2QYTA

Crystal structure of 2-dehydropantoate 2-reductase from porphyromonas gingivalis w83
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
307
structure length
287
Chain Sequence
b'QPIKIAVFGLGGVGGYYGAMLALRAAATDGLLEVSWIARGAHLEAIRAAGGLRVVTPSRDFLARPTCVTDNPAEVGTVDYILFCTKDYDMERGVAEIRPMIGQNTKILPLLNGADIAERMRTYLPDTVVWKGCVYISARKSAPGLITLEADRELFYFGSGLPEQTDDEVRLAELLTAAGIRAYNPTDIDWYIMKKFMMISVTATATAYFDKPIGSILTEHEPELLSLLEEVAELFRAKYGQVPDDVVQQLLDKQRKMETLTGYVVREAEALRVDLPMYKRMYRELVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydropantoate 2-reductase
molecule tags Oxidoreductase
source organism Porphyromonas gingivalis
publication title The crystal structure of 2-dehydropantoate 2-reductase from Porphyromonas gingivalis W83.
rcsb
total genus 87
structure length 287
sequence length 307
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2qytA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qytA01
1TT7A 3JQBC 5TC4A 1X15A 1N92A 4C4OA 4R1SA 3GF4A 4XGNA 5T6BA 5CEFA 1ISIA 2DBQA 3H4VA 2D4AA 1T1RA 4RF3A 4GX5A 1TT5B 4BV8A 1N9GB 2WE7A 3PYMA 4LMRA 3FNEA 1OMOA 2IZ1A 2YQ4A 2EHDA 3JQGB 4FCCA 2QX7A 4F6LA 5EQFA 3C7CB 3GH3A 1UAYA 2R6JA 1DFHA 3HDJA 1YH3A 3O9ZA 2YW9A 3CTMA 4MKRA 3L77A 4DUPA 1HETA 3IKVA 4GGPA 5BSEA 5L45A 3JQ8B 5IN5A 1YBVA 4MDHA 1LTHR 3UKOA 3TOZA 1IPFA 4BMNA 2Q1UA 2ZTLA 3C1OA 4IQGA 2NV6A 4KMSA 2FZEA 4WCFB 4NNJA 3OSUA 1GZ6A 1KEPA 2B4QA 2F1KA 2OFPA 3DBHA 2G76A 3RJ9A 4L74A 1GPJA 3PTZA 4YAIA 5I7VA 4XKJA 4H7PA 3BMQB 2POQX 1HE4A 2EF1A 1DRWA 3VPXA 1P0CA 2EW8A 1Q0HA 2X5KO 2JFGA 2QHXA 3ICCA 3I5MA 4XYBA 3JD3A 4IDFA 4QQRA 3D1LA 3ONFA 2UUOA 3FBGA 3IAHA 4MOWA 4CR8A 1AXEA 3AUAA 3IP1A 3RC1A 2OMEA 2QIOA 1KETA 2VYVA 5K0ZA 2GN6A 1E7MA 3QVOA 4AJJA 4OL9A 5HTOA 2I5PO 4O0LA 4XEHA 2F00A 2HJRA 2CVZA 3NDJA 4YR9A 1YXMA 2Q1WA 1GV1A 2CDBA 1GZ3A 4GX2A 1LUAA 4W9NC 4PRLA 1JVSA 1ZK3A 1LI4A 4ZICA 4IGEA 5I9NA 3ZZNA 1H6AA 3F1LA 4K6FA 4O63O 5TJ9A 4R68A 3FPLA 3RASA 4GAEA 3UF0A 4BKPA 1MC4A 1KS9A 3GHYA 1C1XA 5KNLA 3PJGA 1NAIA 1H93A 5F5NA 5AOVA 1N7GA 1QG6A 2WYUA 2RHRA 3ZGYA 1SZJG 4DIOA 4U6QA 4ZQGA 4AJOA 4ALIA 4WEOA 2CSUA 4HFMA 3DO5A 5I9MA 5F5LA 1VSVA 5IXYA 4CV3A 4G5HA 1PS0A 3W4IA 4I5GA 1JVBA 1ZW1A 5HWSA 3RIHA 2RBEA 2NWQA 3WIEA 2O4CA 3OA2A 3GUCA 3LC2O 3V2HA 4DXHA 3DZGA 4XYGA 4CL3A 5JDIA 4CODB 1GEEA 7ADHA 4BO1A 3HNPA 3M1AA 4YPOA 4XGKA 1VC2A 3ZWBA 2VYNA 4FFOA 4CQMD 1V6AA 1Y81A 2HMSA 2JD2A 2DBVO 4CL8A 2QYTA 1DFIA 4F3YA 1IHXA 1DPGA 1NP3A 4U5QA 3RUIA 1PJBA 4CMBA 3OJEA 1LA2A 2P68A 1ZVMA 2D2IA 3A06A 3OIDA 4PG5A 1PWXA 1WZEA 3LF1A 1P1KA 3K30A 4IZIA 2Q1SA 1BSVA 5TJHA 5G0UA 3RROA 5CPFA 4ND1A 2GERA 3IP3A 5L95A 4JCOA 3WSWA 4J1TA 5KJFA 2TMDA 3GZ4A 3HSKA 3CEAA 3JQ7A 2CZCA 2X6TA 3TQHA 4FSHA 3DTTA 1OAAA 2CMDA 1HYHA 3GVPA 4OKNA 1C3VA 1HXHA 2QZZA 1Q1NA 4UVEA 4XIYA 1JLLA 4WOJA 2QG4A 3W4KA 3TFQA 4WK6A 1U7TA 2EEZA 2HK9A 3MOIA 2AXQA 4JNKA 4IJVA 3WMXA 1A7AA 2NM0A 4ONEA 3A1NA 4TZKA 4IQ0A 3DEYX 3G3EA 1H94A 2UUPA 3WWYA 2Y1EA 3NTRA 3ZU3A 3WSVA 2Q50A 3NJ8A 4RZHA 1PTJA 5COQA 2NADA 1IL0A 1PL6A 2B5WA 3RBZA 1SMKA 1Q7GA 3TSCA 1PZFA 3U4IA 3ZW9A 4NI5A 1ZSVA 4GKBA 3S2GA 4H16A 1K0UA 2I3AA 4WE3A 4RQUA 3O26A 1H9AA 4WLNA 4E33A 1LQTA 3MJCA 3WJ7A 3WYBA 1QSGA 1R0KA 3IC5A 2IYPA 3ETDA 4II2A 5BQFA 2X0IA 4UVDA 5JO0A 1NBOA 1ENZA 4MVJM 3ZHYA 2NUAA 3H9JA 1LSOA 2TMGA 2VRCD 5K6AA 4U7WA 4EJ6A 5AXAA 1GFSA 3PHJA 2BLLA 2R00A 1YVEI 3K2BA 4ALKA 3AM4A 5I7FA 1XGKA 4ZD6A 1F17A 3ZNOA 1NQAO 2P4HX 4DLLA 1JN0A 4BO0A 2O23A 3DFUA 4PG7A 4HBGA 4HFNA 2BHLA 4D42A 3B1FA 3HQ4O 4CMEC 5CDUA 2YFHA 1A4IA 3VH4A 5DBIA 4Z6KA 2VHXA 3V2GA 1U7HA 1GQYA 4ZQHA 4P38A 3GN2A 4W7HA 4HADA 1R4MB 2R00C 2ZTMA 4IDBA 3H9UA 4TZTA 3QLJA 4MJLA 2FPIA 3ZWMA 4YXFA 4FB5A 1TA4A 2X9VA 4IPTA 4ZN6A 3WMWA 3GNQA 1V0JA 3NX4A 3LSYA 1XYGA 1TLTA 3GVCA 5DCUA 2AEMA 4Y9DA 3V1YA 3GZNA 3MWDB 4QO8A 3WJAA 4Z3DA 1Z45A 4CR6A 5JS6A 4YDRA 3T7EA 2X5OA 2I9PA 2WJPA 1M2WA 1O95A 1P31A 1T2EA 3NDRA 4IBOA 2BGKA 4A73A 4BNGA 3U09A 4HFJA 4NBTA 1F06A 1LEHA 4QTZA 5H83A 4BMSA 1BTOA 4R9SA 4DL9A 4RLHA 1V35A 4RLSA 4J3FA 1NVTA 4OH1A 3ZHXA 1JTVA 5DBFA 3RAJA 1NFFA 4H3VA 1T1SA 5K9ZA 3BHJA 3C8MA 4P22A 1PU2A 3ZHZA 3CH6A 3KUXA 5B4UA 1JKFA 2EKLA 2V6MA 3KEQA 4RZIA 4JLWA 1UXJA 1E6EA 1P1RA 3GHHA 3L0DA 3KYCB 4OXNA 5DDIP 4AJNA 4WLVA 1R15A 3ST7A 1HL3A 3K5PA 3I9LA 4M8SA 1HRDA 4EITA 1EVYA 1N8KA 2YV1A 3BXXA 4KDEA 4UAGA 4URFA 4CLEA 2Q49A 4D0RA 4B7XA 1EZ4A 4A5OA 1SB9A 4Z0TA 2VZ9A 1I3KA 3GR6A 4OOEA 2QYSA 1XSEA 3DQPA 4E2WA 4D41A 1IHYA 3UH1A 4YCAA 1VI2A 3L4BC 5U1PA 4NFHA 4IJUA 5JDIC 5FFFA 2ZQZA 3RU9A 1H2HA 4K1LA 1FDTA 5HS4A 4KQXA 1DC5A 1E5QA 1O94A 4XA8A 4CM3A 4DPMA 3PGXA 1TXGA 1VJ1A 3GEDA 1EQ2A 4RDHA 3RFXA 2C5EA 4WJZA 2NU8A 3H2ZA 1X0XA 1VM6A 2Q2WA 4DLAA 4R41A 4PLTA 1ULUA 4UVIA 3D5TA 3CIFA 2H9IA 1E7SA 1GEGA 1NASA 4YB8A 1O5IA 3QJ5A 5H82A 1GQ2A 4N7RA 3Q2KA 4RVSA 3KSDO 2D5AA 1U8XX 3SX2A 4EI2A 4PLGA 2O50A 4XX0A 1EK5A 1EK6A 3RBXA 3KVOA 3UVEA 4HUJA 4WEQA 3JQ6A 1ZK2A 4IINA 2CFCA 4YAEA 4CQMA 3L4SO 4NBUA 2HMWA 4QUKA 4DBVO 4HFRA 4XJTA 5TSDA 3F1KA 1U3UA 3I6IA 5U9CA 4TWRA 3VOSA 5IDXA 2NQTA 3DHEA 4B7CA 2JCVA 1DC3A 2CUKA 5F3RA 1MX3A 1ZZEA 4OM8A 1K6IA 4XD2A 4MO2A 3CZRA 4BNXA 1P45A 3CMCO 3AU9A 3QSGA 3BIOA 3GFBA 5F1KA 2H5LA 5TGDA 2EV9A 3ZHBA 3AM5A 4JBHA 5EINA 3HN7A 3HADA 3TDKA 2CF6A 1UAGA 1ENPA 3QWAA 4IDCA 1LX6A 4FR5A 4HKTA 2AEJA 2HMUA 4NQZA 2X0JA 3EY4A 3WGHA 1IOLA 1ZIDA 4NR0A 3ROMA 2HCTA 1GYPA 4GMFA 1N1EA 4EUEA 4BNFA 4Q39A 2J6IA 3ZWVA 4AJIA 4I1IA 3QRWA 4MKXA 5C3MA 4XYMA 2YHIB 3AFMA 4HY3A 4JBGA 4XQ9A 4J4BA 3UUWA 3NYWA 4WLOA 1LSSA 2Q1TA 1SCUA 4A03A 1DIGA 3KXDA 4H15A 3S1LA 4QX6A 5CEEA 5FF9A 2ZB8A 4OSOA 4HX5A 4W99A 1KOLA 3SJ7A 4U6SA 2DM6A 3KETA 2O3UA 4LCJA 2FOIA 3OQ1A 3UCXA 4E5YA 3PI7A 1LQUA 3KV3O 2CY0A 2I65A 3QWHA 1HZJA 1CQJA 3WXBA 1YJ8A 1XEAA 4XWYA 2W98A 1A5ZA 1NYTA 2VWGA 4J4TA 3RUCA 4Q3AA 4BO3A 4D0SA 5I8ZA 4XJSA 1LDBA 2EXXA 1GCUA 2NVBA 4XYEA 3JSAA 4CM8B 4B79A 4Z9FA 4XYLA 4FPXA 2QRLA 2DBZA 3ON5A 3IQDB 3ZV5A 6ADHA 1YB1A 4FC7A 3DZFA 3FNGA 4Q3DA 1QLHA 3DDNA 1BHSA 1P0FA 3HG7A 4EZBA 3WFIA 2XPCA 3CE6A 3TOXA 3AUSA 4CLDA 4IDDA 3JV7A 8LDHA 1IY8A 4RPKA 1MG5A 3FNHA 1XDWA 5MDHA 2HDHA 3ZN2A 1A72A 2D5CA 2VCYA 3DXFA 4A0SA 1WMBA 1Q0LA 3WOHA 5JLAA 3LVFO 2Q4EA 4O6VA 3WBFA 1P77A 1Z7EA 2FN7A 4ITUA 2VNAA 4J0FA 4E12A 3QVSA 4CLRA 1HDZA 5IJZA 3ZWAA 1PL8A 4G81A 5B12A 4BNHA 3KLPX 3GN1A 3EMKA 3KBOA 2H63A 4DYVA 1CYDA 4Y98A 1I3LA 2YHIA 1NFQA 1PZEA 4FN4A 4NZ9A 1PGNA 4EEXA 3PJEA 2VWQA 3LYLA 3TZQA 3ZWCA 3INTA 1MG0A 5EMHA 5KOIA 4R9RA 2QQ5A 4B4WA 2VHVA 2AG5A 1UDAA 3ZDFA 4R69A 2C29D 3OQ6A 5JAQA 1BGVA 2DC1A 5KIAA 1ADGA 2B69A 1YOVA 4CMHA 5F1PA 1K3TA 2DPHA 2NTNA 3F5SA 3WQQA 2Q46A 4NH4A 3Q0EA 1S7CA 3RD5A 4LMPA 2O3JA 3MTGA 1DIHA 2EGHA 2GD1O 4BNJA 3ITDA 3PGJA 1A7KA 1GYQA 1O0SA 3QE3A 4EBFA 1PS9A 1YL6A 1IULA 4S1VA 2HKIA 4WCDA 2X9NA 4AJ1A 1CQIA 5JY1A 1HZZA 3SC6A 1N2SA 3FRJA 1YL7A 4NJOA 1U5AA 3MZ0A 3O8QB 5AYVA 4KTTE 3RI3A 4NK4A 1MC5A 3FR7A 4MP8A 5IDQA 3W6UA 1C0LA 1KY4A 1ADCA 2HMTA 3LT4A 2FY8A 1IUKA 2P9GA 6LDHA 1X7DA 3O4RA 1DIAA 2G1UA 1H9BA 3ZWYA 5IF3A 1U3VA 2GO1A 4M87A 4ZA2A 4WGGA 2I6TA 1C1DA 5KJ6A 5EERA 1GDHA 3R3SA 4MVJI 1E3IA 5JCXA 3JQ9A 1HE3A 2GZ2A 3STHA 1Q2XA 1PGQA 5JC1A 1Z7BA 1WZIA 4L4SA 1QLJA 3CSDA 4CMJA 3DOOA 1ZXBA 4EUHA 3SJUA 1ZMTA 3C7DB 4CQLB 3P19A 5COBA 5B4TA 3FHLA 3BTOA 3RUFA 2I66A 5CP8A 2UV8A 5ER9A 4R16A 2Q45A 3S2EA 3H3JA 5CEJA 3BMOB 2JFFA 3DBLB 4PCVA 2IRWA 4Q3NA 2YZ7A 4TQGA 3V8BA 4NBVA 1KVSA 1D1SA 2VWHA 3PQEA 1HDCA 3PIIA 5C7LO 3EK2A 3R1IA 5I7SA 3ZU4A 1BRMA 3Q9UA 4FFPA 2ZYAA 1ADFA 1Z82A 1UR5A 2DAPA 4HWKA 2X23A 4MVJG 3O03A 3C1TA 2VQ3A 5CFZA 3ENKA 5TT0A 3L9WA 2JFHA 1ISGA 2YY7A 2J5KA 2NNLD 1M6WA 2Y1DA 2P4QA 2O2SA 4ALNA 4C7KA 3Q11A 1I32A 2VYND 3VHRA 2ZJ0A 3PVZA 5CDYA 2VZ0A 3H7AA 2PGJA 3JQEA 1LLCA 2P2SA 2Y93A 4WECA 3R0IA 2ZYDA 4I9UA 5ICMA 3DMTA 4LVUA 3PQFA 1XWFA 2GN8A 4FGWA 4OKIA 3LZ6A 5TRTA 4OGWA 3ZWNA 4BNKA 3IL2A 4RGBA 3H5NA 4YQYA 2GNAA 2FHSA 4GPD1 4YJFA 1VPDA 4GWKA 2WYWA 3BHMA 2I76A 2QRKA 3QWIA 3I1JA 4KTVE 5FI5A 3H2SA 4UEJA 3WQRA 3NGXA 1T2AA 3EYWA 4RJTA 2V6GA 2EGGA 1X13A 4U0JA 2OXIA 1NXQA 3AI3A 3X2FA 4PZEA 3OEYA 5G2OA 2JJYA 4YA6A 3U9LA 2BGMA 5KTKA 2BFMA 1HDRA 3KO8A 1Z74A 3WFJA 4P4GA 5EQDA 5DF1A 1E1NA 5TT1A 3RC9A 1SB8A 1XHLA 4GSLA 3BMOA 3DBLA 1ID1A 1O8CA 3ETEA 1I3NA 3K31A 3SEFA 2I67A 5IZ4A 1PGJA 5HA5A 3WGZA 4DTIA 4UEOA 1I2BA 2Z95A 3I23A 1I2ZA 1ZJZA 1Y5RA 3DZIA 4CR7A 5JYDA 1E3WA 4EEZA 4RQTA 2OORA 4RF5A 1X14A 3IJRA 1CRWG 1C1XB 3W8EA 5C5IA 3GVHA 1MFPA 3H9EO 3MJTA 4LK3A 3WDSA 1NTOA 5A02A 1GV0A 4D46A 1FDSA 5JMPA 3C3XA 3EAGA 4OJNA 3C85A 1PIWA 5I7EA 2VTDA 2D3TA 3E82A 4RORA 4CMGA 3D4NA 2FR8A 1RWBA 5C7OO 3QA9A 5CAEA 4CPDA 3AM3A 3U4CA 4BNNA 5IN4A 1V3TA 4Y6SA 4GWGA 1CJCA 3ROPA 1KC3A 4JIGA 1AN9A 3B1JA 4YJHB 2J3HA 5A9SB 1HYEA 3G1UA 4KZPA 4CM7A 1B3RA 1T4DA 3L6OO 1YKFA 1AHHA 3PWZA 4A26A 3QWFA 1C1DB 2OP1A 4AG3A 1ONPA 2C82A 1YONA 2WD8A 3I4FA 1KY5A 3M2TA 4DREA 3KB6A 4IS2A 1E3JA 1IZ9A 4DQVA 1PSDA 3OP4A 4CMCA 2J3KA 1PQPA 1WDLA 5DNAA 1Y8QB 4IUYA 1DIBA 1A9YA 5BSFA 3RU7A 3HWRA 2JHFA 3A14A 4DIBA 1T24A 1ZUD1 2B5VA 3BMCA 1UDBA 4OYRA 1AGNA 4JJIA 1PX0A 5TLSA 3O38A 4II3A 4LW8A 4PLVA 1C0IA 3KTDA 1B8UA 2CF5A 1EBUA 3DL2A 1DAPA 3AWDA 1RYDA 4CM9D 1Y6JA 3KYBA 3IS3A 5AXBA 1R0SA 3QVXA 3G1TA 3A28A 3E8XA 1PS8A 1H6DA 1LDGA 4TRNA 1TVEA 4AVYA 1XCBA 1SBYA 4BNIA 3VTZA 3LLVA 3NJ4A 1QV6A 1J49A 5ILGA 1HSZA 1YQDA 4PZDA 1QYDA 1LDMA 1ZK4A 3I9NA 4UEKA 2X1HA 5TQVA 3WWZA 4D7AA 2VTEA 2FR1A 1FDVA 1MLDA 3ZWOA 3D7LA 4FDAA 3JQDA 5EESA 2OBNA 2WD7A 2HJSA 1KBZA 3JD0A 4YVFA 4FQ8A 1EBFA 5ER6A 1QXSA 4PG6A 1JAYA 3OJ0A 2VNSA 3GQVA 3H6KA 1BXGA 5T64A 3MJ4A 1HT0A 3ROKA 3GNSA 4PRKA 2CVOA 1I30A 3V2UA 1WWKA 4BGEA 1NPTO 2O7SA 1AUPA 2YQ5A 4HXYA 4BB6A 4XZ3A 3T4EA 3EDMA 1LC0A 1DRVA 4AFNA 2GRAA 4XDYA 5HS6A 3LF2A 3OA0A 1QV7A 3GVXA 4YYZA 4RL6A 2PZLA 1IB6A 2ZQYA 3GG9A 4QFCA 3ZH2A 3ANLA 4UVHA 5BSHA 2BFPA 3DTYA 4MVJH 1G1AA 1U2GA 4OOFA 3Q3CA 2XF8A 4ALJA 4PVCA 4KUGA 5JAZA 2Y0EA 4TKLA 3O8QA 3U3XA 5CDTA 4E30A 1XU7A 3K73O 3TN7A 3PHLA 2NTJA 2Y0CA 4ZQFA 4KUEA 1K2WA 4JJFA 3VH3A 4KOAA 3NUGA 1YO6A 5T67A 2ILTA 1W73A 4L0QA 2B37A 2WMDA 1EEHA 1G6KA 5CG2A 4R54A 5DOVA 3DAFA 4EJ0A 1K6JA 3ZV6A 1EVJA 2RAFA 2PTGA 1J5PA 3F9IA 1G0NA 1JW9B 3NKLA 1OI7A 5JXWA 1FJHA 1HEUA 4PVDA 1QORA 3F47A 1B15A 4ZVVA 4BV9A 9LDTA 1AHIA 3JQFC 4Z9XA 1UUFA 4CQLA 4XR9A 4D3FA 1M67A 2RH4A 5JAIA 5GY7A 3H65A 5LCXA 2FSVA 4N5MA 5TNXA 2O4UX 5IZCC 4MIEA 3B20A 1QR6A 3DMTC 4N54A 4WUVA 2DPGA 3CTVA 1QYCA 4YJHA 4ZQEA 5KJCA 3R6DA 3PFFA 4XR4A 2Q4BA 3AY3A 1OZAA 2J5QA 4BO6A 2X0NA 4DVJA 4BKRA 4BO7A 1ADBA 1HDOA 3EVTA 4IMPA 5JAMA 2EJWA 3AOEA 3JYQA 5A9TA 1D3AA 3JQAB 3D4PA 1KYQA 4OQZA 4L75A 4JGBA 3OBBA 1SAYA 1PJ2A 1PQUA 4PN3A 4F46A 1UXKA 5JC8A 2Y68A 4Z9YA 3VVCA 5DN9A 4UUOA 3PHIA 1QKIA 3DB2A 2IXAA 1F8GA 1X1TA 4W82A 4W4TA 3BMCB 3SXPA 3I3OA 4B4OA 4BS9A 2VZ8A 5AVOA 1M75A 2OO5A 1R16A 3FTPA 2C5AA 4J1NA 4J90A 1MUUA 3WX0A 2E48A 3M2PA 1Y8RB 3EZLA 4E21A 4DC0A 4JXKA 4HNHA 7MDHA 3DOCA 3NDIA 1L7DA 4U8GA 4BKOA 4KWIA 1UXGA 4QFDA 1OC2A 4R3WA 2X4GA 3OECA 3OETA 3SLKA 3ZWPA 1O6ZA 4OXKA 2RCYA 3LQFA 3F4LA 4J16A 5THQA 2JD0A 5JE8A 3RKUA 3VDQA 2Y0DA 4ND5A 5JW6A 3IKTA 5LDGA 5TIIA 2OHXA 1MGOA 1NQOA 4TRMA 3P5SA 1WNTA 4A2CA 3PIDA 5EPOA 4RPHA 2B83A 2IZZA 1E1MA 1YRLA 3HFGA 4GMGA 5JY6A 3Q6IA 4EJMA 2BELA 2DQ4A 3ZNPA 2Q3EA 1WXDA 1P33A 1I2CA 4J43A 2B36A 2HRZA 4YAGA 2VN8A 4R51A 4XDZA 1U28A 1SO8A 2NSDA 2PGLA 3VZRA 3EUWA 1LSJA 3D3WA 3DAPA 3E9MA 4MVJP 4A7PA 2A9FA 5L4SA 1AXGA 3JQ9C 3HDHA 2OUIA 1EVIA 1I0ZA 1UZLA 3GGGA 1YE3A 4LSMA 2Z1MA 4DQUA 4YJGB 1ZH8A 4LN1A 5G0TA 2PZMA 3W4JA 4HV4A 2BGLA 1XR3A 3Q2IA 2PD6A 1C14A 2DU8A 4GVXA 1U5CA 4D79A 4MVJA 4IDAA 3E1KA 5TX7A 5IAAA 3L07A 1JWAB 1XELA 1QMGA 4DC1A 4D3DA 4WNIA 2A35A 2YV3A 1KERA 1T2DA 4FW8A 4NMHA 4P4LA 4WPGA 1DEHA 4PG8A 3DONA 1U9JA 1JQBA 3MTJA 3OM9A 1KC1A 3MJVA 3MJSA 4FJ0A 4BGVA 3HFSA 3VPSA 3MWEB 3OJFA 1E6WA 5KKAA 3TL2A 3ZV4A 5IZCA 2VUUA 3H9GA 1MV8A 2C0CA 3NTQA 2A92A 2JD1A 3ULKA 1NAHA 1DXYA 3RQSA 3DBVO 3NTOA 1W6UA 4XB1A 2NVUB 5KWEA 4J0EA 5FWNA 4J7UA 2X22A 4J2HA 3ZI0A 4WCFA 1NQTA 1XKQA 2FP4A 3VPHA 3GY0A 4CMIB 1PZHA 2UDPA 1CWUA 3T7CA 2PKQP 4BOYA 4YQZA 4K28A 3E5RA 1A4UA 3VAZA 2GSDA 2GLXA 2IDZA 5ILOA 1GUZA 2XAAA 2Z1NA 3GOHA 4CM6A 1ISFA 4R1TA 2X0RA 1ORRA 4RPGA 2BH9A 5DCWA 4ILKA 5JSFA 4CV1A 4E6PA 4WCFC 2VOJA 3KEOA 3U49A 4IS3A 4CM8A 4DA9A 4NFSA 4YBZA 1ZEJA 3L4BA 2DUWA 2HK7A 3GUYA 2X58A 3K92A 1MFZA 3GRKA 1DLJA 4QEDA 2JKVA 1CETA 1TT5A 5A5FA 3C1AA 1C0KA 2D1YA 5T8KC 1F12A 3AW9A 2IE0A 1ARZA 5A06A 1PGOA 4K26A 1PR9A 3VC7A 3D4OA 5KVCA 3E03A 3PYXA 3AI2A 1D8AA 1SEVA 3KRTA 3PHHA 4KWHA 2PKQO 1X1EA 4HP8A 4IIUA 3RUDA 5L40A 4IZHA 5ENVA 1QRRA 3QWBA 1I10A 1PQWA 1CEQA 3FWZA 2PR2A 2P9CA 3LK7A 4RVHA 4MIOA 2WTBA 5L51A 1GTMA 1P9LA 2Q2VA 4BO9A 3UW3A 1B2LA 3L6DA 4B3JA 1RJWA 2Q99A 5JNLA 2BI8A 4TKMA 2OP0A 2FZWA 3GFGA 2D0IA 3TRIA 2EP5A 2V7PA 2YJZA 3ZU5A 4UULA 3A9WA 1E6UA 3NEPX 1BDMA 1H5QA 1KVTA 1VL6A 4ZHSA 3JQBA 3P2OA 3W8DA 2AG8A 4M55A 4S3MA 4IXTA 4Z0PA 2EG9A 2QW8A 3VZQA 5MGBA 3ENNA 4OXYA 1GY8A 2FRDA 5LC1A 3EGOA 4JROA 4DPKA 2DTEA 2AQKA 4X54A 3JQCA 1BVRA 2VUTA 1EDZA 2BD0A 2ZB3A 3DZJA 3QVTA 2SCUA 5HBRA 4ZJUA 4OHUA 2Y1GA 1TI7A 2W2LD 1EDOA 3PHGA 3MJEA 3VH2A 1B0AA 1NR1A 1HSOA 3I9MA 2UVDA 3GDOA 4D44A 3RUHA 4CMKA 2EKPA 4AJ4A 3PJFA 5CPBA 2AE2A 3B70A 1G0OA 4GX1A 5B1YA 1PWZA 3RVDA 3OHSX 4QECA 1E92A 3JYOA 3WG9A 2ZCVA 3WTCA 3PRJA 2QZ9A 2ZB7A 5T8KA 1ONOA 3PDUA 1UZNA 5BNIA 1KIFA 3JYLA 4PLPA 3B6ZA 3ANNA 1ULSA 3ORFA 5K6AC 4N5LA 4G65A 3IDSA 2BF7A 3GZNB 1DHTA 4RO0A 4DPLA 3LU1A 1JA9A 5B37A 4DMMA 2P9EA 3FSRA 1CF2O 4BNZA 1PL7A 3JQAA 1WW8A 3ASVA 1Z73A 4R01A 1SPXA 5L3ZA 1I3MA 1D7OA 3BA1A 2X86A 4AJLA 3S2IA 3PEFA 4NJMB 1F14A 4PLYA 4ALLA 4EYEA 1E5LA 4TRRA 4KQWA 4L76A 4CM9A 4GX0A 3GA0A 3GNTA 2X8LA 2NU9A 2O3RA 1BG6A 1ZKMA 4QSMA 4TRJA 4M89A 1NM5A 2XXJA 3NV9A 4FOOA 2VHZA 3DOJA 1NR7A 3F6YA 1PZGA 1X0VA 1ISHA 1NHGA 4IIVA 1RM4A 3GPDG 1KEUA 1ZO8A 3LC1O 4P4NA 3INGA 4BNMA 2BI7A 1MXHA 2OZPA 2CDCA 3TL3A 3N58A 4BNYA 1NWHA 1P1IA 1U2DA 4MINA 1P44A 2Y66A 2G0TA 4BUCA 1E7RA 3WGOA 3CKYA 3CINA 2ZKLA 2Q2QA 5GZ3A 3I6QA 1GZ4A 2EKQA 2GZ3A 3BZUA 5H81A 3WNVA 4D45A 4LRTB 3E18A 3GEMA 3WGIA 4CM4B 5G0SA 2PGDA 3C24A 1M6HA 2VHYA 2IZ0A 5L53A 4KDFA 4FFNA 5C7IO 2ZCUA 3GT0A 1Z6ZA 2P5YA 3ONDA 2W8ZA 2HK8A 2P91A 4PLHA 3QVWA 3DAGA 4I9NA 4YJFB 3ZNNA 3ZW8A 3UGKA 4BNUA 1DB3A 3IMFA 4DQXA 2GGSA 1EMDA 2JHGA 2O3QA 1L7EA 4WLEA 3ZCXA 3ZU2A 4OO3A 2C7VA 1B8VA 1N5DA 2C59A 1VSUA 4L4XA 3RC7A 2CD9A 3WGYA 1Q0QA 3Q1LA 4BGUA 5JFOA 3C7AA 3PFWO 2GZ1A 4LVCA 1RM3A 3KZVA 3KYDA 4AJ2A 1EUZA 5ADHA 2W2LA 1ONNA 2RHCA 1V3VA 2AMFA 1LXCA 2GN4A 4JN6B 3MOGA 4YAJA 5F1OA 3E6AA 4DYDA 4NU6A 4BNTA 4GI2A 5F21A 1NVGA 3V1UA 1ENOA 3OICA 3GAZA 4LGVA 4TROA 4AJEA 1I5RA 1WDKA 3X2EA 1VE9A 1ISMA 4Y6RA 3PP8A 5L7YA 1PJLA 2IODA 2DVMA 4MVJF 3M6IA 2NQ8A 4MPDA 3QQPA 4E5KA 1A71A 3WLFA 4JBIA 1GR0A 5GMOA 2UAGA 2VRBA 1U8FO 3LT2A 3GPIA 3U4HA 4EGFA 3QIVA 4LRSB 3OEWA 4GLOA 3ITKA 2ZK7A 3H9QA 4I08A 1WPQA 1DAOA 1K89A 1UDCA 3PQDA 3AI1A 3ROQA 1ZSNA 2EWMA 1P1HA 1HDYA 1P3DA 2HQ1A 4G2NA 3GDFA 1PEDA 1LLQA 3RUAA 4BQRA 2AW5A 3L9XA 2LDXA 1GPDG 3GGPA 1LRLA 1ZK1A 5EL0A 4YAKA 4YT4A 1WP4A 4PLZA 2C54A 4R1NA 4BGIA 5G0WA 5A9SA 3E48A 2PD4A 4JJGA 1GQQA 1ML3A 3FF4A 4PLCA 1E3EA 5IDYA 1YL5A 4AL4A 3KSZO 1NFRA 3NT5A 1KEVA 2IEBA 2WD7B 2GYYA 5U4QA 4BNWA 1E7YA 3AY6A 4J49A 5IFLA 3CZMA 1I33A 1AE1A 2JL1A 2Y1CA 3PDJA 5A4DA 3BHIA 4B4UA 2GASA 1ZMOA 2NACA 2WM3A 1BW9B 4NJMA 4J2OA 2HSDA 1FDWA 4Z0HO 1W8DA 1PJSA 3P7MA 4DLBA 4DGSA 1W4ZA 3HB5X 1WMAA 1R6DA 4MP3A 1PJ4A 1X7HA 5EN4A 1SOVA 1ZBQA 1DSSG 2O7QA 1T26A 1PJTA 3JTMA 4UVGA 2X9GA 1ZEMA 3JCZA 3AUUA 2O48X 5LDHA 1KVQA 4FIZA 1H2BA 4WASA 3U5TA 3WB9A 4ALMA 3RBVA 1EUCA 1OBFO 4CV2A 2O2YA 3NGLA 1RPNA 1MP0A 3OH8A 4ZRMA 3RKRA 2B4TO 2PK3A 3TF5A 1D1TA 3E9QA 4IJKA 2FSSA 4IQ8A 4E2ZA 3HZZA 1EUDA 4I5DA 3IJPA 1U4SA 4FFLA 3DFZA 3UHAA 3DZHA 3TWOA 1ZNQO 5AXDA 3G0OA 3HUDA 3OFSA 4IXWA 4GKVA 5A03A 2H6EA 3I9OA 3DZKA 1DJQA 4CM4A 2ZB4A 3KLMX 2HUNA 4J7XA 4NIMA 5A3JA 3AOGA 3KHUA 4OMUA 5AQ1A 2C7GA 2VYVD 4LSWA 5ENDA 2PKRA 4BKUA 5BNFA 1SNYA 1R4NA 1ZFNA 1IPEA 2BMAA 3BMQA 3UICA 2D8AA 2V65A 5CHEA 1C0PA 1XQ6A 4W6ZA 2JAPA 3GEGA 4B3IA 1ZSYA 2YHUA 4CQMB 3JD4A 4DWVA 4N5NA 1OFGA 1O9BA 3TFOA 1D4FA 5J23A 1IYZA 1FK8A 1SEPA 5B4VA 3V1TC 5BNTA 4L8VA 1JKJA 3H5AA 1HF3A 1DIRA 3DZBA 3E5MA 3ETGA 4ZQBA 5DULA 4B8WA 3S8MA 1WDMA 3SBOA 3UAGA 1B26A 3INRA 2I3GA 1I36A 4P8RA 3DHNA 2VHWA 1ZJYA 2VUSA 1VJ0A 3QV1A 1VL8A 2VT3A 4M49A 4Q3EA 3T4XA 1O89A 5A04A 3JQGA 1JKIA 4A10A 5JMWA 5HM8A 2WE8A 2GUGA 2W2KA 4I5FA 4AJKA 5KJEA 1GCOA 1RYEA 3RJ5A 3PWKA 3GMDA 3JQ8A 4GLLA 5JDCC 1LC3A 4BQPA 2AA3A 2GN9A 3JQAD 4TSKA 5JCJD 4J9UE 3F5QA 1U3TA 1P1JA 2GCGA 5COAA 2XOXA 4RVFA 1U4OA 4E32A 1UP4A 3N74A 4FBGA 1Y5MA 2DTDA 1VLLA 9LDBA 5ITVA 4LISA 4F45A 5FI3A 5THKA 1YQXA 3JD1A 2HMVA 2B35A 5IXSA 1PGPA 4ESOA 1V9LA 4TMFA 1SOWA 1T2CA 5DZSA 3VKVA 1EE9A 4E13A 2OBYA 2AHRA 1RM5A 3OQBA 2J3IA 2PWZA 1P1FA 1MB4A 1LLUA 5BT9A 1PJCA 3WGTA 3WTBA 3LC7O 3VH1A 1YWGO 3K96A 2E82A 4O5OA 4MIYA 4FS3A 5CG1A 4RPJA 1R4NB 3CMMA 3ONEA 3TJRA 4BMVA 3K2EA 4J4HA 1DDOA 3VPGA 2PNFA 4FFMA 3FPCA 2G5CA 4RDIA 4XRRA 1H0KA 4Q3CA 3WS7A 3RFVA 3CPSA 4ND2A 1DJNA 1B7GO 3V5NA 5L4LA 4IY1A 4M54A 1QYVA 3COSA 4ZGWA 3PLNA 2C20A 3OJLA 2OL4A 5BR7A 1A27A 4FOSA 1TB4A 4NHEA 1YBAA 2EIHA 4DBZA 4E31A 3FWNA 4YJGA 2EJVA 1XG5A 2XXBA 4FC6A 1EQUA 1NWCA 4GSKA 1B8PA 4BO4A 2JCXA 3I4CA 4BO8A 1LRKA 1HTBA 1HWYA 2ZYGA 5HRUA 4HNGA 2DT5A 4RV9A 1GADO 4YT5A 3WICA 1LU9A 2EERA 1U1IA 3HDQA 4CUJA 3WR5A 2DKNA 2J5RA 1R37A 4IMRA 3NAQA 1NQ5A 1F0YA 3WGGA 1HYGA 4YACA 1OOEA 1HDXA 3FI9A 4I9HA 4PLWA 2AE1A 1OC4A 2P5UA 3OJOA 4YRDA 3AJRA 2WDZA 2WYVA 4CM1A 5A1TA 1UP6A 2V6FA 3OIGA 4ROSA 3SVTA 4N18A 3HJAA 2DLDA 1T4BA 2HRBA 2OGUA 2NLOA 3RWBA 4Z3KA 4J7CA 1QP8A 4UUPA 2Y1OA 3PZRA 2DBRA 4XQEA 4MKZA 2OOSA 5AXCA 2YUTA 4XB2A 4YRAA 2UYYA 2E4AA 3K6JA 4QXMA 4IM7A 2IXBA 3ZWWA 4CLHA 4IDGA 4CMIA 4GBJA 3D3WB 2B0JA 5KJ1A 2PFGA 5CDSA 3EZYA 3GRPA 3GVIA 3U0BA 1M76A 3DBRA 1K5HA 3I52A 3MEQA 5JPIA 3SLGA 3IUPA 2YDYA 3CXRA 3RUEA 4A27A 1PR3A 3D5QA 1YJQA 3U62A 4BL5A 2DUUA 3EHEA 1LNQA 2C07A 1YDWA 1V3UA 3PWSA 3UCFA 3W8FA 1PJ3A 4B7UA 3D3EA 2W2KB 3G49A 1R0LA 1E0DA 2YDXA 4XQGA 5G4KB 1NVMB 2YYYA 3DC2A 5I8WA 1LJ8A 1Y9EA 4R5MA 3GG2A 2IYOA 5IG2A 4Y6PA 1W0CA 1DC6A 5JO9A 2ZJ1A 4OSPA 3G79A 1DC4A 4KUHA 3K9QO 4QO7A 3LT0A 2CNBA 3AK4A 1BDBA 3IUSA 2HU2A 3BTVA 1GUYA 1YDEA 4E2XA 4PFJA 4D43A 2E49A 5GZ6A 2JCYA 4E0BA 2NVUA 4IGFA 4CUZA 4ND3A 4XCVA 4RVUA 2AQHA 1V8BA 2HO5A 5KKCA 3HN2A 2BFOA 3JD2A 2PLAA 3CUKA 4TVBA 3W1VA 1XA0A 3HDYA 4L9RA 3ANMA 3GLQA 4UUNA 4RVGA 2FMUA 2Z5LA 1Y9AA 2G82A 4Q9NA 1GUFA 2FPGA 5A3VA 1DFGA 1Q7CA 2WEKA 4XGIA 3WBBA 4KP7A 1NPDA 1BXKA 4NDNE 3TZKA 5GZ1A 5FEUA 1R4MA 1YBMA 1YGYA 3WLEA 3FN4A 4NK5A 5L4NA 2VOEA 1B3BA 1Y8QA 4K9DA 4YT2A 4B4VA 5G4LA 4E5PA 4O1MA 1WAMA 5CDGA 2BKAA 3DBRB 5DT9A 4R4JA 1EVZA 2X5JO 3OF2A 5T57A 4CLOA 2VWPA 5FYDA 2HLPA 1FF9A 4MVJE 1JU9A 1YB4A 2A94A 1LBEA 1E3WB 1HKUA 4WKGA 3LT1A 5DOZA 4XQCA 4YJDA 1TEHA 3F3SA 3PYLA 4FJ1A 1MA0A 3WQSB 4GGOA 4D3SA 1FMCA 5L7TA 5G4KA 1NHWA 3AU8A 1KVUA 4RVDA 1UH5A 4K6CA 2C2XA 3AFNA 4IJWA 4WLFA 2CDAA 1E77A 5DP2A 2A4KA 1NPYA 4ND4A 4JX8A 4WOKA 4BNLA 1SC6A 3A4VA 3PJDA 1XQ1A 2AQ8A 5BSGA 4E4YA 1Y7TA 3BMNB 4M1QA 4CJXA 3LDHA 1UP7A 3UCEA 2AQIA 3UFXA 1ISJA 2YV2A 5KCZA 5DCYA 2G17A 3BYZA 3N7UA 5DBGA 1BXGB 3F46A 1FDUA 4UUMA 5JCJA 4WNCA 3VPFA 3QP9A 1CERA 2RIRA 1LLDA 5TF4A 1CDOA 4BB5A 4XIJA 3FTNA 4BHTA 1F8FA 4BO5A 1QYXA 2O3TA 4CLXA 1VKOA 3D64A 5TS3A 4YEDA 4EUFA 1S6YA 1YQGA 2WSBA 3KYCA 4I5EA 2CVQA 4BVAA 3ADOA 4OQYA 1QYWA 1FXSA 4DRYA 4CUKA 1JDJA 3QY9A 4U0KA 4F6CA 3VVBA 4YWJA 3IIEA 3OIFA 4YTEA 1NX6A 3WIDA 4W7IA 4BNVA 3PLRA 2ZTVA 1XU9A 1T25A 3HB4X 2J8ZA 2GDZA 4TVOA 3ZV3A 2ET6A 1VRWA 4MVJD 1BMDA 1N7HA 4B3HA 2PZJA 3GAFA 2NVWA 5L9AA 4FJ2A 3ZNQA 4GQAA 2QRJA 1H6BA 3FD8A 2J3JA 4FGSA 1BVUA 3BTSA 3NT4A 3QHAA 3OMLA 1T2FA 1M66A 1WLYA 2FPPA 2PY6A 1E7QA 3D0OA 4R5HA 3JYPA 3VDRA 2DFDA 5DP1A 2D59A 1I01A 3E9NA 1GAEO 2JAHA 3M1LA 3PPIA 8ADHA 1HE5A 1UJMA 1CIVA 1J4AA 2X7HA 3PK0A 3AUTA 4AJHA 2AEFA 3BMNA 1GD1O 4OIMA 4FFRA 3FCOA 3DHYA 2O3SA 2EW2A 2DTXA 2E37A 3ASUA 3ICPA 4Y67A 1LRJA 3RFTA 4YRBA 4UREA 3EW7A 3BAZA 1L1FA 1DHRA 3FBTA 3FNFA 5ITWA 3I83A 2ZIZA 4NBWA 1NNUA 1IZ0A 1X7GA 3GDGA 4FD3A 2EP7A 1JWBB 1EFLA 3GC6A 4EW6A 3ABIA 2PV7A 3VZSA 4NG5A 5KVQA 3BTUA 2R2GA 3RSHA 3ADPA 5JYEA 2WWRA 1J6UA 4DMLA 2RH8A 5G0VA 2FR0A 1HE2A 4IDEA 1N9GA 3L6EA 2NU7A 3JQ7B 2ZATA 3DR3A 4J1SA 1A9ZA 4BIIA 2NTVA 4CLOB 4C7JA 4RF4A 3VKUA 2BRUA 2PZKA 3QW2A 4ZU3A 3G17A 1ZK0A 2PH3A 1Y8RA 1PJQA 5EJ2A 4OAQA 2YFQA 5KVVA 3H3FA 4J91A 5ICSA 3HE3A 3TNLA 1U3WA 1I24A 4B8ZA 5JBIA 3KM0A 3W6ZA 3AY7A 1K6XA 4NBRA 2DFVA 4QT0A 3AOEC 1J0XO 3NRCA 4R1UA 4BKQA 1B16A 4E2YA 1RKXA 1DLIA 4ID9A 3RCBA 2GR9A 3TZCA 2Y99A 4INAA 3TPCA 3ZWXA 3VZPA 1KVRA 4JP3A 4Q3BA 1HDGO 1YB5A 3H8VA 3WYEA 4PIVA 2LDBA 4PG4A 1ZXLA 4RCVA 5IDWA 1E1LA 4JP2A 3S55A 1VKNA 1XLTA 3JQFA 3KYDB 2HAEA 1UXHA 1GL3A 2PH5A 1YOVB 2BFAA 4AJPA 2B4RO 1ENYA 3EC7A 2Y05A 1N1GA 1BW9A 4GL4A 1LDEA 1KEWA 1UZMA 4JK3A 1EFKA 4JQCA 3TZ6A 2PD3A 4PLFA 4E5NA 2ZTUA 3NT2A 1R12A 1VL0A 2FWMX 4CV0A 5A9RA 4NPCA 1E1KA 1UXIA 3EVNA 4Y8VA 1B14A 1DO8A 2VT2A 5A5EA 3PZBA 3K8ZA 4PGFA 3DWFA 3I9JA 4CLRB 2E6UX 4J9VA 1R66A 4PZCA 3KOUA 2PA3A 4J6FA 1JAXA 4O59O 2W90A 4GH5A 1Y1PA 2GPTA 4L4RA 1Z75A 3GGOA 3RC2A 3UXYA 3VTFA 3B1KA 3IOYA 4ZRNA 4W9NA 2IEDA 2W4QA 2Y1FA 3JYNA 4AICA 4RF2A 1E3SA 3Q9NA 1MXFA 5KVSA 1HLDA 1LDYA 2I99A 3WNQA 2GF2A 3DBHB 4EDFA 4RPLA 3I9KA 1E7WA 4WLUA 3F4BA 2V6BA 2H1SA 5I9LA 5A05A 3P2YA 2VRCA 1ZCJA 4NU5A 3MCVA 4NFYA 4XRGA 1GYRA 4E5MA 1DOHA 1HLPA 1RM0A 4J1QA 3FR8A 3SC4A 1LDNA 5ES3A 1H6CA 1LSUA 1VJTA 3PXXA 4DIFA 1BXZA 1GU7A 3R3JA 1E3LA 4L73A 4M86A 2NU6A 3HHPA 4YT8A 5L7WA 3WYCA 3DMYA 1P74A 1XIVA 1I8TA 3UOGA 2Y67A 4LCEA 1EE2A 4GVLA 1Q7BA 3S2FA 3TZHA 4CMEA 4BO2A 4CM5A 3U4DA 1BWSA 3WGQA 3GK3A 5EIOA 4CMAA 4R3NA 4E3ZA 5C37A 1DBVO 5T5QA 1YS4A 4I8XA 3KSUA 3UN1A 4MP6A 1DRUA 5JDCA 2C2YA 1IE3A 3GMSA 1WVGA 3LLSA 3H5RA
chains in the Genus database with same CATH superfamily
4X1IB 2V8OA 3JQBC 2QD4A 5TC4A 1TA0A 1X15A 4G1BA 1IXKA 4MO9A 2HFJA 13PKA 1T0JB 1T9GR 1C2YA 2G5PA 2JFOA 3GO4A 4XGNA 1IBRA 5CEFA 1E0AA 5DX8A 3RODA 1KJ9A 3LAWA 1QVAA 4AO6A 1D0VA 1CQIB 1G5FA 4M46A 4PC7A 1Y4UA 3EG5A 5AHRA 3LFUA 4LMRA 3FNEA 2EHDA 3JQGB 2QM0A 5D5PA 2PEYA 2Q6IA 2HFKA 1ORIA 2R6JA 4RAOA 3ESAA 3DPUA 3HU1A 5B3LA 2BFCB 3VO9A 2JI7A 1HETA 3HDVA 1CUSA 4GGPA 2AOUA 2KX7A 3AGPA 1YBVA 5L45A 2R68A 1EIWA 1P2VA 3UJ9A 4O4IB 5DT2A 3ZGLA 2GQ0A 1HNWB 1DKQA 1DTSA 1U0BB 2HQBA 4PC1A 5LZ5A 2ZTLA 3AV3A 3O8BA 2NQ2C 4KE8A 4KMSA 2CVFA 4CNBA 1U0LA 3Q6NA 3OSUA 4EA7A 5J2UA 4TYQA 1GZ6A 2BGGA 2B4QA 1RXWA 2F1KA 4W5WA 1XVLA 4NCNA 2IHJA 3RJ9A 2WTUA 2J0QA 3WHLA 3RVNA 4IMJB 5ADWA 1TD9A 4YMVA 4UQOA 1SJ9A 4F2GA 4EPWA 1ZGJA 3LY9A 5AM5A 1AN0A 2RJ3A 2VDWB 3WMFA 4AKSA 4D8WA 1DRWA 3WK4A 4ZIRA 5EI5A 1X8JA 1Q0HA 5DYTA 5E7MA 3MFYA 1REQA 2XUJA 1I7PA 3JD3A 3NXKA 3MN1A 1AUVA 4QQRA 3PC3A 4LXQA 5IMBA 1T5BA 5HIAA 1L3IA 2P90A 3PIRA 4MOWA 5HGJA 1Z0UA 3AUAA 3BG5A 4D9JA 2VAVA 1THMA 5E0KB 2QIOA 2NUPA 3NOVA 4ZU1X 3VV2A 2GN6A 3ZCVA 4F91B 1QIHA 3OE1A 2PYDA 2ZUDA 3LCJA 4KO8A 4C4TA 2HJRA 4CYMA 5EEHA 4WFQA 4GLFA 2CVZA 1L5WA 4NCIA 5EXPA 2VPZA 1YXMA 2Q1WA 5HBGA 1D5CA 3OF3A 1GV1A 3ZZTA 3KOOA 3OG9A 4BLTA 4C0HA 4U3JB 4A2WA 4L50A 2QN2A 1I4EB 1JYSA 1MA3A 4CIYA 1SCIA 2GHIA 5EIHA 1MT3A 2QQEA 1NUAA 3ZZNA 1H6AA 3TIXB 2WBLC 1OYOA 3CX6A 3CZAA 3G5AA 5C81A 1EXNA 5D51S 4YCBA 4KGZA 3PDIB 1XZHA 2W2OA 4O4LF 4OBEA 4B3CA 2VF8A 4I46A 3RVSA 4HNQA 5AT1A 2PKCA 1RYYA 1V16A 2DUMA 3FBWA 4HEQA 2WYUA 3WRYC 4YO8A 5E9QA 5CYFA 2DULA 3LBFA 4B82A 1PVVA 4ZQGA 3HA3A 1I51A 5G1PA 4DV6B 1PDVA 4B43A 1GPNA 4F60A 1GAWA 1UBFA 3GL9A 1CJVC 2BL4A 2WU3A 2HA5A 3DZCA 3GJ4A 1XKXA 1E66A 2C9BA 2HWUA 1T9BA 3G6WA 5HWSA 2CXSA 2QVBA 4WZAB 3TLEA 3W5SA 1G5TA 3WIEA 2AN1A 3OA2A 4GR4A 4N4AA 4C20A 1Y6FA 2O2HA 4LRWA 2YNMA 5KOHA 1B8OA 1WBJB 7ADHA 1KK2A 3WB1A 2A3NA 2Z3ZA 4TZ0A 3ZWBA 2QT0A 3PC8A 4CQMD 4AQYB 1Y81A 2JD2A 3I0NA 4NMLA 2QYTA 2JH8A 2W43A 5D6NA 4F3YA 1UQUA 3RRFA 1DPGA 1NP3A 3BFPA 1U2RA 3JASA 1O4VA 3EZFA 4CMBA 3OJEA 5JJIA 2I4TA 1E5TA 3M6FA 1MOQA 2OCBA 5CGZA 4PG5A 3FLMA 3ECSA 1PWXA 1R88A 3LF1A 1FNNA 3AETB 5CX4A 1DJMA 3H3XA 5TJHA 5G0UA 4OLBA 4E1AA 2D54A 2ST1A 3IP3A 2WUGA 5L95A 1SOUA 2NXEA 3ONVA 1SD5A 3GRYA 2C2OA 1QQ7A 3HSKA 4AWBA 2CZCA 5LM3A 3DTTA 1OAAA 1SM4A 3KYIB 5G3ZA 2QSJA 4YGYA 2O2ZA 1ZGBA 4OKNA 5DBOA 3O3OB 1HXHA 2DUJA 2QZZA 1GWNA 1Q1NA 5E8JA 3D3NA 4Q18A 1F6WA 3DEFA 4WK6A 3MOIA 4P4SA 1EWYA 4MV3A 4YX9A 4WRRA 4JNKA 5FNVA 4Z8YA 2TS1A 4RPCA 1UT8A 4IJVA 2IV2X 4UPEA 4EG1A 1J42A 4MWSA 3USZA 1Z15A 1QH1B 3PUVA 1UXOA 5ETJA 4PC2A 2G7MC 2NM0A 1BU8A 2FDRA 3UMBA 3K9HA 1D2RA 2ZR7A 3AVUA 3P4YA 2FLKA 4UNIA 4ZYTA 3GGCA 1H94A 2UUPA 3E7XA 3WWYA 2LWIA 1SIWA 2XZPA 4W8HA 3ZU3A 5AVWA 4RZHA 3NWOA 3E7WA 1Z47A 2OAGA 4QYIA 4AS3A 4E07A 5KX5F 1IL0A 1YZVA 2QTTA 4FHEA 4G5OA 4PSDA 4RKWA 4F2WA 1SMKA 1Q7GA 1AS0A 3RYIB 3TSCA 2VCHA 3IQWA 3T0IA 1WCV1 4YNBA 4PR0A 4IIFA 1H9CA 1DX4A 1K0UA 4NLLA 1H8HD 1MTOA 1SBNE 3NG1A 3FOCA 2WWGA 3OPYI 4WZAA 4AXBA 4HH1A 4FDLA 2PBRA 1IN8A 4FBLA 1QSGA 1RQLA 2VVTA 4GM1A 4JLSA 3K6SB 5EJ5A 3FMOB 1C7QA 3MCZA 4DMGA 1KZ6A 3ZHYA 2X3UA 2HI0A 5EKTA 1XZJA 3GRFA 5CVJA 4LQCA 1BKYA 3PQ4A 4YGXB 1V1MA 1NUHA 3KVYA 4CG1A 5K8CA 2CDRA 1GFSA 4DWWA 3P5BA 2R00A 1YT5A 3U7HB 4AZ3A 3TMKA 4N82A 3PQ8A 3P9SA 4ENSA 4D5EA 4BUJA 2JLVA 3GRAA 2X3FA 3IAS1 2H3EA 3Q0IA 4HQNA 5HSGA 2NSLA 2QJFA 2R8XA 1J2UA 3TYXA 5KTSA 2FCRA 1G8HA 1N6KA 1XRPA 3ZNOA 2OLKA 2JJ1D 4D02A 4DLLA 1QX4A 4G0OA 5KYKA 4ERNA 2O23A 1XMSA 1MOSA 2NX2A 3RK4A 1WABA 2Q4TA 3QPBA 4HFNA 4MW2A 4PG7A 1SHTX 4LBWA 3ZQ4A 5JHHB 4ARIA 1A4IA 3VH4A 3ZZUA 2ERYA 1U7HA 1Q1AA 3KWMA 4R0MA 1O5TA 4I3FA 1XVUA 1QTNA 4LJ6A 1MB9A 3IT0A 1R4MB 4W7HA 5HJ2A 3QLJA 4CCSA 2FPIA 3CVUA 4KYTA 2Q9AA 4ZYLA 2O8VA 1CT9A 3WMWA 4A8HA 3WLJA 3CKKA 4LYYA 2V0GA 1R5JA 1NP6A 1KZYC 1U99A 3BHNA 3QHQA 4QOJA 1EAYA 2ZUUA 3F8TA 3JZFA 1FYDA 1TLTA 4K81B 1G5RA 4BN4A 4XE5A 2W37A 1QPBA 1SKYB 3KJHA 2A33A 3JWPA 1US8A 3N76A 5FBZA 5LBIA 1ZI8A 2AUTA 1TVKB 1D4OA 3TTXA 2I9PA 3CUYA 4NTZA 4BPBA 1T2EA 3NDRA 3VO2A 5DHSA 2X13A 3CUEF 3IVXA 5AHKA 4TOIA 4F8JA 2IDMA 3NHKA 1RRGA 3O4GA 1XA4A 3HUUA 3KB2A 3Q9LA 4HFJA 1VCHA 3TZBA 1Y1LA 4BIMA 2GN1A 2QAGB 4R9SA 4Q21A 2OO7A 1V35A 3ZJTA 2QJWA 1JHDA 2KI5A 5ALWA 3VFDA 4DNQA 5EZYF 2C2HA 1GZDA 2GEKA 2R6CA 2QUBA 3B3QA 3FOZA 2PSJA 8OHMA 4O2AF 1JTVA 2GESA 1Z4OA 2A0KA 3NALA 3IE2A 1W46A 4H3VA 1MJGM 3H0EA 1S4QA 2EQAA 4H4DA 3C8MA 4HAWA 2YJGA 4G9GA 3AR8A 3RVPA 4B6QA 2HU8A 2RGXA 3FPJA 4WJKB 5EUBA 3RAFC 3C3DA 3VAAA 1OYYA 4YI3A 5HEKA 3V8EA 3UATA 4OX9Y 2V6MA 1SPBS 4XWOA 4CT5A 4US0R 4JLWA 1UXJA 1P1RA 1L5ZA 2GJ4A 3F5FA 1FFEA 3L0DA 5DDIP 3M9XA 621PA 1I4WA 1R15A 2AXNA 1JSXA 1SIOA 2H59A 4X8OA 3ROZA 1P7YA 1T2UA 3B1ZA 2RB5A 1HL3A 3D2LA 3Q85A 3RS5A 1PJZA 1IXYA 1HRDA 5ALOA 4U4AA 5EJIA 4Q6BA 2YV1A 3PGMA 3A4LA 4HS9A 1J1IA 4D0RA 2Q49A 2ZSAA 1XCPA 4IJ5A 4D4MA 1EZ4A 1SB9A 4Z0TA 1R3DA 2H5JA 1AIPA 1NKSA 2YC2C 4E5VA 2CV0A 1V39A 1JYFA 3I30X 4P33A 1VKZA 2E87A 4UXHA 1COWA 3QLUC 1IHYA 2D8MA 2I3ZA 4INZA 3TJMA 4YCAA 4BEJA 4FKMA 5U1PA 4B7AA 4ZWNA 3UWMA 2XZOA 2DWUA 2G9QA 1C9KA 1V6CA 3AJ9A 3DC7A 3GFPA 5FFFA 3RU9A 5CFMA 2IEAA 7YASA 3QU7A 4ZI5A 4TYYA 3MWKA 3R7WB 4K1LA 4QUJA 1FDTA 4JP5A 3WL8A 4RIHA 4KQXA 1O94A 3FMPB 4F7DA 2ADFA 2C2GA 3F98A 3E0XA 3QY0A 4RDCA 1ECGA 1TAQA 1TXGA 2NT3A 3E3MA 4UUBA 4BZXA 4LY0A 5E1MA 2Q2WA 3GD7A 1ULTA 4C7VA 1P7PA 3VR6D 1YDMA 3IUEA 3IVGA 2AZ4A 4RA6A 5H4GA 3K35A 4OCZA 5ECWA 5IBQA 1WXIA 1E2NA 1NASA 4AW9A 1O5IA 3MLBA 1UBHS 1SG9A 5H82A 1YR3A 4D9IA 2JI8A 3ZHCA 1JPVA 4QJ3A 3WK6A 4MGEA 3SX2A 3N2GA 4D4IA 2RI6A 4RWZA 5I7HA 1ZJWA 3KSMA 4YHBA 2P69A 3KVOA 1FP1D 3H8WA 4GQBA 2AI3A 1CZNA 1NI5A 1XVTA 5IVKA 5H3LA 1ECFA 3P0JA 2F2TA 2WQ7A 3H11B 4TMVA 3ZK9A 3ZWQA 4CQMA 2BFEB 2WYIA 1NOIA 1DV1A 1FFSA 2XMSA 3K9CA 1U3UA 4HTFB 2QT9A 2QG6A 5EUMA 1X7WA 2XITA 4OB8A 1WP9A 2FTKE 4OLJA 1X39A 2FW7A 1DC3A 1PF7E 1EFTA 1OI2A 2UZ3A 1K6IA 1H1TA 1U9ZA 3AH8A 1VL2A 4TWIA 3RM3A 2C7OA 3NC0C 4QXPA 3VMFA 2WWWA 2PWBA 3CMCO 3AU9A 1ELOA 1XMXA 2EFHB 4ML3A 4FQ5A 3AEKA 5F98A 5IABA 4GR5A 2VNJA 3H17A 2UZ4A 1JLMA 4MA5A 3ZCSA 1IN7A 1TO6A 2R84A 1TZ2A 5JEEA 1PFGA 5GJWC 2H8GA 3IILA 2W6ID 4RMNA 5DM4A 2Q7OE 3TDKA 2CF6A 2A4MA 1WSWA 1UAGA 2FXIA 4JJ8A 4X41A 4XUEA 4DMUB 1TU4A 1LX6A 1X9HA 4FR5A 4K9PA 5CDFE 3HGMA 3U6BA 1Q95A 3UW1A 2HMUA 2AN3A 1QGZA 1R6BX 2VT6A 1U7OA 1ZIDA 2DWPA 3ROMA 4QOIA 1Z7YA 2JKYA 5JNUA 1OXMA 2IPMA 3HGQA 3HBFA 3VR6A 1T6NA 1A5AB 2H06A 1M2JA 2YHIB 4K40A 2R4TA 2OXTA 3NHYA 1OGIA 2WVAA 3I9V1 1Q3KA 2NTYC 3IHWA 5C32A 3IDOA 2P4SA 2IFTA 3SQWA 2X1LA 4OLAA 3N0RA 2HLDA 1FW6A 1F2TA 1RWMA 2AJBA 1SCUA 3IH5A 1ZCFA 3S1LA 4O2BF 1P5ZB 3RRMA 5FF9A 4QTYA 4ZYVA 1X3LA 2BFFB 4NCJA 2IV3A 3HCWA 3ZGOA 5BNZA 1M73E 3S28A 4ZCSA 2BEUB 1IQUA 2FOIA 2OY0A 3UCXA 2JAWA 4WACA 4E5YA 3MJHA 1LQUA 3KOWA 2RGWA 3FJ1A 2JW5A 3NWJA 4I55B 3HJNA 3BX1A 2C7QA 5BUQA 4XWYA 2RHLA 2FMFA 1NYTA 2XTZA 2VWGA 3OCWA 4D0SA 4XJSA 3N1UA 1GCUA 1Z12A 2F43B 2NVBA 3QLTA 2F1JA 1AKYA 3LO8A 1H0HA 3CVVA 2QRLA 4IX9A 4XTRA 4GOND 4YDSA 5BSVA 4BASA 3LL4A 4Q3DA 2GXUA 3T5BA 1P0FA 1IEQA 1L5HB 3O8DA 4S1WA 2XPCA 1G6OA 1JZTA 2QTVB 2M1XA 4P80A 3LRTA 1W1IA 3FHCB 5CBPA 3JV7A 4MQBA 4G4IA 3BE8A 4F4FA 2H4ZA 2IZ5A 4MQEB 5FCDA 4RPKA 4L9SA 3AXSA 3C87A 2C9ZA 4OY3A 5MDHA 4MUKA 2HDHA 2HUPA 2WPDD 5CJPA 5AK5A 1A9OA 4KR6A 2QTWB 1A5TA 1EDBA 1U04A 4L0MA 3CR8A 2JGFA 2EDCA 5DRYA 5GIOE 3B1WA 1RPJA 4QU5A 3TLGA 2WICA 4X00A 1T10A 4DCGA 3AF0A 3AJ8A 4OFWA 4CLRA 1JKXA 3K32A 2DRIA 2VDJA 1AV7A 3D1JA 1PV1A 2PX2A 3TINA 1QP4A 3LVRE 3IAS6 5E3JA 4LF9B 1CD5A 1NLMA 3U3DA 3CONA 4CHTA 4KQ6A 2WQZA 1XO1A 3T9AA 2Y92A 4Y6OA 4IKEA 1M8KA 1R3UA 3QUAA 4EPTA 4FEAA 1LI5A 1I3LA 3IXMA 1LF0A 1JA0A 1B73A 1I4LD 4CBVA 4EGCB 2JFQA 1SU6A 2RHBA 2JFXA 3PVCA 1NDHA 3WRVA 1YA4A 3AONB 2VWQA 3TZQA 3EA0A 3INTA 4Y2TA 2VHVA 5J1TB 2EJTA 1G18A 2XMBA 3EGWA 2ZOSA 1JMKC 3OQ6A 2AZTA 5KU1A 1LX7A 1Y42X 2IOHA 3V8RA 1MOZA 1YHYA 1ADGA 4YY3B 1IPHA 4KE6A 4ZMBA 1ANKA 1YOVA 4JI8B 3PX7A 1K3TA 2Q3DA 1N0HA 1QYRA 1DT5A 3J81k 2DR3A 1OLUA 3BZWA 3MGKA 4UNNA 4DA7A 1YRAA 4NH4A 4XPIA 5FO0A 5TS2A 1GSAA 3LA8A 3MTGA 1T5SA 3W7AA 1CEYA 2UVPB 4B6OA 2A5YB 4I1UA 2Z9CA 3FDZB 4JVLA 3Q8MA 1A7KA 3LQQA 3DDCA 1KFCB 1G21B 3SZUA 2SCUB 4MGHA 3RJZA 1YL6A 2Q8NA 1SUSA 3V9AA 1WR8A 2GPYA 2E6KA 2IUYA 4RUKA 4TLMB 2X9NA 1U11A 1LBIA 2HZBA 3RT7A 1M34E 3ETNA 3V4VB 1VJCA 5FA6A 2CDNA 5LZ9A 1LD3A 4U1RA 4UE3S 1HNXB 3KL2A 1HZZA 2MHCA 2CL0X 3GFVA 4GM0A 4J6EA 1N2SA 3SC6A 4ARVA 1NUTA 3ENQA 3O8QB 5AK3A 3G8AA 4FOPA 5KQSA 1G66A 4KTTE 4O1HA 1PSWA 1R6XA 4HYEA 5KTTA 1FFHA 4TKVB 1NRJB 5IKMA 2HHLA 1YFKA 2XQGA 4JBXA 2P4UA 1UJNA 2OGTA 3ORQA 3PKZA 5JH7A 3WLHA 4H4CA 1ADCA 4CKYA 2CLFB 4HAOA 1YC2A 3ADBA 4CEJB 3LT4A 4R3UC 4IVNA 2NYVA 3I32A 1IUKA 6LDHA 1Z13A 3QNMA 3B7PA 3W6OA 4WCVA 2G1UA 4JLJA 2XLBA 1V4NA 5IF3A 4YCJA 4CI9A 2NGRA 4JJ7A 4I1VA 4OQNA 2ZREA 4M87A 1TJPB 2QN7A 3IBTA 3DCJA 5FIUA 4NZNA 4PGAA 5EERA 2Q29A 3R3SA 1U0GA 1E3IA 1UL1X 2PEZA 1NATA 1EJ0A 1H2RS 1P7VA 1Q17A 2VDWA 3Q3VA 4LDAA 3C7TA 4R6WA 4ZIRB 5HUJA 5KYTA 3DOOA 3IT1A 5GONA 2QL6A 4EUHA 2O1XA 3SJUA 4R1OA 4X91A 2DJ5A 3UJ8A 3VNAA 2O8BA 2I66A 4G5GA 5CP8A 1MRNA 2H2GA 3MWLA 4ZAGA 4EA6A 2R8ZA 3T0GA 4YPFA 2B8JA 3ROFA 1Z33A 4TQGA 3V8BA 2L0XA 4LCBA 1ITZA 2IP4A 2VWHA 3PQEA 2VBIA 5ISMA 2A8YA 1RWOA 5FLYA 1E3DA 1PZXA 4X8LA 2R8PA 1GCIA 5C7LO 1XTJA 4B6EA 2PMEA 1ZD4A 2WZQA 1REQB 2WYOA 3L1KA 4WK4B 3O0DA 3IOBA 1ADFA 1AKNA 3AV0B 1T3ZA 5FWDA 4J94A 3EA4A 4MVJG 2IZ7A 3O03A 4DLXA 2VQ3A 2N46A 5B64A 5CFZA 5PGMA 1XPOA 1NW6A 1QZXA 3L9WA 4FD2A 3KJQA 1ISGA 5ALIA 4YRSA 2NNLD 3OLWA 6CHYA 2HADA 2Y1DA 1J2EA 2Y2VA 5E4JA 4EO9A 1I32A 4PHTA 2ZJ0A 3LXMA 3PUKA 5DWDA 5CDYA 2VZ0A 3H7AA 3KVNA 2FXVA 1Z6YA 2J59A 3JQEA 3E2MA 4KITB 3PDWA 3K5HA 4WHMA 4YFYA 4L4YA 4WECA 2EWVA 5BRNA 1J1ZA 1K7YA 2IU6A 2ZPTX 3ACCA 4FWIB 1EG7A 1FQOA 1HH4A 1WHSA 3DMTA 4PC3A 3VKWA 2X7JA 2WSSA 1BX1A 2I7VA 2QRQA 1FB5A 1BCSA 1LKZA 1RWWA 2BEJA 3LZ6A 4OKIA 5TRTA 2PH7A 3TXYA 4NXNB 3N70A 5E1OA 1WOMA 3IL2A 2CD7A 5FP0A 1UMBB 3MB8A 2Q3FA 5E1DA 3M4ZA 5A5GA 5K20A 1GCAA 3WBJA 3VZCA 3A7EA 2X41A 3K5IA 1XD9A 1YJBA 4PHCA 4LXGA 5CLLA 5EE5B 3L4EA 3WQRA 5FOTA 3VUFA 6NULA 4B6JA 1OXSC 5LNK1 2ZE7A 1C4XA 2MU1A 4OQQA 3CUTA 3H5LA 1QAOA 1T2AA 3EYWA 2YICA 3I5AA 4JR2A 3KWLA 4JT4A 4L57A 3VA7A 4U0JA 1KJWA 3LKZA 3T7KA 1WY5A 1G19A 1NA5A 2JVJA 1HUQA 3OC6A 5JMTA 5DNWA 2LNDA 3R2JA 1HDRA 1TYZA 4JKIA 1TECE 3QBDA 3WFJA 2R8YA 2OD2A 3IJ5A 3A4TA 3OOWA 3TDMA 3UTDA 4GSLA 1VMIA 3BMOA 1ID1A 1O8CA 3DBLA 2V7BA 3BSFA 3G5LA 4HX2A 1FNMA 5JTTA 4RD4A 2XT6A 1EGQA 1EU1A 1FSZA 1PK9A 4B46A 3VR2A 4DTIA 4QIHA 3E7FA 4XUCA 4MHOA 3I23A 3KQOA 1I2ZA 5MN4A 2YS7A 1QBKC 2GBGA 3L79A 4V0NA 3U37A 4Z4QA 3DZIA 4ZVNA 1OY1A 3TPFA 3ZHSA 2YWEA 1VTKA 5JYDA 1E3WA 3RS4A 3VSDA 4TQUS 2BBWA 3QVKA 3BCHA 2CLLB 1HYBA 1WB6A 1QH8B 2GPWA 3BWCA 3RBAA 2HXGA 3EGEA 3IJRA 1A88A 3FY4A 1U3CA 5KUTA 3W8EA 5C5IA 1PBNA 3A1DA 3ILHA 4H7JA 4LK3A 3H9EO 5HKOA 3K0HA 3IA2A 3PUJA 4G1MB 3WDSA 4C3OB 5HFJA 2FX5A 2ZJAA 3LDAA 5JMPA 3C3XA 2YJTD 4QBFA 4F4DA 3E82A 1K06A 1Z8HA 4GQIA 4EQ6A 4NYIQ 1U5BB 3U4CA 3ZY4A 1BMFD 1QDUA 5AW4A 2W93A 5IN4A 1MO6A 4Y6SA 3MTBA 2PX5A 1CB7A 2XF2A 5HKBA 3C43A 1KC3A 1RHKA 5KQGA 4QYWA 2Z08A 3B1JA 3H4IA 4AB1A 3U7IA 3LOUA 4RHCA 4YRRA 3AQIA 3HWX1 1SHKA 4RGYA 4AI6A 4NV0A 7GPBA 2F48A 1ZIPA 3ED5A 2AV6A 2FEOA 4RKRA 2VBCA 4OM7A 4AG3A 3IEUA 2QNIA 1YONA 4V24A 2W9XA 1C3XA 3F6PA 3M2TA 3KB6A 1IZ9A 2A78A 2PT7A 2VATA 2ZS9A 4JENA 4KU4A 4HLQB 1WDLA 2FWAA 2WJGA 5CT5A 1TMGE 1M74A 4W63A 2IPAB 3PJRA 4HLUA 1ZLYA 3LQ2A 2JHFA 3A14A 1ZUD1 2B5VA 2PS1A 3BMCA 4OYRA 4OHMA 4K3VA 4AF6A 3TR5A 4ER7A 2DHRA 4LW8A 4GLBA 2IK8A 4PLVA 1USVA 3KTDA 4CNQA 2CF5A 2OHHA 4YHHB 3DLBA 3D4IA 3MBOA 5EPUA 1EBUA 1DAPA 5DGTA 3OMWA 3M89A 3Q12A 3NM6B 5DI3B 3SYKA 1Y6JA 1TM1E 2MSNA 4M53A 4EHLA 1TZMA 1R0SA 2FN3A 2IU4A 5E2BA 5AXBA 1U0SY 1E9BA 5LJIA 4TXJA 1UBMS 3ED1A 1EFVB 1H6DA 2ZSUA 3PNVA 5DBHX 2PU7A 1TK9A 4IVRA 2BOVA 3PUYA 1XCBA 5TDHA 5IYZA 4KXUA 1W581 2XTJA 2YH2A 5G53C 4TXLA 3Q98A 4G0YA 1QV6A 4W1PA 5BOSB 5LP6C 4HD8A 1MO3A 1TL7C 1VIVA 2VJQA 1LDMA 3I9NA 4M37A 4UEKA 2X1HA 1MC1A 3B6JA 3B5JA 3TB6A 4AX8A 1FDVA 1UWLA 4L5JA 4D7AA 2BT4A 1G42A 4TT3D 2HHJA 1MLDA 2BEVA 3D7LA 5K0CA 2ZM5A 5D00A 2ZTSA 1QQ5A 2RFLA 3JQDA 3T3GA 5KINB 2Q9BA 2HJWA 3EMDA 2JGIA 4GF5A 2WD7A 1P0PA 1LF5A 2H31A 2O5VA 5L6LB 3CLRD 2PMDA 1FS4A 2Q2OA 1NMQA 2VNIA 3D7KA 1EBFA 3JD0A 3NAGA 3E0QA 1V1RB 4OHPA 4R98A 5DISB 1PTKA 1K8QA 4D92A 1F6DA 1SULA 2Q1YA 2WUEA 1RRPA 3DKIA 3GQVA 3H6KA 3SQLA 5BRAA 5IARA 1HT0A 2DFKB 4GC9A 4NAVA 1S5PA 4PRKA 4KQEA 1KEZA 3AKEA 1AH2A 1JILA 4YJ3B 3CB4A 4QU0A 4BB6A 3EPRA 2VS1A 4URYR 3V4SA 5JZMA 3NC1C 2QT1A 1RQRA 7REQA 4PHGA 4EFMA 4RESA 1CY0A 1JFLA 1P6QA 4FGUA 4X92A 2A5FA 4YONB 3H5TA 4GOJA 3OA0A 5AKGA 5F52A 3GVXA 4TL7A 2PWPA 4K05A 1QGED 2FK8A 2PZLA 3H1TA 1IB6A 1KSFX 1YJXA 2X40A 2ZQYA 4U9IS 1GXSA 2GXSA 2B82A 1YDGA 1GVHA 3ZKAA 4PVCA 4HQOA 2ID9A 1VLQA 2VAWA 3O8QA 3U3XA 1ECBA 5HFNA 1GNSA 1DBRA 2IHZA 3K73O 1WW3A 4OGKA 4FEYA 3B60A 5FORA 1U28C 2Y6UA 3FZEA 1O97C 2WP8J 2EZTA 1ZJJA 3NKFA 3OFNA 4XD7D 4FYYA 3WLIA 2E4XA 4BAUA 4MWZA 3LV8A 2R7KA 3U19A 4L0QA 1EEHA 2VHJA 2OWDA 3DFKA 2Z6AA 3IAAA 1TRHA 5F1YA 4KODA 1J0EA 2RAFA 3D0RA 3PD0A 4PX9A 5HRCA 4X1KA 3F9IA 4RH0A 1G0NA 1FYVA 4LRQA 3WKDA 1CRLA 4GMDA 1QORA 2BHNA 5BOSA 4DUZB 2QLNA 1U3DA 3C3JA 3LBAA 1J99A 3EBLA 3Q7TA 2EBWA 4NMXB 5JSZB 4JT2A 3SJAA 1UUFA 1VJ5A 3FNIA 1LGYA 5K0GA 2IYYA 4RXUA 4WKOA 2I1QA 4ZEOA 4OQMA 5GY7A 3T35A 1KBQA 5IZCC 3STXA 3FWHA 3OCZA 1QR6A 3DMTC 4HXGA 4MARA 3NM4A 4WUVA 1DWOA 2PO7A 2DPGA 4QJ4A 5LA6A 2RK6A 2E7ZA 1U7ZA 4G0WA 4U5XA 2RGYA 2C57A 1XROA 4OXIA 1YB7A 4YLGA 2ACWA 3I58A 4MI9A 3T7AA 3W5DA 2W4IA 5ELLA 2J5QA 3UANA 2X0NA 3IUQA 2KLHA 2ODEA 1HDOA 4IMPA 5FBWB 4X66B 5JAMA 3AOEA 4OTZA 1MVLA 1T0PA 2WKWA 3V1MA 5K8VA 2B8EA 1KYQA 1GPMA 3IBSA 1XPJA 1E79A 2HMAA 1CV2A 4LDZA 2OCYC 4L75A 1DBSA 2X7XA 1C3LA 1SAYA 5FXMA 2OCAA 3G2QA 1PJ2A 1PQUA 2FG5A 5BP7A 4RBNA 3IDZA 2Y68A 3H9BA 4BX8A 3WRYA 4Y6GB 2NZ2A 3KTAA 5DN9A 2B78A 3PHIA 1WMFA 3NIFB 3HSYA 2TECE 3WAGA 2RC5A 5A4IS 2YQZA 3I3OA 1KYYA 1RLJA 3SXPA 4BS9A 3LIPA 1Y7LA 1A2QA 3SS7X 3SKXA 4CF3A 4GS5A 1YRYE 2MYNA 5C8XA 1MUUA 1VG1A 2J9ZB 3A6LA 3KHKA 1IY1A 4QQFA 1XP5A 3WSTA 4E21A 3UGTA 4KAXA 4D4JA 1Z26A 4DC0A 2CVHA 1JJFA 4OVKA 2VXYA 4U7JA 2D3WA 2G67A 5EWMA 4U8GA 1DDGA 3CNEA 4BKOA 2CBGA 3HEMA 2DKOA 1IVSA 1UXGA 4QFDA 1OC2A 3L7LA 2X4GA 4F0JA 5EP4A 5AUNB 1U63A 1N8TA 3ESBA 3FAZA 3QXXA 4ZODA 4Q1DA 5MFZA 2JLWA 1XUOA 4Y9UA 2AJ8A 2IJGX 3OX1A 4KX3A 4DUGD 1VE5A 4EYQA 1K92A 1GL9B 1R1DA 2EKDA 2VNKA 2P1ZA 5TIIA 4TLBA 4IWXA 1YFLA 1L5RA 3DNPA 1XQ9A 4TRMA 3K1YA 4YUZA 1K1EA 3NTXA 5AW8A 1WNTA 4V39A 5EIBD 3G23A 3WGKA 1RQ2A 2PUWA 4GYYA 1RAFA 4PV7A 4JLDA 3SG0A 3NS7A 5JS2A 3IE0A 5AVXA 3KE9A 4QWWA 1MW8X 3MQFA 4XH9B 1KP2A 2BGUA 2IZZA 1YRLA 3C5WP 3D7RA 3IOCA 3Q6IA 1VP3A 3OKPA 3QPCA 2FW1A 3OCUA 2DQ4A 3NOQA 1AGXA 2XRYA 1KDTA 5LYYA 2ZRPA 3AYZB 1SN7A 4S1OA 1SO8A 1FMLA 2HNBA 3D3WA 1ODIA 4X62B 1SA0B 3GAMA 5JI3E 2J48A 2QTMA 4PO3X 1ABFA 2JDIA 3HDHA 2P2CA 3H6GA 4UATA 2I4LA 4JJAA 3WKAA 3FYUB 3OTGA 3ZS9A 2Q27A 2GPJA 5KNDA 3A1CA 2JZCA 5AOBA 1ZH8A 1TAGA 4DY4A 3DT8A 4Z7QB 5G0TA 5LA6F 2R6HA 2XY4A 3W4JA 5KO2A 4UU1A 1Q14A 3UMMA 4GVXA 1MKYA 4XUGB 2O59A 4D79A 4N5HX 5I7UA 1DUSA 4R2IA 4F2HA 3JQQA 5ANRB 3BK2A 1MO5A 2E4WA 4TTQA 1Z0AA 2QM3A 4EG8A 1SUIA 1I6WA 1V45E 1XTRA 2WAMA 3OTHA 2PMFA 1T2DA 3WNZA 4UE6A 3H8SA 2REQA 3U17A 2PS0A 3MTJA 1KYIA 5IHXA 4F9FA 4FJ0A 3UJBA 4OL0A 3MWEB 1E6WA 1JR3D 3TL2A 3ZV4A 4LRYA 3MXOA 1ZU4A 3KR2A 4YV0A 3S29A 2ZSDA 2H0RA 2JD1A 4DMRA 3RQSA 1NUUA 3JASB 4MR9A 5C4IA 5KWEA 3CNQS 4J7UA 2M6LA 2X22A 4LYHA 3DOUA 2IPOA 1A7UA 1J8QA 3KU1A 3ZI0A 4ARBA 1WV1A 3N3BC 5B58T 2NOAA 5C1IA 1XKQA 3QA3E 4JBWA 4B40A 2AR7A 1UMCB 3C3MA 1RWKA 3D2AA 3BIXA 4RMGA 3VHLB 3HPRA 3T7CA 1PEAA 1ZJ5A 2N1BA 3WWEA 5JS8A 2PJUA 1WX1A 3QW4B 2JRLA 1PNOA 4OMFG 1NW9B 5DMHA 2ATVA 1DCTA 4I4CA 4KI0A 4RPGA 2OCLA 1CZKA 1UMDA 4ILKA 1K8RA 2IVZA 3IAM6 4WCFC 3KEOA 4CV1A 4E6PA 1MPXA 1ZD5A 4RYDA 4BVKA 1Y8CA 5FRDA 3WK8A 6REQB 4E5PA 1FA9A 1IAQA 1UPCA 4GW3A 4Y0VA 5C8YA 5AO9A 3ROXA 2HK7A 2COEA 2X58A 2IYXA 1MFZA 1DKRA 3FDZA 3FYCA 3GUYA 3K92A 1R8XA 1IBMB 2NO9A 1BE1A 3KXPA 4GZMA 4YALA 2IUFA 4NZMA 4MI6A 4PINA 1CETA 1MC8A 4LK2A 4RHUA 2M6SA 5EXTA 2NAFA 4ASUD 2WIBA 1NX9A 3C1AA 2VPPA 3IEKA 2D1YA 2WPNA 4ACAA 1GRCA 4EB8A 3G9QA 2M98A 3CEHA 3EULA 5A06A 1KI4A 2XUIA 1PR9A 3EMVA 4K26A 3SLRA 4DIMA 5BV7A 5BSWA 4BY9E 2BFCA 1FUEA 1D8AA 4P4SB 1X7YA 2PFKA 2DPXA 4G5RA 1LBQA 2XGOA 3IMGA 4E4RA 4JOSA 3DOIA 5IM4F 2HGSA 3SS9X 1ODKA 2C4TA 5ENVA 3AUKA 3GJ0A 4DG9A 1K0FA 1AM4D 2KW5A 3QMWA 2P1RA 1E3MA 3ICEA 3P97A 4CE6A 2QI9C 3KJZA 4OBWA 1JKMA 1XZAA 4X45A 5EMMA 1JHAA 5IEJA 2PZAA 3DEAA 4Q4AA 2OV8A 4FONA 1N57A 5FTMA 5JS1A 2PH1A 1Z38A 2PVPA 4JR1A 4D99A 2ZRJA 2B4AA 5CJ2A 4U02A 1AQNA 4YREA 4ED9A 3DYIA 1OV4A 4XQ0A 2Q99A 1DG9A 2BFWA 5JNLA 3Q3GE 2BI8A 3IUJA 4TKMA 4S2EA 2FZWA 3WNCA 2E9SA 2X2OA 1P8JA 2EP5A 5ED4A 2COUA 1D2GA 3HJFA 1L6RA 4X0EA 3K0AB 4UULA 1EM8A 4PX3A 3CUUA 4AZ0A 3WHIA 1H2XA 2LCQA 2QYOA 5FWYA 2P2NA 1W29A 4IJ6A 1RYBA 4BLPA 2VPWA 4R7TA 2ASVA 3W8DA 1WCIB 1RQNA 3HCNA 3IPXA 3TUJC 1UC4B 1E18A 2YWGA 3INYA 1HEYA 1JQ3A 4OXYA 5I4CA 3AR5A 1YKGA 4F1JA 1KOGA 4BLQA 2DTEA 4QQ8A 1IATA 1L5FA 4KWCA 2H2DA 1GGFA 2ZBDA 2AQKA 3RSFA 1ZM2A 3JQCA 4K87A 3THSA 1KI6A 2WILA 4ENQA 4OHUA 3ZTTA 2HWYA 2VF5X 4FP9A 1NR1A 4RM2A 3L7KA 4OHZA 3BFXA 2ZSKA 2JFVA 4X61A 4RKFA 2Q7DA 1CY6A 1ORTA 4CG2A 2EKPA 4Y1GA 1G0OA 4GX1A 2AG1A 4H6VA 2GCOA 1U0HC 2WF6A 3OHSX 4HATA 3PGKA 4DY6A 4H1WA 3JYOA 2ZCVA 4YRZA 1LBSA 3JVDA 3R6LA 4BEBA 1NXXA 2MYPA 2ANCA 2ZB7A 5T8KA 5E7QA 1ONOA 3PDUA 1UZNA 3H2GA 1KIFA 5K6AC 3ORFA 2BSXA 1ULSA 1MO4A 5LQCA 1M8GA 4G65A 1TYBE 1LWOA 3B1XA 3LKBA 1JEJA 2UZ1A 3HUEA 3PGVA 4P4TA 3TLMA 3RSQA 4DPLA 3BH0A 2NSHA 1SURA 3EOAI 2GAOA 4TKZA 2P9EA 1SRQA 2XA1A 1N0WA 1CF2O 5JSHA 3BJIC 5ALZA 3GLTA 4AO7A 1XAJA 3HJBA 3EZ9A 3K8QA 3UAYA 1YIDA 2VJYA 1V96A 1SPXA 4RJLA 4BP1A 1ZM3A 1YR1A 2KS6A 1O96A 2W2TA 2C1XA 1P73A 3ZW7A 4OYLA 3FGPA 1CJSA 3TNFA 3MTIA 2F8TA 2AOTB 1GT91 2QU8A 1HBJA 3K0FB 2ZRDA 2EKZA 4EOGA 5MN6A 3V8PA 2ABWA 1WF6A 2H3HA 4L76A 2P27A 1T9KA 3FHJA 3GA0A 4O0MA 3ZE0B 1H3EA 2LV8A 1SC3A 2NU9A 2O3RA 4OQPA 1MDFA 4M89A 1DJLA 2BTQB 2PAFA 2VQSA 3FUVA 3P4UA 3QVGB 3HBMA 3KDSE 3ZIAD 4NCXA 3FPEA 4DE5A 1QNFA 2GKGA 3DMNA 3FKSA 1X0VA 1IIRA 3WADA 1NHGA 4L5CA 2AXPA 3L6CA 4CF7A 5ALHA 2ZJFA 4CKWB 5TMEA 2BI7A 1MXHA 5HFAA 2XZDA 4KHPB 2VAXA 4ROTA 4HLNA 2YWRA 1VPWA 3TZLA 1U2DA 5LU9A 1P44A 2G0TA 1Q15A 4AXXA 1E7RA 2VBGA 4BUCA 2D7JA 3IUMA 2NMVA 1OH6A 3T1TA 1J09A 3FFAA 4P0TA 1GZ4A 2F1HA 4M7PA 3LXUX 4XASA 1ILWA 1Q0ZA 1ST2A 2PMKA 4KL8S 3SK0A 2CXOA 3KJXA 3MS2A 4UNPA 4HEJA 4KFTA 4WKBA 3WGIA 3V80A 3AHJA 3QKTA 4DDHA 3C24A 3E2PA 1IXZA 2WC1A 1M6HA 1AMUA 4RTJA 2O0KA 4E7OA 5L53A 3ECCA 2J0SA 2UXCB 5K8JB 5TF0A 2ZR9A 3A6KA 2ATXA 4BN0A 2HK8A 2X0KA 4QVIA 2O8DB 3QVWA 3DAGA 3TIFA 3ZNNA 1FQWA 3ZW8A 1OI3A 2BSAA 3UGKA 5AUOB 1CYEA 4MV4A 2WG0A 4IIXA 3HA5A 1H2FA 1P2SA 5HJEA 1X9IA 1NJFA 4AN0A 2C7VA 3WDLA 3WGYA 4YR7A 1VSUA 1WULS 1YTLA 2MR5A 3S40A 4EJSA 2IOFA 4GYKA 3QZUA 4LVCA 4AY5A 1NG1A 1JKJB 4M7OA 4XUDA 1DUIA 2R48A 3DHWC 3WK9A 1T13A 3BEOA 1YZKA 5CA0A 3N7AA 1NF8A 1ZUWA 2VC2B 1L5OA 4L27A 5JVDB 1OPRA 3SIPA 3OTOB 1LXCA 1F20A 3EXHA 1KPHA 1O96B 1I9GA 3F5MA 4FHZA 1O9GA 4PFQA 4YAJA 1QK4A 3E6AA 2V7QD 4KN8A 1DWQA 4NU6A 4QXOA 1O8BA 5F21A 1ENOA 3EISA 5A6SA 4AJEA 4NL4H 3A25A 3T3NA 1WDKA 4LHZA 1R5OA