2QYTA

Crystal structure of 2-dehydropantoate 2-reductase from porphyromonas gingivalis w83
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
307
structure length
287
Chain Sequence
b'QPIKIAVFGLGGVGGYYGAMLALRAAATDGLLEVSWIARGAHLEAIRAAGGLRVVTPSRDFLARPTCVTDNPAEVGTVDYILFCTKDYDMERGVAEIRPMIGQNTKILPLLNGADIAERMRTYLPDTVVWKGCVYISARKSAPGLITLEADRELFYFGSGLPEQTDDEVRLAELLTAAGIRAYNPTDIDWYIMKKFMMISVTATATAYFDKPIGSILTEHEPELLSLLEEVAELFRAKYGQVPDDVVQQLLDKQRKMETLTGYVVREAEALRVDLPMYKRMYRELVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydropantoate 2-reductase
publication title The crystal structure of 2-dehydropantoate 2-reductase from Porphyromonas gingivalis W83.
rcsb
source organism Porphyromonas gingivalis
molecule tags Oxidoreductase
total genus 87
structure length 287
sequence length 307
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2qytA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qytA01
4QSMA 4YJFB 3WYEA 1U3WA 3JQ9C 4BNZA 2AEJA 2O4CA 2Q4EA 4AL4A 2UAGA 4ALIA 3AI3A 1ISMA 2P4QA 3KYDA 1KVRA 3I9OA 3M6IA 2I67A 1LRJA 1LSJA 4E5YA 4Y67A 5CP8A 3JQ8B 5IDWA 1EBUA 2ZKLA 3QLJA 3EC7A 4IBOA 2NVWA 4J2OA 2CFCA 3WWZA 1M76A 3W4IA 4BHTA 3U9LA 4ZN6A 1WDMA 2PK3A 1QRRA 2XPCA 3I6QA 1ZMTA 5F5LA 3ANMA 4ZQBA 3PP8A 4R4JA 2FY8A 5IAAA 3PLNA 2DLDA 4N5NA 4J1QA 3QQPA 5CDUA 4BNFA 4IDCA 1UDAA 3NYWA 2NSDA 1PJ2A 1HTBA 4TMFA 1Q0HA 2Q1UA 3HHPA 1LLUA 5BQFA 3AUUA 1UXKA 3L4BA 5A1TA 5K6AC 1EDOA 2F00A 2GZ3A 1GDHA 1KYQA 4PG7A 1NHGA 4E32A 4EBFA 3DBVO 4DPLA 2GN8A 4J4BA 3C8MA 4R9SA 2GN9A 4EJ6A 2CMDA 1GEGA 3TJRA 4D42A 1E7QA 2V65A 1LSUA 2V6BA 4RF5A 1L7DA 2BFOA 1Z73A 4PLWA 4UVHA 4D43A 1E1NA 1GPJA 4LRTB 4ESOA 4E2ZA 3GEDA 3F1LA 1LDGA 3DL2A 3IC5A 4MOWA 1U5CA 4CL8A 1ENYA 4DWVA 3Q3CA 1HDZA 1PGOA 3ZU2A 2GERA 5JSFA 4BNIA 5L7YA 2O4UX 3C85A 1S7CA 5T64A 3TZHA 1Q0LA 4FB5A 3PHLA 5TLSA 2WYWA 4KTVE 5JS6A 3HDHA 5JW6A 1EVJA 1N2SA 1AGNA 1GR0A 1HETA 4NPCA 1PEDA 1GV1A 3TOZA 3RFTA 3HWRA 3BMNA 1F12A 1WVGA 1Y6JA 4IDGA 3I6IA 2X22A 2ZB7A 2Y1CA 2DPHA 1AHHA 4R68A 3INRA 3OA2A 1NPYA 4CM5A 1Y9EA 4RLSA 4DTIA 5HRUA 3G0OA 1N1EA 4XR9A 3RCBA 1ZNQO 4XZ3A 4N54A 1E7WA 5I9NA 1YB1A 3EVNA 3F9IA 3RC7A 1BG6A 3Q11A 4DVJA 4BO9A 3KUXA 4EZBA 1Z45A 3NDJA 4KWHA 1M6WA 3KB6A 4ALMA 2AG5A 1XSEA 1CYDA 1XU7A 1U4SA 2DTDA 1ML3A 3TSCA 5THKA 4XYLA 4J6FA 1XKQA 4NK5A 1X0VA 1SOWA 4MO2A 1PWZA 4OOFA 4NBUA 1OAAA 4ID9A 1E3WB 2X7HA 5HTOA 1ZXLA 3UN1A 5ER9A 5FFFA 5BSFA 3KSUA 4IQ0A 2BI8A 1TT5A 1YE3A 1I01A 1LUAA 2PKQO 1B3RA 1C3VA 1I32A 2JHGA 1CWUA 3KXDA 1IE3A 5G0UA 1A9YA 4RVFA 5LC1A 4A27A 3OQ6A 2ZYAA 4RPLA 4XRRA 1GQ2A 4HWKA 3UH1A 4TVOA 4BS9A 4TKLA 3RU7A 4IXWA 1HKUA 3F5SA 1GZ3A 3ZW9A 1IPFA 3PHHA 1NXQA 2JAHA 5F3RA 4B7UA 4CMJA 3MJTA 2O3UA 4KWIA 3QWAA 2PD6A 3F5QA 3DBHB 2IRWA 1IHXA 1BMDA 4LN1A 1ZK1A 2VZ9A 3JQBC 5BR7A 5KWEA 5FYDA 4XIYA 4YEDA 4CM3A 5COQA 3VVBA 1WNTA 1EK5A 9LDBA 2W2LA 1P1JA 4B3IA 3ZWWA 4YPOA 2H1SA 1TVEA 4CM8B 4IDEA 4ZRMA 3T4EA 1DO8A 2NWQA 2GLXA 4YXFA 2UYYA 1ZH8A 5DN9A 3ZHBA 2UUPA 3CXRA 4ZQFA 5EN4A 5G4KB 2HK8A 3I9NA 3H9EO 1YL5A 5L4SA 3K96A 1UP7A 2NVUB 4GGOA 4XQGA 2O3SA 1BDBA 3P2OA 2EGGA 4JP3A 4YT2A 1SEVA 3BMCB 4GWGA 5ENDA 3U4IA 3D4OA 3ZN2A 1WDKA 2P91A 4FFPA 4IS2A 3FNHA 1BHSA 4ZQEA 2GPTA 3RAJA 2Y1OA 4W6ZA 2C7GA 3U62A 5MGBA 4E3ZA 2C20A 2Q45A 3DAFA 1CRWG 1ISHA 4AJOA 3ETGA 2ZB8A 3HSKA 4JLWA 2HMSA 3S55A 3DMTA 1M66A 2RBEA 4YWJA 3EZLA 3N7UA 2EWMA 3WICA 4YAGA 2QRKA 4I9NA 1QLHA 3WGTA 2EF1A 3TZ6A 5TS3A 1I24A 3WQSB 2PR2A 3JD2A 3O38A 2UUOA 2G0TA 4NZ9A 2YV3A 3WX0A 2VHWA 1ADGA 5JCXA 1EVIA 3UCFA 2PGDA 2DKNA 1X1EA 4K6FA 3QP9A 4NK4A 2WYVA 2X5JO 4KZPA 3UVEA 2A92A 2PD3A 3O8QB 5CG2A 3AFNA 1RJWA 4DXHA 3BA1A 3AW9A 1I33A 3UHAA 1IUKA 1NR7A 1T2AA 4YYZA 2PZKA 4RF3A 2EKQA 3CUKA 3GAFA 4HFRA 2NACA 4UAGA 1P0FA 4CM9D 1PJLA 4HUJA 3WBBA 3ASUA 2EW8A 4I08A 3L07A 3G3EA 1N9GA 4QFCA 3H3JA 1P1KA 1OC4A 4TSKA 4BO7A 1PGQA 5I7FA 2E82A 4E30A 1C1XB 2QZ9A 1MLDA 4BNMA 1W4ZA 4NU6A 4XCVA 1YO6A 8ADHA 3V1TC 3GGGA 3K9QO 1R66A 1E3JA 3KM0A 3OEWA 3OP4A 3KETA 2WJPA 3IAHA 2VTDA 3X2EA 1SB8A 4YAIA 3JD3A 1ZO8A 3ZHZA 1DSSG 4P22A 1H93A 5GZ3A 3DOCA 3TWOA 4O6VA 5THQA 1GQQA 3DONA 1CQIA 4ALLA 4DLBA 5L7TA 4FJ2A 1TLTA 1U7HA 4A5OA 1DEHA 3RWBA 2HRBA 3E6AA 3QIVA 3H9UA 4IDDA 3D1LA 5F1PA 1F17A 3WMXA 4BIIA 1VJTA 2CUKA 4BO2A 4EI2A 2CNBA 1MG5A 4RQUA 3PFWO 3FR7A 1X15A 4FGWA 3HDQA 4CQLA 2ZJ1A 1NNUA 2Q46A 3GUCA 1XQ6A 2Q2VA 2Q2QA 3GNQA 3QWFA 1JVSA 1YDWA 5ER6A 5JPIA 3JQ6A 5I9LA 4QUKA 3GNTA 4DRYA 2I5PO 1BXGA 1P44A 3QVWA 4DBZA 4XWYA 1E7SA 2DPGA 4FCCA 1NASA 2R6JA 1PGPA 4XKJA 1ADBA 4RVUA 1B14A 4NJMA 1YOVA 3GN2A 3GQVA 3VC7A 3EAGA 3FI9A 1NX6A 5A3JA 2VYNA 4GMFA 5IJZA 4XQEA 2VNAA 3JD4A 5DZSA 3C1AA 2RIRA 3NDIA 1LSSA 3DOOA 4KMSA 2GNAA 1HT0A 1E6WA 5IDYA 5BT9A 4LVUA 4INAA 4L76A 1T2EA 1RWBA 1U9JA 4R3NA 1VC2A 2JL1A 3ZWMA 3L9WA 4EDFA 2J5QA 4M54A 5JE8A 3PLRA 4CMCA 4J0EA 3TPCA 1GD1O 1DIBA 1SC6A 3JQFC 4ITUA 1E1KA 1GAEO 3V5NA 2JCVA 1YBAA 5CPBA 5JDCA 1JU9A 4OAQA 4UUMA 2BFMA 1NAHA 1QV6A 4PLHA 1D7OA 1VL6A 4JXKA 1HE4A 4E2YA 1J49A 3M2TA 3AOGA 3KYCB 3ONEA 3NTOA 4QX6A 3VPXA 2BGMA 1RM3A 3H3FA 4ZA2A 4DL9A 1E77A 1DLIA 1AXEA 3K8ZA 2AQIA 4FQ8A 3DZFA 5K9ZA 3PYLA 4UUNA 4YTEA 1PJSA 1QYVA 1T24A 1A7AA 4WEQA 3CEAA 2ZCVA 5DP2A 3JYPA 4MINA 2VTEA 2WMDA 3Q2KA 2HK7A 1MFPA 4B4VA 1GTMA 3WOHA 4W7IA 3FBGA 1XG5A 3ABIA 3DC2A 1ONNA 3DTTA 4PGFA 3H9QA 3QRWA 1PJBA 3WNQA 5L4LA 1WDLA 3ONDA 3TL2A 3VTFA 4B3HA 3HE3A 4AJHA 4CM4A 1K6JA 2NM0A 3IIEA 3EZYA 2VN8A 3FNEA 4L4XA 2TMDA 3PI7A 1NQAO 2GUGA 2RH4A 3CTVA 4OYRA 4L0QA 2OL4A 4W82A 5JAZA 4CLOB 4B4WA 4XD2A 2IEBA 3IOYA 5IN5A 5EL0A 3I52A 4CV1A 3DR3A 3CMCO 3MJEA 4IS3A 1ORRA 4GLOA 4ALNA 2AEFA 4P4NA 3PJDA 1ISJA 1I5RA 4YJHB 4N5MA 1H94A 4HNHA 4ZU3A 2EKLA 4FSHA 1BW9B 3DBRB 2IODA 3K92A 3GVCA 4IMRA 1YKFA 2CVQA 3VZQA 1A7KA 2EJVA 1LXCA 2NNLD 4IINA 3ZV5A 2X4GA 1X0XA 3QSGA 2WM3A 3QVSA 4LK3A 3ZV3A 4JP2A 1XDWA 3P2YA 2B36A 2BI7A 3INTA 1E92A 2ET6A 3HB5X 3QVXA 4OJNA 3WB9A 1CEQA 5A9SB 3GZNB 3PFFA 3KO8A 4R1UA 1NFFA 2VWGA 1EUCA 4FFRA 4KQWA 4NFSA 3W6ZA 5GY7A 4Z3DA 2A4KA 2BH9A 1U3VA 4E12A 5MDHA 1R4MA 4YAJA 1B8UA 3ON5A 4J90A 3IUSA 1WWKA 1TI7A 4OXYA 4KDFA 2VOJA 2QQ5A 5C7OO 2O7SA 1QR6A 2WTBA 3LZ6A 4TRMA 3W4JA 1FDTA 3AUAA 3KYDB 4GQAA 3PJEA 4GX0A 3GG9A 1DJNA 2Z5LA 4RDIA 3UOGA 2X58A 1XLTA 2F1KA 3JQ7A 1PX0A 1ZSNA 2VQ3A 3GC6A 3RBVA 2YDYA 4CLHA 3MJVA 1IYZA 5H83A 2WWRA 3ZU4A 1YRLA 4JBGA 3HNPA 4B3JA 4EUFA 4BL5A 5A5EA 3ETEA 1LRKA 3C3XA 3E9QA 1I2ZA 3UICA 3PDUA 2YV1A 4MJLA 4CLDA 4WCFA 4BQRA 5TX7A 1JKJA 3MWEB 2AHRA 1H2HA 1F14A 2D59A 4WCDA 1P1HA 1ENPA 4BNVA 2GSDA 5CDYA 2D4AA 3CH6A 1LDNA 4A0SA 1P0CA 2EIHA 2H9IA 2J5KA 4Y8VA 3V2GA 5L53A 3OBBA 3F6YA 1WW8A 2D5AA 1M75A 2P5UA 4GSKA 2ZATA 3GDFA 1XHLA 4DIOA 5T8KC 4P4LA 3JQAB 3EYWA 3GHYA 3PVZA 5EINA 1QMGA 4AVYA 1T25A 1PGJA 4BQPA 2FHSA 3WSWA 2VT3A 3LF2A 2IZ1A 4YQYA 4BMNA 4I5FA 4C4OA 3H8VA 1TEHA 3GGPA 4FC6A 1XWFA 3SEFA 2FWMX 2WD7B 3FR8A 2E4AA 4I9HA 4U6QA 3LLSA 1G0OA 1V3VA 1E1MA 1VPDA 4XX0A 4L4SA 4MKZA 5IF3A 4KQXA 4BNTA 4W7HA 1DHTA 1UAYA 3HG7A 1XA0A 3I9MA 4NU5A 2D8AA 4D44A 3PJFA 1T1SA 1VRWA 4II3A 5KKAA 3LC1O 2PGJA 3UKOA 3GZ4A 2RH8A 3GOHA 3GG2A 4GLLA 5F1KA 4Z0PA 5U1PA 3BMNB 5DULA 1DC3A 2Y66A 2PA3A 4E21A 3IDSA 2IYOA 1Y5RA 5HWSA 5C7LO 2P2SA 2POQX 3SBOA 4CQMD 4LCEA 5JFOA 3PIIA 5TQVA 2BFAA 3LU1A 3B6ZA 1EUDA 2C07A 2VZ8A 2VHYA 4M1QA 1UAGA 4PLCA 3ZCXA 2YY7A 1BGVA 4R51A 1EMDA 2WEKA 4DQXA 1ZBQA 2I99A 3ZWYA 1P45A 4MIEA 1H5QA 3I1JA 4R3WA 4BNJA 1Q0QA 1DXYA 2AE1A 3ZWCA 4DQVA 4XQ9A 1QORA 3D4NA 1TB4A 4N7RA 4PLTA 4U0KA 4DQUA 3HDYA 1FDVA 1VE9A 3E5RA 1A5ZA 4H3VA 4J9VA 1QXSA 4Q3BA 5DF1A 2AA3A 4OL9A 4O59O 3MCVA 4ND5A 5G0VA 2XXJA 4DMLA 2EEZA 3RFVA 2FOIA 1LI4A 4ALKA 2EERA 1DRWA 3IKVA 5AVOA 4RO0A 4U8GA 4B79A 3U4CA 3NJ8A 3R3JA 1HWYA 4LGVA 4RDHA 1I10A 3STHA 4E5KA 1EVZA 3EK2A 1EEHA 2HMWA 3GFGA 3ZHXA 4BKRA 3L6OO 2ZTVA 5GZ6A 3BTUA 3JQGB 4U6SA 2DTEA 2PTGA 3JYNA 2FR1A 3LVFO 1Y5MA 5ITVA 1QKIA 2HO5A 1IOLA 4CLXA 3FHLA 4CMIA 1GY8A 2JAPA 4J7XA 1ONOA 3ZWPA 4I1IA 3AOEA 4J49A 4JJIA 4NBRA 1H6BA 2JHFA 4CQMA 2DBZA 1R0KA 4OKIA 2O3TA 2I9PA 1PJ3A 4OXNA 3ZWAA 5FF9A 4AJIA 3JV7A 2X0JA 4W9NC 1ENOA 5U4QA 2XF8A 2OHXA 3JD0A 3IJPA 1HL3A 1PZGA 1V3UA 2C0CA 3OFSA 5JC1A 2V6GA 3OICA 4XYBA 3WGZA 2E6UX 2HUNA 3HDJA 1A4IA 1DOHA 2AE2A 1ZSYA 2CD9A 2FPIA 2O3RA 5DP1A 1I0ZA 3PK0A 3PZBA 1DPGA 3IS3A 3NT2A 1BVRA 1T26A 1V3TA 1C14A 1O95A 1MP0A 3NEPX 4XJTA 2X5OA 5A03A 1PWXA 2EP5A 1GL3A 1KEUA 4RQTA 3VH2A 4URFA 1TT7A 4D0SA 1YJ8A 1O5IA 1U3UA 1EQUA 4MVJE 4XDZA 3NTRA 4M49A 1MUUA 3WQQA 3GAZA 4H16A 4OSPA 3T7EA 4EEXA 4JCOA 1ZMOA 3QE3A 2OFPA 4QXMA 3OQ1A 1YQXA 1MC4A 4GI2A 4KUEA 1A72A 1JKIA 4B8ZA 1PQUA 1YB4A 1H9BA 1H6CA 3WYBA 4CMEC 3AUSA 2X1HA 4CR8A 1LDEA 1RM5A 1JWBB 1IPEA 5DCYA 3D4PA 1IY8A 4E5MA 5EESA 2YW9A 3HJAA 4WGGA 5CDGA 5JLAA 4O0LA 1QP8A 4YRAA 3ANNA 3V2UA 2VRCD 1WXDA 4WLOA 3WFJA 1NP3A 3KEOA 3I3OA 5ITWA 2P5YA 3HADA 2UDPA 1D1TA 3ETDA 4XRGA 5JY6A 2DUWA 4IUYA 4PCVA 4B7CA 5KJFA 2WE8A 3EUWA 4FFMA 4AJNA 4WLVA 1N9GB 5I7VA 2PD4A 4GVXA 1DRUA 3U09A 4XYMA 3DO5A 4JGBA 4J3FA 4BOYA 1ZEJA 4IJUA 3H9GA 1A27A 3G17A 4NH4A 3U5TA 4P4GA 1NWCA 3RU9A 3BTSA 1BVUA 1ZK4A 4HKTA 1TXGA 1D8AA 1K6IA 1UJMA 4JN6B 5BSHA 5JAIA 5COBA 5AXBA 1HDYA 1SO8A 3S2IA 2XAAA 2HQ1A 4IQGA 2W2LD 3JYLA 5ENVA 4PZEA 3VTZA 2Q1TA 3WBFA 3ZV6A 2EXXA 4CLRA 2C5EA 4BNLA 2OZPA 2DTXA 4DA9A 2OOSA 3ZZNA 1W6UA 4R41A 3PYXA 1F0YA 3JCZA 5L40A 3HFGA 4RF2A 5KVCA 2Y1FA 4IXTA 3WSVA 2Y68A 4YAKA 4HX5A 2DFDA 3DZBA 4HBGA 4O63O 3WG9A 1BXGB 2VRCA 3PTZA 5IDXA 3HFSA 1SAYA 4FGSA 4BKPA 1WPQA 3AY6A 4R9RA 3PXXA 3RKUA 1GV0A 1ENZA 3NUGA 1OOEA 3WDSA 1K3TA 3GA0A 3IUPA 2RHCA 3V1YA 4R1TA 3VH4A 3K73O 4GX5A 3QWHA 3G49A 5CEEA 1EQ2A 4ZVVA 4PFJA 3MZ0A 1NBOA 5I8ZA 5CEFA 1G0NA 3OF2A 3OIDA 1C0PA 5TNXA 1HE2A 5JNLA 1LLDA 1Z82A 4K28A 2X0RA 1KETA 3GMSA 1DIRA 1EE9A 5EIOA 4D79A 4IIVA 1DIHA 5CFZA 1U2DA 2FRDA 2HSDA 1DJQA 2W2KA 1RYDA 2O48X 1YBMA 1SBYA 4UEKA 3DMYA 4WOJA 1C1DA 4AJEA 1MG0A 1E7RA 1CERA 4J9UE 4XEHA 1KVUA 2CZCA 3SXPA 3Q0EA 3ZU5A 4EJMA 5GZ1A 2D3TA 1Q7GA 3PEFA 2EW2A 2O23A 4W4TA 1HYGA 1Y1PA 1PJTA 4TZTA 2Q4BA 5TT1A 4E5PA 3G1UA 5DOVA 2X9GA 3RKRA 1SOVA 1R15A 3JQDA 3Q1LA 2YHUA 1YVEI 1WZEA 5AYVA 4RPKA 2R00C 1PL6A 4P38A 4DC1A 2W98A 1UDBA 1YS4A 3MWDB 4H15A 4AJLA 4BVAA 2ZTUA 2X6TA 5KJ6A 3TRIA 3TZCA 5JAQA 4IDAA 3GPIA 2CF5A 2BRUA 3DAPA 4E4YA 3TNLA 4KUGA 3JQ8A 3KV3O 4Z9XA 5K0ZA 3L6EA 1FJHA 1HRDA 3ULKA 4PLGA 4YJGA 3I4CA 3BTVA 4AJ4A 5JO9A 3WR5A 4FFNA 4HADA 4E5NA 4UUOA 2G17A 5KVVA 4WECA 3ADPA 5T8KA 1FDWA 2C54A 3E9MA 5FWNA 3NDRA 4BNHA 5CEJA 3CZMA 2D1YA 1YQGA 4EW6A 4DIBA 1A4UA 3RI3A 3RIHA 4FBGA 2BGLA 1BRMA 3IP1A 1QYCA 4Y6RA 3C7AA 3D3WA 3OJ0A 1T1RA 2VHZA 4G81A 4KOAA 4WK6A 4BKUA 2VYND 1XQ1A 1LBEA 2BD0A 3FRJA 3RQSA 2DQ4A 2A9FA 3WLEA 3RUIA 3G1TA 1LLCA 4FR5A 4Q39A 3SJ7A 1IULA 4ZGWA 1E7YA 4C7JA 3HN2A 1GUZA 4ND2A 2AEMA 3PYMA 2JFHA 4DIFA 4D45A 2B4RO 4Q3CA 1PJ4A 2A35A 4J2HA 2X8LA 3KLMX 1EUZA 1AHIA 3W4KA 4KTTE 3WGHA 3SLKA 3OH8A 3H65A 3I9JA 5BNFA 3WGYA 3PWSA 3M2PA 1VSUA 3RBZA 1H6DA 1UH5A 3FPCA 3GDGA 1GUFA 1HZJA 3GDOA 2Y0CA 4IJKA 4BNXA 5A06A 4YCAA 4DMMA 1VKNA 2PLAA 3AM3A 4FS3A 5KIAA 3WS7A 2IDZA 1RPNA 3E1KA 3GMDA 5EQFA 5BSEA 1LA2A 1JAXA 3Q6IA 5BNTA 4MPDA 4BV8A 3I5MA 3RC1A 4FFLA 1ZFNA 4J4TA 4YA6A 3HUDA 4GVLA 4RORA 4BMVA 3RUHA 1PTJA 1PL7A 3WGGA 3BMOA 3BZUA 3F47A 3JQ7B 5GMOA 1MC5A 4I9UA 4LW8A 4UULA 2P4HX 1V0JA 2EG9A 5DOZA 3ITDA 1K89A 1P1FA 2OO5A 1X7DA 1VLLA 3NAQA 4JIGA 3WGOA 1YL6A 5CG1A 2H63A 5ICMA 3OETA 4GL4A 1R4NA 1XR3A 2I3AA 1BTOA 3A14A 2ZCUA 3E82A 4AJJA 4PN3A 4RLHA 2PFGA 1JW9B 4L74A 5JBIA 4FDAA 2BMAA 1DC5A 2NU8A 1QYWA 4MVJH 1FF9A 1E3WA 2FR8A 4UEJA 4CPDA 1PS9A 3GFBA 5A5FA 4U5QA 7ADHA 3UF0A 4JQCA 4OOEA 2PZMA 2NV6A 4MVJA 3WQRA 3FWNA 3EW7A 3SJUA 1P9LA 1B0AA 4XJSA 5F21A 4MDHA 1ZVMA 2AW5A 5LCXA 3DFZA 2VHXA 1C0IA 5CHEA 5TT0A 3LT2A 5COAA 2OXIA 4OGWA 4OMUA 4YT4A 1JDJA 4Z3KA 1ZUD1 5ADHA 2Z95A 3S2GA 4CMAA 3ZNNA 2PZLA 4GWKA 1E5LA 2VHVA 3L4BC 4TRRA 3VH3A 5I7SA 4NR0A 5AQ1A 2W4QA 1B7GO 1YDEA 1B3BA 3H5NA 3OJFA 5AXAA 1MV8A 4D46A 3AWDA 3W8FA 4JNKA 3HN7A 4LRSB 4DPKA 3JQ9A 2PV7A 5DNAA 5HS4A 3TZQA 5KVSA 5IFLA 3GLQA 2NU7A 4NMHA 4R01A 3H2SA 3RVDA 3QA9A 4DYVA 3QWIA 3F4BA 4FN4A 3MEQA 4F6CA 3KOUA 1DDOA 3IQDB 5EQDA 1GCOA 4BGVA 3PWZA 5B1YA 4X54A 3RSHA 3LLVA 4GKVA 5G4KA 3CIFA 1I2CA 4FJ0A 5KTKA 2V6FA 4AJKA 4XB2A 2GZ2A 3KYBA 2NVUA 2Y67A 4FC7A 5IZCC 5KJCA 3BMCA 1EE2A 3GGOA 1PZHA 3CTMA 4BUCA 1HYEA 1NVGA 4WLEA 1ID1A 2B5WA 3U4HA 4J4HA 3PHGA 1NVMB 4DGSA 3KZVA 3VZSA 4NNJA 1DC4A 4J91A 4RF4A 3P19A 1DAPA 1U2GA 1NM5A 1ZZEA 3C1TA 1T2FA 1U5AA 2P9CA 4EITA 1K5HA 1X7HA 4I5EA 5K6AA 1ZCJA 1W0CA 1O0SA 3FN4A 4LVCA 3AU8A 4RV9A 3CKYA 3KVOA 3UGKA 1UR5A 5AOVA 1T2CA 6ADHA 4EGFA 3VDRA 1YWGO 1I36A 2Y0DA 4PG5A 1IHYA 3ZWOA 2J3KA 3B1KA 3NV9A 3UCEA 4BMSA 3C7CB 3KSZO 2DU8A 4BNNA 1ISFA 4EYEA 2ZYDA 1ULUA 2EHDA 5H81A 5L7WA 2ZTMA 1EBFA 1GZ6A 2BGKA 2NTVA 3UXYA 2D0IA 2NQTA 2VUTA 3E9NA 5DBIA 4R1SA 4XR4A 1V9LA 2D5CA 4CJXA 1ZSVA 4QQRA 4UREA 3NTQA 4L8VA 1QYDA 2Q1WA 4YDRA 1IZ9A 1PGNA 1W8DA 5L51A 3UAGA 1DLJA 4D3FA 4DUPA 3GY0A 3OQBA 3KEQA 5JYEA 1K0UA 5B4VA 1KY4A 1Y8QB 1U8FO 2G5CA 4BGUA 1C1XA 1H9AA 3B20A 4Y9DA 2BHLA 2C5AA 1KIFA 3I23A 4E33A 4BB6A 2WE7A 2QW8A 1MX3A 2P68A 2VZ0A 1O94A 3LDHA 1Q1NA 4KUHA 4N5LA 4DBVO 5IG2A 1E3LA 3EHEA 1OMOA 5AXDA 2IYPA 1UZLA 3GUYA 1IB6A 4HXYA 3CZRA 2FZEA 4QTZA 4AICA 1M6HA 1UZMA 2CDAA 4D0RA 5LDHA 3FTPA 1NTOA 2NADA 2QX7A 2EGHA 4NBTA 4U7WA 4HNGA 4ND1A 2FMUA 4BNUA 5LDGA 3VHRA 1YH3A 4D41A 5JCJD 1D4FA 4HFNA 2PGLA 4J16A 3GVHA 2ZJ0A 3WNVA 3Q9UA 4YACA 3DZJA 3PGJA 3LT4A 3E48A 3CSDA 2H6EA 1SNYA 3GVIA 3H7AA 3KTDA 4IJWA 4PLZA 2I76A 2VRBA 5TSDA 4DYDA 3JYQA 1I3MA 2ZQYA 2DBQA 3S2EA 3CINA 3JQCA 3DMTC 1P3DA 4MP6A 4XIJA 3OHSX 1MGOA 1HDCA 1E0DA 3INGA 3A4VA 3H5AA 4YT8A 4EEZA 1R12A 3D5TA 4NDNE 3JQBA 1OI7A 2Q3EA 1M67A 1VKOA 1B16A 2FPPA 3DHEA 2HAEA 2HKIA 3H2ZA 4PVDA 4QO8A 1T2DA 4RVHA 3ORFA 4I5DA 1X13A 4NIMA 1WAMA 4MVJM 4N18A 1CETA 4RZHA 3D7LA 1T4DA 4GH5A 4MIOA 2IEDA 3AM4A 3DTYA 3RUFA 2Q49A 2I65A 3ZH2A 1ZEMA 3PRJA 3I83A 2DVMA 1JKFA 4NI5A 3OMLA 4MVJF 4QFDA 1GUYA 4R1NA 2J3HA 1HXHA 3RBXA 2EKPA 3DEYX 5JC8A 1Y8RA 4CMKA 1ISIA 4R5HA 4L75A 5KKCA 4BKOA 2RAFA 5HS6A 4LMRA 4B7XA 3BIOA 4J7CA 4PZDA 1NR1A 2FP4A 2ZB4A 2HMVA 4Q3DA 1YL7A 5JCJA 5B12A 1J0XO 3RUDA 3F46A 5A04A 5DCUA 4TROA 2J3IA 2YFHA 4UVGA 4K26A 3WFIA 3OA0A 3FWZA 3NRCA 2NTNA 3TF5A 3QJ5A 1JQBA 2PNFA 1LQTA 5G4LA 1MFZA 1P77A 2X9NA 2HLPA 4CLRB 3QVOA 1UZNA 3ROPA 1DB3A 1SB9A 3MTJA 3H6KA 3QY9A 4OQZA 5L45A 2GF2A 4Q3NA 4DC0A 1W73A 2IE0A 3FD8A 4IGFA 4PVCA 1ZJYA 2DBRA 4TRJA 5J23A 1NPTO 4E2XA 4IZHA 1NVTA 5DT9A 1PU2A 5T67A 3VPGA 1KEPA 3ITKA 1X14A 3A1NA 3GN1A 3KRTA 3R0IA 4CUKA 5BNIA 4MP8A 1H0KA 2UV8A 1DFHA 3FTNA 3L0DA 5L3ZA 3EY4A 3Q9NA 3PPIA 1L1FA 3RUCA 1TT5B 2GASA 2X86A 3ASVA 1PJQA 4CV2A 2O2YA 3B1JA 4CR6A 2GYYA 4CLOA 2DM6A 3EDMA 2DC1A 2NTJA 3GRPA 1MXFA 3ZW8A 3K30A 4LCJA 4XDYA 2Q99A 5A3VA 3BMQA 2J8ZA 4XGKA 4M86A 4QECA 3KLPX 4B8WA 1AN9A 3ZU3A 4Y6PA 2IXAA 4YJHA 4LSMA 2JCXA 3SLGA 1FMCA 2OP0A 1EFLA 3VKVA 3L9XA 9LDTA 3MJCA 3PJGA 4WE3A 5ILOA 4AJ1A 4CMHA 3N58A 1JAYA 2BF7A 3KBOA 4KP7A 2OBYA 1C1DB 1KY5A 3OJOA 1E3SA 4FJ1A 5KCZA 2W8ZA 5HA5A 3ZNQA 3AU9A 4OH1A 2JFGA 1U4OA 5G0TA 4F45A 4GKBA 1ZW1A 2CVZA 5A9SA 3ENKA 1LDBA 3KHUA 1X1TA 1F8FA 1P31A 4GX1A 4RCVA 4U0JA 4WPGA 3I4FA 4UEOA 3W8EA 4O5OA 1IZ0A 1OBFO 2AQHA 4I8XA 1YBVA 2QRJA 2C7VA 2Q50A 1JLLA 1PZEA 1NWHA 3O26A 3VH1A 3AFMA 4YVFA 4AFNA 2G76A 4RL6A 4WLFA 5A4DA 3E03A 2ZK7A 1GCUA 1U8XX 3FPLA 3VDQA 4BNWA 5KJEA 4YRDA 1MA0A 1R0LA 1JTVA 2O3JA 1YQDA 1GADO 1XCBA 2PWZA 1E6UA 3U0BA 3R3SA 3K31A 2GR9A 4XGIA 2DFVA 1OZAA 1ADFA 2QHXA 3DXFA 3WIEA 1I3LA 4CL3A 1V6AA 4YBZA 1DAOA 1FDSA 2YZ7A 1ARZA 3MOGA 3ROKA 4YJGB 4WLUA 4F3YA 2GN6A 3RC9A 3T4XA 1CDOA 2JFFA 1BXKA 3ICCA 4O1MA 2CY0A 3EVTA 3WWYA 3L77A 1GQYA 2GO1A 3LC7O 4J1TA 3WYCA 5JXWA 4ZQHA 3S2FA 4RPJA 2FR0A 2VWPA 4K9DA 3RUEA 3ADOA 1MB4A 4GGPA 5JDIC 1A9ZA 3C7DB 5DCWA 5FI5A 1XGKA 2GD1O 5FEUA 4BNKA 3DAGA 4IM7A 2DT5A 2YHIA 1GYQA 1KERA 1UXIA 3D3WB 1YJQA 1NAIA 2VWHA 3JQFA 4AJPA 1VM6A 3JQAA 4L4RA 1U3TA 1EDZA 5CAEA 3BTOA 1X7GA 1ZIDA 3CE6A 2YFQA 2VYVA 5IXYA 4M8SA 5DBFA 2Y99A 4ONEA 1U28A 4HY3A 1PS0A 1UP6A 3C24A 4J43A 3B1FA 5C5IA 1Z6ZA 1ADCA 3I9KA 1DFIA 3MJ4A 4DLAA 4YQZA 3ZWVA 1NQTA 2WD7A 5KJ1A 3ZNPA 2HU2A 4PRKA 2BELA 4NBWA 1KEWA 2NU6A 3ZWXA 1HDGO 3RD5A 3D5QA 4FOSA 1R0SA 1D3AA 1I8TA 3RJ5A 1LDYA 1PJCA 2ILTA 1HSZA 5EMHA 3AUTA 4C7KA 2GZ1A 1GEEA 5IZCA 1HDOA 2LDXA 3D0OA 3OECA 4NQZA 3AY7A 3ROQA 4Z9YA 2CVOA 2GCGA 4YAEA 1LSOA 3OIFA 4OIMA 3D3EA 5EPOA 4CQLB 3DBLA 4NFHA 3E8XA 4GAEA 4XYGA 3NT4A 4RPGA 2PKRA 3BMOB 4BGIA 2BFPA 1QG6A 3LT1A 3GPDG 3ZGYA 4GSLA 5L9AA 3PIDA 4S1VA 5ILGA 2C29D 2VCYA 5B4TA 2VOEA 1KVQA 4A2CA 1ZJZA 1H2BA 1LC3A 2JJYA 4OO3A 4NJMB 4R16A 1N1GA 1YOVB 4R69A 2H5LA 1HLDA 2DAPA 4YB8A 1R4NB 4BV9A 2JD2A 1VJ1A 2E48A 4OM8A 4OXKA 2B35A 4RVDA 1IL0A 1B8VA 3PZRA 1B8PA 4M89A 1TA4A 4D3DA 3VVCA 4AG3A 3PQEA 3SX2A 2OP1A 3M1AA 4WCFC 4Z0HO 2AMFA 1UXHA 3DZHA 1Z7EA 2YUTA 3IJRA 4JK3A 5CPFA 1K6XA 1E5QA 2DBVO 3LYLA 2B4QA 1KC1A 1GU7A 1GPDG 2CF6A 4HV4A 1N7GA 1V35A 3GEGA 2NLOA 4ZRNA 3IMFA 2CDCA 4GPD1 3UW3A 4CUZA 2VNSA 1YONA 4PLFA 3DWFA 2J6IA 3O03A 3JQGA 3SC6A 1DIAA 2AXQA 3L6DA 3TZKA 1LQUA 4NBVA 1HDXA 4BKQA 4D7AA 1VSVA 4E6PA 5G0SA 5ES3A 2OUIA 5KVQA 2X23A 3FCOA 1HLPA 3LT0A 4NHEA 4XA8A 2EP7A 4A7PA 4HFMA 4OSOA 3SC4A 4YJFA 3C1OA 2BKAA 5U9CA 3RASA 4DLLA 1UXGA 1VL0A 1YXMA 3H4VA 2FSVA 1I3KA 3TQHA 3COSA 2FZWA 4XB1A 3LSYA 4QO7A 4UVDA 5T5QA 3L4SO 3H9JA 1GFSA 3VZPA 4DREA 2EV9A 4ROSA 2C2XA 3A9WA 4CM4B 5AXCA 3TN7A 4CODB 4LISA 3ZDFA 1XELA 4K1LA 4II2A 2FSSA 4RPHA 4MP3A 4UUPA 5T57A 4BO8A 5I8WA 1WMAA 3JTMA 3BAZA 4NG5A 5C7IO 3Q2IA 1UP4A 4HFJA 3ZWBA 1G6KA 3BHIA 2LDBA 3NX4A 1SZJG 1BDMA 4FPXA 1KBZA 3K2BA 4Q9NA 1LRLA 3I9LA 4FW8A 2NU9A 5ICSA 2I66A 4IJVA 4MKRA 5KOIA 4TZKA 3AI2A 2GDZA 3T7CA 4B4UA 5B4UA 4R5MA 3O4RA 4L9RA 3FNGA 1N7HA 4M87A 1UUFA 3DFUA 2AQKA 1O9BA 1ZK3A 3PWKA 4EJ0A 1LEHA 1DHRA 4ILKA 1ZK0A 2Z1MA 4IZIA 3OEYA 1HF3A 4BO1A 5IDQA 3GRKA 4IGEA 3BXXA 4TWRA 4PLPA 3OJEA 4MVJD 3LC2O 4CLEA 3GNSA 4UVEA 4FD3A 3JSAA 4P8RA 4JJGA 3U4DA 4BB5A 1NFQA 1VL8A 3IP3A 4MIYA 1D1SA 2Q1SA 2Y1DA 1NHWA 1N5DA 2Y93A 2XXBA 2YQ4A 3MJSA 1DRVA 3PHIA 1R4MB 3RC2A 4CR7A 4E13A 2HCTA 5L4NA 1U1IA 4K6CA 3N74A 2YJZA 2CSUA 3RFXA 1WZIA 3DOJA 4ALJA 3TOXA 3AOEC 3ZWNA 3R1IA 1PZFA 2X0IA 5HBRA 5JAMA 1AXGA 3ZV4A 4B4OA 6LDHA 4OKNA 2SCUA 3DZKA 3D64A 1LJ8A 3S8MA 4A03A 1E6EA 3UFXA 3DZGA 3PQDA 2X0NA 2I6TA 1J5PA 3OM9A 4PRLA 1R16A 2QG4A 4WCFB 4BGEA 5IN4A 1XIVA 2HMUA 4TVBA 1KVSA 2ZIZA 1UXJA 5H82A 1KS9A 2QRLA 5A9TA 4RGBA 1GZ4A 4IIUA 4BNGA 1I3NA 3ICPA 2JKVA 2YYYA 1SCUA 3QVTA 3WJAA 1AE1A 1OFGA 1RM4A 3GT0A 4A73A 1KEVA 4CM9A 1NPDA 3RROA 2ZB3A 3AK4A 1SMKA 4L73A 1JN0A 4TRNA 4A26A 2Y1GA 3DB2A 4BO4A 1HYHA 3O9ZA 3RUAA 4PG6A 1H6AA 3DQPA 1WMBA 4TKMA 2BLLA 1HE5A 4KDEA 4WKGA 2C82A 4IDFA 3K2EA 3DBHA 4WEOA 5TRTA 3U3XA 5KNLA 4IY1A 4S3MA 4J0FA 4W9NA 2VUSA 2Y05A 3B70A 1E1LA 2FPGA 4PLYA 3WXBA 3TFOA 2WSBA 4WJZA 2P9GA 4LSWA 3GF4A 1EK6A 2E37A 3NJ4A 2JD1A 1RM0A 4QT0A 4MKXA 1Y8RB 2QIOA 3FBTA 5TC4A 4J1NA 4J1SA 2Q2WA 1Z74A 2B0JA 3M1LA 1LDMA 4CM8A 5TF4A 4WNCA 3V2HA 5TJ9A 2O3QA 4BO5A 2Y0EA 1O6ZA 2HMTA 4XGNA 4IPTA 1DC6A 4TQGA 1P1IA 3GR6A 2QYTA 1HE3A 1N8KA 3BHJA 1I30A 1FXSA 2X5KO 3NT5A 3LK7A 1A71A 2J3JA 3F1KA 3ONFA 2QZZA 3AI1A 1GYRA 1BXZA 1PQPA 4M55A 2UVDA 3OIGA 3DDNA 4ND4A 4ZJUA 4D3SA 3W6UA 3PHJA 2Y1EA 3K6JA 4J7UA 5DBGA 2TMGA 4CMEA 5C37A 4I5GA 1YGYA 4BO0A 5JMWA 2WDZA 4GX2A 1Q7CA 3H5RA 5JDIA 1P33A 3R6DA 4YRBA 1JWAB 2NQ8A 5JO0A 1ZXBA 3BYZA 3E18A 1CQJA 3AY3A 1NFRA 2IZZA 4NJOA 1EVYA 3O8QA 4BO6A 1EZ4A 5C3MA 3QW2A 1SEPA 2J5RA 2HJRA 5CDTA 3F3SA 3GVXA 3WGIA 2B69A 2R2GA 3BMQB 3MOIA 3E5MA 1QYXA 1L7EA 4CM7A 2VT2A 4Z9FA 5I9MA 3WTCA 4IQ8A 2PY6A 4CMIB 5TGDA 1QSGA 3P5SA 1ZK2A 1XU9A 2B5VA 1P1RA 3CMMA 3NGLA 2YV2A 4YR9A 4CQMB 3ANLA 2G1UA 2NUAA 4A10A 3VPSA 5TJHA 2O50A 5JMPA 1GYPA 1ULSA 2RCYA 2HDHA 3AJRA 4RVSA 3RJ9A 4BNYA 3KSDO 4E2WA 2PH3A 1R37A 5FI3A 3AM5A 4WASA 3IKTA 1HEUA 1S6YA 2AQ8A 4G2NA 3ZHYA 2B83A 3P7MA 1P74A 1WLYA 1M2WA 3FSRA 3GK3A 1CF2O 3HZZA 1Z75A 3GVPA 4E0BA 4Z6KA 2FN7A 1MXHA 2ZYGA 2WD8A 4UVIA 3TL3A 2QYSA 1CJCA 2O2SA 4WOKA 1I2BA 1XEAA 2GRAA 4Z0TA 4RZIA 1T4BA 4CMBA 4YJDA 3FF4A 3NKLA 2B37A 2GGSA 5EJ2A 3TFQA 3EGOA 1KVTA 4DPMA 3VOSA 4E31A 4OQYA 1LU9A 1Q7BA 4ND3A 4HP8A 5JYDA 3GH3A 5CDSA 3WJ7A 4Y98A 1FDUA 4GMGA 2OBNA 3WLFA 4GBJA 3ZI0A 3ST7A 2A94A 1F8GA 3V8BA 5IXSA 5BSGA 2PH5A 2IZ0A 3FNFA 1K2WA 4MVJI 2HRZA 1DBVO 3UUWA 1LNQA 1BWSA 2W90A 1PSDA 1PS8A 2JCYA 1Q2XA 1DFGA 2YHIB 4CMGA 1RKXA 2OGUA 1SPXA 3S1LA 3WGQA 1O89A 4ZICA 3QV1A 1KOLA 2E49A 1FK8A 4G5HA 1ONPA 3NGXA 3WMWA 3TDKA 2V7PA 3PQFA 1OC2A 3LF1A 2PKQP 4IDBA 2G82A 1E3IA 1KC3A 1NQOA 1J6UA 3F4LA 3WTBA 4R54A 3W8DA 5I7EA 3GEMA 7MDHA 2I3GA 2EJWA 4FOOA 3QHAA 2HJSA 4PZCA 1WP4A 5T6BA 1C0LA 2B4TO 4ZD6A 2AG8A 5A9RA 1Y7TA 4OHUA 3OJLA 4JBHA 2R00A 5EERA 3V1UA 2HK9A 1JVBA 4QEDA 2P9EA 4W99A 4CUJA 2X9VA 3KYCA 1HZZA 4Q3EA 4RJTA 2YDXA 1B15A 2C59A 3JQEA 5G0WA 3VAZA 3VZRA 3OSUA 4CV0A 1PR9A 4PG4A 1Y81A 4F46A 1DIGA 1PL8A 4ZHSA 3EMKA 3A06A 4FIZA 3DBLB 4WLNA 2CDBA 5A02A 4PLVA 2RHRA 5L95A 1VI2A 1EFKA 2V6MA 2D2IA 2IXBA 3MTGA 1V8BA 2JD0A 4IMPA 4JBIA 1LTHR 4G65A 2PZJA 1F06A 1E3EA 1CIVA 4NFYA 3HQ4O 3JD1A 4JROA 5F5NA 2NVBA 3X2FA 1AUPA 1UDCA 2ZQZA 2ZTLA 1Z7BA 4Q3AA 2XOXA 2VWQA 3DHNA 5F1OA 4JX8A 1BSVA 4F6LA 3UCXA 5A05A 3LQFA 1B26A 1O8CA 4XQCA 4WUVA 4XYEA 1PQWA 4PIVA 2WYUA 3PDJA 4RVGA 1YB5A 4YT5A 8LDHA 4WNIA 1QLJA 4BO3A 2OMEA 1LX6A 5B37A 4JJFA 3DZIA 4AJ2A 1ISGA 4MVJP 3SVTA 4LMPA 4EUHA 3JYOA 5G2OA 5IZ4A 4CV3A 1XYGA 3A28A 1BW9A 3DBRA 4EUEA 5TIIA 2VUUA 3GHHA 1QV7A 4FFOA 1PIWA 1E7MA 1N92A 2GN4A 2O7QA 1ZKMA 3K5PA 4MVJG 3ROMA 2W2KB 1JA9A 3ENNA 1G1AA 3HB4X 4ZQGA 3VKUA 2YQ5A 3VPFA 5DDIP 5JY1A 3PGXA 3IL2A 1PR3A 3U49A 2C2YA 3JQAD 1J4AA 4CM6A 1C0KA 1Y9AA 3ZNOA 4CM1A 4PG8A 2OORA 1LLQA 1HDRA 5HM8A 1NYTA 3WIDA 3GZNA 2VYVD 3W1VA 1NQ5A 1LC0A 3VPHA 1VJ0A 3CPSA 2Z1NA 1Y8QA 1HSOA 4Y6SA 3DHYA 3G79A 1B2LA 2DUUA 3QWBA 5JDCC 1R6DA 4H7PA 3BHMA 1RYEA 1U7TA
chains in the Genus database with same CATH superfamily
4YJFB 4F93B 4UATA 5K8VA 3WKBA 2C3OA 3JQ9C 2Z9BA 3HEMA 3Q12A 4BNZA 3E8SA 4ESHA 3NEAA 4AL4A 4EQZA 1Q12A 1Y3DE 3AI3A 3CPEA 3L92A 1RBQA 3PEEA 2FZGA 2PUEA 3QG5A 2CWWA 3VPBA 5JS7A 4GE3A 1G1MA 1DQZA 1LRJA 1UJ6A 1T1GA 2CBXA 2C4MA 2IEYA 1E64A 4Y67A 1ODJA 2XNKA 3C7KA 5BWLA 4UTXA 3JQ8B 1I4TD 2XMPA 3N2EA 4IXNA 3O90A 3C3PA 2ZWIA 2ZKLA 1BU5A 3QLJA 5CDFA 3HCDA 1N6OA 3NS7A 2CNOA 1R5BA 2WHPB 5EHIA 4JI4B 3L1VA 2Q0XA 1C4WA 2IV7A 2R1TA 3WWZA 1XX6A 5FX2A 4D57A 1CQXA 4BHTA 4ZN6A 1WDMA 1QRRA 1DDIA 5F5LA 2XGGA 5GONB 3K1JA 3MWEA 4O4IB 1HFJA 2V3VA 2Z09A 6GPBA 2OQ2A 3HCAA 3PLNA 2RB5A 2DLDA 1UOEA 1J7JA 1JDUA 1XD8A 4BNFA 2I91A 3ZQKA 1S01A 1KI6A 2OSVA 3E5NA 1PF7E 1NM5C 3RVLA 2F9LA 2YYAA 3KSMA 5REQB 4TMFA 1Z6GA 1XAGA 3K70C 2OCBA 2Q1UA 1RP1A 2E1RA 2ZWOA 4JBWA 4Q4JB 1IN8A 1TCUA 3IMGA 3FROA 3LUJA 2IE8A 4A0HA 5BQFA 3TBKA 5A5GA 2A58A 3L4BA 3DBIA 2XWBF 5A1TA 2F00A 5K6AC 1QP7A 4PG7A 4OH7A 1EB9A 4G4IA 3QENA 4DLPA 1DUIA 4EBFA 3QJYA 2IEAA 3DBVO 1EPUA 3B36A 4DPLA 3NKFA 3C8MA 4J4BA 3M4ZA 2CMDA 3TJRA 4C7BA 1N5JA 2BJVA 4D42A 3S5JA 5SZIA 5GINE 1M34A 3F9CA 2I3BA 1L7DA 4RF5A 4JY7A 4PLWA 2IK8A 3TM4A 4UVHA 1E1NA 3NLLA 4LRTB 2PO5A 1N0UA 2HJHA 4KSYA 3C45A 1B76A 3GEDA 1LDGA 3GLUA 4ZI5A 5C4IA 2OLKA 1JV2B 3N9IA 3Q3CA 5JSFA 1PGOA 2EG5A 4TS4A 4AF6A 3DKRA 2I8AA 5T64A 1R27A 2HNBA 3TZHA 3QK7A 4JQZA 2NIPA 5DIZA 5TLSA 2C04A 4KTVE 2AMLA 4X92A 1EVJA 2PXCA 2YWJA 1HETA 1PEDA 3F90A 3RFCA 3SAJA 4V3CA 3RFTA 3F4KA 1VG8A 3Q5GA 1GPAA 1WXGA 1Y6JA 2V4ZA 4IDGA 4N0EA 4RJLA 3I6IA 2X22A 4JH0A 2JHCA 3II6X 3ZDCA 1SUAA 2H1CA 3UAVA 4R68A 4J3NA 1CR1A 2ZXUA 2JFVA 2CXSA 1Y9EA 1FSPA 1JALA 4LJ4A 5ITSA 1UK9A 1ZNQO 3QGMA 5DPMA 3BKXA 2VQFB 1OXXK 5JCPA 1IJKA 1FFHA 5I9NA 1YFJA 1N9ZA 1TYEB 3OOWA 2HTEA 4PV7A 4EZEA 3LUCA 4JLPA 1J0BA 1BCSA 1NL3A 2ZJZA 2VJCA 3W6OA 3H11A 1XA4A 3JARB 3LUHA 4F9FA 2BJHA 1DX6A 3RK1A 4BO9A 1QH0A 2KLBA 3EIWA 1IY0A 2ZDQA 4V0OA 3KB6A 4ALMA 4DXDA 1QH1B 1JPVA 2QAGC 2ZBDA 4PO3X 3OY2A 2DTDA 2GCIA 2GA9A 2I6XA 2I2DA 4HS9A 3TSCA 3P9KA 1W5FA 5THKA 1HV8A 4NK5A 1SOWA 5K2MA 2H54A 1M74A 3A9SA 4NBUA 2NU8B 4B3XA 1P2FA 1SZDA 2GF9A 4LJLA 4QASA 4YRKA 2AFRA 5DGDA 3U16A 5HTOA 3UN1A 5ER9A 3G23A 5BSFA 2ZIWB 1OLUA 4IQ0A 3AZPA 3VI3B 2BI8A 3QPAA 3ZEIA 2Z6AA 1X8JA 1B3RA 1C3VA 3CX4A 4Q3KA 1JR4A 3KXDA 4DMCA 3LPLA 3FIJA 1CZOA 2QVBA 2FOLA 4YV7A 4JEHA 1II9A 2FQWA 2M1ZA 3LBYA 2W22A 4TVOA 4AULA 2IUEA 4BS9A 1JIKA 2X9LA 5CFQA 5K05A 3CISA 4XWOA 3QU2A 5LIPA 3F5SA 3AESA 1DAGA 2PT6A 1NC3A 1ZOSA 2JAHA 2RBGA 3HJHA 3H75A 4LGYA 5E9QA 3TCNA 1SKMA 3QWAA 1YCHA 2FGJA 2I4OA 3A4LA 4U7PB 4GXTA 4V03A 5I5GA 3W3AD 3TR0A 3AX6A 4JCCA 2VZ9A 2G6BA 2JCGA 3AHEA 1ZOOA 4QA9A 2Z30A 1DAMA 5FYDA 1T5HX 4CM3A 1XCMA 4IVPA 3I8XA 1JHDA 4LVOA 3T7KA 3VVBA 1Y8ZA 1DG9A 3UHJA 2HLHA 3PC7A 1N6PA 2QSJA 4P84A 1UFKA 3KKKA 4L6AA 4QU9A 3V1YA 1I2DA 1Z08A 2VK4A 1T9GS 2H1SA 1VHDA 1DXHA 1EAMA 2NWQA 4WNAA 3VOAA 4YXFA 4TLMB 3O3NB 3NDBB 4HUQB 1QFZA 1RWMA 1Y1RA 4ENRA 4PAWA 4R40A 5I5EA 5L4SA 4LYHA 3V8QA 2JLWA 3CF0A 3L7MA 4EVIA 3QLUA 4XIFA 1DX9A 2NVUB 4YT2A 1X80B 1D04A 4OJMX 1AKTA 3BMCB 4B3DA 1E2PA 3G2OA 2RH9B 3CUSA 4GWGA 4ZYTA 5GOTA 1GPH1 5ENDA 3ZN2A 3D4OA 4OHVA 3VR0A 3EIHA 3LDAA 2NAFA 4IS2A 5CMLA 3AIOA 1SVOA 4ZQEA 2GPTA 1QDLB 3QFRA 4LK2A 3WB2A 3M6VA 4A23A 5DNDA 4MYSA 1OZHA 1U5BB 1W35A 5ESRA 1KR2A 5BMVF 3G88A 3QG1A 2DFNA 1ISHA 1LBHA 1YTLA 5H3LA 4BEBA 2Q7DA 3ETGA 4PX9A 2ZB8A 5CA1A 4DB4A 4LXQA 2G0NA 4YDQA 4IMJB 1YF3A 3H19A 4RTMA 1M66A 2RBEA 1M6YA 2EX1A 3MRTA 3A0RB 3N7UA 4O08A 5EKTA 1FB5A 3ZU6A 1QLHA 1NIPA 1Y1SA 2BFFA 2EF1A 2UZ3A 3U39A 1DAFA 3JD2A 2G0TA 4DMFA 5LQRA 1H65A 3TSYA 2E18A 3WKAA 2YV3A 3WX0A 2WYOA 1U9YA 1KFEB 3FIUA 4EHBA 5JCXA 1QQBA 3UCFA 2DKNA 1CQJB 1X1EA 3HRHA 2GYVA 3KZOA 4K6FA 5H70A 2IGTA 4DV4B 2WYVA 3ZD9A 3W3AA 2CBZA 1CB0A 2B6HA 5FADA 4PINA 2F62A 3CLRC 5FOTA 4JAVC 5H8WA 3BA1A 2YVKA 3AW9A 1TA0A 1I33A 3UHAA 4AZ0A 4HAVA 1T2AA 4YYZA 4GOKA 1V8DA 1XEWY 2PZKA 4MRRA 3WWEA 3GAFA 3IQHX 1P6UA 3ED1A 4HFRA 3ZDEA 4UAGA 1F2DA 5K0NA 5LXTB 4NBNA 4CM9D 5ESDA 3IUJA 4HUJA 4G9GA 1QFXA 1E1RD 2QM3A 3GEIA 3R6GA 1GGVA 1Z0UA 5D3MA 4CCYA 4OBWA 3G3EA 1OWOA 3OJCA 1XHEA 1W44A 3F6CA 3PGKA 1PGQA 4EG3A 3FCEA 1G9TA 1E3TA 2VSYA 4KSCA 1SXJB 4ZCSA 4NABA 3GGGA 3TK1A 3O93A 1CUEA 3U9SA 3KM0A 3OP4A 4FWBA 4AQYB 4B71A 4TL9A 3KETA 5LD2B 2WJPA 3BDAA 2VTDA 3KYIB 1NE2A 4DR3B 1ZO8A 1DCTA 1JEYA 4FMDB 3DOCA 3ANYB 2RDMA 3NHZA 5THQA 1GQQA 3DONA 1CQIA 1PBTA 1Y48E 2QRHA 4CW7A 4RTPA 1WLSA 2C0PA 5L7TA 1U7DA 2DT8A 5BOVA 1NJ6A 4FJ2A 3TG8A 1Z17A 4A5OA 1DEHA 4LRXA 2VPZA 2KBFA 3G13A 1JYEA 1AGPA 1N2JA 4L5BA 1ZM9A 3H9UA 4X61A 1OGJA 3IV7A 1LVUA 3GFOA 3N2GA 2XNDA 2WFAA 1NMEA 4HPJB 3I61A 1VIVA 3RKSA 5KOYA 1UDWA 3B1VA 3KKZA 3ZTYA 5K7SA 1X15A 2YWFA 3QELA 3JPYA 3TIVA 4F9GA 3VO9A 2N1MA 2JEYA 1TTHA 3DXYA 2Q46A 3QWFA 2JFZA 1JVSA 5ER6A 4CF4A 2W2MA 4QUKA 4E1AA 4D9IA 2WZQA 1QG0A 1O8BA 4PBSA 3UT5A 1P44A 3QVWA 4TMKA 1SG0A 1KJYA 4XWYA 2DPGA 5JPCA 1FUEA 2X42A 2R6JA 1PGPA 1KZ4A 1QIEA 3EDYA 1ADBA 3PEUA 4RVUA 4DADA 4ZT4A 3K1TA 4MARA 5K4AA 1E1RA 1QQ5A 5BN5B 2F59A 4IJMA 3VDNB 5A3JA 5IARA 5I01A 4KO2S 2XR1A 1JLKA 2H48A 5DISB 2D7DA 2KSQA 2PSFA 2IXTA 4RZUA 4L02A 3C1AA 4IEEA 2JIPA 2QM8A 4G0VA 3HRKA 3CZ5A 3DOOA 3G8CA 3QLEA 1MAWA 1PR5A 1HT0A 3GLFB 3L7LA 3PJRA 4CT0A 2O9JA 3GP8A 4LVUA 4KN5A 5ALHA 4INAA 1T2EA 1U9JA 1XMPA 4W5WA 4FNMA 5ALVA 5KNDH 1CEYA 1XWWA 4NZYA 5AICA 2R6DA 4EDFA 2YVAA 2BYTA 1JBQA 3U3ZA 4ANFA 3IBSA 4C0BA 3PLRA 5HIAA 3TPCA 1LV7A 2WA1A 2GBPA 4JSYA 3OT1A 4FGKA 5EGSA 4ITUA 1SC6A 2BOVA 2RC5A 4M8IA 1E1KA 1KDVA 3V5NA 4X7MA 3W34A 2FP4B 5CPBA 5E2BA 1XI2A 5JFGA 3E81A 3R7WB 3R5XA 3DO6A 1QVWA 5ICCA 1NAHA 4HI0E 1GTJ1 1BCRB 1D7OA 1VL6A 3HI4A 1XTTA 2WT8A 2C2OA 1M1ZA 2WYHA 4Y9TA 1FP7A 3P2IA 4RPIA 4E2YA 3THOA 4YRZA 2IPOA 3AOGA 3KYCB 3NC0C 3VTAA 4DHEA 4IRXA 1RM3A 5HCUA 3ZHCA 3Q3VA 1WBBA 4I9FA 5JCOC 2DPLA 3K8ZA 1E4EA 2AQIA 2ZRKA 1F51E 1USVA 4UUNA 1Q3KA 3WK7A 1PJSA 2Z4TA 1E5VA 1A82A 2E5FA 4BZZA 1PVOA 2CMKA 3ORSA 1JE0A 1UCFA 3AR5A 1D4OA 1LI5A 4DVGA 4MUHA 4PSDA 2B99A 2QGZA 1J0CA 3CLTC 4C07A 3AVXA 2O2HA 3EJ6A 2QL5A 3T41A 4C0XA 5L4LA 2FW1A 1HRKA 1BX1A 5HQ3B 4K5QA 1RKBA 4U9IS 4B3HA 3PR3A 4DZZA 1SC1A 4TQ9A 2I7TA 3O2SB 2WJYA 1K3UB 3IQXA 5LA6B 1WQ4A 1EHIA 4M1WA 1REQB 4FYHA 5DTJA 2J09A 2VN8A 3DQQA 3FNEA 2I6QA 1S0UA 5B7QA 2H3EA 5GVSA 2GUGA 2AFIB 2R9VA 3IHLA 3S1SA 2PGIA 4KE6A 3RSZA 5HDQA 1ZJWA 2OL4A 3SICE 4CLOB 3AF6A 1CHNA 2EFCB 4MS4A 5SZHB 3VM6A 3SQOA 4A6DA 3V4RA 1FS4A 5CA0F 1DELA 1NU6A 2VDQB 2RGEA 4I1UA 2PXAA 2XUAA 5AI9A 3M0EA 2C5GA 1JQDA 1TMYA 2J9XB 2XGOA 1SUDA 3AVOA 3D7SA 2RE8A 4OHCA 1PT7A 1ECBA 3GLHA 1E2UA 1PP4A 4M76B 2CXQA 2H00A 3N3BC 4JVMA 4NE7A 4N5MA 3K0KA 4HNHA 3BSWA 3OX3A 3CBQA 5NULA 2EKLA 2I6SA 4FSHA 5AWFC 5GGYA 3ODPA 3OOEA 3FOFC 1IWBB 4M46A 3L7CA 1E9CA 3UQZA 2CVQA 2PZFA 1BQEA 1O96B 1RWVA 2EJVA 2GKOA 3D54D 4QAQA 3TX6A 3ZV5A 4DA0A 1IATA 1PNVA 3ZV3A 2D1RA 1KARA 1CUFA 2F9FA 3P2YA 3DEJA 5DE3A 3UWSA 1W19A 1VCOA 2BN4A 3D7MA 1T8SA 4UUBA 3RG2A 3QVXA 3INTA 3FPAA 4RZXA 5HKOA 2XMBA 1CEQA 3OPYA 4QZVA 4B2IA 3GZNB 2ZYVX 1B0PA 3BCSA 4R1UA 1EFDN 1E69A 2VWGA 4RS4A 4JUDX 3LUAA 5CIQA 4F97A 1GKIA 4I4TB 1SHKA 3MCAA 4ND8A 5GY7A 2EL7A 3KKPA 2HCJB 2F1RA 3BG5A 1PK8A 4E12A 2A7XA 3CY6A 4RIHA 1ZRMA 5THXA 1HQKA 3UHFA 4EKDA 2OBLA 1JQ5A 4B2PA 1KJIA 4LJ8A 2G7MC 4OUDA 3WGKA 3AVVA 4MW5A 4Q3OA 4M1OA 5FULA 5F2EA 4N39A 4ZO9A 4LJ5A 1OUMA 3RF7A 4AROA 1P9OA 2YC4C 1QR6A 4TRMA 2DRIA 3DHWC 1FDTA 2ECOA 2NXNA 4YI5A 4N4AA 16PKA 2V3WA 3PJEA 4GQAA 4RDIA 2Z5LA 5AJUA 1XZBA 1TA9A 2QUBA 2F1KA 2OAQ1 3JQ7A 1VE5A 5DNYB 3GC6A 4HDMA 5CCBA 1TF5A 3R74A 4CLHA 3UG6A 1IYZA 2RCNA 5H83A 4BDTA 1Z63A 2F67A 3SIPA 1PSWA 4EK9A 5JHGB 4N0DA 1X7WA 1LRKA 3C3XA 4ZC8A 1JZQA 1C1YA 2FUKA 2H06A 1SQFA 3AEUA 1I2ZA 3D1JA 3DCIA 3PUXA 2OKCA 3GZTB 4TWZA 1JUDA 1TMGE 3UICA 4BLVA 5FOQA 1ODLA 1CR2A 4MJLA 4B4KA 2RG7A 4CLDA 4BQRA 1BKYA 3QBVA 1J1ZA 1E2MA 1H2HA 3MWEB 1GP2A 2ERYA 4JUFA 2D59A 4WJKB 2GSDA 3DS8A 3EXFB 4FCTA 4YK7A 1Q92A 2EIHA 1GTZA 4QNMA 3TNJA 2HBQA 4PCUA 4BLWA 2VLBA 1FP4A 4B45A 3LXXA 5CNIA 3MS4A 4MTLA 4F4UA 4YALA 2ZATA 5IJXA 2FJ0A 4GKKB 4PC7A 1I13A 1W34A 3N53A 5H68A 2QRNA 4EO9A 1AT1A 1KK1A 2R8PA 2YRFA 3T0GA 1T25A 4M0MA 3VRHA 4EKIA 5M04A 4PO9A 4BQPA 4N41A 2QXYA 3LF2A 2IZ1A 3EVAA 2D2FA 3A7EA 5U4XA 3H8VA 3EDCA 1NZFA 3FRHA 2DETA 4FC6A 1D6MA 4TM7A 1QF6A 3RYCA 3M34A 4REMA 1R9GA 1R5OA 4EJ2A 5I7OA 4QOJA 1M34B 2ID4A 2O1WA 3U60B 4TX1A 1Z39A 2E4AA 3JRXA 3C6ZA 5L3SA 4FEYA 5ES4B 1QAQA 1WHSB 2VJAA 1FJ2A 1VI6A 1G0OA 3LLSA 2WAAA 5JZBA 1CCWA 4XX0A 3DLBA 4XOUA 1KI1A 4KQXA 2ENUA 4RMGA 1FIUA 5EZQA 1GUBA 4BNTA 4L8GA 2FF5A 1UAYA 1RBMA 3HYNA 4HB2A 4EF4A 4TMXA 1WB5A 1WXXA 2PGJA 3LC1O 4LZWA 3GZ4A 2RH8A 1U8YA 3LY8A 2QSUA 3AO0B 3SM3A 4GLLA 3NNDA 1U0HC 2Y66A 3GFFA 1N4DA 1ZL0A 4M7PA 2GMWA 4FGJA 5E38A 1VIMA 5AP9A 1AGYA 2VATA 3USES 2WT9A 2O5CA 1QRAA 4CKEA 3GQBA 4O02B 4Y2XA 4LCEA 3FAKA 4QAJA 2P9YA 2ZE7A 5EE1A 1Q11A 3B6ZA 3TIXB 4IFIA 4TLCA 4ZT6A 2YL2A 1EBBA 1G5QA 3C97A 2BFCB 1BCSB 2X3FA 3CGGA 2I99A 1E6LA 4JOCA 1P45A 5T7BA 1G64A 4N3NA 1YVPA 1HH4A 2SBTA 1XYYA 2FFRA 3YASA 4DOMA 1RNLA 1Z4LA 2AE1A 3ZWCA 4XQ9A 4TTPA 2P2GA 1BWRA 1PD0A 4N7RA 2FUG6 2HFKA 2RARA 3G8DA 1SELA 4DQUA 1FDVA 3PXUA 3N0TA 4Y2YA 3O3MB 4J9VA 2CFSA 3WQHA 3H42B 4Q3BA 1GZ7A 1G5RA 4BPBA 2G5TA 5D5PA 3TQTA 3ZXIA 4O59O 4KOEC 4R31A 2RBKA 2YRXA 4QBFA 3HKDB 3HBLA 5G0VA 2EEZA 2E6KA 2W2QA 4MXDA 2C8KA 3MPUA 5AVOA 4L0MA 2BSXA 4ECEA 4UBOA 4PPGA 4PEVA 1U1CA 4OQXA 3R2JA 1RI1A 4BAGA 4N6OA 3R3JA 1P73A 4LGVA 1OFVA 3AR7A 1I10A 3P9NA 4IRUB 2QUKA 1GL6A 3UWPA 4IQFA 1H3EA 4PSKA 3U3DA 3AESB 2AJBA 4L3VA 2REBA 4KO1S 4BKRA 1VE6A 1G3UA 2O0JA 3AJ8A 2DH6A 1HC7A 3JQGB 4OM7A 2PTGA 4X7PA 5I7UA 3K4PA 3LVFO 1Y5MA 1SOUA 3UK2A 1DJOA 1IOLA 3GLRA 1E8NA 1GY8A 3GCWA 1UBEA 4WADA 3WGNA 4C20A 1X8LA 2QTFA 2ZS8A 3AOEA 4K8OA 1YV9A 4P5DA 5SICE 1YZGA 1RLMA 1R0KA 3KUDA 3LYAA 3MJRA 1JQJC 1XRRA 1XO1A 2EARA 3AF5A 4MV4A 3KKEA 4FYMA 1PJ3A 3F2VA 5CFRA 1B93A 1DKQA 2IYAA 3QEJA 1WF3A 4TUYF 4U2EA 4AJIA 4X6XA 4KAJA 5BMVA 1TYCA 3P9IA 4WNAB 2OHXA 3BXGA 3AL0C 3IJPA 1YIOA 4LJ6A 1PZGA 3MVEA 1V3UA 4RK5A 2HA7A 1U7WA 4Y9RA 1EA5A 3VR6H 1WHTB 2JLQA 1A4IA 3EOZA 5KYYA 5IRCD 4C05A 4B3SB 2Q3LA 4HVCA 1GN9A 5DP1A 1UKEA 2OCIA 1FY2A 2XWJI 3L7JA 3P27A 3PZBA 1NUHA 1DPGA 3RJTA 3NT2A 2JAUA 1M2GA 1BVRA 1T26A 4I1SA 4AP6A 5P21A 2VAVA 4H4CA 5ADUS 4RESA 2X5OA 2QMOA 4UCWA 3A3PA 3L8ZA 3RLFA 5FQOA 3STUA 3HZHA 4URFA 3OT5A 2A0FA 4JJ8A 1YJ8A 3IYLW 4MVJE 4BMYA 3OLZA 4LVNA 3NTRA 4M49A 3A26A 3ZGOA 1DMRA 4JL5A 1YC2A 3PITA 5H80A 1YZQA 4HQOA 3T7EA 1JFFA 1QR2A 4KFSA 1ZMOA 2BFFB 3HGTA 3ASZA 2ZUEA 3OZCA 2Z5FA 4QXMA 3OQ1A 4RDXA 1KYWA 4V0QA 4E3WA 3HBMA 1A72A 1NW3A 1JKIA 3PNOA 2Z2XA 5EE9A 4XQ0A 3Q9LA 4CMEC 4XJXA 1NJFA 2X1HA 1M54A 2IPLA 5J4KA 2H9AA 1IPEA 3B9PA 5GZ3A 1XNHA 4D82A 1CQWA 1XK7A 3HEBA 3JVEA 4I3FA 4QUAA 2GZMA 4G86A 1N5OX 2I03A 2LRHA 1ORDA 3AG5A 1T4CA 5JLAA 1L5NA 1WCYA 2QPLA 4ZTUB 4O0LA 4QEZA 3KZXA 3EZGA 3ANNA 3EVDA 1YBFA 1HMPA 4G0XA 1NF2A 4RIFA 4AIRA 1IHDA 3REQA 3EOBI 1A98A 1NP3A 3I3OA 2OYCA 2P5YA 3ETDA 1G8GA 1D1TA 1R8XA 3RGWS 2Y8EA 4JJZA 3VKWA 4IUYA 3S8EA 2VXCA 1VCHA 1CULC 4JP8A 1GFIA 4FFMA 4CCYB 4BUZA 3AFIA 1NF8A 4X84A 4EG0A 3VYSB 1MPTA 4OJYA 3RSQA 1YI8A 3BQMB 1KRXA 1ACMA 3TDMA 3LCJA 3R5SA 5CCXA 4XYMA 1ITZA 5JSUA 2PUBA 3DO5A 3MTAA 5CT9A 1IU9A 2OMKA 2ORIA 3KLOA 1ZI9A 5DGIA 4OMCA 1A27A 2R1VB 5KBYA 4J8PA 4QREA 4QVGA 3BTSA 1AK1A 1BVUA 2Q3CA 3I05A 1OHHD 4HSEA 1FTNA 1D8AA 1K6IA 1UJMA 3BE8A 4JN6B 4LBVA 4M2LA 1JEYB 5AXBA 5KHAA 3IJ5A 2HK6A 1CQIB 1GG8A 4R7ZA 2YX1A 2XB6A 3WBJA 5ALOA 3DDCA 4PZEA 3VTZA 3DFIA 3WBFA 4UHKA 3A9UA 2NT4A 2WJGA 4R2LA 2Z9CA 2UZ0A 5HUJA 3O4IA 1IJBA 2OZPA 2ZUTA 1KORA 1RMTA 1ECFA 3H83A 3I09A 3LSTA 3JAMA 3FWKA 3N2GB 4Q93A 3R0ZA 3OZTA 4D5EA 3U4MA 1PT8A 5G3ZA 1U0RA 1DJLA 4R41A 2AOTB 1BVYF 1WULS 1F0YA 3FNQA 5H02A 4PS0A 5CNJA 1ZCZA 3FYSA 3I9V6 4RSHA 1JILA 4RF2A 2H31A 3IUMA 4JJAA 5DGCA 5H4HA 1CF9A 1RT9A 4YAKA 2WUDA 4HX5A 2DFDA 1AQLA 2PQ6A 4JB3A 3I72A 3DZBA 4PYQA 1MT3A 4HBGA 4BWFB 1YQWA 4P34A 5E8JA 3IGFA 1E5TA 4DUZB 1IUOA 3WG9A 4KH1A 4A1OA 3UT5B 1VG9B 2V8BA 4ACBA 3SN6A 1O3YA 2FJUA 1SG6A 3MIIA 4MVXA 4WFJA 3UV6A 1T10A 4ETIA 4TVKA 2C4VA 3PXXA 1MQAA 2ZU6A 2BEWA 3UMVA 3WDSA 2R68A 1JPJA 3IUPA 2O19A 3VH4A 3L0SA 8ATCA 3HXTA 4K9OA 5EIAA 4ZDKA 2PX8A 5ALDA 2YZ2A 4MW7A 3RYFA 4CTOA 4BLRA 2HHCA 5D87A 3GGSA 2PEZA 3QWHA 5CEEA 3OMXA 2WP8J 1B6RA 4JR2A 5INTA 3MC1A 2GBLA 5JSKA 2Q27A 4WRRA 4NCKA 1ZPDA 1KOFA 3IALA 3TTWA 2XUDA 4MRMA 3OIDA 4HJXA 3C16C 4C0HA 4ESVA 2RAPA 4NJEA 1LLDA 2IGBA 1KETA 1OHHA 2QQEA 3GMSA 2HSJA 2OBBA 2DGDA 3U31A 4IIVA 1ZGBA 3OCUA 5A3SA 4D79A 1DIHA 1W85A 4JBYA 4EYGA 3HYTA 4EI7A 1TZMA 1RYDA 4TYPA 2GN1A 3A3OA 5IMBA 2GEFA 4ZALA 5BQ3A 1TK9A 1YBMA 2WMNB 1ATIA 3OT1B 1C1DA 3R7SA 4YYEA 1E7RA 1CERA 3K0CC 4DV1B 4MV7A 4Q7QA 5K20A 4J9UE 2IYLD 2R5FA 3BT7A 2K2WA 2JGFA 1QF9A 3GPCA 3Q0EA 4U2BA 5GZ1A 3FHOA 5IVPA 2D3TA 1Q7GA 1A1VA 3P9XA 1DAIA 2QSZA 4HDAA 3ZE6A 5LOVF 1F9AA 1RJGA 3PPXA 4MKGA 1U0OC 3CJRA 2C31A 4YHHB 3LA8A 2J45A 4DLYA 5IHXA 1PJTA 4TZTA 3D8HA 4ZREA 5TT1A 4E5PA 3QIAA 5DOVA 1T9KA 3HWWA 1CZHA 3RKRA 1KI4A 1EDDA 3JQDA 3ELBA 4UHJA 2E0IA 2IXFA 5EJ8A 4K9MA 5JQWA 4OL0A 1H85A 1VSTA 2R00C 3RHSA 4P38A 3VOTA 1VHJA 1HEYA 2W98A 3KE8A 3HV2A 3LPDA 4HQ6A 4RK4A 2ZAOA 1T5SA 3HCRA 1Z29A 1HZZC 2ZTUA 3LJKA 1L4UA 1ZC3A 4DANA 5KJ6A 1NNEA 4EO7A 5KNCD 2ZITA 4HNAB 2BRUA 5CA0A 3ET4A 2XRMA 1TMOA 5AKKA 3KV3O 3UUEA 5EIEA 5K0ZA 4IIJF 4Y2JA 3S68A 4JS0A 3RVBA 3S7ZA 3A3YA 4D9CA 5LNK6 4RULA 2JAOA 5LP6C 3BTVA 4FFBA 4H3SA 4P98A 1Y4AE 2CXXA 3OPXA 3WR5A 1JQEA 4HADA 5D01A 5ENZA 4D97A 1TU4A 1NXPA 1W0JD 4JVSB 1Y82A 2O1EA 1QG2A 5FWNA 1E79D 3ZCVA 4MS4B 4JT9A 3TOSA 2Y1WA 1TM2A 4M38A 4C78A 5AESA 4ZDIA 3GJTA 4KE9A 5G40A 3RI3A 4DIBA 4EW6A 3OCVA 3W5BA 1JXAA 4FBGA 4D9MA 2Z8YA 2NZWA 2F55A 1JEDA 1N6IA 3OLXA 4E88A 5EP1A 4F85A 1CX9B 1N3BA 1G291 1QYCA 3D3WA 2I2BA 3ABSB 3FCXA 3GLHB 1G3QA 1D09A 2VHZA 1EVLA 3ICVA 4DZTA 1APBA 4DA4A 3KZ1E 1LBEA 4I1PA 5JYBA 3H05A 3ORRA 5DHQA 3J7AC 1X92A 1RP7A 5ALKA 2EYQA 2OCDA 5CLGA 2VLIA 4BX9A 3RUIA 3G1TA 3BS4A 1LLCA 3QI2A 3IUNA 1E7YA 3PL5A 1JAIA 3ZDXB 4P3OA 3WLPA 2R6HA 3S81A 2IELA 3TDNA 3ZE0B 3ZHOA 2GJAA 2OK7A 1WQ3A 1QF7A 2R60A 3WLQA 2B8EA 3M7IA 5DEIA 3SDBA 1E1CA 3ZH9B 4RTKA 3A2KA 1QAMA 2QUIA 2ZUDA 2IZ7A 3W5DA 2YMPA 2BFNA 4DLVA 5LZ5A 1YMQA 3I9JA 1BFKA 2CNLA 5HYVA 4K6HA 3TTTA 4KBYA 5C8DA 1H6DA 2FZ4A 4XASA 4M1KA 1NLMA 3W79A 5KNCA 2V1UA 3PNBA 1B73A 1HZJA 2LXNA 4RMHA 3CLUD 2Y0CA 4IJKA 4YCAA 1B74A 2A3RA 1JG1A 5JBQA 2OORC 4DMMA 5TMDA 1OWNA 1N7JA 5FORA 2RAUA 3WDKA 5K2OA 3WS7A 4GW3A 4UPEA 1RPNA 1QHIA 3ZZ1A 5GOZA 4BV8A 4NV0A 3SQWA 3IQWA 4B0OA 4YA6A 3EFBA 3EPRA 3NU1A 4RORA 2HDNB 4X6LA 5EIWA 3RUHA 4DSAA 4YCCA 2H1IA 1W0JA 3JQ7B 1P6QA 3F47A 4HDMB 3A2LA 5GMOA 2NYRA 1ICEA 3SPXA 5IBCA 3EPHA 3VNRA 2BEJA 1GT6A 1CUIA 1HNNA 2C7BA 1AIPA 1F60A 1WV0A 2ILVA 3LRTA 3N1UA 1WUHS 2VTVA 5JVDF 1TZCA 5FYQA 1Z4PX 2FPXA 1P2BA 3A6DA 2XTJA 4OAOA 5AKIA 5ARDA 4E15A 2GAAA 2PUCA 1ND5A 3PX7A 4HZUB 4P53A 2AC4A 2YMMA 5CG1A 3HM9A 5LMUB 2JBWA 2X2EA 5B1HA 3CLSC 4AC9A 2NO1A 3A14A 3USZA 3DT9A 3GDWA 3RS7A 4L74A 1Z4IA 4HATA 5CVTA 4C7XA 3O8BA 1DC5A 1F2UA 2RHWA 3H6GA 3QPWA 3KC2A 1COWD 1PS9A 1G18A 4NMMA 2VQSA 2XUPA 4D6YA 3LY7A 3ROZA 3K70D 1Y5LA 1NVWQ 5JZSA 1NYQA 5FBKA 1JWLA 2PX5A 4PGGA 4HYEA 4OOEA 4ZVRA 1ADJA 3GJ5A 1T3GA 1GSHA 2FZKA 4KXFB 1NOJA 4GPIB 2JH3A 1WBDA 3QFCA 1B0AA 1ST3A 5F21A 1SBQA 4MDHA 1QP4A 2O1XA 2VHXA 2OXIA 5COAA 3G8AA 2Y9PB 2WWYA 4G24A 721PA 2Z95A 4KLCA 3RYCB 1KKMA 2Z08A 3KQSA 2OGWA 2AN9A 1KTIA 3ETLA 4I55F 1BYUA 4GWKA 3Q7TA 3ZNNA 1E5LA 3GV0A 1WXWA 2GXSA 4GYJA 2ODBA 1YDEA 2CJXA 3H5NA 5AVQA 4HB3A 1LF0A 3BRSA 2WWXA 3W8FA 1EB8A 1CVRA 4NYMQ 3F78A 4UU0A 1N36B 1L2TA 1VIYA 3JQ9A 3O1HB 4DPKA 4EAAA 5DNAA 5HM6A 5AW9A 4CKCA 5C4MA 2C4NA 4XX0B 2JGDA 3V46A 1W52X 3KJZA 5KVSA 4A4DA 2WU1A 3PSHA 2H4HA 1DXQA 4NMHA 4X8HA 3TR5A 5EZ6B 2HHJA 3CH7A 5B57C 1SRQA 2C2HA 4JLUA 2HO4A 4DCTA 4P6VF 2VXBA 4P3NA 4BJ5A 4DYVA 3ZDRA 3QWIA 4ZCIA 5A7HA 1OW3B 3F4BA 1UPTA 1XTJA 2ZR9A 3EWNA 3Q98A 4FN4A 3IQDB 1GCOA 1XVTA 2GEDA 5DM2A 4KXWA 4F2WA 3GLGE 4X54A 3GEHA 3RSHA 3RRMA 4AF8A 2QL6A 4J0KA 2OV2A 5G4KA 2ZZNA 3CIFA 4G0PA 3LMKA 1P2UA 2YHSA 3T5TA 4RXUA 4B3TB 7ABPA 1UINA 1XN4A 4XB2A 3QMVA 4G41A 4CKEB 3KYBA 2I8LA 2YWDA 4U2DA 4JT4A 1EK1A 1UMBB 1HDEA 1UDXA 2VHEA 2XCTB 1HYEA 2G04A 2B5WA 4JLKA 3U4HA 3GBVA 4GYWA 3PHGA 5FBVB 3G5TA 3TLYA 5A0VA 2JRCA 2P8JA 3O8NA 3ECAA 5F76A 4FHGA 4X1YA 1U8UA 4J91A 4WK4B 3M4NA 4MR9A 3RTAA 1C50A 1NM5A 3RSFA 1YKSA 4CZ2A 1VPWA 4TTSA 5BPHA 4H3KB 3FY4A 4GM0A 4EITA 1K5HA 1AS0A 2QUHA 3LQ2A 5A7GA 5K6AA 1DJPA 2QT1A 4KRXA 4LXGA 1Z0AA 4AZVA 1O0SA 1WXIA 2YIJA 1CZUA 1W47A 2QXTA 3H4MA 5LLSA 4LBYA 1UR5A 2GAIA 2QEQA 1AKEA 2QPOA 1UT5A 4EGFA 4QKQA 4IJ5A 1I36A 1KAOA 1XZJA 4PG5A 1IEXA 1IHYA 2WVJA 3OAAD 3O4FA 3QX9A 3RV3A 3TI9A 3ZWOA 3UCEA 5CTJA 3KOZA 4BMSA 1P61B 4BNNA 2CBGA 4L4UA 5CX1A 1ISFA 3BEDA 1OA1A 2ZYDA 1KP3A 1GARA 2DUMA 2EHDA 3C8DA 4X6UA 5AW3A 5L7WA 3LYUA 4XWGA 2ZTMA 3EQ9A 1P2GA 2P0EA 3OI7A 2CJYA 4J3JA 4DIEA 5KQSA 2IZ6A 3BQNB 1X3LA 1XCLA 5LLDA 3V8VA 3TGLA 2VIIA 2QR3A 3DE7X 4GRIA 2RGUA 3LQ4A 4TUYA 5AO9A 1CLEA 3FW1A 1VYHA 1BFUA 1U02A 4OP1A 4DIMA 1V9LA 2D5CA 3FJYA 3AV3A 3K1AA 2HA4A 3AKDA 3NTQA 4OQQA 2Q1WA 4YDRA 2E4VA 1IZ9A 1PGNA 4LOLA 4NICA 1W8DA 4EECA 2NYUA 1IN1A 5L51A 1N6NA 5D5QA 3K09C 2WM9B 5JXJA 3VU0A 4DNFA 3B1WA 2PUWA 3CRRA 3NGMA 3HJNA 2AYXA 1KY4A 2FKAA 3VHXA 1O6GA 3O8DA 3INNA 4Q01A 1WUYA 4BGUA 5BWBA 1C1XA 3ND6A 4QYTA 4A2PA 3RM3A 3O8LA 4Y9DA 2C5AA 5ALIA 1KIFA 2BGRA 4A6PA 4A3SA 1C80A 3GEPA 4IZ6A 1WBJB 2P68A 2QVCA 1T8UA 2VZ0A 3WLJA 3LDHA 3H0KA 2G4LA 1BEZA 1ZRNA 5BMVB 2H1HA 3U48A 3AUJB 5I7FA 5IG2A 3EHEA 4F8JA 1UBGA 3RJMA 3O4HA 1BX0A 1T2NA 5F7JA 2IYPA 3GUYA 4MWCA 3KALA 2FZEA 4QTZA 4AICA 1DQPA 1M6HA 2CDAA 5HIMA 2AZMA 4D0RA 2QAGA 1NTOA 2H0RA 2PH1A 2QX7A 2VP5A 1G3RA 3CU5A 4LKRA 4ND6A 1QHGA 4B3FX 3BGWA 5JU6A 3MELA 3UAZA 1MA3A 1AM4D 2YWCA 2X5XA 4NPHA 1YH3A 3T3IA 4GR5A 2NTEA 2E89A 1JIQA 3BH7A 5LZ7A 3ZI4A 2QE7D 1HORA 2I1WA 4C0QC 2CLKB 3PNPA 1L7QA 3H6HA 4QWMA 2F2TA 3OAAA 2WC1A 1FTSA 5BW8A 4ZJZA 4MI9A 5F2KA 4M53A 6REQA 3X1ZA 1O6BA 2HCBA 2RGWA 3E48A 1Z5GA 1I9CA 1T36A 2H6EA 3EW9A 1FLVA 4JP1A 1SBNE 3R6TA 4IR7A 4HT3B 3ADCA 2QTTA 1RXVA 4MEBA 1OH6A 3EB9A 2R0QC 5FWDA 3ZIUA 3JYQA 3L1JA 5EXEA 2VH5R 4YAWA 1WX1A 3ABQB 5JNWA 1QOZA 3JQCA 1CU1A 1JS1X 2JHPA 1BE8A 2H1RA 4Y2GA 4G0UA 2X5NA 3OHSX 4QNNA 4WY8A 3K53A 4JEIA 1MO6A 3DFKA 1YUNA 5E1OA 4MWBA 1E0SA 3CLRD 3S70A 3ZZNA 2HKIA 4J0IA 1KZGB 4QO8A 1T4CB 4KX3A 1DKMA 4RVHA 4F4IA 1X19A 1TVCA 1XMQB 4S1NA 3OQMA 3KT6A 3Q5DA 5DJ5A 3ZY4A 3PHBE 4GH5A 5FUVA 3NUZA 3REQB 5AVWA 1ZH6A 2FK8A 4MIOA 2IEDA 1GO2A 3DTYA 3RUFA 1IQPA 2HF8A 2Q49A 5CYGA 5HKBA 5FLEX 5IKMA 1IHOA 2B1RA 4IHQA 1ISSA 5CFLA 5K8CA 1KF0A 1GILA 4LBWA 4MVJF 4QFDA 3PQ6A 3Q3JB 2GQ0A 1FTGA 4L8FA 4KYUA 4N49A 4C29A 4FEEA 4CG2A 3RBXA 2F48A 3BE4A 5ERGB 3W8NA 4QJ4A 3WJ2A 4J0JA 4EB6B 3THXA 2LKCA 1DADA 4H7HA 2AGVA 2X1LA 4B0PA 1JQAA 2O5EA 1VJCA 4LEIA 4PZDA 3FPEA 5B12A 2I6UA 4Q3DA 3DT8A 3E22A 3RHTA 1Q5PA 2W6ZA 1MBZA 4QU8A 5DNCA 3E9EA 4YS6A 3R7NA 4BMDA 5A04A 4TROA 1NBAA 2QE7A 3CF2A 2YFHA 2I0FA 3OD1A 2PQ0A 4F2GA 1UDRA 4YWHA 5JZMA 1NMSA 5DNUA 2HX1A 4UQPA 1R8JA 1PAUA 2JASA 2VCHA 3TR6A 4XDGA 5IVKA 2QENA 4KR3A 3MIZA 3T35A 2Q41A 2X9NA 5JNSA 2DZDA 4Q34A 2X77A 3AEXA 4RHTA 1UZNA 3ISTA 3GLFE 3C98A 2QTNA 3BBLA 3MTJA 2QZPA 4PHTA 2J4CA 4XVRA 5FWAA 3SR3A 2ST1A 5L45A 2GF2A 1UPBA 4Q3NA 3HVHA 4RWZA 2UXCB 2QN6A 4BC1A 3OM1A 4RX1A