2QYBA

Crystal structure of the gaf domain region of putative membrane protein from geobacter sulfurreducens pca
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
SEIMNRTLDLQIIMDDLLNLLLKEFKLDLAVIRLVDEKGVLRVRSYSGKGIAGIAGKDWEPEIETYIGEAFLSNRLQFVNDTQYMTKPLTRELMQKEGIKSFAHIPISRKGEPPFGILSVFSRTIVGLFNEPFLNLLESLAGQLAQAVKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the GAF domain region of putative membrane protein from Geobacter sulfurreducens PCA.
rcsb
source organism Geobacter sulfurreducens pca
molecule tags Membrane protein
molecule keywords Membrane protein, putative
total genus 42
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qybA00
4E04A 4YNRA 2KLIA 1F5MA 3MQ0A 1YKDA 3IBRA 3HCYA 3VV4A 1YSQA 2O9AA 4RQ9A 2W3DA 2VZWA 3KSHA 1TD5A 3E0YA 3KSIA 3CITA 5I5LA 2B18A 3S7NA 4G3KA 4GLQA 2O9BA 2VEAA 1MC0A 2K31A 4LRZE 2VJWA 4Y2FA 3O5YA 3S7OA 3TRCA 2GX5A 2O99A 5HL6A 3W2ZA 4EU0A 5K5BA 4MN7A 2W1TB 4Q0IA 5HPFA 3KO6A 4EUVA 1ZTUA 4DMZA 3NOPC 1VHMA 3NOTC 2O0YA 1YSPA 2Y8HA 3MMHA 4O0PA 4O01A 5C5KA 4BWIA 2VKSA 4LRYC 4R70A 5HSQA 3EEAA 4ME4A 5AJGA 2W1RA 3C2WA 1TF1A 3BJNA 2O9CA 1MKMA 4ETZA 2W3FA 2QYBA 2KOIA 4ZRRA 3IBJA 3DBAA 4IUKA 4YOFA 3NOUC 5L8MA 3KSFA 2IA2A 3R4KA 3K2NA 5DFXA 4MDZA 4GW9A 2W1TA 2W3EA 3G6OA 3D3OA 1STZA 3KSGA 4Z1WA 3MF0A 5DFYA 3NHQA 3S7QA 4G3VA 4O8GA 4IJGA 2LB5A 4G3WA 2M7VA 2XROA 2LB9A 4LRXC 3CI6A 5LBRA 2XRNA 2HGVA 2ZMFA 5HPIA 4MMNA 4Q0JA 2K2NA 3ZQ5A 4PAUA 4Q0HA 3LFVA 2G7UA 4QPRA 5TJJA 3RFBA 4DN0A 2OOLA 4MCWA 2Y79A 4R6LA 2M7UA 4Y5FA 4Y3IA 4ETXA 4IUHA 3S7PA 2W3HA 3OBFA 4CQHA 4FOFA 3E98A 2W3GA 3OOVA 2XSSA
chains in the Genus database with same CATH superfamily
3OPRA 2BTFP 3QHYA 2H0YA 1N9NA 1HZOA 2C6WB 3G2ZA 3CJMA 3WS1A 1M40A 1MKIA 4ARZB 2Y4AA 5CGSA 3IHAA 4CLCE 2L0WA 3V3RA 5I5LA 3TG9A 4XT2B 3BLMA 5TBMB 3VP3A 2PAVP 3GV9A 1IFQA 4PHTA 3BEBA 2Y91A 3FZCA 2EFXA 2ZC4B 1MPLA 5DKLA 1RGYA 1G28A 3VFFA 1BLCA 1IYSA 4EWFA 4EXOA 1BULA 4ME4A 1GSWA 5FQ9A 4IVKA 3IF6A 2XEPA 3BJNA 4LLOB 1W5DA 4OOMA 4GD6A 3LIBA 4WEKA 3UMEA 3S1YA 1LSVA 2QPNA 3ZGAB 2ZOHA 4NG2A 2W3EA 1TS6A 4OQHA 3IX8A 3CUEC 1KE0A 3I7JA 4GOGA 3KSGA 3OLOA 4BL3A 4KUOA 3NY4A 1OTBA 4WMCD 2QHKA 3B42A 2XROA 4EBLA 4EERA 3GTCA 3QP8A 2PU2A 3ZVWA 4B9OA 3ZG8B 3MKFA 3NBLA 2OOLA 4QWOA 3LR0A 4PM5A 1BYWA 2HDQA 4CQHA 4Y13A 4C3QA 5DTSA 4OPYA 1GHIA 2KLIA 3H82B 4NXBA 1TS8A 4JF6A 3HCYA 4RQ9A 4C6YA 3VP2A 4DJ3A 2Y2LA 3UDIA 4QU3A 3VOYA 4ZDXA 3MXQA 3CITA 1XFQA 2Z6DA 3H7WA 5E2GA 3OZHA 4MN5A 4Y2FA 2Z2LB 2J9OA 2QKPA 1OPXA 4K08A 3E4PA 1PWGA 1JTGA 4MN7A 3IHBA 2V8CA 4CLCC 1YMXA 2UWXA 2ZQAA 5EUAA 3M6HA 1K56D 2XA7M 4YFMA 4DKIA 1KDWA 1MWSA 4HH3A 2RL3A 2WGWB 5FSRA 4ZJ3A 2XF3A 4K91A 3HL9A 3IX4A 1XPBA 2VLGA 4LFUA 4IUKA 3W4OA 3A3DA 4JXSA 1KGGA 1L3LA 3PBQA 1ERQA 2L4RA 3EQVA 3S7QA 2HZ5A 4O8GA 1T1AA 4GS9A 5G4YA 2EX8A 2P04A 3QNBA 1DP9A 4KUKA 4ZJ2A 2ZQ7A 4Q0JA 2V0WA 1NRJA 2WKRA 1YMSA 3U2AA 2G7UA 4X56A 4GDNA 5AQ7A 2KDKA 3PBTA 1ESUA 3UB7A 2WKHA 4RX3A 2DNSA 2QJ5A 2V20A 3K3CA 2VGLS 1JWPA 4BBUA 1VQQA 3HBRA 2GNXA 1K57C 5FEFA 1DJAA 2IWDA 4P6ZM 3C30A 3EGDC 3FC7A 4NEED 3WS2A 3HLFA 1K55C 4GLQA 4QY6A 4S2JA 5EVLA 3W2ZA 4EU0A 1PRQA 2HPBA 5HDDA 5IU1A 4MLLA 5HZHA 3TOIA 4DDSA 4LRYC 4U0TA 4KZ3A 4FD8A 3OPHA 3TJZC 4ZAMA 1LI0A 3MQOA 3IXBA 4DE0A 2W3FA 5F68A 4YOFA 5F83A 3BFFA 3IH9A 1A0KA 4QD4A 1XJ2A 1VB6A 3UB9A 1T1BA 1BTLA 5CRFA 1PIOA 4GHIA 3P7NA 2PYPA 2G2UA 1GSVA 1SHVA 4PM7A 3VE3A 4IJGA 1Y54A 5E2FA 4WF0A 5MC7A 4JGRA 2R78A 2EFUA 1V9ZA 5HPIA 1OTAA 3WS5A 3VSLA 3IS2A 3ZQ5A 1W63Q 2DCFA 5JYPA 4Y0UA 4Z9QA 3D72A 2A3UA 4H6JB 4X25A 2XA7S 4N1XA 3DTEA 3DWZA 2PT7A 3E2KA 1K0KA 3A0SA 3VP0A 4E3MA 3IWIA 1YKDA 2WGVA 3W8KA 2WYXA 3FPWA 1ACFA 3LY3A 1CK3A 4PKYA 2PU4A 2PR6A 1RCJA 2GZAA 2O9BA 3GMWA 3Q82A 1IYOA 4LV1A 3S4XA 1TS0A 3UNWA 4EQ1A 2J8YA 5HDSA 4NKPA 1JWZA 3BQ8A 1K4EA 5EVIC 3NDGA 3KO6A 2XLNA 5L10A 1K54C 4HIAA 3MBZA 3MXSA 4OH0A 2P08A 4ZTKA 3Q7VB 4U3TA 1FSWA 3IH8A 3O86A 3HREA 4HY8A 5CTMA 1EROA 1MKMA 4R3AA 4X53A 4EEUA 4JF5A 1NWZA 2ZBBA 3D4FA 4MDZA 5L09A 5HFOA 2W1TA 2I72A 5A8BA 5DF7A 1GCEA 5EVIB 3MFDA 3T4LA 3VP1A 3GDIA 1WYBA 1J9MA 2Y2HA 1I2SA 3G32A 3B47A 4LENA 4IVIA 3TW8A 5KIZA 3BY8A 3DAVA 3KYZA 5E2EA 4L9GA 1S66L 3DW0A 1K57A 1VEUA 4PM6A 4ETXA 5DF9A 2HDUA 3KYQA 3OCLA 2EWVA 4E3NA 3BM6A 4KG6A 4Y0OA 3FKWA 2Q0OA 4BENA 3CWFA 3GQZA 5GLBA 5J7EA 3CHWP 3T4OA 5E43A 2VZWA 3AGFA 3CG5A 5TR7A 2IWBA 3N8LA 2B18A 3UB6A 4LV2A 1N9OA 4EQIA 2JKTI 1YLWA 5FI6A 2GX5A 2EX9A 3ZG0A 3A3JA 5K5BA 4CLCA 5FDSA 4NXEA 1W8YA 3IS2B 2IWCA 3UPOA 4WZ5C 4DXBA 2HV1A 2V1AA 1XX2A 4WLAA 3MS6A 3N8RA 2WGIA 1XJ3A 4BJPA 1IKIA 5FI2A 4R1GA 3JVUA 4IBXA 3AGEA 1KDSA 1SDEA 3L7HA 3W4PA 2EXBA 3ZG7B 5AVFA 1NRFA 5DFYA 5F82A 4I38A 2LB5A 2M7VA 4Y17A 4OQIA 1VETB 1MZUA 2HGVA 3HLCA 4GD8A 3SZTA 1G6AA 1L0EA 2QJ7A 3MXRA 1RP5A 4BL2A 5F6AA 3T4KA 3EOIA 5CX7A 1DJBA 2ZC7A 3P01A 3SH8A 1VEUB 2V0UA 3OOVA 4YINA 2WGWA 3H7WB 4JPMA 5L07A 3MQ0A 4E6WA 1ES5A 1NXYA 2PBYA 3H9WA 1TD5A 1CF0A 1YLYA 3CAXA 4S2MA 3PAGA 4UQIS 1E25A 5CEDA 4HP4A 4YWZA 2O99A 1S4SA 4BD0A 1NZUA 3ISGA 2H10A 5F69A 1OTDA 5C5KA 1CI9A 2VKSA 4LV0A 4PKYG 3ITAA 3LUQA 1G5UA 1K6RA 3BFCA 2QYBA 3DBAA 1EWZA 5L8MA 3F1NA 5DFXA 2JKFA 4F94A 2P7JA 4EUZA 3Q07A 5GLCA 5FATA 3G4PA 1UWNX 3WRTA 1EI5A 2JHEA 4KQDA 5A92A 1T19A 4KZ7A 2H28A 3CI6A 4P87A 3P98A 1MXOA 1AXBA 3NULA 1L2SA 5J3WA 1XGJA 1HLUP 4Q0HA 1S0WA 2J9PA 1H5XA 1HVBA 3PYPA 3CPTA 1MWTA 4Y3IA 4KG2A 2PDRA 4ESPA 1G68A 4UA7A 4GJ4A 1CI8A 3ZHHA 3PBSA 1WA9A 2VV7A 5CEBA 1IYPA 1DP8A 1S67L 3PR6A 1L0DA 1IYQA 2VK3A 3KSIA 4OKPA 5EOOA 5DVAA 5FQIA 2KX6A 3TRCA 3R7WB 1I5QA 5HL6A 3UO9A 4FUWA 1E3UD 5M1AA 2OWJA 3ULFA 1LHYA 4R70A 4P0MA 4KZBA 4GDBA 2W1RA 1YLJA 3CZDA 5M19A 2PBDP 1MY8A 3LYXA 5HL1A 1UGUA 4WBGA 5CXWA 4JXVA 5EM0A 3LEQA 3ZNYA 1F9IA 3ZNTA 1P9WA 3OC2A 2Y2JA 4S2OA 3BFDA 1K56A 4GS9B 3T4JA 2OAQ1 5GHXA 5FI7A 4JGPA 4WELA 1ZKJA 3FG8A 5BOHA 4QB8A 1N9LA 5LBRA 2OLVA 3UE1A 2WKIA 4HJ6A 4PM8A 2HP9A 3ITBA 4R6LA 4FCFA 4Y5FA 1RGZA 1L0GA 1E4DA 4MBHA 1KGEA 1NLYA 3T4QA 2H0TA 4HNBA 5AQAA 4F3LA 2ACGA 1BLSA 4L0LA 1ALQA 2K7SA 2L1MA 3FV7A 3LIAA 2V1ZA 2OWHA 5U47A 3Q7ZA 2WZZA 4WL9A 1FQGA 5HAQA 2J3TD 3CPTB 3JVVA 4EV4A 5DJTA 2ZQCA 5FEGA 2CC1A 3LGOA 1KE3A 2ZC6B 4DMZA 2EXAA 2X02A 1YSPA 3A3IA 3T12B 1SDNA 4CJNA 1DP6A 1G6OA 3WWXA 4NXGA 5I94A 3C2WA 5EFWA 2J3TC 2OSUA 3BW6A 1XXMA 3LI8A 5TGFA 2QMIA 4KZ5A 3L9KA 3BRMA 3NOUC 4X6TA 3ZVTA 3HVFA 4KG5A 2Q9NA 1DY6A 2ZL1B 3BQAA 4E6XA 2WZXA 1KOUA 1VM1A 4DF6A 1K25A 3IX3A 1GHPA 4XT2A 3EGXC 5CGXA 4Q8IA 4E3LA 3T50A 3QNCA 3ZFZA 4N92A 2ZQ9A 4KQRA 1IOUA 3N6IA 3HUOA 3OPLA 2Y79A 1CEFA 3A3EA 4S2IA 2P74A 3SS3A 1PZPA 3HLWA 3G35A 2D01A 4WEJA 1LI9A 2X71A 4E04A 1J3WA 1H8ZA 3MKEA 2JKGA 5FDHA 5EOEA 4K0WA 1TDGA 3IXDA 1PWCA 2XD5A 4KZ6A 3HLEA 3LI9A 3JYIA 1F2KA 3ICYA 4G3KA 4P6ZS 1MC0A 1BUEA 1IEMA 3MSHA 4OQ0A 5EE8A 3TE8A 2W1TB 5F1FA 3KYEA 5G18A 2BASA 5FAPA 1YPRA 3NOPC 3EEHA 2P9VB 1MWUA 2EA9A 5EPHA 5HWTA 2NUTC 3NIAA 5AQBA 1CEGA 4OP8A 5HD3A 4R3BA 1H3QA 2ZD8A 5HD5A 5CHJA 3S22A 3VFHA 3ZYTA 1PWDA 4DJ2A 4B93A 2KOIA 2V2FF 2Z2MB 5KSHA 3M2KA 3R4KA 3E4QA 3SOIA 4MBKA 2OLUA 2H5SA 2Y2QA 3QP4A 2Y55A 2PHYA 1OJGA 1D7EA 3Q81A 1TDLA 1ZC2A 3UE6A 4G3WA 4GZBA 4M4XA 2ZC3B 3QP1A 1O07A 1ZG6A 4FH4A 2PD8A 2UV0E 3LFVA 4GN2A 3IXGA 2JKRI 3SS5A 3RFBA 1W63M 4MNRA 2GDNA 4WN5A 2ZM2A 3O87A 3WS0A 3IF6B 3KX0X 2D02A 1FIKA 1BT5A 4WZ4A 2VA0A 2XSSA 4GNUA 4R4RA 3IWOA 1FILA 1LLBA 5GL9A 2HDSA 3IF6C 1V9YA 4NETA 4CLCB 1ODVA 2VGKA 1P97A 4LRZE 4LCLA 3S7OA 2ZM0A 1GHMA 5EV0A 4RA7A 4X55A 3VSKA 4QHCA 1JNUA 2VX8A 1N9BA 4Q0IA 5F5YA 4EUVA 4NXFA 5JYOA 2VV6A 1VHMA 4LPZA 4R3JA 2Y8HA 5EVEA 5G4ZA 3CLOA 2OV5A 4QJGA 1S6RA 5FL3A 3SW1A 3RXWA 1KVMA 2O9CA 5FQKA 5DTTA 4DXCA 4KQQA 4WUJA 2FFYA 3V39A 3QP6A 3U4LP 1XFNA 3MF0A 3RXXA 2RCXA 4JKTA 3CMZA 4BD1A 2VGJA 5KZHA 4KQOA 4LRXC 3MQQA 3WRZA 2NUPC 5FASA 4OPZA 2OAP1 2XK1A 3Q7VA 1Z6FA 4E3OA 3C8CA 2B5RA 2A2LA 1U60A 1C3BA 1PZOA 3G2YA 1VETA 4HQAA 2FZ0A 4CLCD 2Y2GA 4L9EA 2Y2IA 4XXRA 3C4OA 4KZ9A 3C5AA 1ONHA 1F5MA 1NY0A 2ZLYA 2XD1A 4WMCA 3BY9A 1YSQA 4KZ4A 1XJ4A 3UDFA 3M2JA 3LIFA 3PBNA 5HAPA 1XGIA 2Y2KA 2K31A 4BMWA 3A3FA 2EX2A 3G34A 3IF5A 1XP4A 1LL8A 2EWWA 2WUQA 5TBMA 3CUEA 1Y4OA 5AQ9A 1W8QA 1K6SA 3G31A 1PW1A 2WAFA 2W27A 1PFLA 3ZG9B 4DRTA 3BYDA 2ZQ8A 1PI4A 4I39A 5F1GA 4O0PA 5HDCA 4O01A 1Q2PA 4OPQA 3PTEA 3F1PB 5HSQA 3EEAA 2HF6A 4FTXA 1E3UA 3WS4A 1WE4A 1O7EA 5GLAA 3UE0A 4JXWA 4HJ4A 3UB5P 4EESA 1L0FA 5IS1A 5CTNA 1ES2A 1ES3A 2Y2MA 2V1BA 1DJCA 4GW9A 4HP9A 3K3DA 5HX9A 5CECA 3OPPA 1NZOA 3DWKA 3GRJA 1SKFA 3V50A 1EW0A 1T18A 1XA7A 1AWIA 2HDRA 2I9VA 3B3XA 3HJIA 3D9YA 1HD8A 3V3SA 4M3KA 4X1LA 4UHUA 2K2NA 4BBVA 3E2LA 3SS4A 2WK0A 3A0VA 1TS7A 1TEMA 2W0NA 3GECA 3UY6A 3T1RA 1OJ5A 1PYYA 3S7PA 4X1MA 4FSFA 4BBTA 2XR0A 1QMFA 4X68A 1NLZA 2V9AA 3MJQA 4D60A 5HPFA 1MWRA 3LR5A 4MN6A 3NCKA 3HLBA 3IBRA 2JBFA 4PPRA 2W3DA 1GA9A 3E0YA 5IHVA 4GCZA 1ESIA 3O5YA 3M6BA 1HTZA 4HBTA 1FSYA 1FCNA 2DRWA 1FCOA 4OVDA 1WYCA 1YQSA 3EWKA 3P09A 3MMHA 5FA7A 4BWIA 3UDXA 4BQMA 1JWVA 5DJUA 2A24A 4AFIA 1MBLA 1CJFA 3F1OB 3DTIA 3NC8A 1X0OA 3HJKA 3UPPA 4WM9A 1P0ZA 4K0XA 3NHQA 5GHZA 4G3VA 4N9KA 2G2WA 5FAOA 3NECA 2XRNA 5A93A 5A91A 1Z09A 1ZHHB 4UA6A 3DTMA 4KENB 1PNEA 4UQIM 3HUMA 5CHUA 3UB8A 3SH7A 2E8JA 1JTDA 4IUHA 2W3HA 3OBFA 4IBRA 1OT6A 3E4OA 4NK3A 2J7VA 4I3IA 3UMDA 5HWWA 4ID4A 1YLPA 3KSHA 4UAAA 1BZAA 2ZMAA 1P9RA 4B88A 4CPKA 4H8RA 1FR1A 1F98A 1GSXA 2MJ6A 2VEAA 4F3LB 1JVJA 1H8MA 3Q1FA 3PBRA 3T1XA 3LR4A 3C4PA 1IKGA 1ES4A 2X01A 1W7FA 1BLPA 1YLZA 3BLSA 3TSGA 4QY5A 3LEZA 4E3KA 5AJGA 2PYRA 4C75A 1Y28A 4I5SA 1H0MA 1TF1A 3R7WA 4D2OA 3VE4A 1KGFA 1S4RA 2R9WA 3JPUA 4A5RA 5M18A 2HJ9C 2Q9MA 4ZBEA 3IWQA 4XUXA 3KSFA 4L9FA 5HW3A 4E3IA 1FR6A 3MFXA 1ZG4A 1STZA 2AVXA 4Z1WA 4R4SA 3FWLA 5HAIA 5GLDA 2WKQA 3T4SA 4E3JA 2ZL1A 4JGOA 2ZMFA 5FAQA 2PD7A 4MMNA 4HOIA 4I3AA 3F1OA 1YLTA 4MCWA 1XJ6A 2J3WA 1D1JA 2XGNA 3VOLA 4DE1A 3UE3A 4FOFA 2YKHA 2PRFA 4LV3A 2W3GA 5KMWA 4YNRA 3IXHA 1K4FA 4JBFA 4HHDA 3BWLA 4II7A 4S2KA 5DTKA 1NYYA 3C7UA 4RX2A 2XH9A 4JF4A 2M1CA 1IELA 3S7NA 5J8XA 3T4TA 1N4OA 2CMNA 1QMEA 4OLGA 3HLGA 3RTYA 3LO7A 4S2NA 2WAEA 4S2LA 3NJAA 1ZTUA 2JC7A 2YKFA 2O0YA 3N4IA 4S2PA 2BLSA 4Y15A 4Y0TA 3BFGA 4ETZA 4DE3A 2J80A 2IA2A 5DKKA 3T1QB 1GA0A 2QWSA 5HARA 4XUZA 3PAEA 4R38A 3PBOA 4S2NC 1FCMA 4OPRA 5FQQA 4P6BA 1KVLA 4HESA 4HI4A 5TFQA 1W79A 3W4QA 3UPNA 4OONA 1DRMA 2FH5A 2INWA 3G30A 2JKTM 2JCHA 5EM1A 1YAXA 3NI9A 4PAUA 2C5WB 4UA9A 1LT0A 4QPRA 3GR2A 4DN0A 1XKZA 4PMAA 2VV8A 4LCMA 3FYZA 1K38A 2ZC5B 4EBNA 1OTEA 3HLDA 4H6JA 4GB7A 3LICA 3VV4A 1FOFA 3V5MA 4HBUA 4JXGA 1KE4A 2HJEA 1BLHA 4KZAA 4O7DA 4OLDA 4N1HA 4DDYA 1PI5A 2WKEA 3HUNA 4P85A 5L2FA 2ZOIA 2B95A 4EBPA 3F1PA 3LY4A 2Y59A 3MZDA 4LGWA 3VMAA 3O88A 2P9VA 3EQUA 4B4XA 3FKVA 3NDEA 3ZDJA 3A0RA 4B4ZA 3NOTC 3MR0A 3QP2A 1H8YA 4ZJ1A 1LSXA 1OTIA 5J4EA 2Y2OA 1K54A 3FPVA 4JLFA 5EVIA 5EECA 3IBJA 3ZCZA 1YT4A 1SKOB 3BFEA 4RYEA 3G6OA 1SKOA 5EVID 4I3JA 1M6KA 4GKUA 4JGQA 4DE2A 2BG1A 1SCWA 1ERMA 5GHYA 2LB9A 1T1CA 3DTKA 4OOLA 4GHIB 3LIDA 2Y2PA 2JN7A 3GVBA 2XFTA 5DF8A 4OOYA 1ONGA 1UWPX 4BLMA 2HP6A 2Z6CA 5IT5A 3VOZA 5FQJA 5A90A 2ZJ9A 4FH2A 3E98A 3LIEA 3BECA 1CQAA 2XQZA 4OQGA 2DMWA 1NYMA 2A24B 3SH9A 3LR3A 1D06A 1BSGA 2O9AA 2WADA 1PW8A 2GJ3A 5CERA 5E2HA 2VGLM 4R23A 1OMEA 3VP4A 3N8SA 4IHQA 3F1NB 3B33A 4PM9A 2XDMA 2EX6A 4HJ3A 1Q2QA 1S1YA 5FQMA 2A49A 1S1ZA 3O3VA 3IQAA 2VJWA 3ZG5A 2JE5A 3QP5A 4OP5A 1LL9A 3T1SA 2Y2NA 2JKRM 4U0XA 2QZ6A 4HEFA 4WYYA 3MZEA 2B02A 4N9LA 1XA1A 5AVEA 2PR5A 2R9XA 1YM1A 2HP5A 2E8IA 2XFSA 1SZVA 3PHYA 1I2WA 4MEZA 1TVFA 4ZRRA 4Y7PA 3V67A 3MZFA 4UEYA 3K2NA 3N7WA 2WKPA 4IEDA 3RJUA 5HWVA 4EW7A 1K55A 3D3OA 2FFFB 3GSGA 2ZQDA 4X69A 4EEPA 3H82A 3RH8B 2ZMVA 3C38A 1LSWA 3OCNA 4EETB 3IT9A 1NJ4A 3UN7A 3C7VA 5KSCA 4ARZA 3LCEA 4RVAA 5CHMA 5D3OA 1OT9A 5TJJA 4HH2A 4WZ5A 3AGDA 5CGWA 3PXPA 4R0QA 4MBFA 1LL5A 4KZ8A 2M7UA 2V8FA 2ZM8A
chains in the Genus database with same CATH topology
4E04A 1OT6A 1N9NA 3E4OA 3CWFA 4I3IA 4ARZB 3UMDA 5HWWA 5J7EA 3T4OA 2VZWA 3KSHA 4CLCE 2L0WA 1P9RA 5I5LA 3LI9A 2B18A 3ICYA 4G3KA 1F98A 1GSXA 2MJ6A 1MC0A 2VEAA 4P6ZS 3UB6A 4F3LB 1N9OA 1H8MA 4XT2B 3PBRA 5TBMB 2JKTI 2GX5A 3LR4A 1IFQA 4PHTA 3TE8A 5K5BA 4CLCA 2W1TB 2BASA 4NXEA 5DKLA 3NOPC 3EEHA 3IS2B 1G28A 2EA9A 5HWTA 2NUTC 2HV1A 2V1AA 4EXOA 4ME4A 5HD3A 5AJGA 1GSWA 2PYRA 4WLAA 1Y28A 1H3QA 4I5SA 1TF1A 3R7WA 3BJNA 5HD5A 3VE4A 4LLOB 3ZYTA 1XJ3A 1S4RA 4DJ2A 4OOMA 2HJ9C 4B93A 3LIBA 4BJPA 4WEKA 2KOIA 3UMEA 1LSVA 5KSHA 3JVUA 3KSFA 3R4KA 3E4QA 4L9FA 2ZOHA 2W3EA 1TS6A 3MFXA 3CUEC 2PHYA 1STZA 1OJGA 3KSGA 5AVFA 5DFYA 4Z1WA 1D7EA 3OLOA 4KUOA 4I38A 1OTBA 2LB5A 3UE6A 4G3WA 2M7VA 2QHKA 2WKQA 3T4SA 3B42A 4M4XA 2XROA 1MZUA 4JGOA 2HGVA 2ZMFA 4EERA 2PD7A 4MMNA 2PD8A 4HOIA 3LFVA 2QJ7A 4B9OA 4I3AA 3F1OA 2JKRI 3RFBA 1W63M 2OOLA 4MCWA 4WN5A 1XJ6A 2J3WA 5F6AA 3LR0A 3T4KA 3EOIA 3VOLA 1BYWA 5CX7A 3KX0X 2D02A 4CQHA 3UE3A 3P01A 4FOFA 2YKHA 2V0UA 2W3GA 3OOVA 2VA0A 2XSSA 4YNRA 3H82B 2KLIA 3H7WB 4NXBA 3MQ0A 4HHDA 1TS8A 3BWLA 4II7A 3HCYA 4RQ9A 4DJ3A 1V9YA 3H9WA 4CLCB 1TD5A 1ODVA 3MXQA 3CAXA 3CITA 2M1CA 1XFQA 2Z6DA 3H7WA 3S7NA 3T4TA 1P97A 2CMNA 4UQIS 4LRZE 4MN5A 4Y2FA 3S7OA 4HP4A 4YWZA 3RTYA 2QKPA 1OPXA 2O99A 4K08A 1JNUA 3E4PA 4MN7A 1S4SA 2VX8A 4CLCC 4Q0IA 5F5YA 4EUVA 4NXFA 3NJAA 1ZTUA 5F69A 2VV6A 1VHMA 2YKFA 4LPZA 1OTDA 2O0YA 2Y8HA 5G4ZA 2XA7M 5C5KA 3CLOA 2VKSA 5FL3A 4HH3A 4PKYG 3LUQA 3SW1A 2O9CA 4ETZA 2VLGA 2QYBA 3DBAA 4IUKA 2J80A 4WUJA 5L8MA 3F1NA 2IA2A 5DFXA 5DKKA 2P7JA 2QWSA 3PBQA 4R38A 3PBOA 1XFNA 2L4RA 3EQVA 3MF0A 3S7QA 4O8GA 1T1AA 1UWNX 4GS9A 4HI4A 2JHEA 4KQDA 5G4YA 1T19A 4KQOA 2H28A 4LRXC 3MQQA 3CI6A 2P04A 2NUPC 4KUKA 1DRMA 1DP9A 2FH5A 2INWA 2OAP1 2JKTM 4Q0JA 2V0WA 1NRJA 5J3WA 2WKRA 1YAXA 4PAUA 4Q0HA 3U2AA 2G7UA 1LT0A 3C8CA 4QPRA 4DN0A 2A2LA 2KDKA 3PYPA 3PBTA 2VV8A 3UB7A 4HQAA 2QJ5A 4Y3IA 3K3CA 2FZ0A 4CLCD 2VGLS 1OTEA 2PDRA 4L9EA 4GJ4A 3PBSA 4BBUA 1F5MA 1WA9A 2GNXA 2VV7A 4H6JA 3BY9A 3LICA 1DP8A 3VV4A 1YSQA 1S67L 3PR6A 1XJ4A 4P6ZM 3C30A 3EGDC 3KSIA 3FC7A 3LIFA 2HJEA 4NEED 3PBNA 4GLQA 2K31A 2KX6A 4BMWA 3TRCA 2ZOIA 3R7WB 1LL8A 2EWWA 3F1PA 5HL6A 5TBMA 3W2ZA 3CUEA 4EU0A 5HDDA 3EQUA 2W27A 5IU1A 3A0RA 2OWJA 4I39A 3NOTC 5HZHA 3MR0A 4O0PA 3ULFA 5HDCA 4O01A 3F1PB 4LRYC 4R70A 5HSQA 3EEAA 1LSXA 1OTIA 2HF6A 3TJZC 5J4EA 2W1RA 3MQOA 3FPVA 3LYXA 1UGUA 2W3FA 4HJ4A 4EESA 5IS1A 3IBJA 5F68A 4YOFA 1XJ2A 1VB6A 3UB9A 1F9IA 1P9WA 1T1BA 2V1BA 4GW9A 3G6OA 3OC2A 4HP9A 3K3DA 4GHIA 4I3JA 3P7NA 2PYPA 4JGQA 4GS9B 3T4JA 1EW0A 2OAQ1 1T18A 1GSVA 3VE3A 4IJGA 4JGPA 4WF0A 5MC7A 4JGRA 4WELA 2R78A 2I9VA 1T1CA 2LB9A 3FG8A 4OOLA 3HJIA 4GHIB 3LIDA 1N9LA 5LBRA 2JN7A 1V9ZA 5HPIA 1OTAA 2K2NA 3IS2A 4HJ6A 1W63Q 3ZQ5A 4BBVA 3A0VA 1TS7A 2W0NA 1UWPX 5IT5A 2Z6CA 3D72A 3GECA 4R6LA 4H6JB 2XA7S 4Y5FA 1OJ5A 3S7PA 4FSFA 4BBTA 2PT7A 3E98A 1NLZA 3LIEA 3A0SA 3MJQA 2V9AA 1NLYA 5HPFA 3T4QA 2DMWA 3LR5A 2A24B 4HNBA 4MN6A 4F3LA 3LR3A 1YKDA 3IBRA 3FPWA 4L0LA 1D06A 2K7SA 2L1MA 3LIAA 2O9AA 2W3DA 2OWHA 2GJ3A 2VGLM 4PKYA 4IHQA 3E0YA 3F1NB 3B33A 2PR6A 4GCZA 4WL9A 4HJ3A 1S1YA 2GZAA 2O9BA 1S1ZA 2VJWA 3O5YA 1TS0A 4EQ1A 2J3TD 5HDSA 3JVVA 4NKPA 5DJTA 3BQ8A 2JKRM 3KO6A 3EWKA 2B02A 4DMZA 4HIAA 5AVEA 2PR5A 1YSPA 2P08A 3MMHA 4BWIA 1DP6A 1G6OA 4NXGA 5DJUA 2A24A 3C2WA 4AFIA 5EFWA 4HY8A 2J3TC 3PHYA 1MKMA 3BW6A 3LI8A 4R3AA 4ZRRA 4EEUA 3F1OB 3V67A 1NWZA 4UEYA 3NOUC 1X0OA 2ZBBA 3K2NA 2WKPA 4MDZA 3HJKA 2W1TA 3BQAA 5HWVA 4EW7A 1P0ZA 1KOUA 3D3OA 5A8BA 3NHQA 4EEPA 4G3VA 3T4LA 3H82A 3RH8B 3GDIA 2ZMVA 4XT2A 3C38A 1LSWA 3EGXC 3OCNA 3B47A 2XRNA 4EETB 3T50A 1ZHHB 3TW8A 5KIZA 4ARZA 3BY8A 3KYZA 4L9GA 1OT9A 5TJJA 4HH2A 1IOUA 4UQIM 1S66L 2Y79A 3UB8A 3PXPA 4ETXA 4IUHA 5DF9A 2W3HA 3KYQA 3OBFA 3OCLA 2EWVA 2D01A 2M7UA 4WEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E04 A;  4YNR A;  2KLI A;  1F5M A;  3MQ0 A;  1YKD A;  3IBR A;  3HCY A;  3VV4 A;  1YSQ A;  2O9A A;  4RQ9 A;  2W3D A;  2VZW A;  3KSH A;  1TD5 A;  3E0Y A;  3KSI A;  3CIT A;  5I5L A;  2B18 A;  3S7N A;  4G3K A;  4GLQ A;  2O9B A;  2VEA A;  1MC0 A;  2K31 A;  4LRZ E;  2VJW A;  4Y2F A;  3O5Y A;  3S7O A;  3TRC A;  2GX5 A;  2O99 A;  5HL6 A;  3W2Z A;  4EU0 A;  5K5B A;  4MN7 A;  2W1T B;  4Q0I A;  5HPF A;  3KO6 A;  4EUV A;  1ZTU A;  4DMZ A;  3NOP C;  1VHM A;  3NOT C;  2O0Y A;  1YSP A;  2Y8H A;  3MMH A;  4O0P A;  4O01 A;  5C5K A;  4BWI A;  2VKS A;  4LRY C;  4R70 A;  5HSQ A;  3EEA A;  4ME4 A;  5AJG A;  2W1R A;  3C2W A;  1TF1 A;  3BJN A;  2O9C A;  1MKM A;  4ETZ A;  2W3F A;  2QYB A;  2KOI A;  4ZRR A;  3IBJ A;  3DBA A;  4IUK A;  4YOF A;  3NOU C;  5L8M A;  3KSF A;  2IA2 A;  3R4K A;  3K2N A;  5DFX A;  4MDZ A;  4GW9 A;  2W1T A;  2W3E A;  3G6O A;  3D3O A;  1STZ A;  3KSG A;  4Z1W A;  3MF0 A;  5DFY A;  3NHQ A;  3S7Q A;  4G3V A;  4O8G A;  4IJG A;  2LB5 A;  4G3W A;  2M7V A;  2XRO A;  2LB9 A;  4LRX C;  3CI6 A;  5LBR A;  2XRN A;  2HGV A;  2ZMF A;  5HPI A;  4MMN A;  4Q0J A;  2K2N A;  3ZQ5 A;  4PAU A;  4Q0H A;  3LFV A;  2G7U A;  4QPR A;  5TJJ A;  3RFB A;  4DN0 A;  2OOL A;  4MCW A;  2Y79 A;  4R6L A;  2M7U A;  4Y5F A;  4Y3I A;  4ETX A;  4IUH A;  3S7P A;  2W3H A;  3OBF A;  4CQH A;  4FOF A;  3E98 A;  2W3G A;  3OOV A;  2XSS A; 
#chains in the Genus database with same CATH topology
 3OPR A;  2BTF P;  3QHY A;  2H0Y A;  1N9N A;  1HZO A;  2C6W B;  3G2Z A;  3CJM A;  3WS1 A;  1M40 A;  1MKI A;  4ARZ B;  2Y4A A;  5CGS A;  3IHA A;  4CLC E;  2L0W A;  3V3R A;  5I5L A;  3TG9 A;  4XT2 B;  3BLM A;  5TBM B;  3VP3 A;  2PAV P;  3GV9 A;  1IFQ A;  4PHT A;  3BEB A;  2Y91 A;  3FZC A;  2EFX A;  2ZC4 B;  1MPL A;  5DKL A;  1RGY A;  1G28 A;  3VFF A;  1BLC A;  1IYS A;  4EWF A;  4EXO A;  1BUL A;  4ME4 A;  1GSW A;  5FQ9 A;  4IVK A;  3IF6 A;  2XEP A;  3BJN A;  4LLO B;  1W5D A;  4OOM A;  4GD6 A;  3LIB A;  4WEK A;  3UME A;  3S1Y A;  1LSV A;  2QPN A;  3ZGA B;  2ZOH A;  4NG2 A;  2W3E A;  1TS6 A;  4OQH A;  3IX8 A;  3CUE C;  1KE0 A;  3I7J A;  4GOG A;  3KSG A;  3OLO A;  4BL3 A;  4KUO A;  3NY4 A;  1OTB A;  4WMC D;  2QHK A;  3B42 A;  2XRO A;  4EBL A;  4EER A;  3GTC A;  3QP8 A;  2PU2 A;  3ZVW A;  4B9O A;  3ZG8 B;  3MKF A;  3NBL A;  2OOL A;  4QWO A;  3LR0 A;  4PM5 A;  1BYW A;  2HDQ A;  4CQH A;  4Y13 A;  4C3Q A;  5DTS A;  4OPY A;  1GHI A;  2KLI A;  3H82 B;  4NXB A;  1TS8 A;  4JF6 A;  3HCY A;  4RQ9 A;  4C6Y A;  3VP2 A;  4DJ3 A;  2Y2L A;  3UDI A;  4QU3 A;  3VOY A;  4ZDX A;  3MXQ A;  3CIT A;  1XFQ A;  2Z6D A;  3H7W A;  5E2G A;  3OZH A;  4MN5 A;  4Y2F A;  2Z2L B;  2J9O A;  2QKP A;  1OPX A;  4K08 A;  3E4P A;  1PWG A;  1JTG A;  4MN7 A;  3IHB A;  2V8C A;  4CLC C;  1YMX A;  2UWX A;  2ZQA A;  5EUA A;  3M6H A;  1K56 D;  2XA7 M;  4YFM A;  4DKI A;  1KDW A;  1MWS A;  4HH3 A;  2RL3 A;  2WGW B;  5FSR A;  4ZJ3 A;  2XF3 A;  4K91 A;  3HL9 A;  3IX4 A;  1XPB A;  2VLG A;  4LFU A;  4IUK A;  3W4O A;  3A3D A;  4JXS A;  1KGG A;  1L3L A;  3PBQ A;  1ERQ A;  2L4R A;  3EQV A;  3S7Q A;  2HZ5 A;  4O8G A;  1T1A A;  4GS9 A;  5G4Y A;  2EX8 A;  2P04 A;  3QNB A;  1DP9 A;  4KUK A;  4ZJ2 A;  2ZQ7 A;  4Q0J A;  2V0W A;  1NRJ A;  2WKR A;  1YMS A;  3U2A A;  2G7U A;  4X56 A;  4GDN A;  5AQ7 A;  2KDK A;  3PBT A;  1ESU A;  3UB7 A;  2WKH A;  4RX3 A;  2DNS A;  2QJ5 A;  2V20 A;  3K3C A;  2VGL S;  1JWP A;  4BBU A;  1VQQ A;  3HBR A;  2GNX A;  1K57 C;  5FEF A;  1DJA A;  2IWD A;  4P6Z M;  3C30 A;  3EGD C;  3FC7 A;  4NEE D;  3WS2 A;  3HLF A;  1K55 C;  4GLQ A;  4QY6 A;  4S2J A;  5EVL A;  3W2Z A;  4EU0 A;  1PRQ A;  2HPB A;  5HDD A;  5IU1 A;  4MLL A;  5HZH A;  3TOI A;  4DDS A;  4LRY C;  4U0T A;  4KZ3 A;  4FD8 A;  3OPH A;  3TJZ C;  4ZAM A;  1LI0 A;  3MQO A;  3IXB A;  4DE0 A;  2W3F A;  5F68 A;  4YOF A;  5F83 A;  3BFF A;  3IH9 A;  1A0K A;  4QD4 A;  1XJ2 A;  1VB6 A;  3UB9 A;  1T1B A;  1BTL A;  5CRF A;  1PIO A;  4GHI A;  3P7N A;  2PYP A;  2G2U A;  1GSV A;  1SHV A;  4PM7 A;  3VE3 A;  4IJG A;  1Y54 A;  5E2F A;  4WF0 A;  5MC7 A;  4JGR A;  2R78 A;  2EFU A;  1V9Z A;  5HPI A;  1OTA A;  3WS5 A;  3VSL A;  3IS2 A;  3ZQ5 A;  1W63 Q;  2DCF A;  5JYP A;  4Y0U A;  4Z9Q A;  3D72 A;  2A3U A;  4H6J B;  4X25 A;  2XA7 S;  4N1X A;  3DTE A;  3DWZ A;  2PT7 A;  3E2K A;  1K0K A;  3A0S A;  3VP0 A;  4E3M A;  3IWI A;  1YKD A;  2WGV A;  3W8K A;  2WYX A;  3FPW A;  1ACF A;  3LY3 A;  1CK3 A;  4PKY A;  2PU4 A;  2PR6 A;  1RCJ A;  2GZA A;  2O9B A;  3GMW A;  3Q82 A;  1IYO A;  4LV1 A;  3S4X A;  1TS0 A;  3UNW A;  4EQ1 A;  2J8Y A;  5HDS A;  4NKP A;  1JWZ A;  3BQ8 A;  1K4E A;  5EVI C;  3NDG A;  3KO6 A;  2XLN A;  5L10 A;  1K54 C;  4HIA A;  3MBZ A;  3MXS A;  4OH0 A;  2P08 A;  4ZTK A;  3Q7V B;  4U3T A;  1FSW A;  3IH8 A;  3O86 A;  3HRE A;  4HY8 A;  5CTM A;  1ERO A;  1MKM A;  4R3A A;  4X53 A;  4EEU A;  4JF5 A;  1NWZ A;  2ZBB A;  3D4F A;  4MDZ A;  5L09 A;  5HFO A;  2W1T A;  2I72 A;  5A8B A;  5DF7 A;  1GCE A;  5EVI B;  3MFD A;  3T4L A;  3VP1 A;  3GDI A;  1WYB A;  1J9M A;  2Y2H A;  1I2S A;  3G32 A;  3B47 A;  4LEN A;  4IVI A;  3TW8 A;  5KIZ A;  3BY8 A;  3DAV A;  3KYZ A;  5E2E A;  4L9G A;  1S66 L;  3DW0 A;  1K57 A;  1VEU A;  4PM6 A;  4ETX A;  5DF9 A;  2HDU A;  3KYQ A;  3OCL A;  2EWV A;  4E3N A;  3BM6 A;  4KG6 A;  4Y0O A;  3FKW A;  2Q0O A;  4BEN A;  3CWF A;  3GQZ A;  5GLB A;  5J7E A;  3CHW P;  3T4O A;  5E43 A;  2VZW A;  3AGF A;  3CG5 A;  5TR7 A;  2IWB A;  3N8L A;  2B18 A;  3UB6 A;  4LV2 A;  1N9O A;  4EQI A;  2JKT I;  1YLW A;  5FI6 A;  2GX5 A;  2EX9 A;  3ZG0 A;  3A3J A;  5K5B A;  4CLC A;  5FDS A;  4NXE A;  1W8Y A;  3IS2 B;  2IWC A;  3UPO A;  4WZ5 C;  4DXB A;  2HV1 A;  2V1A A;  1XX2 A;  4WLA A;  3MS6 A;  3N8R A;  2WGI A;  1XJ3 A;  4BJP A;  1IKI A;  5FI2 A;  4R1G A;  3JVU A;  4IBX A;  3AGE A;  1KDS A;  1SDE A;  3L7H A;  3W4P A;  2EXB A;  3ZG7 B;  5AVF A;  1NRF A;  5DFY A;  5F82 A;  4I38 A;  2LB5 A;  2M7V A;  4Y17 A;  4OQI A;  1VET B;  1MZU A;  2HGV A;  3HLC A;  4GD8 A;  3SZT A;  1G6A A;  1L0E A;  2QJ7 A;  3MXR A;  1RP5 A;  4BL2 A;  5F6A A;  3T4K A;  3EOI A;  5CX7 A;  1DJB A;  2ZC7 A;  3P01 A;  3SH8 A;  1VEU B;  2V0U A;  3OOV A;  4YIN A;  2WGW A;  3H7W B;  4JPM A;  5L07 A;  3MQ0 A;  4E6W A;  1ES5 A;  1NXY A;  2PBY A;  3H9W A;  1TD5 A;  1CF0 A;  1YLY A;  3CAX A;  4S2M A;  3PAG A;  4UQI S;  1E25 A;  5CED A;  4HP4 A;  4YWZ A;  2O99 A;  1S4S A;  4BD0 A;  1NZU A;  3ISG A;  2H10 A;  5F69 A;  1OTD A;  5C5K A;  1CI9 A;  2VKS A;  4LV0 A;  4PKY G;  3ITA A;  3LUQ A;  1G5U A;  1K6R A;  3BFC A;  2QYB A;  3DBA A;  1EWZ A;  5L8M A;  3F1N A;  5DFX A;  2JKF A;  4F94 A;  2P7J A;  4EUZ A;  3Q07 A;  5GLC A;  5FAT A;  3G4P A;  1UWN X;  3WRT A;  1EI5 A;  2JHE A;  4KQD A;  5A92 A;  1T19 A;  4KZ7 A;  2H28 A;  3CI6 A;  4P87 A;  3P98 A;  1MXO A;  1AXB A;  3NUL A;  1L2S A;  5J3W A;  1XGJ A;  1HLU P;  4Q0H A;  1S0W A;  2J9P A;  1H5X A;  1HVB A;  3PYP A;  3CPT A;  1MWT A;  4Y3I A;  4KG2 A;  2PDR A;  4ESP A;  1G68 A;  4UA7 A;  4GJ4 A;  1CI8 A;  3ZHH A;  3PBS A;  1WA9 A;  2VV7 A;  5CEB A;  1IYP A;  1DP8 A;  1S67 L;  3PR6 A;  1L0D A;  1IYQ A;  2VK3 A;  3KSI A;  4OKP A;  5EOO A;  5DVA A;  5FQI A;  2KX6 A;  3TRC A;  3R7W B;  1I5Q A;  5HL6 A;  3UO9 A;  4FUW A;  1E3U D;  5M1A A;  2OWJ A;  3ULF A;  1LHY A;  4R70 A;  4P0M A;  4KZB A;  4GDB A;  2W1R A;  1YLJ A;  3CZD A;  5M19 A;  2PBD P;  1MY8 A;  3LYX A;  5HL1 A;  1UGU A;  4WBG A;  5CXW A;  4JXV A;  5EM0 A;  3LEQ A;  3ZNY A;  1F9I A;  3ZNT A;  1P9W A;  3OC2 A;  2Y2J A;  4S2O A;  3BFD A;  1K56 A;  4GS9 B;  3T4J A;  2OAQ 1;  5GHX A;  5FI7 A;  4JGP A;  4WEL A;  1ZKJ A;  3FG8 A;  5BOH A;  4QB8 A;  1N9L A;  5LBR A;  2OLV A;  3UE1 A;  2WKI A;  4HJ6 A;  4PM8 A;  2HP9 A;  3ITB A;  4R6L A;  4FCF A;  4Y5F A;  1RGZ A;  1L0G A;  1E4D A;  4MBH A;  1KGE A;  1NLY A;  3T4Q A;  2H0T A;  4HNB A;  5AQA A;  4F3L A;  2ACG A;  1BLS A;  4L0L A;  1ALQ A;  2K7S A;  2L1M A;  3FV7 A;  3LIA A;  2V1Z A;  2OWH A;  5U47 A;  3Q7Z A;  2WZZ A;  4WL9 A;  1FQG A;  5HAQ A;  2J3T D;  3CPT B;  3JVV A;  4EV4 A;  5DJT A;  2ZQC A;  5FEG A;  2CC1 A;  3LGO A;  1KE3 A;  2ZC6 B;  4DMZ A;  2EXA A;  2X02 A;  1YSP A;  3A3I A;  3T12 B;  1SDN A;  4CJN A;  1DP6 A;  1G6O A;  3WWX A;  4NXG A;  5I94 A;  3C2W A;  5EFW A;  2J3T C;  2OSU A;  3BW6 A;  1XXM A;  3LI8 A;  5TGF A;  2QMI A;  4KZ5 A;  3L9K A;  3BRM A;  3NOU C;  4X6T A;  3ZVT A;  3HVF A;  4KG5 A;  2Q9N A;  1DY6 A;  2ZL1 B;  3BQA A;  4E6X A;  2WZX A;  1KOU A;  1VM1 A;  4DF6 A;  1K25 A;  3IX3 A;  1GHP A;  4XT2 A;  3EGX C;  5CGX A;  4Q8I A;  4E3L A;  3T50 A;  3QNC A;  3ZFZ A;  4N92 A;  2ZQ9 A;  4KQR A;  1IOU A;  3N6I A;  3HUO A;  3OPL A;  2Y79 A;  1CEF A;  3A3E A;  4S2I A;  2P74 A;  3SS3 A;  1PZP A;  3HLW A;  3G35 A;  2D01 A;  4WEJ A;  1LI9 A;  2X71 A;  4E04 A;  1J3W A;  1H8Z A;  3MKE A;  2JKG A;  5FDH A;  5EOE A;  4K0W A;  1TDG A;  3IXD A;  1PWC A;  2XD5 A;  4KZ6 A;  3HLE A;  3LI9 A;  3JYI A;  1F2K A;  3ICY A;  4G3K A;  4P6Z S;  1MC0 A;  1BUE A;  1IEM A;  3MSH A;  4OQ0 A;  5EE8 A;  3TE8 A;  2W1T B;  5F1F A;  3KYE A;  5G18 A;  2BAS A;  5FAP A;  1YPR A;  3NOP C;  3EEH A;  2P9V B;  1MWU A;  2EA9 A;  5EPH A;  5HWT A;  2NUT C;  3NIA A;  5AQB A;  1CEG A;  4OP8 A;  5HD3 A;  4R3B A;  1H3Q A;  2ZD8 A;  5HD5 A;  5CHJ A;  3S22 A;  3VFH A;  3ZYT A;  1PWD A;  4DJ2 A;  4B93 A;  2KOI A;  2V2F F;  2Z2M B;  5KSH A;  3M2K A;  3R4K A;  3E4Q A;  3SOI A;  4MBK A;  2OLU A;  2H5S A;  2Y2Q A;  3QP4 A;  2Y55 A;  2PHY A;  1OJG A;  1D7E A;  3Q81 A;  1TDL A;  1ZC2 A;  3UE6 A;  4G3W A;  4GZB A;  4M4X A;  2ZC3 B;  3QP1 A;  1O07 A;  1ZG6 A;  4FH4 A;  2PD8 A;  2UV0 E;  3LFV A;  4GN2 A;  3IXG A;  2JKR I;  3SS5 A;  3RFB A;  1W63 M;  4MNR A;  2GDN A;  4WN5 A;  2ZM2 A;  3O87 A;  3WS0 A;  3IF6 B;  3KX0 X;  2D02 A;  1FIK A;  1BT5 A;  4WZ4 A;  2VA0 A;  2XSS A;  4GNU A;  4R4R A;  3IWO A;  1FIL A;  1LLB A;  5GL9 A;  2HDS A;  3IF6 C;  1V9Y A;  4NET A;  4CLC B;  1ODV A;  2VGK A;  1P97 A;  4LRZ E;  4LCL A;  3S7O A;  2ZM0 A;  1GHM A;  5EV0 A;  4RA7 A;  4X55 A;  3VSK A;  4QHC A;  1JNU A;  2VX8 A;  1N9B A;  4Q0I A;  5F5Y A;  4EUV A;  4NXF A;  5JYO A;  2VV6 A;  1VHM A;  4LPZ A;  4R3J A;  2Y8H A;  5EVE A;  5G4Z A;  3CLO A;  2OV5 A;  4QJG A;  1S6R A;  5FL3 A;  3SW1 A;  3RXW A;  1KVM A;  2O9C A;  5FQK A;  5DTT A;  4DXC A;  4KQQ A;  4WUJ A;  2FFY A;  3V39 A;  3QP6 A;  3U4L P;  1XFN A;  3MF0 A;  3RXX A;  2RCX A;  4JKT A;  3CMZ A;  4BD1 A;  2VGJ A;  5KZH A;  4KQO A;  4LRX C;  3MQQ A;  3WRZ A;  2NUP C;  5FAS A;  4OPZ A;  2OAP 1;  2XK1 A;  3Q7V A;  1Z6F A;  4E3O A;  3C8C A;  2B5R A;  2A2L A;  1U60 A;  1C3B A;  1PZO A;  3G2Y A;  1VET A;  4HQA A;  2FZ0 A;  4CLC D;  2Y2G A;  4L9E A;  2Y2I A;  4XXR A;  3C4O A;  4KZ9 A;  3C5A A;  1ONH A;  1F5M A;  1NY0 A;  2ZLY A;  2XD1 A;  4WMC A;  3BY9 A;  1YSQ A;  4KZ4 A;  1XJ4 A;  3UDF A;  3M2J A;  3LIF A;  3PBN A;  5HAP A;  1XGI A;  2Y2K A;  2K31 A;  4BMW A;  3A3F A;  2EX2 A;  3G34 A;  3IF5 A;  1XP4 A;  1LL8 A;  2EWW A;  2WUQ A;  5TBM A;  3CUE A;  1Y4O A;  5AQ9 A;  1W8Q A;  1K6S A;  3G31 A;  1PW1 A;  2WAF A;  2W27 A;  1PFL A;  3ZG9 B;  4DRT A;  3BYD A;  2ZQ8 A;  1PI4 A;  4I39 A;  5F1G A;  4O0P A;  5HDC A;  4O01 A;  1Q2P A;  4OPQ A;  3PTE A;  3F1P B;  5HSQ A;  3EEA A;  2HF6 A;  4FTX A;  1E3U A;  3WS4 A;  1WE4 A;  1O7E A;  5GLA A;  3UE0 A;  4JXW A;  4HJ4 A;  3UB5 P;  4EES A;  1L0F A;  5IS1 A;  5CTN A;  1ES2 A;  1ES3 A;  2Y2M A;  2V1B A;  1DJC A;  4GW9 A;  4HP9 A;  3K3D A;  5HX9 A;  5CEC A;  3OPP A;  1NZO A;  3DWK A;  3GRJ A;  1SKF A;  3V50 A;  1EW0 A;  1T18 A;  1XA7 A;  1AWI A;  2HDR A;  2I9V A;  3B3X A;  3HJI A;  3D9Y A;  1HD8 A;  3V3S A;  4M3K A;  4X1L A;  4UHU A;  2K2N A;  4BBV A;  3E2L A;  3SS4 A;  2WK0 A;  3A0V A;  1TS7 A;  1TEM A;  2W0N A;  3GEC A;  3UY6 A;  3T1R A;  1OJ5 A;  1PYY A;  3S7P A;  4X1M A;  4FSF A;  4BBT A;  2XR0 A;  1QMF A;  4X68 A;  1NLZ A;  2V9A A;  3MJQ A;  4D60 A;  5HPF A;  1MWR A;  3LR5 A;  4MN6 A;  3NCK A;  3HLB A;  3IBR A;  2JBF A;  4PPR A;  2W3D A;  1GA9 A;  3E0Y A;  5IHV A;  4GCZ A;  1ESI A;  3O5Y A;  3M6B A;  1HTZ A;  4HBT A;  1FSY A;  1FCN A;  2DRW A;  1FCO A;  4OVD A;  1WYC A;  1YQS A;  3EWK A;  3P09 A;  3MMH A;  5FA7 A;  4BWI A;  3UDX A;  4BQM A;  1JWV A;  5DJU A;  2A24 A;  4AFI A;  1MBL A;  1CJF A;  3F1O B;  3DTI A;  3NC8 A;  1X0O A;  3HJK A;  3UPP A;  4WM9 A;  1P0Z A;  4K0X A;  3NHQ A;  5GHZ A;  4G3V A;  4N9K A;  2G2W A;  5FAO A;  3NEC A;  2XRN A;  5A93 A;  5A91 A;  1Z09 A;  1ZHH B;  4UA6 A;  3DTM A;  4KEN B;  1PNE A;  4UQI M;  3HUM A;  5CHU A;  3UB8 A;  3SH7 A;  2E8J A;  1JTD A;  4IUH A;  2W3H A;  3OBF A;  4IBR A;  1OT6 A;  3E4O A;  4NK3 A;  2J7V A;  4I3I A;  3UMD A;  5HWW A;  4ID4 A;  1YLP A;  3KSH A;  4UAA A;  1BZA A;  2ZMA A;  1P9R A;  4B88 A;  4CPK A;  4H8R A;  1FR1 A;  1F98 A;  1GSX A;  2MJ6 A;  2VEA A;  4F3L B;  1JVJ A;  1H8M A;  3Q1F A;  3PBR A;  3T1X A;  3LR4 A;  3C4P A;  1IKG A;  1ES4 A;  2X01 A;  1W7F A;  1BLP A;  1YLZ A;  3BLS A;  3TSG A;  4QY5 A;  3LEZ A;  4E3K A;  5AJG A;  2PYR A;  4C75 A;  1Y28 A;  4I5S A;  1H0M A;  1TF1 A;  3R7W A;  4D2O A;  3VE4 A;  1KGF A;  1S4R A;  2R9W A;  3JPU A;  4A5R A;  5M18 A;  2HJ9 C;  2Q9M A;  4ZBE A;  3IWQ A;  4XUX A;  3KSF A;  4L9F A;  5HW3 A;  4E3I A;  1FR6 A;  3MFX A;  1ZG4 A;  1STZ A;  2AVX A;  4Z1W A;  4R4S A;  3FWL A;  5HAI A;  5GLD A;  2WKQ A;  3T4S A;  4E3J A;  2ZL1 A;  4JGO A;  2ZMF A;  5FAQ A;  2PD7 A;  4MMN A;  4HOI A;  4I3A A;  3F1O A;  1YLT A;  4MCW A;  1XJ6 A;  2J3W A;  1D1J A;  2XGN A;  3VOL A;  4DE1 A;  3UE3 A;  4FOF A;  2YKH A;  2PRF A;  4LV3 A;  2W3G A;  5KMW A;  4YNR A;  3IXH A;  1K4F A;  4JBF A;  4HHD A;  3BWL A;  4II7 A;  4S2K A;  5DTK A;  1NYY A;  3C7U A;  4RX2 A;  2XH9 A;  4JF4 A;  2M1C A;  1IEL A;  3S7N A;  5J8X A;  3T4T A;  1N4O A;  2CMN A;  1QME A;  4OLG A;  3HLG A;  3RTY A;  3LO7 A;  4S2N A;  2WAE A;  4S2L A;  3NJA A;  1ZTU A;  2JC7 A;  2YKF A;  2O0Y A;  3N4I A;  4S2P A;  2BLS A;  4Y15 A;  4Y0T A;  3BFG A;  4ETZ A;  4DE3 A;  2J80 A;  2IA2 A;  5DKK A;  3T1Q B;  1GA0 A;  2QWS A;  5HAR A;  4XUZ A;  3PAE A;  4R38 A;  3PBO A;  4S2N C;  1FCM A;  4OPR A;  5FQQ A;  4P6B A;  1KVL A;  4HES A;  4HI4 A;  5TFQ A;  1W79 A;  3W4Q A;  3UPN A;  4OON A;  1DRM A;  2FH5 A;  2INW A;  3G30 A;  2JKT M;  2JCH A;  5EM1 A;  1YAX A;  3NI9 A;  4PAU A;  2C5W B;  4UA9 A;  1LT0 A;  4QPR A;  3GR2 A;  4DN0 A;  1XKZ A;  4PMA A;  2VV8 A;  4LCM A;  3FYZ A;  1K38 A;  2ZC5 B;  4EBN A;  1OTE A;  3HLD A;  4H6J A;  4GB7 A;  3LIC A;  3VV4 A;  1FOF A;  3V5M A;  4HBU A;  4JXG A;  1KE4 A;  2HJE A;  1BLH A;  4KZA A;  4O7D A;  4OLD A;  4N1H A;  4DDY A;  1PI5 A;  2WKE A;  3HUN A;  4P85 A;  5L2F A;  2ZOI A;  2B95 A;  4EBP A;  3F1P A;  3LY4 A;  2Y59 A;  3MZD A;  4LGW A;  3VMA A;  3O88 A;  2P9V A;  3EQU A;  4B4X A;  3FKV A;  3NDE A;  3ZDJ A;  3A0R A;  4B4Z A;  3NOT C;  3MR0 A;  3QP2 A;  1H8Y A;  4ZJ1 A;  1LSX A;  1OTI A;  5J4E A;  2Y2O A;  1K54 A;  3FPV A;  4JLF A;  5EVI A;  5EEC A;  3IBJ A;  3ZCZ A;  1YT4 A;  1SKO B;  3BFE A;  4RYE A;  3G6O A;  1SKO A;  5EVI D;  4I3J A;  1M6K A;  4GKU A;  4JGQ A;  4DE2 A;  2BG1 A;  1SCW A;  1ERM A;  5GHY A;  2LB9 A;  1T1C A;  3DTK A;  4OOL A;  4GHI B;  3LID A;  2Y2P A;  2JN7 A;  3GVB A;  2XFT A;  5DF8 A;  4OOY A;  1ONG A;  1UWP X;  4BLM A;  2HP6 A;  2Z6C A;  5IT5 A;  3VOZ A;  5FQJ A;  5A90 A;  2ZJ9 A;  4FH2 A;  3E98 A;  3LIE A;  3BEC A;  1CQA A;  2XQZ A;  4OQG A;  2DMW A;  1NYM A;  2A24 B;  3SH9 A;  3LR3 A;  1D06 A;  1BSG A;  2O9A A;  2WAD A;  1PW8 A;  2GJ3 A;  5CER A;  5E2H A;  2VGL M;  4R23 A;  1OME A;  3VP4 A;  3N8S A;  4IHQ A;  3F1N B;  3B33 A;  4PM9 A;  2XDM A;  2EX6 A;  4HJ3 A;  1Q2Q A;  1S1Y A;  5FQM A;  2A49 A;  1S1Z A;  3O3V A;  3IQA A;  2VJW A;  3ZG5 A;  2JE5 A;  3QP5 A;  4OP5 A;  1LL9 A;  3T1S A;  2Y2N A;  2JKR M;  4U0X A;  2QZ6 A;  4HEF A;  4WYY A;  3MZE A;  2B02 A;  4N9L A;  1XA1 A;  5AVE A;  2PR5 A;  2R9X A;  1YM1 A;  2HP5 A;  2E8I A;  2XFS A;  1SZV A;  3PHY A;  1I2W A;  4MEZ A;  1TVF A;  4ZRR A;  4Y7P A;  3V67 A;  3MZF A;  4UEY A;  3K2N A;  3N7W A;  2WKP A;  4IED A;  3RJU A;  5HWV A;  4EW7 A;  1K55 A;  3D3O A;  2FFF B;  3GSG A;  2ZQD A;  4X69 A;  4EEP A;  3H82 A;  3RH8 B;  2ZMV A;  3C38 A;  1LSW A;  3OCN A;  4EET B;  3IT9 A;  1NJ4 A;  3UN7 A;  3C7V A;  5KSC A;  4ARZ A;  3LCE A;  4RVA A;  5CHM A;  5D3O A;  1OT9 A;  5TJJ A;  4HH2 A;  4WZ5 A;  3AGD A;  5CGW A;  3PXP A;  4R0Q A;  4MBF A;  1LL5 A;  4KZ8 A;  2M7U A;  2V8F A;  2ZM8 A; 
#chains in the Genus database with same CATH homology
 4E04 A;  1OT6 A;  1N9N A;  3E4O A;  3CWF A;  4I3I A;  4ARZ B;  3UMD A;  5HWW A;  5J7E A;  3T4O A;  2VZW A;  3KSH A;  4CLC E;  2L0W A;  1P9R A;  5I5L A;  3LI9 A;  2B18 A;  3ICY A;  4G3K A;  1F98 A;  1GSX A;  2MJ6 A;  1MC0 A;  2VEA A;  4P6Z S;  3UB6 A;  4F3L B;  1N9O A;  1H8M A;  4XT2 B;  3PBR A;  5TBM B;  2JKT I;  2GX5 A;  3LR4 A;  1IFQ A;  4PHT A;  3TE8 A;  5K5B A;  4CLC A;  2W1T B;  2BAS A;  4NXE A;  5DKL A;  3NOP C;  3EEH A;  3IS2 B;  1G28 A;  2EA9 A;  5HWT A;  2NUT C;  2HV1 A;  2V1A A;  4EXO A;  4ME4 A;  5HD3 A;  5AJG A;  1GSW A;  2PYR A;  4WLA A;  1Y28 A;  1H3Q A;  4I5S A;  1TF1 A;  3R7W A;  3BJN A;  5HD5 A;  3VE4 A;  4LLO B;  3ZYT A;  1XJ3 A;  1S4R A;  4DJ2 A;  4OOM A;  2HJ9 C;  4B93 A;  3LIB A;  4BJP A;  4WEK A;  2KOI A;  3UME A;  1LSV A;  5KSH A;  3JVU A;  3KSF A;  3R4K A;  3E4Q A;  4L9F A;  2ZOH A;  2W3E A;  1TS6 A;  3MFX A;  3CUE C;  2PHY A;  1STZ A;  1OJG A;  3KSG A;  5AVF A;  5DFY A;  4Z1W A;  1D7E A;  3OLO A;  4KUO A;  4I38 A;  1OTB A;  2LB5 A;  3UE6 A;  4G3W A;  2M7V A;  2QHK A;  2WKQ A;  3T4S A;  3B42 A;  4M4X A;  2XRO A;  1MZU A;  4JGO A;  2HGV A;  2ZMF A;  4EER A;  2PD7 A;  4MMN A;  2PD8 A;  4HOI A;  3LFV A;  2QJ7 A;  4B9O A;  4I3A A;  3F1O A;  2JKR I;  3RFB A;  1W63 M;  2OOL A;  4MCW A;  4WN5 A;  1XJ6 A;  2J3W A;  5F6A A;  3LR0 A;  3T4K A;  3EOI A;  3VOL A;  1BYW A;  5CX7 A;  3KX0 X;  2D02 A;  4CQH A;  3UE3 A;  3P01 A;  4FOF A;  2YKH A;  2V0U A;  2W3G A;  3OOV A;  2VA0 A;  2XSS A;  4YNR A;  3H82 B;  2KLI A;  3H7W B;  4NXB A;  3MQ0 A;  4HHD A;  1TS8 A;  3BWL A;  4II7 A;  3HCY A;  4RQ9 A;  4DJ3 A;  1V9Y A;  3H9W A;  4CLC B;  1TD5 A;  1ODV A;  3MXQ A;  3CAX A;  3CIT A;  2M1C A;  1XFQ A;  2Z6D A;  3H7W A;  3S7N A;  3T4T A;  1P97 A;  2CMN A;  4UQI S;  4LRZ E;  4MN5 A;  4Y2F A;  3S7O A;  4HP4 A;  4YWZ A;  3RTY A;  2QKP A;  1OPX A;  2O99 A;  4K08 A;  1JNU A;  3E4P A;  4MN7 A;  1S4S A;  2VX8 A;  4CLC C;  4Q0I A;  5F5Y A;  4EUV A;  4NXF A;  3NJA A;  1ZTU A;  5F69 A;  2VV6 A;  1VHM A;  2YKF A;  4LPZ A;  1OTD A;  2O0Y A;  2Y8H A;  5G4Z A;  2XA7 M;  5C5K A;  3CLO A;  2VKS A;  5FL3 A;  4HH3 A;  4PKY G;  3LUQ A;  3SW1 A;  2O9C A;  4ETZ A;  2VLG A;  2QYB A;  3DBA A;  4IUK A;  2J80 A;  4WUJ A;  5L8M A;  3F1N A;  2IA2 A;  5DFX A;  5DKK A;  2P7J A;  2QWS A;  3PBQ A;  4R38 A;  3PBO A;  1XFN A;  2L4R A;  3EQV A;  3MF0 A;  3S7Q A;  4O8G A;  1T1A A;  1UWN X;  4GS9 A;  4HI4 A;  2JHE A;  4KQD A;  5G4Y A;  1T19 A;  4KQO A;  2H28 A;  4LRX C;  3MQQ A;  3CI6 A;  2P04 A;  2NUP C;  4KUK A;  1DRM A;  1DP9 A;  2FH5 A;  2INW A;  2OAP 1;  2JKT M;  4Q0J A;  2V0W A;  1NRJ A;  5J3W A;  2WKR A;  1YAX A;  4PAU A;  4Q0H A;  3U2A A;  2G7U A;  1LT0 A;  3C8C A;  4QPR A;  4DN0 A;  2A2L A;  2KDK A;  3PYP A;  3PBT A;  2VV8 A;  3UB7 A;  4HQA A;  2QJ5 A;  4Y3I A;  3K3C A;  2FZ0 A;  4CLC D;  2VGL S;  1OTE A;  2PDR A;  4L9E A;  4GJ4 A;  3PBS A;  4BBU A;  1F5M A;  1WA9 A;  2GNX A;  2VV7 A;  4H6J A;  3BY9 A;  3LIC A;  1DP8 A;  3VV4 A;  1YSQ A;  1S67 L;  3PR6 A;  1XJ4 A;  4P6Z M;  3C30 A;  3EGD C;  3KSI A;  3FC7 A;  3LIF A;  2HJE A;  4NEE D;  3PBN A;  4GLQ A;  2K31 A;  2KX6 A;  4BMW A;  3TRC A;  2ZOI A;  3R7W B;  1LL8 A;  2EWW A;  3F1P A;  5HL6 A;  5TBM A;  3W2Z A;  3CUE A;  4EU0 A;  5HDD A;  3EQU A;  2W27 A;  5IU1 A;  3A0R A;  2OWJ A;  4I39 A;  3NOT C;  5HZH A;  3MR0 A;  4O0P A;  3ULF A;  5HDC A;  4O01 A;  3F1P B;  4LRY C;  4R70 A;  5HSQ A;  3EEA A;  1LSX A;  1OTI A;  2HF6 A;  3TJZ C;  5J4E A;  2W1R A;  3MQO A;  3FPV A;  3LYX A;  1UGU A;  2W3F A;  4HJ4 A;  4EES A;  5IS1 A;  3IBJ A;  5F68 A;  4YOF A;  1XJ2 A;  1VB6 A;  3UB9 A;  1F9I A;  1P9W A;  1T1B A;  2V1B A;  4GW9 A;  3G6O A;  3OC2 A;  4HP9 A;  3K3D A;  4GHI A;  4I3J A;  3P7N A;  2PYP A;  4JGQ A;  4GS9 B;  3T4J A;  1EW0 A;  2OAQ 1;  1T18 A;  1GSV A;  3VE3 A;  4IJG A;  4JGP A;  4WF0 A;  5MC7 A;  4JGR A;  4WEL A;  2R78 A;  2I9V A;  1T1C A;  2LB9 A;  3FG8 A;  4OOL A;  3HJI A;  4GHI B;  3LID A;  1N9L A;  5LBR A;  2JN7 A;  1V9Z A;  5HPI A;  1OTA A;  2K2N A;  3IS2 A;  4HJ6 A;  1W63 Q;  3ZQ5 A;  4BBV A;  3A0V A;  1TS7 A;  2W0N A;  1UWP X;  5IT5 A;  2Z6C A;  3D72 A;  3GEC A;  4R6L A;  4H6J B;  2XA7 S;  4Y5F A;  1OJ5 A;  3S7P A;  4FSF A;  4BBT A;  2PT7 A;  3E98 A;  1NLZ A;  3LIE A;  3A0S A;  3MJQ A;  2V9A A;  1NLY A;  5HPF A;  3T4Q A;  2DMW A;  3LR5 A;  2A24 B;  4HNB A;  4MN6 A;  4F3L A;  3LR3 A;  1YKD A;  3IBR A;  3FPW A;  4L0L A;  1D06 A;  2K7S A;  2L1M A;  3LIA A;  2O9A A;  2W3D A;  2OWH A;  2GJ3 A;  2VGL M;  4PKY A;  4IHQ A;  3E0Y A;  3F1N B;  3B33 A;  2PR6 A;  4GCZ A;  4WL9 A;  4HJ3 A;  1S1Y A;  2GZA A;  2O9B A;  1S1Z A;  2VJW A;  3O5Y A;  1TS0 A;  4EQ1 A;  2J3T D;  5HDS A;  3JVV A;  4NKP A;  5DJT A;  3BQ8 A;  2JKR M;  3KO6 A;  3EWK A;  2B02 A;  4DMZ A;  4HIA A;  5AVE A;  2PR5 A;  1YSP A;  2P08 A;  3MMH A;  4BWI A;  1DP6 A;  1G6O A;  4NXG A;  5DJU A;  2A24 A;  3C2W A;  4AFI A;  5EFW A;  4HY8 A;  2J3T C;  3PHY A;  1MKM A;  3BW6 A;  3LI8 A;  4R3A A;  4ZRR A;  4EEU A;  3F1O B;  3V67 A;  1NWZ A;  4UEY A;  3NOU C;  1X0O A;  2ZBB A;  3K2N A;  2WKP A;  4MDZ A;  3HJK A;  2W1T A;  3BQA A;  5HWV A;  4EW7 A;  1P0Z A;  1KOU A;  3D3O A;  5A8B A;  3NHQ A;  4EEP A;  4G3V A;  3T4L A;  3H82 A;  3RH8 B;  3GDI A;  2ZMV A;  4XT2 A;  3C38 A;  1LSW A;  3EGX C;  3OCN A;  3B47 A;  2XRN A;  4EET B;  3T50 A;  1ZHH B;  3TW8 A;  5KIZ A;  4ARZ A;  3BY8 A;  3KYZ A;  4L9G A;  1OT9 A;  5TJJ A;  4HH2 A;  1IOU A;  4UQI M;  1S66 L;  2Y79 A;  3UB8 A;  3PXP A;  4ETX A;  4IUH A;  5DF9 A;  2W3H A;  3KYQ A;  3OBF A;  3OCL A;  2EWV A;  2D01 A;  2M7U A;  4WEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...