1GSXA 1FIKA 2XSSA 2P08A 4JPMA 3CI6A 5DJTA 5A93A 3PBOA 1QMFA 5CGXA 5CXWA 4EETB 3DWZA 2B95A 3VOZA 4BL2A 4DXCA 1IYSA 4LV0A 3N7WA 3ZVTA 2HZ5A 3LIBA 3MKEA 1K4EA 4E3KA 3LIFA 2Y2LA 4BQMA 3VP3A 4IJGA 2W3EA 2JC7A 1OT6A 3VV4A 4ETZA 2VGLM 4UQIM 3C7UA 1UGUA
chains in the Genus database with same CATH topology
2O9CA 3F1PB 4MN5A 5DFXA 2JKTI 2VLGA 3JVVA 1BYWA 4I3IA 2HJEA 1YKDA 5CX7A 5J3WA 4NXEA 4EERA 5TJJA 3KYQA 2PT7A 2L0WA 3NOTC 4CLCE 4GS9A 3KO6A 3MQOA 2J3TC 1DP9A 5HWWA 4L0LA 4UEYA 2W1TB 3LR5A 3S7QA 2Y79A 3T4QA 3LI8A 3MFXA 4F3LB 2INWA 2OAQ1 2ZOHA 2PHYA 2W3DA 3T4LA 4XT2A 4Q0HA 5F68A 4BWIA 5IT5A 2K2NA 2VEAA 2GJ3A 2WKQA 4HH3A 1TD5A 1P9RA 3UMDA 5TBMA 2D02A 3D72A 4CLCA 3P7NA 5DJUA 2WKRA 4PAUA 4DJ2A 4P6ZM 1G28A 4NXGA 3U2AA 1H3QA 4PKYA 3H82B 4DJ3A 2LB9A 4YOFA 5L8MA 1XFNA 2PD7A 5HDDA 5HD5A 2M7UA 1LL8A 3PYPA 2EA9A 3EEHA 4GLQA 4R6LA 1T1BA 4I3AA 4WLAA 3F1PA 1T1AA 3T4KA 4GJ4A 1ODVA 4I3JA 3T4OA 2QHKA 2QJ5A 2H28A 3CUEA 2KOIA 5F69A 3A0RA 2J3WA 1DP6A 3KSHA 2VV6A 4ME4A 2W3HA 2EWVA 3HJKA 4HOIA 2VJWA 2W1TA 3LICA 1LSWA 2PD8A 2YKFA 3T4JA 1T1CA 3T50A 4F3LA 2KX6A 1DP8A 2G7UA 3R4KA 4OOLA 4H6JB 4G3VA 3A0VA 2PR6A 3F1NA 4RQ9A 2W3FA 4K08A 3OLOA 4E04A 3VE4A 3LI9A 3LIDA 4PKYG 1EW0A 4EU0A 1UWNX 3OBFA 4HJ6A 2A24B 4Y3IA 2JN7A 3H9WA 5AVEA 3VOLA 3IS2B 3NHQA 1S1ZA 4HP9A 2Z6DA 1LSXA 3LR0A 5KIZA 3LIEA 3PXPA 1XJ3A 3BQ8A 3ZYTA 1W63M 4AFIA 3R7WB 1TS6A 3FPVA 2EWWA 2QKPA 2WKPA 4M4XA 1OTAA 1JNUA 5DFYA 3MMHA 1OTDA 5IS1A 3C30A 4IUKA 4L9EA 4CLCD 1YSPA 5J7EA 4WL9A 5HL6A 1XJ2A 2K7SA 4OOMA 3GECA 2OWHA 3LFVA 3PBRA 4BMWA 3KSGA 4EEPA 2V0WA 4YWZA 5HWVA 3UB7A 5LBRA 3UB9A 3CITA 3K2NA 5DKKA 4KQDA 1X0OA 3PHYA 4G3KA 3NOUC 1NLZA 3FG8A 2JHEA 3VE3A 5AJGA 1TF1A 3CWFA 2XA7M 4HH2A 3TW8A 3MQQA 2V9AA 3EGDC 4UQIS 1F9IA 1S1YA 2L1MA 2W1RA 3UMEA 3K3CA 5KSHA 3RTYA 4O0PA 3D3OA 3W2ZA 3KX0X 3PBTA 1XJ6A 2PYPA 4HI4A 3MF0A 1MZUA 1OJ5A 3BY8A 3UE3A 3C2WA 3E4PA 1NLYA 2QJ7A 4KUOA 4GW9A 2OWJA 1OJGA 2O9BA 3TE8A 4HJ4A 4WEKA 1T19A 2L4RA 4JGOA 3K3DA 1D06A 4Q0IA 3CAXA 1IFQA 2J80A 2W27A 1DRMA 3P01A 3HCYA 4MCWA 2QWSA 3BQAA 4KUKA 1V9YA 2DMWA 4EESA 3PBNA 2VA0A 2M1CA 5HD3A 5HDCA 4YNRA 3EQVA 3HJIA 4JGQA 4NEED 1V9ZA 1ZHHB 3NOPC 3CUEC 3LYXA 1OTBA 3GDIA 4WEJA 4HHDA 2XRNA 3E4OA 4UQIM 2D01A 3EOIA 3NJAA 3IBJA 1TS0A 1T18A 4ARZB 3RFBA 2O9AA 2LB5A 3G6OA 4R3AA 1VHMA 5A8BA 3KSIA 2FZ0A 4MN6A 1UWPX 2JKRM 3KSFA 2V1AA 3TRCA 1N9OA 1P0ZA 2V0UA 5FL3A 1N9LA 1XJ4A 4PHTA 3TJZC 3OC2A 3C8CA 5AVFA 2B02A 1W63Q 4Y2FA 1TS8A 5F5YA 3MQ0A 2OOLA 1MKMA 5G4YA 3E98A 3PBSA 4HY8A 5HWTA 4HP4A 2GZAA 2HF6A 3H82A 4IHQA 2O0YA 3LIAA 1G6OA 2FH5A 1OTEA 3MXQA 2OAP1 4GS9B 5HPIA 2ZBBA 4LPZA 4LLOB 3C38A 2BASA 5HDSA 1F5MA 4O01A 5I5LA 5DF9A 2J3TD 3ZQ5A 4MDZA 3V67A 1KOUA 2M7VA 4BJPA 3E0YA 3JVUA 1MC0A 4XT2B 1N9NA 3ULFA 4ARZA 4LRXC 2B18A 4MN7A 2VV7A 3OCLA 1P97A 1OPXA 3S7OA 4BBUA 3BY9A 4GCZA 2ZMVA 3UB8A 2NUTC 5IU1A 5C5KA 3MJQA 4II7A 5HSQA 2KLIA 3BWLA 4Q0JA 2VGLS 2GNXA 2GX5A 4H6JA 3DBAA 3PBQA 2XROA 4G3WA 4WF0A 4WELA 3UB6A 4ZRRA 4HNBA 1IOUA 3KYZA 2XA7S 2HJ9C 2HGVA 2NUPC 2A24A 4CQHA 4JGRA 3MR0A 4BBTA 1P9WA 1STZA 3IBRA 3IS2A 4LRYC 4L9FA 3FPWA 4EEUA 3RH8B 4WN5A 4Z1WA 3S7PA 4R70A 3F1OB 4CLCC 3R7WA 5HZHA 3H7WB 4HIAA 3UE6A 2PDRA 2R78A 4WUJA 4L9GA 1S4RA 4EW7A 1OTIA 2KDKA 3E4QA 2JKTM 2HV1A 2VV8A 3FC7A 3O5YA 4I5SA 4LRZE 2JKRI 1WA9A 3F1NB 4EUVA 4EQ1A 1XFQA 4P6ZS 3EWKA 3T4TA 2VKSA 3OCNA 2W0NA 2I9VA 1ZTUA 2IA2A 4GHIB 2PYRA 3EGXC 3OOVA 4JGPA 3A0SA 3S7NA 5MC7A 4EXOA 3LR4A 4FOFA 4B93A 1LSVA 2ZOIA 3BJNA 2YKHA 2PR5A 3CLOA 1GSWA 4NXBA 1S66L 4I39A 4O8GA 2MJ6A 3PR6A 4DN0A 4NXFA 2VZWA 1D7EA 1TS7A 4FSFA 2V1BA 3F1OA 2P7JA 5F6AA 5HPFA 3EEAA 3H7WA 3LUQA 2K31A 3B47A 1S4SA 2W3GA 1GSXA 4Y5FA 1LT0A 2XSSA 2P08A 1GSVA 3CI6A 1VB6A 2Z6CA 2P04A 4NKPA 5J4EA 4KQOA 2Y8HA 5DJTA 3PBOA 2ZMFA 5G4ZA 1S67L 4IUHA 4EETB 1YSQA 3ICYA 4HJ3A 3EQUA 5DKLA 1YAXA 4GHIA 4HQAA 3B33A 4MMNA 1NRJA 3LIBA 5K5BA 3T4SA 2CMNA 3LIFA 5TBMB 3SW1A 4CLCB 1H8MA 4BBVA 4IJGA 4DMZA 1NWZA 4I38A 2W3EA 1OT9A 2QYBA 4ETXA 3B42A 3LR3A 1OT6A 2O99A 1Y28A 1F98A 3VV4A 5EFWA 4R38A 4ETZA 4QPRA 2VGLM 2VX8A 3BW6A 4B9OA 2A2LA 1UGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9C A;  5DFX A;  3KSF A;  3O5Y A;  4LRZ E;  3TRC A;  4EUV A;  1YKD A;  2VKS A;  5TJJ A;  3NOT C;  5DFY A;  1ZTU A;  3MMH A;  3KO6 A;  4IUK A;  1YSP A;  4Y2F A;  2IA2 A;  5HL6 A;  3OOV A;  3MQ0 A;  1MKM A;  2OOL A;  3S7N A;  3E98 A;  3LFV A;  2W1T B;  3KSG A;  4FOF A;  3S7Q A;  2Y79 A;  5LBR A;  3CIT A;  3K2N A;  2O0Y A;  3BJN A;  4G3K A;  3NOU C;  2W3D A;  4Q0H A;  5AJG A;  1TF1 A;  4BWI A;  2K2N A;  5HPI A;  4O8G A;  2VEA A;  1TD5 A;  4DN0 A;  2VZW A;  4PAU A;  1F5M A;  4O01 A;  5I5L A;  5HPF A;  3ZQ5 A;  3EEA A;  2LB9 A;  4MDZ A;  4YOF A;  5L8M A;  2W1R A;  2M7V A;  2M7U A;  3E0Y A;  1MC0 A;  4O0P A;  3D3O A;  3W2Z A;  2K31 A;  4LRX C;  4GLQ A;  4R6L A;  2B18 A;  4MN7 A;  2W3G A;  4Y5F A;  3MF0 A;  3S7O A;  2XSS A;  3C2W A;  5C5K A;  4GW9 A;  3CI6 A;  2O9B A;  5HSQ A;  2KLI A;  2KOI A;  2Y8H A;  4Q0J A;  2GX5 A;  2ZMF A;  3DBA A;  4G3W A;  4Q0I A;  3KSH A;  4IUH A;  1YSQ A;  4ZRR A;  4ME4 A;  2W3H A;  2HGV A;  3HCY A;  4CQH A;  2VJW A;  2W1T A;  4MCW A;  4MMN A;  1STZ A;  5K5B A;  3IBR A;  4LRY C;  2G7U A;  3R4K A;  4YNR A;  4Z1W A;  4G3V A;  3NOP C;  4RQ9 A;  4R70 A;  4IJG A;  4DMZ A;  2W3F A;  2W3E A;  2QYB A;  4ETX A;  4E04 A;  2XRN A;  2O99 A;  4EU0 A;  3OBF A;  3IBJ A;  4Y3I A;  3VV4 A;  3RFB A;  2O9A A;  2LB5 A;  3G6O A;  4ETZ A;  4QPR A;  1VHM A;  2XRO A;  3KSI A;  3NHQ A;  3S7P A; 
#chains in the Genus database with same CATH topology
 1A0K A;  2JKT I;  3N8R A;  3NDG A;  4I3I A;  2HJE A;  5CX7 A;  1QME A;  5HFO A;  3GRJ A;  2PT7 A;  3S22 A;  5F83 A;  2P9V B;  2J3T C;  5CRF A;  2ZMA A;  3A3I A;  5HWW A;  3HRE A;  3LR5 A;  2HP6 A;  3HLE A;  2Y79 A;  4CPK A;  3T4Q A;  2INW A;  1PZP A;  4GDB A;  1XP4 A;  4XT2 A;  4Q0H A;  5D3O A;  1TD5 A;  1P9R A;  5TBM A;  3P7N A;  4EBP A;  2WKR A;  4PAU A;  3H82 B;  2WUQ A;  2LB9 A;  4YOF A;  2DNS A;  2PD7 A;  1JTD A;  3PYP A;  2EA9 A;  3UDF A;  3ZHH A;  1DJC A;  4I3A A;  3Q1F A;  1K6R A;  3T4K A;  3S4X A;  4GJ4 A;  4R3B A;  3CUE A;  4KZ6 A;  3HBR A;  2J3W A;  1VEU A;  3G2Y A;  2XFT A;  1FQG A;  4K0X A;  4R4S A;  5A90 A;  1I2S A;  1IKG A;  5KMW A;  1MWR A;  3HJK A;  1OME A;  1TVF A;  2PD8 A;  2WYX A;  4NG2 A;  3NY4 A;  3UE0 A;  4JBF A;  3R4K A;  4OOL A;  3OLO A;  3LO7 A;  4E04 A;  1HTZ A;  4PKY G;  5FI6 A;  1K55 A;  2JN7 A;  3ISG A;  5AVE A;  4HP9 A;  5J8X A;  1H0M A;  3I7J A;  1L0F A;  4GD6 A;  3FKV A;  3W4Q A;  3SS5 A;  4OPR A;  3AGF A;  2B5R A;  3FPV A;  1OTA A;  4L9E A;  4CLC D;  5HL6 A;  1XJ2 A;  4BMW A;  3KSG A;  3N6I A;  2V0W A;  4OLD A;  4YWZ A;  5HX9 A;  5LBR A;  3UB9 A;  5DKK A;  3K2N A;  1X0O A;  2CC1 A;  1YMX A;  2EFX A;  2JHE A;  3FG8 A;  3UN7 A;  1TF1 A;  4QU3 A;  3PTE A;  1ESU A;  2XA7 M;  4HH2 A;  3TW8 A;  2Y55 A;  2XFS A;  1NYY A;  2EX8 A;  2ZQC A;  4U3T A;  1NY0 A;  2W1R A;  3K3C A;  4FUW A;  3RTY A;  4O0P A;  1PIO A;  3PBT A;  3ZG5 A;  1NJ4 A;  3P09 A;  1SKO B;  1ZKJ A;  3HLW A;  3BEB A;  1OJ5 A;  1W7F A;  3E4P A;  1DY6 A;  3Q7V B;  2OWJ A;  1OJG A;  3NC8 A;  1LI0 A;  5DVA A;  4NK3 A;  2V2F F;  4Q0I A;  3SOI A;  4BD0 A;  4R0Q A;  5GL9 A;  5FA7 A;  1IFQ A;  1SDE A;  5HW3 A;  1NRF A;  3ZG9 B;  3HCY A;  4H8R A;  1ERM A;  4MCW A;  4KUK A;  1VM1 A;  5CHU A;  3AGE A;  2VA0 A;  4KQR A;  2M1C A;  3MXS A;  5HD3 A;  5HDC A;  4YNR A;  1KVM A;  4WMC D;  4NEE D;  1V9Z A;  3LYX A;  1SKF A;  1K25 A;  3E4O A;  2D01 A;  4N9K A;  3EOI A;  1EI5 A;  3G6O A;  2LB5 A;  3BLM A;  3ZG8 B;  3QP2 A;  1JVJ A;  1N9O A;  1P0Z A;  1LL5 A;  5FL3 A;  4E3I A;  5FAP A;  3OC2 A;  2ZQ9 A;  2Y2H A;  3C8C A;  1Z09 A;  1W63 Q;  5E2H A;  1F2K A;  4S2N A;  3MQ0 A;  5F5Y A;  1MKM A;  5G4Y A;  3E98 A;  3PBS A;  1PW8 A;  4HP4 A;  1YLZ A;  3T1R A;  3LIA A;  5FDS A;  1G6O A;  2FFY A;  4OP5 A;  5DTS A;  4DXB A;  3FWL A;  5HPI A;  3WRZ A;  5M19 A;  3ZVW A;  1K4F A;  4O01 A;  4ZJ2 A;  3HLB A;  2ZLY A;  1W8Q A;  4UA7 A;  1YM1 A;  2J3T D;  2WKH A;  3O88 A;  1MC0 A;  3ULF A;  4ARZ A;  1L3L A;  5HAP A;  2VV7 A;  4OQ0 A;  3E2K A;  1ES5 A;  3KYE A;  3BY9 A;  1XXM A;  2ZMV A;  3WS5 A;  4OKP A;  3BWL A;  3L9K A;  4IBX A;  2GX5 A;  3SS3 A;  1ES4 A;  4LEN A;  4XUX A;  2H10 A;  4X55 A;  3UB6 A;  1CI9 A;  4HNB A;  4ZAM A;  2WAE A;  1PWD A;  4PM9 A;  4CQH A;  4BBT A;  2Y2P A;  3MFD A;  2H5S A;  3IBR A;  1LL9 A;  3IF5 A;  4LRY C;  4L9F A;  3FPW A;  2WGW B;  4R70 A;  2C5W B;  3F1O B;  5A92 A;  3R7W A;  5HZH A;  2WK0 A;  3MZE A;  4UA6 A;  2R78 A;  2BG1 A;  2KDK A;  3A3J A;  3E4Q A;  3O5Y A;  1ACF A;  4EUV A;  4EQ1 A;  4EBL A;  3EWK A;  3T4T A;  1LHY A;  3MS6 A;  4JXW A;  4S2O A;  3HUO A;  4OPY A;  4GHI B;  4JGP A;  3A0S A;  4LV2 A;  5CEC A;  1Y54 A;  2EFU A;  3SZT A;  1LSV A;  2PR5 A;  4NXB A;  1S66 L;  4O8G A;  1KDS A;  5FQI A;  1E3U A;  3PR6 A;  3IF6 A;  2OLV A;  3ZCZ A;  3T12 B;  4NXF A;  3SS4 A;  1D7E A;  3UY6 A;  1YLW A;  3D9Y A;  1K55 C;  2J8Y A;  4S2L A;  4X6T A;  5FSR A;  4DF6 A;  3SH7 A;  1S4S A;  5E43 A;  3A3F A;  1GSV A;  3DTM A;  3VSK A;  3A3D A;  1VB6 A;  5J4E A;  3GQZ A;  3QNC A;  1Q2Q A;  4E6X A;  1CK3 A;  5HAR A;  1TEM A;  2XDM A;  2XQZ A;  4IUH A;  1YSQ A;  3ICY A;  1RCJ A;  5CGS A;  3B33 A;  3DTK A;  3IHB A;  5TR7 A;  1ONH A;  4MMN A;  5CTM A;  3ZGA B;  1ALQ A;  5EVL A;  3WS4 A;  1H8M A;  4BBV A;  1NWZ A;  3C4O A;  4CJN A;  2QYB A;  1BLP A;  4ETX A;  2O99 A;  1F98 A;  4GB7 A;  3UNW A;  3BLS A;  4QPR A;  1SCW A;  5CER A;  4JLF A;  5DFX A;  4ZDX A;  1ERQ A;  4EER A;  3KYQ A;  1PZO A;  2L0W A;  3NOT C;  4FCF A;  1JTG A;  3U4L P;  1O07 A;  1Y4O A;  1YPR A;  2ZD8 A;  4L0L A;  5L10 A;  3S7Q A;  3LI8 A;  3MFX A;  2OAQ 1;  2EX2 A;  2PHY A;  4JF4 A;  5EE8 A;  4BWI A;  3OPL A;  5IT5 A;  2K2N A;  2GJ3 A;  2Y2N A;  4S2M A;  2D02 A;  1G28 A;  4NXG A;  4BD1 A;  3IXB A;  4RVA A;  3GSG A;  1XFN A;  5HDD A;  2JKG A;  1I5Q A;  3EEH A;  4R6L A;  4N92 A;  3G30 A;  2PRF A;  1YT4 A;  3T4O A;  5FI2 A;  2QHK A;  2KOI A;  3Q81 A;  3CG5 A;  4OH0 A;  2P9V A;  5TGF A;  4ME4 A;  1FSY A;  3Q82 A;  2XK1 A;  2R9X A;  1CI8 A;  1HD8 A;  2VJW A;  3M6B A;  1CJF A;  4LCM A;  2XD1 A;  2G7U A;  4DDS A;  4QJG A;  1BUL A;  4H6J B;  4G3V A;  3F1N A;  4OQG A;  2W3F A;  1FIL A;  2X71 A;  3LY3 A;  4C6Y A;  5JYP A;  4FH4 A;  3LID A;  4EUZ A;  2V8F A;  5DF7 A;  4MBF A;  3VOL A;  3IS2 B;  1S1Z A;  2Z6D A;  3AGD A;  2J9O A;  1NYM A;  2IWB A;  1XJ3 A;  4HES A;  5EOE A;  4WZ4 A;  3IX4 A;  1TS6 A;  4M4X A;  2QKP A;  2WKP A;  5DFY A;  1CEG A;  4X53 A;  1K54 C;  1KGE A;  4R23 A;  3RXW A;  5IS1 A;  1KE0 A;  5FAT A;  3FZC A;  1CQA A;  4OOM A;  3GEC A;  3LFV A;  3CHW P;  4EEP A;  5HWV A;  2RL3 A;  4KQD A;  3N8L A;  3NOU C;  2QPN A;  3BM6 A;  1PRQ A;  1YMS A;  5EOO A;  1MKI A;  3MQQ A;  2V9A A;  5M18 A;  4UQI S;  1J9M A;  3JPU A;  3UME A;  2Q9M A;  2VGJ A;  1KVL A;  1BLS A;  4YFM A;  2PYP A;  4O7D A;  4DDY A;  3MF0 A;  3C2W A;  3DTI A;  4GW9 A;  5AQB A;  4WEK A;  4F94 A;  5FI7 A;  3VP1 A;  5F1G A;  4R4R A;  1DJA A;  3CZD A;  2J80 A;  2W27 A;  3P01 A;  2QWS A;  4XUZ A;  4EES A;  4ID4 A;  2VGK A;  3DAV A;  2WZZ A;  3EQV A;  5DF8 A;  3HJI A;  3NOP C;  3IF6 C;  3IXG A;  1OTB A;  4Y0T A;  2XRN A;  4ZTK A;  1T18 A;  3ITA A;  3V3R A;  5CHJ A;  1Q2P A;  3KSI A;  2P74 A;  2FZ0 A;  4DE2 A;  1UWP X;  4RX2 A;  3KSF A;  1SKO A;  5EVI B;  1ES2 A;  4PHT A;  5EM0 A;  5HAI A;  3Q7V A;  2A3U A;  2B02 A;  1L0E A;  2OOL A;  3G31 A;  2XF3 A;  4JXS A;  1XA7 A;  4UAA A;  2HF6 A;  1K38 A;  4IHQ A;  1MY8 A;  2O0Y A;  2PU2 A;  3MXQ A;  2OAP 1;  5CED A;  1WE4 A;  3OZH A;  2ZBB A;  2BAS A;  2Y2G A;  3L7H A;  4GN2 A;  3M2K A;  1E4D A;  1F5M A;  4KZ5 A;  1HZO A;  5L07 A;  1ZG6 A;  3V67 A;  2M7V A;  4BJP A;  3JVU A;  4XT2 B;  2BTF P;  2HDR A;  4MN7 A;  1P97 A;  3S7O A;  4GCZ A;  4HBT A;  2NUT C;  4QHC A;  3MJQ A;  1YQS A;  3HUN A;  4KG2 A;  4II7 A;  3PBQ A;  4G3W A;  4WF0 A;  3UPO A;  4X68 A;  3UB5 P;  5CHM A;  2XA7 S;  2HJ9 C;  1JWZ A;  4MLL A;  2PU4 A;  2A24 A;  1FCO A;  4C3Q A;  3MR0 A;  1P9W A;  3BYD A;  2XH9 A;  4E6W A;  5EV0 A;  4WN5 A;  4P85 A;  4Y13 A;  4DRT A;  3H7W B;  1GHI A;  5GHY A;  1W5D A;  4WUJ A;  4L9G A;  3G2Z A;  3QP4 A;  2XEP A;  3OPR A;  2VV8 A;  3JYI A;  4LRZ E;  4FD8 A;  1WA9 A;  1XFQ A;  4P6Z S;  4UA9 A;  1MWS A;  2Z2M B;  3OCN A;  4N1X A;  2W0N A;  2I9V A;  4MNR A;  1NZO A;  3IWO A;  2PYR A;  4RA7 A;  3OOV A;  3S7N A;  4LCL A;  5FDH A;  3LR4 A;  4FOF A;  4B93 A;  2YKH A;  3E2L A;  4OQI A;  3CLO A;  5EEC A;  1GSW A;  1G5U A;  4I39 A;  1MBL A;  3NUL A;  1K6S A;  2WGW A;  3QP6 A;  3F1O A;  1SDN A;  5F6A A;  5HPF A;  4X56 A;  1CEF A;  2EXB A;  4KZA A;  3M2J A;  4N9L A;  4K0W A;  2PBD P;  2K31 A;  2E8J A;  4Y5F A;  5F82 A;  5E2F A;  3T1Q B;  3TG9 A;  1HLU P;  2Z6C A;  4NKP A;  4KQO A;  1MPL A;  2ZMF A;  3CJM A;  5G4Z A;  5FEG A;  4P87 A;  1H8Z A;  4GHI A;  1ONG A;  4HQA A;  2X02 A;  1BT5 A;  3MBZ A;  1NRJ A;  5K5B A;  3T4S A;  2CMN A;  3SW1 A;  4CLC B;  2UV0 E;  3MZF A;  3CMZ A;  1AWI A;  4DMZ A;  1K54 A;  1OT9 A;  1VQQ A;  3LR3 A;  1Y28 A;  4R38 A;  3Q7Z A;  1IEL A;  5CGW A;  2XRO A;  4B9O A;  2A49 A;  1TDL A;  3F1P B;  4OLG A;  4D60 A;  4KZ7 A;  3BFG A;  1FR1 A;  4IED A;  1YKD A;  1S0W A;  2WZX A;  2HP9 A;  1EWZ A;  4C75 A;  5TJJ A;  1E3U D;  4CLC E;  4GS9 A;  4QWO A;  4S2P A;  3MQO A;  4X1M A;  1PW1 A;  1DP9 A;  5JYO A;  4BL3 A;  1VET B;  2W1T B;  3O3V A;  3VMA A;  4F3L B;  2ZQ8 A;  3QP5 A;  1PWC A;  5F68 A;  4E3L A;  2VEA A;  1GCE A;  4HH3 A;  4Y0U A;  3D72 A;  4Y15 A;  5DJU A;  2EX9 A;  1AXB A;  4PKY A;  4JXG A;  1IYP A;  2IWC A;  2M7U A;  3G35 A;  1KDW A;  2BLS A;  3SH8 A;  3GVB A;  1RP5 A;  1ODV A;  2HP5 A;  4I3J A;  2PAV P;  3IH8 A;  3PAE A;  4B4Z A;  1GHP A;  3A0R A;  1K56 A;  1DP6 A;  1RGY A;  4QY5 A;  1N4O A;  2J9P A;  3W4O A;  2YKF A;  3T4J A;  1T1C A;  3T50 A;  3N4I A;  1BUE A;  4JKT A;  1ZG4 A;  4RQ9 A;  2PR6 A;  1MXO A;  1HVB A;  2R9W A;  4K08 A;  2Z2L B;  4DE0 A;  2H0T A;  1EW0 A;  1WYC A;  1UWN X;  3OBF A;  1BLH A;  3H9W A;  2H0Y A;  4K91 A;  2ZC3 B;  3LR0 A;  3G34 A;  3BQ8 A;  1W63 M;  4AFI A;  4R3J A;  3R7W B;  3IXD A;  1OTD A;  4X69 A;  1E25 A;  4IUK A;  5CTN A;  3IXH A;  1ERO A;  4WL9 A;  1PI5 A;  4B4X A;  1I2W A;  3FKW A;  3UB7 A;  3UO9 A;  3CIT A;  3WWX A;  3PHY A;  5GLD A;  4G3K A;  1NLZ A;  3WS0 A;  2Y59 A;  5E2G A;  2WGV A;  2ZJ9 A;  1M40 A;  3EGD C;  3BFD A;  3LCE A;  1PYY A;  2WAD A;  4Q8I A;  1S1Y A;  2L1M A;  5GLB A;  1KGG A;  3D4F A;  3W2Z A;  4OPQ A;  1XJ6 A;  1IEM A;  1XX2 A;  1KE3 A;  4HI4 A;  3BY8 A;  1NLY A;  2C6W B;  4KUO A;  3TE8 A;  1T19 A;  2HDS A;  1W8Y A;  2L4R A;  5HAQ A;  4JGO A;  3K3D A;  1D06 A;  4EV4 A;  3CAX A;  3HLC A;  1XGI A;  4Y7P A;  3RJU A;  5GHZ A;  1PFL A;  4HEF A;  1JWV A;  3BQA A;  1V9Y A;  3PBN A;  1ZHH B;  1YLJ A;  4LV3 A;  4HHD A;  4EBN A;  4JXV A;  3NJA A;  3IBJ A;  3RFB A;  1VHM A;  4KQQ A;  5A8B A;  3C5A A;  4M3K A;  1GA0 A;  2FFF B;  4DE1 A;  2G2U A;  1K57 A;  4WZ5 A;  3TJZ C;  5FEF A;  5L09 A;  4IVK A;  2ZC4 B;  1MWT A;  1RGZ A;  1W79 A;  3FYZ A;  3BFE A;  4Y2F A;  1O7E A;  4KG5 A;  4Y0O A;  4HY8 A;  5HWT A;  3O87 A;  3H82 A;  2ZL1 B;  3UDX A;  4X25 A;  2FH5 A;  4A5R A;  1OTE A;  4QD4 A;  4U0X A;  2Y91 A;  5FAQ A;  4LPZ A;  4LLO B;  3IWI A;  2J7V A;  1GA9 A;  2AVX A;  5E2E A;  2ZC5 B;  4MEZ A;  5DF9 A;  3ZQ5 A;  4MDZ A;  2V8C A;  1MWU A;  2IWD A;  3G4P A;  4UHU A;  4LRX C;  2ACG A;  2B18 A;  3IT9 A;  4OOY A;  4ESP A;  3OCL A;  1OPX A;  2I72 A;  3UB8 A;  5IU1 A;  4NET A;  2KLI A;  5EVI A;  2X01 A;  2VGL S;  2GNX A;  3VP2 A;  1IYQ A;  3DBA A;  2Q9N A;  3PAG A;  4ZRR A;  4BLM A;  3CPT B;  4S2I A;  4JGR A;  4MBK A;  5U47 A;  1STZ A;  2WGI A;  4GDN A;  1KE4 A;  3RH8 B;  4PPR A;  4Z1W A;  5M1A A;  2RCX A;  4OPZ A;  1PI4 A;  4HIA A;  1BZA A;  2PDR A;  1PWG A;  4IBR A;  1DJB A;  4KZ4 A;  2HV1 A;  4GZB A;  3FC7 A;  5FAO A;  4I5S A;  4D2O A;  1XGJ A;  3QNB A;  4KG6 A;  2OSU A;  3F1N B;  3GMW A;  3ZFZ A;  5GHX A;  2ZQ7 A;  5IHV A;  4FH2 A;  5MC7 A;  5GLC A;  3QP8 A;  5FQM A;  4EXO A;  4QY6 A;  2Y4A A;  3BJN A;  3MKF A;  5G18 A;  2OV5 A;  3WRT A;  2MJ6 A;  4DN0 A;  1FSW A;  2VZW A;  3BRM A;  3OPH A;  3V50 A;  2OLU A;  1G6A A;  3EEA A;  4U0T A;  2VK3 A;  3H7W A;  5FQK A;  3LUQ A;  4S2K A;  2ZC6 B;  4JF5 A;  2WAF A;  3B47 A;  3UPN A;  3W8K A;  5KZH A;  1LT0 A;  3IQA A;  4N1H A;  3OPP A;  2P04 A;  2Y8H A;  4GD8 A;  3P98 A;  2ZQA A;  4IVI A;  1S67 L;  1BLC A;  4HJ3 A;  3EQU A;  4RX3 A;  1YAX A;  5DKL A;  3BFF A;  5L2F A;  4OQH A;  1L2S A;  5TBM B;  2ZM0 A;  2XLN A;  4I38 A;  4EWF A;  3UE1 A;  3B42 A;  3V3S A;  3NBL A;  3IH9 A;  3NCK A;  5EFW A;  3GV9 A;  2VX8 A;  3BW6 A;  5AQ7 A;  2A2L A;  3S7P A;  2O9C A;  4MN5 A;  2VLG A;  4ZJ1 A;  3JVV A;  1BYW A;  5EUA A;  5J3W A;  4NXE A;  4E3M A;  4JF6 A;  3ITB A;  1VEU B;  1SHV A;  3KO6 A;  1NZU A;  4UEY A;  2Y2O A;  3SH9 A;  4OON A;  4KZ9 A;  1K0K A;  1CF0 A;  2ZOH A;  2W3D A;  3T4L A;  3NI9 A;  3DWK A;  4ZJ3 A;  2WKQ A;  2XGN A;  2WKI A;  3UMD A;  2JCH A;  4CLC A;  5A91 A;  4P6Z M;  4DJ2 A;  3U2A A;  1H3Q A;  4DJ3 A;  1D1J A;  1JWP A;  5L8M A;  4RYE A;  4R1G A;  5HD5 A;  1FCN A;  1LL8 A;  4GLQ A;  1IKI A;  2Q0O A;  3QHY A;  1T1B A;  4GNU A;  4WLA A;  3F1P A;  3VFF A;  1T1A A;  1K57 C;  2ZQD A;  2QJ5 A;  4WZ5 C;  4Z9Q A;  2H28 A;  3GR2 A;  3HL9 A;  5F69 A;  3T1X A;  4Y17 A;  1XPB A;  4DE3 A;  4KZB A;  1XA1 A;  3VP4 A;  5AQ9 A;  3KSH A;  2VV6 A;  5AQA A;  1VET A;  3HLF A;  2W3H A;  2EWV A;  2V1Z A;  3M6H A;  4HOI A;  2W1T A;  3LIC A;  1LSW A;  4P6B A;  4PM6 A;  1M6K A;  4F3L A;  1KGF A;  2KX6 A;  1DP8 A;  3TSG A;  3A0V A;  1LLB A;  3TOI A;  3LI9 A;  3VE4 A;  5EPH A;  4EU0 A;  2DRW A;  4PM7 A;  4HJ6 A;  2A24 B;  4Y3I A;  1U60 A;  1YLP A;  2Y2Q A;  3NHQ A;  1LSX A;  2V20 A;  3S1Y A;  5KIZ A;  3LIE A;  3PXP A;  4WMC A;  3ZYT A;  2WKE A;  2EWW A;  1JNU A;  2HDU A;  5EVI C;  3MMH A;  3C30 A;  1YSP A;  3MZD A;  5J7E A;  2K7S A;  1XKZ A;  2OWH A;  3PBR A;  3MSH A;  3WS2 A;  2Y2M A;  3BFC A;  3W4P A;  3MXR A;  4FTX A;  1L0G A;  3VE3 A;  5AJG A;  4GOG A;  3CWF A;  3NIA A;  4B88 A;  3LEQ A;  3HLD A;  1PNE A;  1F9I A;  2EX6 A;  3LEZ A;  1ZC2 A;  1K56 D;  1J3W A;  3UDI A;  5KSH A;  5CEB A;  2DCF A;  3D3O A;  3KX0 X;  1MZU A;  3UE3 A;  3DW0 A;  2QJ7 A;  2O9B A;  4E3J A;  4HJ4 A;  3VP0 A;  5KSC A;  3GTC A;  1IYO A;  3IX3 A;  4PM5 A;  2JBF A;  1H5X A;  5GLA A;  1DRM A;  4E3N A;  3IX8 A;  4PMA A;  2DMW A;  1TDG A;  1GHM A;  3FV7 A;  4JGQ A;  3CUE C;  3GDI A;  4WEJ A;  1FOF A;  4BEN A;  4WBG A;  5EM1 A;  1TS0 A;  4WYY A;  5EVE A;  4ARZ B;  2O9A A;  3C7V A;  2XR0 A;  3B3X A;  4R3A A;  3LGO A;  3V5M A;  4MN6 A;  4KZ8 A;  2ZC7 A;  2JKR M;  2V1A A;  3TRC A;  5FQQ A;  2Y2I A;  2V0U A;  1C3B A;  5FQJ A;  1N9L A;  1XJ4 A;  3ZNT A;  3N8S A;  2UWX A;  5DTT A;  2PBY A;  5AVF A;  1TS8 A;  4MBH A;  4OP8 A;  4X1L A;  1H8Y A;  4LFU A;  3V39 A;  5BOH A;  2GZA A;  3HUM A;  3C4P A;  4GS9 B;  2ZM2 A;  3C38 A;  1ES3 A;  4XXR A;  5F1F A;  5HDS A;  2GDN A;  5HL1 A;  3NEC A;  5I5L A;  2QMI A;  4DKI A;  1KOU A;  3E0Y A;  1N9N A;  4KEN B;  5I94 A;  1FCM A;  3QP1 A;  3ZNY A;  5DTK A;  4BBU A;  3WS1 A;  5C5K A;  1ESI A;  5HSQ A;  4P0M A;  2Y2J A;  4Q0J A;  5TFQ A;  4H6J A;  3RXX A;  4WEL A;  1LI9 A;  1IOU A;  3KYZ A;  2HGV A;  2NUP C;  5FAS A;  1NXY A;  3UPP A;  4LGW A;  3LY4 A;  3Q07 A;  1WYB A;  3IS2 A;  2ZL1 A;  1N9B A;  3IF6 B;  4OVD A;  4EEU A;  1BSG A;  1L0D A;  3IHA A;  4CLC C;  1S6R A;  3UE6 A;  3IWQ A;  4QB8 A;  1S4R A;  4EW7 A;  1OTI A;  2JKT M;  1YLT A;  3NDE A;  2Y2K A;  4YIN A;  2JKR I;  2ZM8 A;  4PM8 A;  5FQ9 A;  2G2W A;  3A3E A;  2JE5 A;  2VKS A;  4WM9 A;  3ZG0 A;  3VSL A;  2E8I A;  4KZ3 A;  1ZTU A;  4E3O A;  2HDQ A;  2QZ6 A;  2IA2 A;  3EGX C;  4ZBE A;  3VOY A;  3G32 A;  2ZOI A;  2HPB A;  3O86 A;  1FR6 A;  1G68 A;  3BEC A;  3CPT A;  3HVF A;  4LV1 A;  3VFH A;  3DTE A;  2JKF A;  1TS7 A;  5EVI D;  4FSF A;  4EQI A;  4HBU A;  2V1B A;  2P7J A;  4S2N C;  4GKU A;  1YLY A;  1SZV A;  3ZG7 B;  3T1S A;  2EXA A;  3HLG A;  4S2J A;  1BTL A;  2XD5 A;  3ZDJ A;  1Z6F A;  2W3G A;  1GSX A;  1FIK A;  2XSS A;  2P08 A;  4JPM A;  3CI6 A;  5DJT A;  5A93 A;  3PBO A;  1QMF A;  5CGX A;  5CXW A;  4EET B;  3DWZ A;  2B95 A;  3VOZ A;  4BL2 A;  4DXC A;  1IYS A;  4LV0 A;  3N7W A;  3ZVT A;  2HZ5 A;  3LIB A;  3MKE A;  1K4E A;  4E3K A;  3LIF A;  2Y2L A;  4BQM A;  3VP3 A;  4IJG A;  2W3E A;  2JC7 A;  1OT6 A;  3VV4 A;  4ETZ A;  2VGL M;  4UQI M;  3C7U A;  1UGU A; 
#chains in the Genus database with same CATH homology
 2O9C A;  3F1P B;  4MN5 A;  5DFX A;  2JKT I;  2VLG A;  3JVV A;  1BYW A;  4I3I A;  2HJE A;  1YKD A;  5CX7 A;  5J3W A;  4NXE A;  4EER A;  5TJJ A;  3KYQ A;  2PT7 A;  2L0W A;  3NOT C;  4CLC E;  4GS9 A;  3KO6 A;  3MQO A;  2J3T C;  1DP9 A;  5HWW A;  4L0L A;  4UEY A;  2W1T B;  3LR5 A;  3S7Q A;  2Y79 A;  3T4Q A;  3LI8 A;  3MFX A;  4F3L B;  2INW A;  2OAQ 1;  2ZOH A;  2PHY A;  2W3D A;  3T4L A;  4XT2 A;  4Q0H A;  5F68 A;  4BWI A;  5IT5 A;  2K2N A;  2VEA A;  2GJ3 A;  2WKQ A;  4HH3 A;  1TD5 A;  1P9R A;  3UMD A;  5TBM A;  2D02 A;  3D72 A;  4CLC A;  3P7N A;  5DJU A;  2WKR A;  4PAU A;  4DJ2 A;  4P6Z M;  1G28 A;  4NXG A;  3U2A A;  1H3Q A;  4PKY A;  3H82 B;  4DJ3 A;  2LB9 A;  4YOF A;  5L8M A;  1XFN A;  2PD7 A;  5HDD A;  5HD5 A;  2M7U A;  1LL8 A;  3PYP A;  2EA9 A;  3EEH A;  4GLQ A;  4R6L A;  1T1B A;  4I3A A;  4WLA A;  3F1P A;  1T1A A;  3T4K A;  4GJ4 A;  1ODV A;  4I3J A;  3T4O A;  2QHK A;  2QJ5 A;  2H28 A;  3CUE A;  2KOI A;  5F69 A;  3A0R A;  2J3W A;  1DP6 A;  3KSH A;  2VV6 A;  4ME4 A;  2W3H A;  2EWV A;  3HJK A;  4HOI A;  2VJW A;  2W1T A;  3LIC A;  1LSW A;  2PD8 A;  2YKF A;  3T4J A;  1T1C A;  3T50 A;  4F3L A;  2KX6 A;  1DP8 A;  2G7U A;  3R4K A;  4OOL A;  4H6J B;  4G3V A;  3A0V A;  2PR6 A;  3F1N A;  4RQ9 A;  2W3F A;  4K08 A;  3OLO A;  4E04 A;  3VE4 A;  3LI9 A;  3LID A;  4PKY G;  1EW0 A;  4EU0 A;  1UWN X;  3OBF A;  4HJ6 A;  2A24 B;  4Y3I A;  2JN7 A;  3H9W A;  5AVE A;  3VOL A;  3IS2 B;  3NHQ A;  1S1Z A;  4HP9 A;  2Z6D A;  1LSX A;  3LR0 A;  5KIZ A;  3LIE A;  3PXP A;  1XJ3 A;  3BQ8 A;  3ZYT A;  1W63 M;  4AFI A;  3R7W B;  1TS6 A;  3FPV A;  2EWW A;  2QKP A;  2WKP A;  4M4X A;  1OTA A;  1JNU A;  5DFY A;  3MMH A;  1OTD A;  5IS1 A;  3C30 A;  4IUK A;  4L9E A;  4CLC D;  1YSP A;  5J7E A;  4WL9 A;  5HL6 A;  1XJ2 A;  2K7S A;  4OOM A;  3GEC A;  2OWH A;  3LFV A;  3PBR A;  4BMW A;  3KSG A;  4EEP A;  2V0W A;  4YWZ A;  5HWV A;  3UB7 A;  5LBR A;  3UB9 A;  3CIT A;  3K2N A;  5DKK A;  4KQD A;  1X0O A;  3PHY A;  4G3K A;  3NOU C;  1NLZ A;  3FG8 A;  2JHE A;  3VE3 A;  5AJG A;  1TF1 A;  3CWF A;  2XA7 M;  4HH2 A;  3TW8 A;  3MQQ A;  2V9A A;  3EGD C;  4UQI S;  1F9I A;  1S1Y A;  2L1M A;  2W1R A;  3UME A;  3K3C A;  5KSH A;  3RTY A;  4O0P A;  3D3O A;  3W2Z A;  3KX0 X;  3PBT A;  1XJ6 A;  2PYP A;  4HI4 A;  3MF0 A;  1MZU A;  1OJ5 A;  3BY8 A;  3UE3 A;  3C2W A;  3E4P A;  1NLY A;  2QJ7 A;  4KUO A;  4GW9 A;  2OWJ A;  1OJG A;  2O9B A;  3TE8 A;  4HJ4 A;  4WEK A;  1T19 A;  2L4R A;  4JGO A;  3K3D A;  1D06 A;  4Q0I A;  3CAX A;  1IFQ A;  2J80 A;  2W27 A;  1DRM A;  3P01 A;  3HCY A;  4MCW A;  2QWS A;  3BQA A;  4KUK A;  1V9Y A;  2DMW A;  4EES A;  3PBN A;  2VA0 A;  2M1C A;  5HD3 A;  5HDC A;  4YNR A;  3EQV A;  3HJI A;  4JGQ A;  4NEE D;  1V9Z A;  1ZHH B;  3NOP C;  3CUE C;  3LYX A;  1OTB A;  3GDI A;  4WEJ A;  4HHD A;  2XRN A;  3E4O A;  4UQI M;  2D01 A;  3EOI A;  3NJA A;  3IBJ A;  1TS0 A;  1T18 A;  4ARZ B;  3RFB A;  2O9A A;  2LB5 A;  3G6O A;  4R3A A;  1VHM A;  5A8B A;  3KSI A;  2FZ0 A;  4MN6 A;  1UWP X;  2JKR M;  3KSF A;  2V1A A;  3TRC A;  1N9O A;  1P0Z A;  2V0U A;  5FL3 A;  1N9L A;  1XJ4 A;  4PHT A;  3TJZ C;  3OC2 A;  3C8C A;  5AVF A;  2B02 A;  1W63 Q;  4Y2F A;  1TS8 A;  5F5Y A;  3MQ0 A;  2OOL A;  1MKM A;  5G4Y A;  3E98 A;  3PBS A;  4HY8 A;  5HWT A;  4HP4 A;  2GZA A;  2HF6 A;  3H82 A;  4IHQ A;  2O0Y A;  3LIA A;  1G6O A;  2FH5 A;  1OTE A;  3MXQ A;  2OAP 1;  4GS9 B;  5HPI A;  2ZBB A;  4LPZ A;  4LLO B;  3C38 A;  2BAS A;  5HDS A;  1F5M A;  4O01 A;  5I5L A;  5DF9 A;  2J3T D;  3ZQ5 A;  4MDZ A;  3V67 A;  1KOU A;  2M7V A;  4BJP A;  3E0Y A;  3JVU A;  1MC0 A;  4XT2 B;  1N9N A;  3ULF A;  4ARZ A;  4LRX C;  2B18 A;  4MN7 A;  2VV7 A;  3OCL A;  1P97 A;  1OPX A;  3S7O A;  4BBU A;  3BY9 A;  4GCZ A;  2ZMV A;  3UB8 A;  2NUT C;  5IU1 A;  5C5K A;  3MJQ A;  4II7 A;  5HSQ A;  2KLI A;  3BWL A;  4Q0J A;  2VGL S;  2GNX A;  2GX5 A;  4H6J A;  3DBA A;  3PBQ A;  2XRO A;  4G3W A;  4WF0 A;  4WEL A;  3UB6 A;  4ZRR A;  4HNB A;  1IOU A;  3KYZ A;  2XA7 S;  2HJ9 C;  2HGV A;  2NUP C;  2A24 A;  4CQH A;  4JGR A;  3MR0 A;  4BBT A;  1P9W A;  1STZ A;  3IBR A;  3IS2 A;  4LRY C;  4L9F A;  3FPW A;  4EEU A;  3RH8 B;  4WN5 A;  4Z1W A;  3S7P A;  4R70 A;  3F1O B;  4CLC C;  3R7W A;  5HZH A;  3H7W B;  4HIA A;  3UE6 A;  2PDR A;  2R78 A;  4WUJ A;  4L9G A;  1S4R A;  4EW7 A;  1OTI A;  2KDK A;  3E4Q A;  2JKT M;  2HV1 A;  2VV8 A;  3FC7 A;  3O5Y A;  4I5S A;  4LRZ E;  2JKR I;  1WA9 A;  3F1N B;  4EUV A;  4EQ1 A;  1XFQ A;  4P6Z S;  3EWK A;  3T4T A;  2VKS A;  3OCN A;  2W0N A;  2I9V A;  1ZTU A;  2IA2 A;  4GHI B;  2PYR A;  3EGX C;  3OOV A;  4JGP A;  3A0S A;  3S7N A;  5MC7 A;  4EXO A;  3LR4 A;  4FOF A;  4B93 A;  1LSV A;  2ZOI A;  3BJN A;  2YKH A;  2PR5 A;  3CLO A;  1GSW A;  4NXB A;  1S66 L;  4I39 A;  4O8G A;  2MJ6 A;  3PR6 A;  4DN0 A;  4NXF A;  2VZW A;  1D7E A;  1TS7 A;  4FSF A;  2V1B A;  3F1O A;  2P7J A;  5F6A A;  5HPF A;  3EEA A;  3H7W A;  3LUQ A;  2K31 A;  3B47 A;  1S4S A;  2W3G A;  1GSX A;  4Y5F A;  1LT0 A;  2XSS A;  2P08 A;  1GSV A;  3CI6 A;  1VB6 A;  2Z6C A;  2P04 A;  4NKP A;  5J4E A;  4KQO A;  2Y8H A;  5DJT A;  3PBO A;  2ZMF A;  5G4Z A;  1S67 L;  4IUH A;  4EET B;  1YSQ A;  3ICY A;  4HJ3 A;  3EQU A;  5DKL A;  1YAX A;  4GHI A;  4HQA A;  3B33 A;  4MMN A;  1NRJ A;  3LIB A;  5K5B A;  3T4S A;  2CMN A;  3LIF A;  5TBM B;  3SW1 A;  4CLC B;  1H8M A;  4BBV A;  4IJG A;  4DMZ A;  1NWZ A;  4I38 A;  2W3E A;  1OT9 A;  2QYB A;  4ETX A;  3B42 A;  3LR3 A;  1OT6 A;  2O99 A;  1Y28 A;  1F98 A;  3VV4 A;  5EFW A;  4R38 A;  4ETZ A;  4QPR A;  2VGL M;  2VX8 A;  3BW6 A;  4B9O A;  2A2L A;  1UGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...