2QYZA

Crystal structure of the uncharacterized protein ctc02137 from clostridium tetani e88
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
b'NREVKFRAWDKELNMMVYTKEQTGHIEYNTNPADTINIILNQDDYGYVFMQYTGLKDKNEKEIYEGDIIKKSNRSSNLYEIIYQDSIACFRCKVIKGDIKSFPCLNIGTVRNCEVIGNIYENPELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of the uncharacterized protein CTC02137 from Clostridium tetani E88.
rcsb
source organism Clostridium tetani e88
molecule tags Structural genomics, unknown function
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.290 Mainly Beta Roll SH3 type barrels. YopX-like domains 2qyzA02
3.30.1490.160 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ctc02137 like domains 2qyzA01
2P84A 2OX7A 2QYZA
chains in the Genus database with same CATH superfamily
2ECZA 1T0JA 4RTWA 2OH2A 4QWDA 1AWOA 5GANj 3FB9A 2B86A 4WTOB 2PNIA 3CCET 4XZ3B 5C0MA 4C5AA 3OW2P 1D1AA 3QZ7A 4RB3C 3QDFA 4IWYA 3TSWA 2ZAEA 2A37A 3BQ1A 2QDLA 3URGA 1VS0A 1GCQC 4Q5WA 1VQKA 1M1GA 2DLNA 4QVDA 4UCSA 2XCAA 3PVQA 3J7AK 2NU7B 4HKEA 1YJ9T 3H6ZA 4XTVA 3KXYT 5GAN6 1AVZC 4B3RH 4F4XA 1KG1A 1IB8A 3FKIA 1WJSA 3CC2Q 1K73R 3G71Q 2KRMA 4FYYB 3THKA 4J83A 1J5EH 2EKHA 3G7ZA 3UQ8A 3CXCP 1Q81C 2DYBA 2LQ8A 4M75C 2PMZE 2DZ9A 4LDYA 1N36H 2DL3A 5KFOA 4BI8B 1U3OA 1D3BB 3PTAA 3EGXA 2FHDA 4HYKA 2XDPA 4OMQA 2QTXA 4R0KA 2X3WD 2KT1A 3JB9G 4ECUA 4I4TF 3OBYA 4GLMA 3M53A 3TIGA 2CP3A 1VQPA 2BIVA 3L2VA 4DL6A 3I5RA 2EJFA 4C5GA 1I7LA 2IP4A 2IMWP 4C8QC 2EQJA 2R7ZG 3X25B 1JB0E 2LCCA 4RB2C 5AYFA 5CIUA 1B34B 3TSZA 3LGFA 1XQHA 2JEGA 2W9BB 1VQ7A 4O3OA 5KX5F 4ED7A 2QA4A 1UUEA 2XD4A 1ZX6A 1DV1A 3G4SQ 2F2XA 1G2BA 3KFVA 6AT1B 3CPWP 1M3CA 1IGQA 1N56A 3KHRA 5IN1A 2DXBA 2B63G 4WBNF 4RTYA 4FM4B 1WFWA 3A1PA 4B9XA 3VS4A 4GKJH 4M75E 1YJNT 1VYTA 3UT1A 3WO1A 3CCMQ 1UGVA 1QVFS 1LVKA 5KFWA 4GLKA 3QIIA 2HAXA 3C4SA 1BIBA 1PSEA 3KHHA 2W6PA 1B3QA 3H41A 1VQLT 1OI1A 2UUCH 2JEFA 3JB9J 3JCMX 2W6OA 2I2LA 3L1AA 3UA7A 2ASLA 3CCVQ 1I07A 3G6EQ 4ZI7F 1Q81R 1W2BS 4C8QE 5A0LA 1IHVA 3G71A 5KG1A 3EYYA 4A3CG 4UCOA 4ECXA 3CCRT 2MPXC 2BQ3A 3DLLA 3G1JA 2W9CA 1GFDA 1VQ4A 3CCQT 1S10A 2F2WA 4RCCA 2F5KA 5IHIA 3A8OB 5GAN3 2V8JA 5GAOq 5KT4A 1SCUB 2RF4A 4X34A 2JS0A 3CCJQ 3JB9D 4E6RA 3HRTA 1JLLB 3CMEQ 3BFMA 1OX9A 1KEEA 1WHHA 4XU1A 1SG5A 2DLPA 4YBZB 2VV5A 3CCUA 4LN2A 4CC4B 1BGWA 2W7PA 2R92G 1U06A 2D0QB 1TTHB 3QXEB 3V8JA 2LX7A 2DWCA 4O3RA 2DXUA 2D6FA 2VQFH 4M77C 3QZ8A 3D7SB 3OS0A 4FS2A 3FRNA 2XG8D 4Q44A 2E10A 2EGEA 4TV9F 2WSFE 2J6TA 3GTQA 3KHLA 2OJ2A 3GV7B 1CQIB 5DGBA 2QI2A 4XYMB 1YI2A 3GV5B 1BI2A 3CMAA 4AG1C 3QFFA 2UVWA 3I56A 3REBB 5KFZA 5HKCA 4A3JG 2HDAA 4Y8VB 3VS3A 2O31A 4E4TA 3VS7A 3AYHB 2FVUA 5J2UF 4J9OA 3RKXA 2BZYA 3MEAA 4IRDA 2EGAA 2V5AA 4F17A 1XDNA 2EJGA 5CO7A 3T1HH 3I5SA 4UC4A 3I55T 3LP8A 4UCRA 4Z8AA 4FYXB 4X62H 5FWCA 1YHQT 3X26B 4DOVA 4E7JA 3L2WA 2KBTA 3JCMW 4I7HA 3WNZA 1RLQC 4EMKA 3EGXB 2YT6A 3N6XA 2OWOA 4DOWA 2FRWA 3CCVA 2OTJT 3G6EA 5LMNH 3GNFB 1QWFA 3C12A 2LCSA 4C5CA 4OF1A 1M3AA 3UF4A 3MR6A 1TUGB 2CP2A 4LDWA 1TWGA 5DLFA 4M77E 4BE0A 1AWWA 3RF2A 3PIPA 5DLQE 2JOYA 4M7DC 2K5IA 3QG1A 1Y96A 2NU9B 3JB9I 1I94H 1GLVA 2FLPA 1OOTA 1XJWB 2XI9A 1ABQA 3CCEQ 4GBQA 2CKKA 1X43A 4YAJB 3P8BB 1CS0A 3CMEA 1VQ6A 5LJ3d 2CT4A 4JDSA 3WXMB 1QVFP 3M57A 4DV1H 2D8JA 2X4YA 4E47A 1GYFA 3M0RA 2LQKA 5KFRA 4DR4H 3SE7A 3CXCA 3EG9A 1H92A 1FMVA 2GLTA 2VGNA 1YJ9Q 3G8CA 4MV8A 3RFCA 3O5ZA 2W70A 1GSOA 5EWFA 2YXYA 1W2BP 3PMTA 4RAYA 3GIIA 3OYHA 4M7DB 4Y28E 3GF5A 4M78C 4JV0A 4KT0E 3EFOB 3RGXA 3G6VA 2BQRA 3ME9A 1WXBA 1ZETA 2VXFA 3VV0A 2RD1A 3ETJA 2HBWA 5KYXA 4O3SA 1JXLA 2YRCA 1Z2NX 3I12A 4DBHA 1M4ZA 1OYXA 4QIWE 2D1XA 1VUBA 2UVRA 2HHHH 2V26A 3M4YA 3H40A 4RTVA 3MJFA 1C3OA 2W9AA 4IR1A 3H20A 4LXCA 2O9VA 2DRMA 4EFBA 1OWTA 2D9TA 4O4IF 3BQ0A 2V4RA 3BDLA 5KT3A 5CCAA 1N6AA 1X01A 3RERA 4R7RA 4BBSG 3EG3A 1V76A 4DR2H 4DV7H 3M0TA 1S68A 3CPWA 4M75G 5CKDA 4ORZA 2ZDGA 5T14A 4X64H 2VUBA 1YIJT 2R7ZA 1G3WA 4D6WA 1P92A 3KXTA 2KXCA 2YUNA 2KRNA 4CRIA 2J06A 2YRVA 2RPNA 3H0GG 4K0KH 3EG1A 2AT1B 1N9RA 4OB3B 5D1OA 4C8QG 1S0NA 2PVDB 3INZA 4M78E 4MV9A 2XCLA 3QWYA 4DL7A 4JS5A 3TQ1A 4JUZA 2DL4A 1WSCA 2JS2A 4A63B 2CDTA 1R0CB 2LP5A 1TWAA 3VMMA 2DTOA 3P8DA 2XC9A 2SRCA 1UDLA 4LDUA 4O2BF 3CD6Q 2XIGA 1D0XA 2L5QA 2X9HA 1VQLQ 3M55A 3OUZA 1YJ9A 2EJ9A 3PW0A 2X4WA 4FT2A 4ED6A 2ZPIB 4AFSC 1XNQH 4EEQA 4LFAH 3GTGA 1I6UA 2K6DA 2KI7A 4HT9A 1N9SA 2FB7A 2OX7A 2YU9A 1FYNA 2FLLA 1IREB 2JT4A 1OU9A 4PFZA 4IRKA 1SRMA 5KE2A 3CCRQ 5LJ3j 4E7ZA 4LFCH 3CCQQ 4XU2A 5KFNA 4QW9A 5LJ5j 2UVUA 3TEEA 4BWSC 4ZNXA 2VQDA 1E6HA 1Y71A 3RAXA 1PRMC 2W0ZA 1UECA 3MWMA 5KG5A 2EYWA 4ZGDB 2SEMA 3X20B 4D8KA 4FBTA 4ECWA 3OHBA 1BNCA 4PJOG 4ECSA 4BBRG 5GAN5 1I8FA 5L1IA 4M75D 4JRQA 4RAZA 4C5EA 1DV2A 2CH4W 1KC7A 3QSUA 4JI1H 1KHIA 1PD1A 1IZ6A 1GXIE 2ATCB 4J9BA 2CUBA 2K79A 1SSHA 5GAN2 1ZA2B 2PN1A 4YB8B 3A8MB 4OGCA 4LDVA 1KQSS 2DXCA 3SWNC 3M56A 2PQWA 4X1VA 1DJ7B 3MWDA 2X35A 1M8MA 1UJYA 1S03G 3X24B 4C8QD 2AU0A 3M4IA 3EPIA 1AT1B 1WHGA 5D6XA 4PFPA 3K5IA 3I9QA 5C1PA 1YJWT 2WYOA 3K3PA 1YITT 1WIEA 2NVYA 1MNEA 3EG2A 3ASKA 5DG7A 1T3NA 4ECVA 1MV0B 2DA9A 4M77G 3JCMc 1YJNA 5L8RE 1OULA 2G3RA 4MZMA 3EPGA 4NXNH 2DJQA 1Q95G 5C4XG 4ME7A 3I55Q 1YHQQ 1Y1VG 4B3SH 2CZGA 3GIKA 3OYYA 2CQYA 2OTJQ 5KFTA 2RDJA 1NG2A 1UHFA 4RZRA 1X27A 4NLGA 1BU1A 4PLIA 3Q8PB 5FPOA 2XK0A 4WF2A 1WCMG 1QVFA 3CCRA 2EPDA 4QWAA 3CCQA 3PMIA 5JH7F 5GAN8 4ED3A 1B33N 2R7MA 1NEBA 5KYYB 2YRDA 1PKTA 3CPFA 1S72A 1K83A 3OB9A 4L6V5 1M90C 1KJIA 2ALZA 3OYJA 1SEMA 2OTLT 4PNOA 1X6GA 2XHCA 2K5FA 2PMZA 2VPSA 2DETA 3HBLA 3PT9A 3MR3A 3MFIA 1T3LA 1BJTA 2OAUA 1LPLA 5D1OB 2PUOB 1ZHQA 3LMLA 2EAYA 4F50A 2BQUA 3Q8SB 3PE0A 2HL3A 1OEBA 3JCMP 1VQ8Q 3Q1KA 1MMGA 1RAAB 2NUTA 2RHXA 5GANd 2FPPB 1FMKA 2H3JA 1RJQA 5FD5A 2C2EA 4LF4H 1KSWA 5KG6A 2COZA 5CA1F 1HK9A 1XTDA 3F8NA 1WJRA 2YCHA 3HKZE 5GAOp 2CP7A 2RQRA 2V1RA 1JEGA 1GCQA 5GAOr 1D3BA 2DXTA 4E7IA 4QWEA 2A28A 3OYDA 4M77D 5HBRB 2YHTA 4ELYC 5DG8A 2VQEH 3KAKA 2PVGB 3ZEHA 4XTYA 4ZTJA 2EYZA 3RTXA 5D7UA 3QHSA 2FB9A 1RI9A 2YUQA 2L8DA 4M78G 1X75C 3I55A 1RUWA 5GAN4 2CYZB 2RI5A 3JCMJ 2L2PA 1YHQA 4DV5H 2V1QA 2C22A 2AZVA 2W9BA 4MDXA 4M75A 1EFNA 5JQWA 1KJ8A 1YIJQ 3QZ9B 1KQSP 2OTJA 4UCVA 4ECQA 5KFJA 3L2RA 1PCXA 5J2TF 3L2UA 4GC7A 3NPFA 5HV6A 5BPFA 4JZ4A 2RQUA 3JB9F 3PGGA 5DG9A 4ECTA 4IUTA 4A3LG 1M90R 1WI7A 1BCMA 4IUUA 1CKAA 2HJWA 5J26A 1HSQA 2R85A 3H0GA 1VYVA 1ZLMA 4OGEA 5KT6A 3OMCA 4C8QA 4OMMA 3RBBB 3O8VA 3CC4T 3HXLA 5GMKh 5CR2A 1M0TA 4EDUA 2IBKA 3TU4K 1EUDB 3RUXA 3LLRA 5GMKi 2KRSA 2DEQA 3EH2A 1RAFB 2XGPA 2DPJA 2QQRA 2EYYA 3HTRA 5LJ3g 4DBQA 3UFXB 5KG3A 2RQWA 3N44B 2HEQA 3VUZA 3NGPA 2P0AA 1VAJA 4GKKH 2YLCA 4JS4A 3RNJA 2YUOA 4JI8H 3ER0A 4F04B 2HNIA 4R8UA 3OYIA 4EBCA 4JRPA 2IPOB 3H9NA 5LJ3f 1Z2PX 4EMGA 4OB2B 5LJ5f 1E7OA 5KG2A 5D6WA 2PZ1A 2J6SA 2VXEA 2R93G 2FPFA 1G3YA 3N5BB 2AQ4A 2DNUA 1CSKA 4PJMA 1M2VA 1ARKA 4L1KA 2LTOA 5KFXA 2ESWA 2C28A 5LJ3h 1ZBJA 3GIJA 3JCMQ 2QQSA 4M78D 4KHPH 4M9UA 5A2QW 3JRWA 4LF8H 1ZSZC 1M2OA 2DL7A 2L0AA 5EC7A 1T94A 4PK4A 3HSBA 2BZXA 3FIFA 1YIJA 4IAJA 2V9WA 2W57A 2CREA 2KSWA 1IOVA 1FWZA 3RR6A 4A4HA 4MV7A 2O88A 4ZN3A 2UU9H 2K9GA 3CCLT 1WHLA 2MYSA 4M7AC 2LNHB 2LX9A 5GMKe 1UC9A 3R5FA 4LD9K 4A93G 1RL2A 4RCBA 2UXDH 4B3TH 1YJWQ 3EHRA 4OMNA 1YITQ 3H4BA 1JX4A 4JYAH 1HXDA 2ZCFB 4YR0A 1D0ZA 2NUTB 2XKOC 4J9FA 5KH6A 2HKNA 3GIDA 4M77A 3PR5B 2WDTA 1PM3A 2R7LA 4F4ZA 1S0MA 1EX4A 2PVOB 3E9FA 2HSEB 2BKDN 4K11A 4OVAA 2C0TA 2Y0SE 2YYAA 2WSCE 2WE6A 4Q0YA 3M4GA 1Y1VA 1ZQ7A 4FT4A 2IG0A 5KFQA 4V2SA 3LWBA 1BI1A 2AK5A 1KD1R 2GQIA 2GPSA 2W7OA 3KUFA 3GLXA 3A8LB 5A2QE 4YJ2F 2CP5A 2R8GA 5GONF 3VS5A 2DPIA 2YRXA 4LF9H 4OP0A 5IWAH 3H4DA 3RDVA 1M6VA 3HB9A 5LJ3e 2XGQA 1WX6A 5LJ5e 1R0BG 4U7CA 2O9SA 4M75B 2IIMA 1GSAA 4M7EA 3V6HA 3GILA 4C92C 1RK6A 1SHGA 4BD3A 4M7AE 1RAIB 2YZGA 5JVDF 2JM8A 3LW5E 4D8DA 4F7UE 3Q8QB 2JA7A 1WYXA 2X3XD 5I2MA 5CAIA 2QEXT 1JJ2S 2OTLQ 1D1CA 1EZ1A 2NUAB 5HY6A 5FLXW 4EYIB 1AZGB 4EYHB 2J6OA 3JV3A 2E3IA 2C06A 4JJDA 2C0OA 4QIWA 3FJ5A 4F16A 5HCKA 4N0AC 3DB4A 3VU3C 4C8QB 3FDRA 1YWPA 1IRXA 2MIOA 4M7DA 1FMWA 2LJ3A 5KT5A 3EFOA 3CD6T 2O03A 2ZDHA 2R82A 4HXJA 3R6NA 4J9PA 2RI2A 4J9EA 2YZMA 5LOVF 2CZ7B 2CP0A 4ANJA 4II1A 1OZ3A 4IURA 4MAMA 4RMOA 4A3GG 2L3PA 4QKUA 2P0PA 3CC2A 3EFSA 3E19A 1YJWA 4PJOC 1YITA 1NPPA 5DY9A 1S1NA 4C5HA 4EPCA 2DO3A 2FK2A 1NBEB 1KQSA 1GL5A 4R8UB 4BB7A 4F14A 5H80A 2RF0A 2CSIA 2KSSA 1MZBA 3OYKA 3RB6A 4C92E 2KROA 8ATCB 4DV4H 1NLOC 9ATCB 2AIRB 4M78A 1UFFA 3EG0A 3PW4A 1WNLA 4L59A 1M2VB 1TWCA 1R9TA 5CVIA 2VB6A 2QQBA 1K0XA 4HCCA 4RKUE 1X6BA 1WH2A 3X28B 5FLXE 2FK3A 1QMCA 2FRYA 2C2RA 1VQ9T 2RHZA 2MOXA 4Y92A 1GO3E 1M1KU 4DQ2A 3JRZA 4LFBH 4JRKA 1V4YA 2R8IA 1PKSA 2V8KA 2Q2UA 2ENMA 1PK8A 2M0YA 3OYBA 3BA9A 5FU6C 4MZTA 3V8KA 4QJFA 4M75F 2VA3A 4A3FG 3G4SA 5FRMA 2DK3A 4MV3A 3G6YA 2HGSA 2UUBH 2OTLA 3CC4Q 4A3IG 3NTIA 4EBEA 1NYFA 1C0MA 2GF7A 2VR1A 2HBPA 4PJOE 3AHUA 1KJ9A 3BAAA 1ZBXA 1Y7XA 3ZFJA 2XCPA 1FJGH 3TREA 1AWXA 1QQJA 3CCMA 4E7KA 1IXDA 4MA0A 4C8QF 1VQ5T 1M5Q1 3EFRA 4M77B 4I55F 5LP6F 1HNWH 3M9QA 4C2MA 4XK8E 1BKBA 2JMCA 3RJ0A 2M0OA 1ZSGA 5FU6B 2P84A 4J9GA 4ZOLF 3PW7A 3UWNA 2GQVA 1OQKA 2JXBA 3GIQA 5D6YA 5GANg 3OW2A 1W96A 4DR7H 3TCJA 4GLXA 3UPUA 2XMFA 2XD0A 1JJ2P 5GAOn 1N8RU 2F2VA 4LE9A 4DUZH 1RYSA 2JZ2A 2M05A 5I21A 2KVQG 1QKWA 3C0FB 4KUIA 4FIBA 1PD0A 1SRLA 1OU8A 1RADB 5GANf 4BE2A 2RDIA 2V59A 2NU8B 4JPBW 4B3MH 3CCJA 2JNGA 2NUZA 4TQRA 3BE3A 3C95A 2QQAA 1I4K1 1GBRA 2MI6A 4XU3A 3V6KA 5LJ5d 3RUPA 2RGVA 2RHYA 3VS1A 4O2AF 3HRUA 4IUVA 1RABB 4JZ3A 3QPHA 3I4NG 1KC8U 5GANh 2SCUB 4PL6A 3META 2Y4YA 2FP4B 1RAGB 3JRXA 3FMAA 2GCXA 1H3HA 3CCLQ 1E4FT 2HKQB 2J6FA 2R84A 1QLYA 1VQ8T 1UJ0A 4YTLA 3OTOH 1SYXB 2ABLA 2AZSA 1A0IA 2C35B 4HNTA 1I1JA 1AD5A 3JSNA 4ECYA 2J7IA 2DAQA 3HFNA 4IZOA 3RBEA 1Z9QA 4QT7A 2HVQA 3VRZA 4BACA 1Q82U 3CC4A 5CKFA 4N4HA 2CH4A 2E5QA 3K5HA 4A4EA 1W93A 5A0DA 4YAKB 1GFCA 5KFVA 4M7AG 3SWNA 4A2AA 2ZPHB 4F7UG 5J39A 1UGSB 1BYMA 2MWOA 3PW2A 4CC6A 1YCYA 4PJNA 3T5HA 4TUYF 2EGCA 1T3SA 3PN1A 3NTHA 5C6SA 3OSSC 1LCKA 4M77F 1CE8A 1FKAH 4M78B 4A3EG 2RM4A 3RGZA 1VIFA 2I8CA 1VQOT 5KYYA 2DYIA 3M0PA 4XU0A 1IBMH 3GTLA 2H3EB 2JJ9A 2EQUA 1TUDA 2PVPA 4UCTA 3VS6A 4LH6A 2HCKA 2VPQA 2MWPA 5DM7R 5KFKA 3VYGA 3GTKA 1TA8A 2YL2A 3OYMA 2QEXQ 4A54A 4AMCA 3EAEA 3HKZA 3KAJA 5A0GA 4NL3A 4QQGA 2KY9A 3ULRB 2B63A 5GANe 3CCEA 3J81W 2COWA 1VQKT 1WZOA 1R8OB 4I50F 3GTOA 1I5OB 4GY5A 3JCMg 3MWEA 4C92G 2K2VA 2LMJA 3LYIA 1ZHSA 2VUMG 1MUZA 3CQZA 4EFEA 1W4SA 4C5IA 2FZKB 5KFYA 3MJXA 1HJDA 2ZPEB 1UGQB 5CK9A 1Y07A 2BE7D 4DR5H 2FG0A 3JSLA 3JCMf 3OYEA 5LA6F 5KFGA 3VUBA 3HFOA 2KE9A 4A3MG 4Q8EA 2DVEA 4ELZC 4M7DF 5IHKA 1HNXH 3V7CA 1DIKA 3A8GB 5EDWA 4JLGA 5KFUA 2ROLA 1AZEA 4J9SA 3JCMh 1NJIU 4FL6A 5KFAA 2NYSA 4JI7H 4O5VA 3ORRA 3U9SA 3MPUB 2DL8A 2QQ9A 4M7AD 4YHHH 4VUBA 4YQWA 2QASA 4CI0C 4FU6A 2JMAA 4XTWA 4Z02A 4LD6A 5LL6b 2CW8A 4ZTFA 2BTTA 1TOVA 2JA5G 2EIFA 3UATA 2ZDQA 2YDLA 3HOUG 4M4ZA 4O3PA 1N32H 2KYMA 1BI0A 1O9SA 7AT1B 2L3RA 2R92A 1C30A 5EWGA 1VQ9Q 2EVRA 3BJYA 3J81E 5KFDA 4DBFA 5KFMA 1UTIA 4QQ6A 3R5HA 2UXCH 1VQMT 4E7SA 4M78F 2RI3A 5M9OA 1UE9A 1RACB 3DKMA 4NXMH 2LNVA 1QP2A 1M1KC 5GJVB 4FSXA 1JIHA 2CZ1B 3PVXA 2COYA 4OB0B 4ATOA 2BUDA 1U5SA 4J6WA 2JW4A 4ZGEB 2QEXA 3ZBDA 5IXFA 1GRIA 1YN8A 3LWIA 2OI3A 3A98A 1QVGS 4ED1A 3M0SA 4J9KA 2RH2A 5KFLA 4WD3A 4DLKA 2AGOA 2RQVA 1E4EA 2KAFA 4DEXA 2LQWA 1JBMA 4L5GA 3QJYA 4EEYA 3LH5A 2DRKA 1HYOA 3VPCA 2FE3A 3MKDA 4XTUA 3WVDB 4C92D 2F69A 2NLUA 4KGZB 1VQNT 3QUIA 3FKIG 2DVJA 1ZUUA 1VQ5Q 1G5VA 1IO6A 4J5YA 4PLLA 3CD6A 4JV1A 2DM1A 4DEYA 1VQLA 5IYBG 3C94A 2F1LA 3SWNB 1Q81U 1TSFA 1K1ZA 4QVCA 1LOJA 4FS1A 1RLPC 4FYVB 1VQ4T 4FBUA 4MV6A 3JCMe 2E70A 2RJDA 2E6ZA 3C0CA 3M0QA 2OLSA 2W10A 2DE0X 3L2QA 1QCOA 2MAMA 4MDWA 3PNWC 3RMSA 3EH1A 3PO3G 4ECZA 4X9DA 5I47A 5KG7A 1DGSA 2JEIA 2F5TX 1N8RC 4NOYA 2VKNA 1RAHB 4O4LF 3CCUT 2PU9B 5IP9G 5DQIA 1W2BA 4PJOD 3VRYA 2EKOA 1KJJA 1WLPB 2BR0A 1TU0B 2YW2A 3CEYA 4HCKA 4ZN1A 2V58A 3M9NB 1WQ7A 1HNZH 3MEVA 5CKHA 3I4MG 2R7NA 4HCBA 3N8DA 1ULZA 1SKUB 2P4TA 2E65A 3L2ZA 4E7LA 4OMPA 3IN5A 2RNAA 4DR6H 2Y0SA 2EWNA 4MZPA 1YFNA 1KC8C 2XU8A 1TWFA 4HNVA 1YI2T 4E2FB 3CMAT 1ZSZA 2LVMA 2J05A 3I56T 2JA6G 4Q45A 1W6XA 1I50A 1D09B 5KT2A 3E5NA 3MP8A 1AHJB 4KH1B 2ROTA 3OYNA 1QCNA 4EG0A 1G3TA 1I3QA 5JVLA 2I87A 4DL2A 4HCZA 5FU7C 3LWHA 1PG5B 1TS9A 1Q82C 1I81A 2WAQE 4MMKA 1HD3A 1MNDA 2X0SA 3MEUA 3HP9A 5GAN7 3IQLA 4M7AA 5CB4F 1WGSA 4F7UA 1VQ5A 1WA7A 4UCUA 1NYGA 4J9CA 2L89A 3OYAA 1RI0A 3OUUA 4LMYA 1M1FA 3BQ2A 2KDSA 2H8HA 3H8ZA 1WHJA 2K3XA 5CKBA 2K5LA 1VQOQ 2YUPA 3RESA 4C0GA 2K57A 2G6FX 2AHJB 4DL4A 1NPRA 5FU7B 2K3BA 3U23A 4AFQC 1N8RR 3RV3A 1K76A 1TUCA 1QVGP 5GMKm 2CW7A 2CT3A 2JA8G 2GPWA 1V29B 1VQ6T 4ZHQF 5GAMd 2D8HA 1Z2OX 3SFMA 4PWQA 4PJLA 4IKFA 3I35A 5FPRA 1VQKQ 2OAWA 3M5AA 3RIRA 4BXXG 4OX9H 5GMKl 4J9NA 3LX7A 3GIMA 1BCOA 2RK2A 3J80W 1H3ZA 2VOBA 2YS6A 1XNRH 5CA0F 4JV5H 1KC8R 4JI3H 1RJRA 3M54A 4C92A 1WPYA 3OQ5A 3VKIA 1E4EB 2VUMA 2KR3A 1VKZA 4J9RA 5LJ5g 1O75A 4C5BA 2DILA 1VQ8A 4JI0H 2Y4XA 2FPGB 5IHNA 1NE8A 3OSPA 4DL5A 3VS0A 4RTTA 3N42B 1A9XA 4N0AA 1Q82R 2V4QA 1ABOA 1GBQA 4AYBE 4DV2H 4JI2H 1A0NB 2QK0A 2LZ6B 2MF2A 1B6SA 4F4WA 3GTPA 2AKLA 2E2IA 4N4IA 1ZUYA 3PVLA 4NS5A 1BXRA 1VQPQ 1M27C 2QTVA 1NJIC 1G3SA 1W1FA 2X4JA 1KJQA 5DLOA 5LJ5h 3JCMd 2GNCA 5KE3A 2D0NA 2LDMA 2FPEA 4PJOA 1PC0A 1M9SA 3RBDA 2GGRA 4J9LA 2A0FB 5KFCA 2B8AA 1YWOA 2EQMA 2LCLA 4J9IA 4AFZC 1VQ7Q 3RB0A 2YWWA 2P0KA 5F9NA 2QGGA 3SDZA 1VQOA 2RJFA 4XTXA 5KKNB 5KFSA 1VQMQ 3J80E 5IAYA 1M3BA 1K0SA 3OYLA 1SSFA 4ED2A 2X4XA 4BI4A 4CC7A 2UXBH 4P5NA 2J9GA 4J0MA 5FLMG 1OX8A 3HHTB 2WB1E 1JQQA 2RK1A 3WO0A 3SHWA 3PFSA 5DGAA 1IBKH 1J3TA 1JXMA 2DBKA 3LGLA 2A7YA 1ZSZB 2QAZA 3BW1A 5K2MA 2HQEA 2ZPFB 4LUEA 2BZ8A 1HR0H 3F70A 1N5ZA 2JN0A 2VC8A 1VQNQ 4A2BA 4R55A 4LF6H 5IXBA 3UDCA 1MHNA 2GFAA 4KGVB 2DBMA 2ED0A 2O2OA 3MO8A 4IR9A 2VGMA 2KK4A 2LT4A 2X51A 2K7AA 2FMAA 4M7AB 3ETHA 3V4SA 4GC6A 2DF6A 4EGQA 5EOYA 5DQGA 2ASDA 1VQ4Q 4F7UB 5GAMj 5LXTF 3G6XA 2Z0WA 1BBZA 1K9AA 1G83A 1X2KA 3DLMA 3N43B 4Z88A 5I11A 3JZIA 5KFPA 5KYNA 1X69A 1WCMA 4MV4A 5HK0A 1NJIR 2J6UA 4JLIA 4LNPA 5GJWB 4DV3H 2DL5A 1JDEA 2EYQA 3A5ZB 3CCST 1Q7YU 3OYFA 1CQJB 1U8RA 3GV8B 3L4KA 1YCSB 4BY1G 4MMLA 2LJ1A 1ZA1B 3VJPA 1ACMB 3CCUQ 2LRQA 2LJ0A 4X66H 1QKXA 1WXTA 4CC3A 2YZNA 4DBRA 4DUYH 4ED0A 4BI3A 4JI6H 2L3SA 1UB4A 4E7HA 1BIAA 2LC4A 1EIFA 4DR1H 3V4ZA 2CGHA 2FLNA 1X9NA 1I7NA 1BB9A 4HVWA 1KJWA 1VQMA 5LYJF 1N34H 8AT1B 4FSSA 3OMGA 1RK5A 4HQ6A 1YI2Q 3CMAQ 1QVPA 4A4KA 2DZDA 1RJPA 2RQTA 3BA8A 3I56Q 4B6MA 4C92B 4EMHA 4C0DC 3KBGA 4O4HF 2JA6A 3ORQA 5JUMA 3QJ6A 2HVSA 4HVUA 4MV1A 4DV6H 3REAB 3TQTA 5IYZF 1IOWA 3RKYA 1QP3A 2JTMA 3QBYA 1YNZA 2DPPB 2W6QA 2KQWA 3M0UA 4QWBA 3MR5A 4LUDA 2J6KA 4X65H 3JB9H 3M58A 1AOJA 1VQNA 4LSXA 2RGRA 4XTZA 4RTUA 4A3DG 1PSFA 4FW2A 2FK1A 5KYUB 2R86A 1QVGA 3SI8A 2PBZA 2FZGB 1GSHA 5I2SA 5KFFA 3VPDA 1LNXA 2MCNA 1Y14B 3HOWG 2EBPA 1E4GT 2QGFB 3MEWA 2FZCB 4C0DB 2JUFA 2EQIA 4M7AF 4C0ZA 2ATLA 1JDBB 1H8KA 2RO0A 4F7UF 1WDXA 4PJOB 2NVXA 2RHUA 3A8HB 4MA5A 4LDXA 2KXDA 5EWEA 1S72T 2ZZDA 3T5LA 4G3IA 3OHAA 3QYHB 3HKSA 4DA4A 2Q2TA 2JM9A 2ED1A 2O4XA 1VQ6Q 2QG9B 2I80A 2XICA 4RB1A 1NEGA 3NTKA 1M8VA 4JI4H 4KRTA 2MCTA 5L9XA 3FDSA 5L1LA 1K8AU 4HA8A 3J7AF 4WCIA 2BE9B 3T5JA 2M51A 4RG8A 3VPBA 3CBOA 4C0FA 2ASJA 1VBHA 3GTJA 1PHTA 1Q86U 5HK3A 3OY9A 1EZZB 3T9NA 4ESRA 3JCMb 2DERA 3H0HA 2CKZB 4DV0H 1WHKA 1WXUA 5FW9A 1SHFA 2XDDA 2A3LA 2FPIB 2C2DA 3TQ7P 2HQXA 2PTKA 1NZ9A 2KYBA 2E4HA 1U1SA 4ME6A 3K3VA 1MGQA 3M59A 4C92F 1Y1WG 1E6GA 2O01E 5KCOA 3GIBA 3R23A 2LT1A 2CUDA 2NUPA 1OZ2A 2I0NA 2CZ6B 3PIOA 4XYLB 2R8JA 3E2UA 1GGOA 5IH2A 4O3QA 5IYCG 4A4FA 2R93A 1Z9ZA 2RMOA 4RTZA 4YR3A 4RUCA 1FXXA 3RB3A 1RYRA 1RAEB 2M16A 1TXQA 3DF7A 2K2MA 1F1BB 2AGQA 2DIKA 1ZHIA 2QXFA 5DLGA 1MMAA 2E1HA 1XOVA 4FM9A 2IA6A 1I0CA 5L1KA 2DTHA 2YLBA 4HNUA 4A3KG 1UGRB 2UVVA 1T36A 1B7TA 4TV8F 1IBLH 1P8LA 4HR7A 3JSCA 2VASA 4APMA 4ETSA 2EYXA 3KTMA 4JV2A 3CC7T 2QK4A 4KULA 3T5KA 2HMAA 4IUPA 4LF7H 1M90U 1VIEA 1VOMA 2GTOA 1T0HA 2M02A 4PJOF 4X9CA 2P0QA 2R6FA 4AQYH 2RA2A 3NHNA 2HQHA 3EHQA 4JJNK 2CS7A 1FX7A 2JTEA 3MP1A 3R5XA 4RNOA 1I5LA 4JUVA 3UA6A 1B04A 3RAQA 3S6WA 3Q2OA 1MV3A 1K1SA 5GAMg 3V7SA 4YY3H 1UG1A 2M9UA 3NFCA 5FD6A 3QKJA 1S97A 1OPLA 4RNMA 4IWXA 4QVZA 1JXOA 4FYWB 4OMFB 3PO2G 3OBWA 2FKLA 4XAXB 3BG5A 3H3VH 1SPKA 2WTFA 1K9MU 1S9FA 4J7IA 5GAMf 1AUXA 3FC3A 1BK2A 4RNNA 2M1HA 5KT7A 1JRIA 2PUKB 3KHGA 3FLGA 1UNNC 2GBQA 3P8HA 1UGPB 4UFZA 1UEBA 2K4YA 3OS2A 4ZGJB 3MHXA 5GAMh 4M7DE 4R56A 2W9CB 3L4JA 3CCSQ 2FEIA 4J9MA 2AGPA 2DJZA 2DTIA 4LSAA 4YP3A 1K1QA 1Q7YC 1QWEA 2RN8A 3S3MA 3M9OB 3HOYG 5IT9W 1KFZA 4RU9A 3MFHA 2R8HA 1PRLC 5AT1B 5KG0A 2O4XB 4J8OA 2WAQA 3CQTA 2R87A 3S3NA 3TVTA 1K4US 2W8LA 5C8YF 2UUAH 3HPWA 3OSNA 2RJCA 4CC5A 5L1JA 5GMKj 4CC2A 1U1TA 2EQKA 4J6XA 3GIPA 2DD4A 3V6JA 3WVEB 2FJZA 4LF5H 3CCLA 4YJ3F 3HOZG 2DIQA 3HL8A 2IVWA 2WACA 1K73U 1AUVA 5LMUH 1WR2A 4RUGA 4EMKC 3CVZA 2MMPA 5IP7G 3SB2A 1YJNQ 2GFUA 3PR4A 3L42A 4A3BG 3TINA 2VA2A 4RZQA 3BDUA 5BR8H 3MCAB 5EZYF 1M0WA 5KFIA 1H641 4RTXA 2E5LH 5FRNA 1TG0A 1XNIA 2MK5A 3Q1JA 1AEYA 3PZPA 2R7KA 2A36A 4Q8FA 5KFEA 1VQPT 2NUPB 2CZ0B 4BDYA 1KD1U 1VA7A 3QZ5B 1R77A 4BE1A 2V8IA 4ED8A 2EFIA 4HVVA 1L2ZA 3HOVG 4EMKB 5GAMe 1PX2A 4AT1B 5IT9E 3GLKA 3HOXG 2RHIA 2W6NA 5FJ8G 1VQ7T 3FJPA 2KT8A 5C1OA 2JTFA 2QA4T 1KBLA 1QW1A 2VYTA 3OSVA 1S72Q 2YS7A 4OMOA 3N41B 2E12A 5KCHA 4IIOA 1Q7YR 3CCSA 2ZGWA 1VYUA 3Q8RB 3OS5A 1ZQ1A 5L23A 2W6ZA 2DKGA 2C00A 4JRIA 2XDBA 1WJQA 1Y96B 3BABA 1XMOH 1VBGA 4KH0B 5IYDG 2W8KA 4EBDA 4AYBA 2DFUA 2KNBB 2DZCA 3RB4A 2L3QA 3HRSA 1K8AC 1YP5A 2EW3A 1JKJB 2VWFA 1D1BA 4IRCA 3E1SA 1PNJA 3DB3A 4EIKA 3EG9B 3BY7A 1V51A 2DD5A 1JJ2A 1KIKA 5BPHA 3N40P 2E3HA 2YSQA 1UHCA 1Q86C 3CC2T 2E5KA 2ZM6H 1TWBA 3G71T 3H0FA 1SFOA 2E6NA 1N27A 3EGDA 4BY7G 1MMNA 4FW1A 1EYZA 3L2PA 1IGUA 4A4GA 5KYWA 5EG2A 2P4RA 3IG0A 3QWXX 4TQSA 1Y1WA 1WHMA 2ZPGB 1WQWA 2W71A 4TVRA 4KGXB 4B9WA 5KYXB 2FO0A 3SD4A 2DX1A 2CP6A 5CKEA 3V8LA 2A08A 3EGUA 1OV3A 1G8XA 2HD0A 2DMOA 2WB1A 5CAEB 1NLPC 5J3BA 1C1AA 5C44G 1C6VX 2GTJA 3MR2A 2JVVA 2HZYA 2ZJTA 2HL5C 3QYGB 3S3OA 4LH7A 1TAEA 3M9MB 2FYKA 5CQYA 4KBMB 1MMDA 2FL7A 3RV4A 4JJBA 3OS1A 3CC7Q 1VQ9A 4Q43A 1KQ2A 2DEUA 3SEMA 3GQCA 1M1KR 4MTEA 4XQ3A 2JA7G 3G4ST 2K3YA 3V7RA 1N48A 4PFOA 1V1CA 3CBPA 5FROA 4OMLA 4FCYA 2LQNA 2QYZA 2DIGA 5DQHA 1EHIA 2W6MA 2R58A 3GPLA 3H0IA 1X2QA 4DL3A 2HSPA 1K8AR 4KUDK 2JEJA 4BUGA 4J9QA 3OW2S 4M7DG 3FEOA 3CCMT 4RUAA 4O3NA 3RIZA 1SF9A 1QCFA 5I22A 4XX0B 2Y90A 1Q86R 4NL2A 2KEAA 3KALA 1GCPA 1OPKA 4QWCA 3JAMW 4F4YA 3CCVT 2VUGA 2NU6B 3G6ET 2R8KA 1KQ1A 5KFBA 2KMTA 4JI5H 5KFHA 1K9MC 3VS2A 5BMVF 5D8DA 2AKKA 4HT8A 1B07A 3GNGA 3PW5A 3GBQA 5ECAA 4QQDA 3CXCS 4O6JA 1AN7A 5D1PA 2XIDA 4BY6C 1SEIA 1JO8A 3ZL7C 4ECRA 2C0IA 2KGTA 3CCJT 5CQXA 3CMET 1TH7A 5LL6S 1B34A 4Z89A 3JCMV 2WSEE 5C3EG 1LJOA 1NM7A 1CKBA 4YR2A 4U6PA 3OYGA 2R57A 4QW8A 5KG4A 3GOXA 3LH0A 1UC8A 3QO3A 2E2HA 1KK7A 1Y0MA 5F9LA 3CC7A 4J9DA 3AT1B 2R5AA 4AFUC 4N4GA 1PWTA 3E9GA 3OYCA 2NWMA 1XMQH 4BY6B 3GP8A 4RB0A 4MTDA 1Y57A 1TWHA 1KHCA 4IUQA 4A53A 5C5JA 4IHJF 3R6OA 3NMZC 3U9TA 3CPWS 1K73C 4PJJA 3JAME 4DR3H 1B6RA 3RMQA 1X6OA 2YRWA 1M30A 2FPDA 2RB6A 4FU0A 4PKCC 3GTMA 3MP6A 2VVKA 1IHWA 4M7DD 2R5MA 3EGDB 4AG2C 5KYUA 4PDBA 1BI3A 5KYWB 1M7JA 4JJCA 4EGJA 2E41A 2E64A 4RG2A 1AWJA 3VYHB 3NGDA 2F4VH 5GAOm 4BDZA 1FVIA 4QW2A 1S0OA 1EUCB 4Y91A 2CSQA 2JA5A 1KD1C 1K9MR 4J6YA 3TIIA 4OB1B 3CBMA 4IIMA 1V9PA 1JU5C 5GAOl 2QA4Q 1YBYA 2RJEA 3OA6A 3RKWA 4ZQIA 3QDRB 4J9HA 1W70A 1ZUKA 1D0YA 1N33H 2ZPBB 2QDYB 3T1YH 5FWBA 4J7FA 2HVRA
chains in the Genus database with same CATH topology
2P84A 2OX7A 2QYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P84 A;  2OX7 A;  2QYZ A; 
#chains in the Genus database with same CATH topology
 2ECZ A;  1T0J A;  4RTW A;  2OH2 A;  4QWD A;  1AWO A;  5GAN j;  3FB9 A;  2B86 A;  4WTO B;  2PNI A;  3CCE T;  4XZ3 B;  5C0M A;  4C5A A;  3OW2 P;  1D1A A;  3QZ7 A;  4RB3 C;  3QDF A;  4IWY A;  3TSW A;  2ZAE A;  2A37 A;  3BQ1 A;  2QDL A;  3URG A;  1VS0 A;  1GCQ C;  4Q5W A;  1VQK A;  1M1G A;  2DLN A;  4QVD A;  4UCS A;  2XCA A;  3PVQ A;  3J7A K;  2NU7 B;  4HKE A;  1YJ9 T;  3H6Z A;  4XTV A;  3KXY T;  5GAN 6;  1AVZ C;  4B3R H;  4F4X A;  1KG1 A;  1IB8 A;  3FKI A;  1WJS A;  3CC2 Q;  1K73 R;  3G71 Q;  2KRM A;  4FYY B;  3THK A;  4J83 A;  1J5E H;  2EKH A;  3G7Z A;  3UQ8 A;  3CXC P;  1Q81 C;  2DYB A;  2LQ8 A;  4M75 C;  2PMZ E;  2DZ9 A;  4LDY A;  1N36 H;  2DL3 A;  5KFO A;  4BI8 B;  1U3O A;  1D3B B;  3PTA A;  3EGX A;  2FHD A;  4HYK A;  2XDP A;  4OMQ A;  2QTX A;  4R0K A;  2X3W D;  2KT1 A;  3JB9 G;  4ECU A;  4I4T F;  3OBY A;  4GLM A;  3M53 A;  3TIG A;  2CP3 A;  1VQP A;  2BIV A;  3L2V A;  4DL6 A;  3I5R A;  2EJF A;  4C5G A;  1I7L A;  2IP4 A;  2IMW P;  4C8Q C;  2EQJ A;  2R7Z G;  3X25 B;  1JB0 E;  2LCC A;  4RB2 C;  5AYF A;  5CIU A;  1B34 B;  3TSZ A;  3LGF A;  1XQH A;  2JEG A;  2W9B B;  1VQ7 A;  4O3O A;  5KX5 F;  4ED7 A;  2QA4 A;  1UUE A;  2XD4 A;  1ZX6 A;  1DV1 A;  3G4S Q;  2F2X A;  1G2B A;  3KFV A;  6AT1 B;  3CPW P;  1M3C A;  1IGQ A;  1N56 A;  3KHR A;  5IN1 A;  2DXB A;  2B63 G;  4WBN F;  4RTY A;  4FM4 B;  1WFW A;  3A1P A;  4B9X A;  3VS4 A;  4GKJ H;  4M75 E;  1YJN T;  1VYT A;  3UT1 A;  3WO1 A;  3CCM Q;  1UGV A;  1QVF S;  1LVK A;  5KFW A;  4GLK A;  3QII A;  2HAX A;  3C4S A;  1BIB A;  1PSE A;  3KHH A;  2W6P A;  1B3Q A;  3H41 A;  1VQL T;  1OI1 A;  2UUC H;  2JEF A;  3JB9 J;  3JCM X;  2W6O A;  2I2L A;  3L1A A;  3UA7 A;  2ASL A;  3CCV Q;  1I07 A;  3G6E Q;  4ZI7 F;  1Q81 R;  1W2B S;  4C8Q E;  5A0L A;  1IHV A;  3G71 A;  5KG1 A;  3EYY A;  4A3C G;  4UCO A;  4ECX A;  3CCR T;  2MPX C;  2BQ3 A;  3DLL A;  3G1J A;  2W9C A;  1GFD A;  1VQ4 A;  3CCQ T;  1S10 A;  2F2W A;  4RCC A;  2F5K A;  5IHI A;  3A8O B;  5GAN 3;  2V8J A;  5GAO q;  5KT4 A;  1SCU B;  2RF4 A;  4X34 A;  2JS0 A;  3CCJ Q;  3JB9 D;  4E6R A;  3HRT A;  1JLL B;  3CME Q;  3BFM A;  1OX9 A;  1KEE A;  1WHH A;  4XU1 A;  1SG5 A;  2DLP A;  4YBZ B;  2VV5 A;  3CCU A;  4LN2 A;  4CC4 B;  1BGW A;  2W7P A;  2R92 G;  1U06 A;  2D0Q B;  1TTH B;  3QXE B;  3V8J A;  2LX7 A;  2DWC A;  4O3R A;  2DXU A;  2D6F A;  2VQF H;  4M77 C;  3QZ8 A;  3D7S B;  3OS0 A;  4FS2 A;  3FRN A;  2XG8 D;  4Q44 A;  2E10 A;  2EGE A;  4TV9 F;  2WSF E;  2J6T A;  3GTQ A;  3KHL A;  2OJ2 A;  3GV7 B;  1CQI B;  5DGB A;  2QI2 A;  4XYM B;  1YI2 A;  3GV5 B;  1BI2 A;  3CMA A;  4AG1 C;  3QFF A;  2UVW A;  3I56 A;  3REB B;  5KFZ A;  5HKC A;  4A3J G;  2HDA A;  4Y8V B;  3VS3 A;  2O31 A;  4E4T A;  3VS7 A;  3AYH B;  2FVU A;  5J2U F;  4J9O A;  3RKX A;  2BZY A;  3MEA A;  4IRD A;  2EGA A;  2V5A A;  4F17 A;  1XDN A;  2EJG A;  5CO7 A;  3T1H H;  3I5S A;  4UC4 A;  3I55 T;  3LP8 A;  4UCR A;  4Z8A A;  4FYX B;  4X62 H;  5FWC A;  1YHQ T;  3X26 B;  4DOV A;  4E7J A;  3L2W A;  2KBT A;  3JCM W;  4I7H A;  3WNZ A;  1RLQ C;  4EMK A;  3EGX B;  2YT6 A;  3N6X A;  2OWO A;  4DOW A;  2FRW A;  3CCV A;  2OTJ T;  3G6E A;  5LMN H;  3GNF B;  1QWF A;  3C12 A;  2LCS A;  4C5C A;  4OF1 A;  1M3A A;  3UF4 A;  3MR6 A;  1TUG B;  2CP2 A;  4LDW A;  1TWG A;  5DLF A;  4M77 E;  4BE0 A;  1AWW A;  3RF2 A;  3PIP A;  5DLQ E;  2JOY A;  4M7D C;  2K5I A;  3QG1 A;  1Y96 A;  2NU9 B;  3JB9 I;  1I94 H;  1GLV A;  2FLP A;  1OOT A;  1XJW B;  2XI9 A;  1ABQ A;  3CCE Q;  4GBQ A;  2CKK A;  1X43 A;  4YAJ B;  3P8B B;  1CS0 A;  3CME A;  1VQ6 A;  5LJ3 d;  2CT4 A;  4JDS A;  3WXM B;  1QVF P;  3M57 A;  4DV1 H;  2D8J A;  2X4Y A;  4E47 A;  1GYF A;  3M0R A;  2LQK A;  5KFR A;  4DR4 H;  3SE7 A;  3CXC A;  3EG9 A;  1H92 A;  1FMV A;  2GLT A;  2VGN A;  1YJ9 Q;  3G8C A;  4MV8 A;  3RFC A;  3O5Z A;  2W70 A;  1GSO A;  5EWF A;  2YXY A;  1W2B P;  3PMT A;  4RAY A;  3GII A;  3OYH A;  4M7D B;  4Y28 E;  3GF5 A;  4M78 C;  4JV0 A;  4KT0 E;  3EFO B;  3RGX A;  3G6V A;  2BQR A;  3ME9 A;  1WXB A;  1ZET A;  2VXF A;  3VV0 A;  2RD1 A;  3ETJ A;  2HBW A;  5KYX A;  4O3S A;  1JXL A;  2YRC A;  1Z2N X;  3I12 A;  4DBH A;  1M4Z A;  1OYX A;  4QIW E;  2D1X A;  1VUB A;  2UVR A;  2HHH H;  2V26 A;  3M4Y A;  3H40 A;  4RTV A;  3MJF A;  1C3O A;  2W9A A;  4IR1 A;  3H20 A;  4LXC A;  2O9V A;  2DRM A;  4EFB A;  1OWT A;  2D9T A;  4O4I F;  3BQ0 A;  2V4R A;  3BDL A;  5KT3 A;  5CCA A;  1N6A A;  1X01 A;  3RER A;  4R7R A;  4BBS G;  3EG3 A;  1V76 A;  4DR2 H;  4DV7 H;  3M0T A;  1S68 A;  3CPW A;  4M75 G;  5CKD A;  4ORZ A;  2ZDG A;  5T14 A;  4X64 H;  2VUB A;  1YIJ T;  2R7Z A;  1G3W A;  4D6W A;  1P92 A;  3KXT A;  2KXC A;  2YUN A;  2KRN A;  4CRI A;  2J06 A;  2YRV A;  2RPN A;  3H0G G;  4K0K H;  3EG1 A;  2AT1 B;  1N9R A;  4OB3 B;  5D1O A;  4C8Q G;  1S0N A;  2PVD B;  3INZ A;  4M78 E;  4MV9 A;  2XCL A;  3QWY A;  4DL7 A;  4JS5 A;  3TQ1 A;  4JUZ A;  2DL4 A;  1WSC A;  2JS2 A;  4A63 B;  2CDT A;  1R0C B;  2LP5 A;  1TWA A;  3VMM A;  2DTO A;  3P8D A;  2XC9 A;  2SRC A;  1UDL A;  4LDU A;  4O2B F;  3CD6 Q;  2XIG A;  1D0X A;  2L5Q A;  2X9H A;  1VQL Q;  3M55 A;  3OUZ A;  1YJ9 A;  2EJ9 A;  3PW0 A;  2X4W A;  4FT2 A;  4ED6 A;  2ZPI B;  4AFS C;  1XNQ H;  4EEQ A;  4LFA H;  3GTG A;  1I6U A;  2K6D A;  2KI7 A;  4HT9 A;  1N9S A;  2FB7 A;  2OX7 A;  2YU9 A;  1FYN A;  2FLL A;  1IRE B;  2JT4 A;  1OU9 A;  4PFZ A;  4IRK A;  1SRM A;  5KE2 A;  3CCR Q;  5LJ3 j;  4E7Z A;  4LFC H;  3CCQ Q;  4XU2 A;  5KFN A;  4QW9 A;  5LJ5 j;  2UVU A;  3TEE A;  4BWS C;  4ZNX A;  2VQD A;  1E6H A;  1Y71 A;  3RAX A;  1PRM C;  2W0Z A;  1UEC A;  3MWM A;  5KG5 A;  2EYW A;  4ZGD B;  2SEM A;  3X20 B;  4D8K A;  4FBT A;  4ECW A;  3OHB A;  1BNC A;  4PJO G;  4ECS A;  4BBR G;  5GAN 5;  1I8F A;  5L1I A;  4M75 D;  4JRQ A;  4RAZ A;  4C5E A;  1DV2 A;  2CH4 W;  1KC7 A;  3QSU A;  4JI1 H;  1KHI A;  1PD1 A;  1IZ6 A;  1GXI E;  2ATC B;  4J9B A;  2CUB A;  2K79 A;  1SSH A;  5GAN 2;  1ZA2 B;  2PN1 A;  4YB8 B;  3A8M B;  4OGC A;  4LDV A;  1KQS S;  2DXC A;  3SWN C;  3M56 A;  2PQW A;  4X1V A;  1DJ7 B;  3MWD A;  2X35 A;  1M8M A;  1UJY A;  1S03 G;  3X24 B;  4C8Q D;  2AU0 A;  3M4I A;  3EPI A;  1AT1 B;  1WHG A;  5D6X A;  4PFP A;  3K5I A;  3I9Q A;  5C1P A;  1YJW T;  2WYO A;  3K3P A;  1YIT T;  1WIE A;  2NVY A;  1MNE A;  3EG2 A;  3ASK A;  5DG7 A;  1T3N A;  4ECV A;  1MV0 B;  2DA9 A;  4M77 G;  3JCM c;  1YJN A;  5L8R E;  1OUL A;  2G3R A;  4MZM A;  3EPG A;  4NXN H;  2DJQ A;  1Q95 G;  5C4X G;  4ME7 A;  3I55 Q;  1YHQ Q;  1Y1V G;  4B3S H;  2CZG A;  3GIK A;  3OYY A;  2CQY A;  2OTJ Q;  5KFT A;  2RDJ A;  1NG2 A;  1UHF A;  4RZR A;  1X27 A;  4NLG A;  1BU1 A;  4PLI A;  3Q8P B;  5FPO A;  2XK0 A;  4WF2 A;  1WCM G;  1QVF A;  3CCR A;  2EPD A;  4QWA A;  3CCQ A;  3PMI A;  5JH7 F;  5GAN 8;  4ED3 A;  1B33 N;  2R7M A;  1NEB A;  5KYY B;  2YRD A;  1PKT A;  3CPF A;  1S72 A;  1K83 A;  3OB9 A;  4L6V 5;  1M90 C;  1KJI A;  2ALZ A;  3OYJ A;  1SEM A;  2OTL T;  4PNO A;  1X6G A;  2XHC A;  2K5F A;  2PMZ A;  2VPS A;  2DET A;  3HBL A;  3PT9 A;  3MR3 A;  3MFI A;  1T3L A;  1BJT A;  2OAU A;  1LPL A;  5D1O B;  2PUO B;  1ZHQ A;  3LML A;  2EAY A;  4F50 A;  2BQU A;  3Q8S B;  3PE0 A;  2HL3 A;  1OEB A;  3JCM P;  1VQ8 Q;  3Q1K A;  1MMG A;  1RAA B;  2NUT A;  2RHX A;  5GAN d;  2FPP B;  1FMK A;  2H3J A;  1RJQ A;  5FD5 A;  2C2E A;  4LF4 H;  1KSW A;  5KG6 A;  2COZ A;  5CA1 F;  1HK9 A;  1XTD A;  3F8N A;  1WJR A;  2YCH A;  3HKZ E;  5GAO p;  2CP7 A;  2RQR A;  2V1R A;  1JEG A;  1GCQ A;  5GAO r;  1D3B A;  2DXT A;  4E7I A;  4QWE A;  2A28 A;  3OYD A;  4M77 D;  5HBR B;  2YHT A;  4ELY C;  5DG8 A;  2VQE H;  3KAK A;  2PVG B;  3ZEH A;  4XTY A;  4ZTJ A;  2EYZ A;  3RTX A;  5D7U A;  3QHS A;  2FB9 A;  1RI9 A;  2YUQ A;  2L8D A;  4M78 G;  1X75 C;  3I55 A;  1RUW A;  5GAN 4;  2CYZ B;  2RI5 A;  3JCM J;  2L2P A;  1YHQ A;  4DV5 H;  2V1Q A;  2C22 A;  2AZV A;  2W9B A;  4MDX A;  4M75 A;  1EFN A;  5JQW A;  1KJ8 A;  1YIJ Q;  3QZ9 B;  1KQS P;  2OTJ A;  4UCV A;  4ECQ A;  5KFJ A;  3L2R A;  1PCX A;  5J2T F;  3L2U A;  4GC7 A;  3NPF A;  5HV6 A;  5BPF A;  4JZ4 A;  2RQU A;  3JB9 F;  3PGG A;  5DG9 A;  4ECT A;  4IUT A;  4A3L G;  1M90 R;  1WI7 A;  1BCM A;  4IUU A;  1CKA A;  2HJW A;  5J26 A;  1HSQ A;  2R85 A;  3H0G A;  1VYV A;  1ZLM A;  4OGE A;  5KT6 A;  3OMC A;  4C8Q A;  4OMM A;  3RBB B;  3O8V A;  3CC4 T;  3HXL A;  5GMK h;  5CR2 A;  1M0T A;  4EDU A;  2IBK A;  3TU4 K;  1EUD B;  3RUX A;  3LLR A;  5GMK i;  2KRS A;  2DEQ A;  3EH2 A;  1RAF B;  2XGP A;  2DPJ A;  2QQR A;  2EYY A;  3HTR A;  5LJ3 g;  4DBQ A;  3UFX B;  5KG3 A;  2RQW A;  3N44 B;  2HEQ A;  3VUZ A;  3NGP A;  2P0A A;  1VAJ A;  4GKK H;  2YLC A;  4JS4 A;  3RNJ A;  2YUO A;  4JI8 H;  3ER0 A;  4F04 B;  2HNI A;  4R8U A;  3OYI A;  4EBC A;  4JRP A;  2IPO B;  3H9N A;  5LJ3 f;  1Z2P X;  4EMG A;  4OB2 B;  5LJ5 f;  1E7O A;  5KG2 A;  5D6W A;  2PZ1 A;  2J6S A;  2VXE A;  2R93 G;  2FPF A;  1G3Y A;  3N5B B;  2AQ4 A;  2DNU A;  1CSK A;  4PJM A;  1M2V A;  1ARK A;  4L1K A;  2LTO A;  5KFX A;  2ESW A;  2C28 A;  5LJ3 h;  1ZBJ A;  3GIJ A;  3JCM Q;  2QQS A;  4M78 D;  4KHP H;  4M9U A;  5A2Q W;  3JRW A;  4LF8 H;  1ZSZ C;  1M2O A;  2DL7 A;  2L0A A;  5EC7 A;  1T94 A;  4PK4 A;  3HSB A;  2BZX A;  3FIF A;  1YIJ A;  4IAJ A;  2V9W A;  2W57 A;  2CRE A;  2KSW A;  1IOV A;  1FWZ A;  3RR6 A;  4A4H A;  4MV7 A;  2O88 A;  4ZN3 A;  2UU9 H;  2K9G A;  3CCL T;  1WHL A;  2MYS A;  4M7A C;  2LNH B;  2LX9 A;  5GMK e;  1UC9 A;  3R5F A;  4LD9 K;  4A93 G;  1RL2 A;  4RCB A;  2UXD H;  4B3T H;  1YJW Q;  3EHR A;  4OMN A;  1YIT Q;  3H4B A;  1JX4 A;  4JYA H;  1HXD A;  2ZCF B;  4YR0 A;  1D0Z A;  2NUT B;  2XKO C;  4J9F A;  5KH6 A;  2HKN A;  3GID A;  4M77 A;  3PR5 B;  2WDT A;  1PM3 A;  2R7L A;  4F4Z A;  1S0M A;  1EX4 A;  2PVO B;  3E9F A;  2HSE B;  2BKD N;  4K11 A;  4OVA A;  2C0T A;  2Y0S E;  2YYA A;  2WSC E;  2WE6 A;  4Q0Y A;  3M4G A;  1Y1V A;  1ZQ7 A;  4FT4 A;  2IG0 A;  5KFQ A;  4V2S A;  3LWB A;  1BI1 A;  2AK5 A;  1KD1 R;  2GQI A;  2GPS A;  2W7O A;  3KUF A;  3GLX A;  3A8L B;  5A2Q E;  4YJ2 F;  2CP5 A;  2R8G A;  5GON F;  3VS5 A;  2DPI A;  2YRX A;  4LF9 H;  4OP0 A;  5IWA H;  3H4D A;  3RDV A;  1M6V A;  3HB9 A;  5LJ3 e;  2XGQ A;  1WX6 A;  5LJ5 e;  1R0B G;  4U7C A;  2O9S A;  4M75 B;  2IIM A;  1GSA A;  4M7E A;  3V6H A;  3GIL A;  4C92 C;  1RK6 A;  1SHG A;  4BD3 A;  4M7A E;  1RAI B;  2YZG A;  5JVD F;  2JM8 A;  3LW5 E;  4D8D A;  4F7U E;  3Q8Q B;  2JA7 A;  1WYX A;  2X3X D;  5I2M A;  5CAI A;  2QEX T;  1JJ2 S;  2OTL Q;  1D1C A;  1EZ1 A;  2NUA B;  5HY6 A;  5FLX W;  4EYI B;  1AZG B;  4EYH B;  2J6O A;  3JV3 A;  2E3I A;  2C06 A;  4JJD A;  2C0O A;  4QIW A;  3FJ5 A;  4F16 A;  5HCK A;  4N0A C;  3DB4 A;  3VU3 C;  4C8Q B;  3FDR A;  1YWP A;  1IRX A;  2MIO A;  4M7D A;  1FMW A;  2LJ3 A;  5KT5 A;  3EFO A;  3CD6 T;  2O03 A;  2ZDH A;  2R82 A;  4HXJ A;  3R6N A;  4J9P A;  2RI2 A;  4J9E A;  2YZM A;  5LOV F;  2CZ7 B;  2CP0 A;  4ANJ A;  4II1 A;  1OZ3 A;  4IUR A;  4MAM A;  4RMO A;  4A3G G;  2L3P A;  4QKU A;  2P0P A;  3CC2 A;  3EFS A;  3E19 A;  1YJW A;  4PJO C;  1YIT A;  1NPP A;  5DY9 A;  1S1N A;  4C5H A;  4EPC A;  2DO3 A;  2FK2 A;  1NBE B;  1KQS A;  1GL5 A;  4R8U B;  4BB7 A;  4F14 A;  5H80 A;  2RF0 A;  2CSI A;  2KSS A;  1MZB A;  3OYK A;  3RB6 A;  4C92 E;  2KRO A;  8ATC B;  4DV4 H;  1NLO C;  9ATC B;  2AIR B;  4M78 A;  1UFF A;  3EG0 A;  3PW4 A;  1WNL A;  4L59 A;  1M2V B;  1TWC A;  1R9T A;  5CVI A;  2VB6 A;  2QQB A;  1K0X A;  4HCC A;  4RKU E;  1X6B A;  1WH2 A;  3X28 B;  5FLX E;  2FK3 A;  1QMC A;  2FRY A;  2C2R A;  1VQ9 T;  2RHZ A;  2MOX A;  4Y92 A;  1GO3 E;  1M1K U;  4DQ2 A;  3JRZ A;  4LFB H;  4JRK A;  1V4Y A;  2R8I A;  1PKS A;  2V8K A;  2Q2U A;  2ENM A;  1PK8 A;  2M0Y A;  3OYB A;  3BA9 A;  5FU6 C;  4MZT A;  3V8K A;  4QJF A;  4M75 F;  2VA3 A;  4A3F G;  3G4S A;  5FRM A;  2DK3 A;  4MV3 A;  3G6Y A;  2HGS A;  2UUB H;  2OTL A;  3CC4 Q;  4A3I G;  3NTI A;  4EBE A;  1NYF A;  1C0M A;  2GF7 A;  2VR1 A;  2HBP A;  4PJO E;  3AHU A;  1KJ9 A;  3BAA A;  1ZBX A;  1Y7X A;  3ZFJ A;  2XCP A;  1FJG H;  3TRE A;  1AWX A;  1QQJ A;  3CCM A;  4E7K A;  1IXD A;  4MA0 A;  4C8Q F;  1VQ5 T;  1M5Q 1;  3EFR A;  4M77 B;  4I55 F;  5LP6 F;  1HNW H;  3M9Q A;  4C2M A;  4XK8 E;  1BKB A;  2JMC A;  3RJ0 A;  2M0O A;  1ZSG A;  5FU6 B;  2P84 A;  4J9G A;  4ZOL F;  3PW7 A;  3UWN A;  2GQV A;  1OQK A;  2JXB A;  3GIQ A;  5D6Y A;  5GAN g;  3OW2 A;  1W96 A;  4DR7 H;  3TCJ A;  4GLX A;  3UPU A;  2XMF A;  2XD0 A;  1JJ2 P;  5GAO n;  1N8R U;  2F2V A;  4LE9 A;  4DUZ H;  1RYS A;  2JZ2 A;  2M05 A;  5I21 A;  2KVQ G;  1QKW A;  3C0F B;  4KUI A;  4FIB A;  1PD0 A;  1SRL A;  1OU8 A;  1RAD B;  5GAN f;  4BE2 A;  2RDI A;  2V59 A;  2NU8 B;  4JPB W;  4B3M H;  3CCJ A;  2JNG A;  2NUZ A;  4TQR A;  3BE3 A;  3C95 A;  2QQA A;  1I4K 1;  1GBR A;  2MI6 A;  4XU3 A;  3V6K A;  5LJ5 d;  3RUP A;  2RGV A;  2RHY A;  3VS1 A;  4O2A F;  3HRU A;  4IUV A;  1RAB B;  4JZ3 A;  3QPH A;  3I4N G;  1KC8 U;  5GAN h;  2SCU B;  4PL6 A;  3MET A;  2Y4Y A;  2FP4 B;  1RAG B;  3JRX A;  3FMA A;  2GCX A;  1H3H A;  3CCL Q;  1E4F T;  2HKQ B;  2J6F A;  2R84 A;  1QLY A;  1VQ8 T;  1UJ0 A;  4YTL A;  3OTO H;  1SYX B;  2ABL A;  2AZS A;  1A0I A;  2C35 B;  4HNT A;  1I1J A;  1AD5 A;  3JSN A;  4ECY A;  2J7I A;  2DAQ A;  3HFN A;  4IZO A;  3RBE A;  1Z9Q A;  4QT7 A;  2HVQ A;  3VRZ A;  4BAC A;  1Q82 U;  3CC4 A;  5CKF A;  4N4H A;  2CH4 A;  2E5Q A;  3K5H A;  4A4E A;  1W93 A;  5A0D A;  4YAK B;  1GFC A;  5KFV A;  4M7A G;  3SWN A;  4A2A A;  2ZPH B;  4F7U G;  5J39 A;  1UGS B;  1BYM A;  2MWO A;  3PW2 A;  4CC6 A;  1YCY A;  4PJN A;  3T5H A;  4TUY F;  2EGC A;  1T3S A;  3PN1 A;  3NTH A;  5C6S A;  3OSS C;  1LCK A;  4M77 F;  1CE8 A;  1FKA H;  4M78 B;  4A3E G;  2RM4 A;  3RGZ A;  1VIF A;  2I8C A;  1VQO T;  5KYY A;  2DYI A;  3M0P A;  4XU0 A;  1IBM H;  3GTL A;  2H3E B;  2JJ9 A;  2EQU A;  1TUD A;  2PVP A;  4UCT A;  3VS6 A;  4LH6 A;  2HCK A;  2VPQ A;  2MWP A;  5DM7 R;  5KFK A;  3VYG A;  3GTK A;  1TA8 A;  2YL2 A;  3OYM A;  2QEX Q;  4A54 A;  4AMC A;  3EAE A;  3HKZ A;  3KAJ A;  5A0G A;  4NL3 A;  4QQG A;  2KY9 A;  3ULR B;  2B63 A;  5GAN e;  3CCE A;  3J81 W;  2COW A;  1VQK T;  1WZO A;  1R8O B;  4I50 F;  3GTO A;  1I5O B;  4GY5 A;  3JCM g;  3MWE A;  4C92 G;  2K2V A;  2LMJ A;  3LYI A;  1ZHS A;  2VUM G;  1MUZ A;  3CQZ A;  4EFE A;  1W4S A;  4C5I A;  2FZK B;  5KFY A;  3MJX A;  1HJD A;  2ZPE B;  1UGQ B;  5CK9 A;  1Y07 A;  2BE7 D;  4DR5 H;  2FG0 A;  3JSL A;  3JCM f;  3OYE A;  5LA6 F;  5KFG A;  3VUB A;  3HFO A;  2KE9 A;  4A3M G;  4Q8E A;  2DVE A;  4ELZ C;  4M7D F;  5IHK A;  1HNX H;  3V7C A;  1DIK A;  3A8G B;  5EDW A;  4JLG A;  5KFU A;  2ROL A;  1AZE A;  4J9S A;  3JCM h;  1NJI U;  4FL6 A;  5KFA A;  2NYS A;  4JI7 H;  4O5V A;  3ORR A;  3U9S A;  3MPU B;  2DL8 A;  2QQ9 A;  4M7A D;  4YHH H;  4VUB A;  4YQW A;  2QAS A;  4CI0 C;  4FU6 A;  2JMA A;  4XTW A;  4Z02 A;  4LD6 A;  5LL6 b;  2CW8 A;  4ZTF A;  2BTT A;  1TOV A;  2JA5 G;  2EIF A;  3UAT A;  2ZDQ A;  2YDL A;  3HOU G;  4M4Z A;  4O3P A;  1N32 H;  2KYM A;  1BI0 A;  1O9S A;  7AT1 B;  2L3R A;  2R92 A;  1C30 A;  5EWG A;  1VQ9 Q;  2EVR A;  3BJY A;  3J81 E;  5KFD A;  4DBF A;  5KFM A;  1UTI A;  4QQ6 A;  3R5H A;  2UXC H;  1VQM T;  4E7S A;  4M78 F;  2RI3 A;  5M9O A;  1UE9 A;  1RAC B;  3DKM A;  4NXM H;  2LNV A;  1QP2 A;  1M1K C;  5GJV B;  4FSX A;  1JIH A;  2CZ1 B;  3PVX A;  2COY A;  4OB0 B;  4ATO A;  2BUD A;  1U5S A;  4J6W A;  2JW4 A;  4ZGE B;  2QEX A;  3ZBD A;  5IXF A;  1GRI A;  1YN8 A;  3LWI A;  2OI3 A;  3A98 A;  1QVG S;  4ED1 A;  3M0S A;  4J9K A;  2RH2 A;  5KFL A;  4WD3 A;  4DLK A;  2AGO A;  2RQV A;  1E4E A;  2KAF A;  4DEX A;  2LQW A;  1JBM A;  4L5G A;  3QJY A;  4EEY A;  3LH5 A;  2DRK A;  1HYO A;  3VPC A;  2FE3 A;  3MKD A;  4XTU A;  3WVD B;  4C92 D;  2F69 A;  2NLU A;  4KGZ B;  1VQN T;  3QUI A;  3FKI G;  2DVJ A;  1ZUU A;  1VQ5 Q;  1G5V A;  1IO6 A;  4J5Y A;  4PLL A;  3CD6 A;  4JV1 A;  2DM1 A;  4DEY A;  1VQL A;  5IYB G;  3C94 A;  2F1L A;  3SWN B;  1Q81 U;  1TSF A;  1K1Z A;  4QVC A;  1LOJ A;  4FS1 A;  1RLP C;  4FYV B;  1VQ4 T;  4FBU A;  4MV6 A;  3JCM e;  2E70 A;  2RJD A;  2E6Z A;  3C0C A;  3M0Q A;  2OLS A;  2W10 A;  2DE0 X;  3L2Q A;  1QCO A;  2MAM A;  4MDW A;  3PNW C;  3RMS A;  3EH1 A;  3PO3 G;  4ECZ A;  4X9D A;  5I47 A;  5KG7 A;  1DGS A;  2JEI A;  2F5T X;  1N8R C;  4NOY A;  2VKN A;  1RAH B;  4O4L F;  3CCU T;  2PU9 B;  5IP9 G;  5DQI A;  1W2B A;  4PJO D;  3VRY A;  2EKO A;  1KJJ A;  1WLP B;  2BR0 A;  1TU0 B;  2YW2 A;  3CEY A;  4HCK A;  4ZN1 A;  2V58 A;  3M9N B;  1WQ7 A;  1HNZ H;  3MEV A;  5CKH A;  3I4M G;  2R7N A;  4HCB A;  3N8D A;  1ULZ A;  1SKU B;  2P4T A;  2E65 A;  3L2Z A;  4E7L A;  4OMP A;  3IN5 A;  2RNA A;  4DR6 H;  2Y0S A;  2EWN A;  4MZP A;  1YFN A;  1KC8 C;  2XU8 A;  1TWF A;  4HNV A;  1YI2 T;  4E2F B;  3CMA T;  1ZSZ A;  2LVM A;  2J05 A;  3I56 T;  2JA6 G;  4Q45 A;  1W6X A;  1I50 A;  1D09 B;  5KT2 A;  3E5N A;  3MP8 A;  1AHJ B;  4KH1 B;  2ROT A;  3OYN A;  1QCN A;  4EG0 A;  1G3T A;  1I3Q A;  5JVL A;  2I87 A;  4DL2 A;  4HCZ A;  5FU7 C;  3LWH A;  1PG5 B;  1TS9 A;  1Q82 C;  1I81 A;  2WAQ E;  4MMK A;  1HD3 A;  1MND A;  2X0S A;  3MEU A;  3HP9 A;  5GAN 7;  3IQL A;  4M7A A;  5CB4 F;  1WGS A;  4F7U A;  1VQ5 A;  1WA7 A;  4UCU A;  1NYG A;  4J9C A;  2L89 A;  3OYA A;  1RI0 A;  3OUU A;  4LMY A;  1M1F A;  3BQ2 A;  2KDS A;  2H8H A;  3H8Z A;  1WHJ A;  2K3X A;  5CKB A;  2K5L A;  1VQO Q;  2YUP A;  3RES A;  4C0G A;  2K57 A;  2G6F X;  2AHJ B;  4DL4 A;  1NPR A;  5FU7 B;  2K3B A;  3U23 A;  4AFQ C;  1N8R R;  3RV3 A;  1K76 A;  1TUC A;  1QVG P;  5GMK m;  2CW7 A;  2CT3 A;  2JA8 G;  2GPW A;  1V29 B;  1VQ6 T;  4ZHQ F;  5GAM d;  2D8H A;  1Z2O X;  3SFM A;  4PWQ A;  4PJL A;  4IKF A;  3I35 A;  5FPR A;  1VQK Q;  2OAW A;  3M5A A;  3RIR A;  4BXX G;  4OX9 H;  5GMK l;  4J9N A;  3LX7 A;  3GIM A;  1BCO A;  2RK2 A;  3J80 W;  1H3Z A;  2VOB A;  2YS6 A;  1XNR H;  5CA0 F;  4JV5 H;  1KC8 R;  4JI3 H;  1RJR A;  3M54 A;  4C92 A;  1WPY A;  3OQ5 A;  3VKI A;  1E4E B;  2VUM A;  2KR3 A;  1VKZ A;  4J9R A;  5LJ5 g;  1O75 A;  4C5B A;  2DIL A;  1VQ8 A;  4JI0 H;  2Y4X A;  2FPG B;  5IHN A;  1NE8 A;  3OSP A;  4DL5 A;  3VS0 A;  4RTT A;  3N42 B;  1A9X A;  4N0A A;  1Q82 R;  2V4Q A;  1ABO A;  1GBQ A;  4AYB E;  4DV2 H;  4JI2 H;  1A0N B;  2QK0 A;  2LZ6 B;  2MF2 A;  1B6S A;  4F4W A;  3GTP A;  2AKL A;  2E2I A;  4N4I A;  1ZUY A;  3PVL A;  4NS5 A;  1BXR A;  1VQP Q;  1M27 C;  2QTV A;  1NJI C;  1G3S A;  1W1F A;  2X4J A;  1KJQ A;  5DLO A;  5LJ5 h;  3JCM d;  2GNC A;  5KE3 A;  2D0N A;  2LDM A;  2FPE A;  4PJO A;  1PC0 A;  1M9S A;  3RBD A;  2GGR A;  4J9L A;  2A0F B;  5KFC A;  2B8A A;  1YWO A;  2EQM A;  2LCL A;  4J9I A;  4AFZ C;  1VQ7 Q;  3RB0 A;  2YWW A;  2P0K A;  5F9N A;  2QGG A;  3SDZ A;  1VQO A;  2RJF A;  4XTX A;  5KKN B;  5KFS A;  1VQM Q;  3J80 E;  5IAY A;  1M3B A;  1K0S A;  3OYL A;  1SSF A;  4ED2 A;  2X4X A;  4BI4 A;  4CC7 A;  2UXB H;  4P5N A;  2J9G A;  4J0M A;  5FLM G;  1OX8 A;  3HHT B;  2WB1 E;  1JQQ A;  2RK1 A;  3WO0 A;  3SHW A;  3PFS A;  5DGA A;  1IBK H;  1J3T A;  1JXM A;  2DBK A;  3LGL A;  2A7Y A;  1ZSZ B;  2QAZ A;  3BW1 A;  5K2M A;  2HQE A;  2ZPF B;  4LUE A;  2BZ8 A;  1HR0 H;  3F70 A;  1N5Z A;  2JN0 A;  2VC8 A;  1VQN Q;  4A2B A;  4R55 A;  4LF6 H;  5IXB A;  3UDC A;  1MHN A;  2GFA A;  4KGV B;  2DBM A;  2ED0 A;  2O2O A;  3MO8 A;  4IR9 A;  2VGM A;  2KK4 A;  2LT4 A;  2X51 A;  2K7A A;  2FMA A;  4M7A B;  3ETH A;  3V4S A;  4GC6 A;  2DF6 A;  4EGQ A;  5EOY A;  5DQG A;  2ASD A;  1VQ4 Q;  4F7U B;  5GAM j;  5LXT F;  3G6X A;  2Z0W A;  1BBZ A;  1K9A A;  1G83 A;  1X2K A;  3DLM A;  3N43 B;  4Z88 A;  5I11 A;  3JZI A;  5KFP A;  5KYN A;  1X69 A;  1WCM A;  4MV4 A;  5HK0 A;  1NJI R;  2J6U A;  4JLI A;  4LNP A;  5GJW B;  4DV3 H;  2DL5 A;  1JDE A;  2EYQ A;  3A5Z B;  3CCS T;  1Q7Y U;  3OYF A;  1CQJ B;  1U8R A;  3GV8 B;  3L4K A;  1YCS B;  4BY1 G;  4MML A;  2LJ1 A;  1ZA1 B;  3VJP A;  1ACM B;  3CCU Q;  2LRQ A;  2LJ0 A;  4X66 H;  1QKX A;  1WXT A;  4CC3 A;  2YZN A;  4DBR A;  4DUY H;  4ED0 A;  4BI3 A;  4JI6 H;  2L3S A;  1UB4 A;  4E7H A;  1BIA A;  2LC4 A;  1EIF A;  4DR1 H;  3V4Z A;  2CGH A;  2FLN A;  1X9N A;  1I7N A;  1BB9 A;  4HVW A;  1KJW A;  1VQM A;  5LYJ F;  1N34 H;  8AT1 B;  4FSS A;  3OMG A;  1RK5 A;  4HQ6 A;  1YI2 Q;  3CMA Q;  1QVP A;  4A4K A;  2DZD A;  1RJP A;  2RQT A;  3BA8 A;  3I56 Q;  4B6M A;  4C92 B;  4EMH A;  4C0D C;  3KBG A;  4O4H F;  2JA6 A;  3ORQ A;  5JUM A;  3QJ6 A;  2HVS A;  4HVU A;  4MV1 A;  4DV6 H;  3REA B;  3TQT A;  5IYZ F;  1IOW A;  3RKY A;  1QP3 A;  2JTM A;  3QBY A;  1YNZ A;  2DPP B;  2W6Q A;  2KQW A;  3M0U A;  4QWB A;  3MR5 A;  4LUD A;  2J6K A;  4X65 H;  3JB9 H;  3M58 A;  1AOJ A;  1VQN A;  4LSX A;  2RGR A;  4XTZ A;  4RTU A;  4A3D G;  1PSF A;  4FW2 A;  2FK1 A;  5KYU B;  2R86 A;  1QVG A;  3SI8 A;  2PBZ A;  2FZG B;  1GSH A;  5I2S A;  5KFF A;  3VPD A;  1LNX A;  2MCN A;  1Y14 B;  3HOW G;  2EBP A;  1E4G T;  2QGF B;  3MEW A;  2FZC B;  4C0D B;  2JUF A;  2EQI A;  4M7A F;  4C0Z A;  2ATL A;  1JDB B;  1H8K A;  2RO0 A;  4F7U F;  1WDX A;  4PJO B;  2NVX A;  2RHU A;  3A8H B;  4MA5 A;  4LDX A;  2KXD A;  5EWE A;  1S72 T;  2ZZD A;  3T5L A;  4G3I A;  3OHA A;  3QYH B;  3HKS A;  4DA4 A;  2Q2T A;  2JM9 A;  2ED1 A;  2O4X A;  1VQ6 Q;  2QG9 B;  2I80 A;  2XIC A;  4RB1 A;  1NEG A;  3NTK A;  1M8V A;  4JI4 H;  4KRT A;  2MCT A;  5L9X A;  3FDS A;  5L1L A;  1K8A U;  4HA8 A;  3J7A F;  4WCI A;  2BE9 B;  3T5J A;  2M51 A;  4RG8 A;  3VPB A;  3CBO A;  4C0F A;  2ASJ A;  1VBH A;  3GTJ A;  1PHT A;  1Q86 U;  5HK3 A;  3OY9 A;  1EZZ B;  3T9N A;  4ESR A;  3JCM b;  2DER A;  3H0H A;  2CKZ B;  4DV0 H;  1WHK A;  1WXU A;  5FW9 A;  1SHF A;  2XDD A;  2A3L A;  2FPI B;  2C2D A;  3TQ7 P;  2HQX A;  2PTK A;  1NZ9 A;  2KYB A;  2E4H A;  1U1S A;  4ME6 A;  3K3V A;  1MGQ A;  3M59 A;  4C92 F;  1Y1W G;  1E6G A;  2O01 E;  5KCO A;  3GIB A;  3R23 A;  2LT1 A;  2CUD A;  2NUP A;  1OZ2 A;  2I0N A;  2CZ6 B;  3PIO A;  4XYL B;  2R8J A;  3E2U A;  1GGO A;  5IH2 A;  4O3Q A;  5IYC G;  4A4F A;  2R93 A;  1Z9Z A;  2RMO A;  4RTZ A;  4YR3 A;  4RUC A;  1FXX A;  3RB3 A;  1RYR A;  1RAE B;  2M16 A;  1TXQ A;  3DF7 A;  2K2M A;  1F1B B;  2AGQ A;  2DIK A;  1ZHI A;  2QXF A;  5DLG A;  1MMA A;  2E1H A;  1XOV A;  4FM9 A;  2IA6 A;  1I0C A;  5L1K A;  2DTH A;  2YLB A;  4HNU A;  4A3K G;  1UGR B;  2UVV A;  1T36 A;  1B7T A;  4TV8 F;  1IBL H;  1P8L A;  4HR7 A;  3JSC A;  2VAS A;  4APM A;  4ETS A;  2EYX A;  3KTM A;  4JV2 A;  3CC7 T;  2QK4 A;  4KUL A;  3T5K A;  2HMA A;  4IUP A;  4LF7 H;  1M90 U;  1VIE A;  1VOM A;  2GTO A;  1T0H A;  2M02 A;  4PJO F;  4X9C A;  2P0Q A;  2R6F A;  4AQY H;  2RA2 A;  3NHN A;  2HQH A;  3EHQ A;  4JJN K;  2CS7 A;  1FX7 A;  2JTE A;  3MP1 A;  3R5X A;  4RNO A;  1I5L A;  4JUV A;  3UA6 A;  1B04 A;  3RAQ A;  3S6W A;  3Q2O A;  1MV3 A;  1K1S A;  5GAM g;  3V7S A;  4YY3 H;  1UG1 A;  2M9U A;  3NFC A;  5FD6 A;  3QKJ A;  1S97 A;  1OPL A;  4RNM A;  4IWX A;  4QVZ A;  1JXO A;  4FYW B;  4OMF B;  3PO2 G;  3OBW A;  2FKL A;  4XAX B;  3BG5 A;  3H3V H;  1SPK A;  2WTF A;  1K9M U;  1S9F A;  4J7I A;  5GAM f;  1AUX A;  3FC3 A;  1BK2 A;  4RNN A;  2M1H A;  5KT7 A;  1JRI A;  2PUK B;  3KHG A;  3FLG A;  1UNN C;  2GBQ A;  3P8H A;  1UGP B;  4UFZ A;  1UEB A;  2K4Y A;  3OS2 A;  4ZGJ B;  3MHX A;  5GAM h;  4M7D E;  4R56 A;  2W9C B;  3L4J A;  3CCS Q;  2FEI A;  4J9M A;  2AGP A;  2DJZ A;  2DTI A;  4LSA A;  4YP3 A;  1K1Q A;  1Q7Y C;  1QWE A;  2RN8 A;  3S3M A;  3M9O B;  3HOY G;  5IT9 W;  1KFZ A;  4RU9 A;  3MFH A;  2R8H A;  1PRL C;  5AT1 B;  5KG0 A;  2O4X B;  4J8O A;  2WAQ A;  3CQT A;  2R87 A;  3S3N A;  3TVT A;  1K4U S;  2W8L A;  5C8Y F;  2UUA H;  3HPW A;  3OSN A;  2RJC A;  4CC5 A;  5L1J A;  5GMK j;  4CC2 A;  1U1T A;  2EQK A;  4J6X A;  3GIP A;  2DD4 A;  3V6J A;  3WVE B;  2FJZ A;  4LF5 H;  3CCL A;  4YJ3 F;  3HOZ G;  2DIQ A;  3HL8 A;  2IVW A;  2WAC A;  1K73 U;  1AUV A;  5LMU H;  1WR2 A;  4RUG A;  4EMK C;  3CVZ A;  2MMP A;  5IP7 G;  3SB2 A;  1YJN Q;  2GFU A;  3PR4 A;  3L42 A;  4A3B G;  3TIN A;  2VA2 A;  4RZQ A;  3BDU A;  5BR8 H;  3MCA B;  5EZY F;  1M0W A;  5KFI A;  1H64 1;  4RTX A;  2E5L H;  5FRN A;  1TG0 A;  1XNI A;  2MK5 A;  3Q1J A;  1AEY A;  3PZP A;  2R7K A;  2A36 A;  4Q8F A;  5KFE A;  1VQP T;  2NUP B;  2CZ0 B;  4BDY A;  1KD1 U;  1VA7 A;  3QZ5 B;  1R77 A;  4BE1 A;  2V8I A;  4ED8 A;  2EFI A;  4HVV A;  1L2Z A;  3HOV G;  4EMK B;  5GAM e;  1PX2 A;  4AT1 B;  5IT9 E;  3GLK A;  3HOX G;  2RHI A;  2W6N A;  5FJ8 G;  1VQ7 T;  3FJP A;  2KT8 A;  5C1O A;  2JTF A;  2QA4 T;  1KBL A;  1QW1 A;  2VYT A;  3OSV A;  1S72 Q;  2YS7 A;  4OMO A;  3N41 B;  2E12 A;  5KCH A;  4IIO A;  1Q7Y R;  3CCS A;  2ZGW A;  1VYU A;  3Q8R B;  3OS5 A;  1ZQ1 A;  5L23 A;  2W6Z A;  2DKG A;  2C00 A;  4JRI A;  2XDB A;  1WJQ A;  1Y96 B;  3BAB A;  1XMO H;  1VBG A;  4KH0 B;  5IYD G;  2W8K A;  4EBD A;  4AYB A;  2DFU A;  2KNB B;  2DZC A;  3RB4 A;  2L3Q A;  3HRS A;  1K8A C;  1YP5 A;  2EW3 A;  1JKJ B;  2VWF A;  1D1B A;  4IRC A;  3E1S A;  1PNJ A;  3DB3 A;  4EIK A;  3EG9 B;  3BY7 A;  1V51 A;  2DD5 A;  1JJ2 A;  1KIK A;  5BPH A;  3N40 P;  2E3H A;  2YSQ A;  1UHC A;  1Q86 C;  3CC2 T;  2E5K A;  2ZM6 H;  1TWB A;  3G71 T;  3H0F A;  1SFO A;  2E6N A;  1N27 A;  3EGD A;  4BY7 G;  1MMN A;  4FW1 A;  1EYZ A;  3L2P A;  1IGU A;  4A4G A;  5KYW A;  5EG2 A;  2P4R A;  3IG0 A;  3QWX X;  4TQS A;  1Y1W A;  1WHM A;  2ZPG B;  1WQW A;  2W71 A;  4TVR A;  4KGX B;  4B9W A;  5KYX B;  2FO0 A;  3SD4 A;  2DX1 A;  2CP6 A;  5CKE A;  3V8L A;  2A08 A;  3EGU A;  1OV3 A;  1G8X A;  2HD0 A;  2DMO A;  2WB1 A;  5CAE B;  1NLP C;  5J3B A;  1C1A A;  5C44 G;  1C6V X;  2GTJ A;  3MR2 A;  2JVV A;  2HZY A;  2ZJT A;  2HL5 C;  3QYG B;  3S3O A;  4LH7 A;  1TAE A;  3M9M B;  2FYK A;  5CQY A;  4KBM B;  1MMD A;  2FL7 A;  3RV4 A;  4JJB A;  3OS1 A;  3CC7 Q;  1VQ9 A;  4Q43 A;  1KQ2 A;  2DEU A;  3SEM A;  3GQC A;  1M1K R;  4MTE A;  4XQ3 A;  2JA7 G;  3G4S T;  2K3Y A;  3V7R A;  1N48 A;  4PFO A;  1V1C A;  3CBP A;  5FRO A;  4OML A;  4FCY A;  2LQN A;  2QYZ A;  2DIG A;  5DQH A;  1EHI A;  2W6M A;  2R58 A;  3GPL A;  3H0I A;  1X2Q A;  4DL3 A;  2HSP A;  1K8A R;  4KUD K;  2JEJ A;  4BUG A;  4J9Q A;  3OW2 S;  4M7D G;  3FEO A;  3CCM T;  4RUA A;  4O3N A;  3RIZ A;  1SF9 A;  1QCF A;  5I22 A;  4XX0 B;  2Y90 A;  1Q86 R;  4NL2 A;  2KEA A;  3KAL A;  1GCP A;  1OPK A;  4QWC A;  3JAM W;  4F4Y A;  3CCV T;  2VUG A;  2NU6 B;  3G6E T;  2R8K A;  1KQ1 A;  5KFB A;  2KMT A;  4JI5 H;  5KFH A;  1K9M C;  3VS2 A;  5BMV F;  5D8D A;  2AKK A;  4HT8 A;  1B07 A;  3GNG A;  3PW5 A;  3GBQ A;  5ECA A;  4QQD A;  3CXC S;  4O6J A;  1AN7 A;  5D1P A;  2XID A;  4BY6 C;  1SEI A;  1JO8 A;  3ZL7 C;  4ECR A;  2C0I A;  2KGT A;  3CCJ T;  5CQX A;  3CME T;  1TH7 A;  5LL6 S;  1B34 A;  4Z89 A;  3JCM V;  2WSE E;  5C3E G;  1LJO A;  1NM7 A;  1CKB A;  4YR2 A;  4U6P A;  3OYG A;  2R57 A;  4QW8 A;  5KG4 A;  3GOX A;  3LH0 A;  1UC8 A;  3QO3 A;  2E2H A;  1KK7 A;  1Y0M A;  5F9L A;  3CC7 A;  4J9D A;  3AT1 B;  2R5A A;  4AFU C;  4N4G A;  1PWT A;  3E9G A;  3OYC A;  2NWM A;  1XMQ H;  4BY6 B;  3GP8 A;  4RB0 A;  4MTD A;  1Y57 A;  1TWH A;  1KHC A;  4IUQ A;  4A53 A;  5C5J A;  4IHJ F;  3R6O A;  3NMZ C;  3U9T A;  3CPW S;  1K73 C;  4PJJ A;  3JAM E;  4DR3 H;  1B6R A;  3RMQ A;  1X6O A;  2YRW A;  1M30 A;  2FPD A;  2RB6 A;  4FU0 A;  4PKC C;  3GTM A;  3MP6 A;  2VVK A;  1IHW A;  4M7D D;  2R5M A;  3EGD B;  4AG2 C;  5KYU A;  4PDB A;  1BI3 A;  5KYW B;  1M7J A;  4JJC A;  4EGJ A;  2E41 A;  2E64 A;  4RG2 A;  1AWJ A;  3VYH B;  3NGD A;  2F4V H;  5GAO m;  4BDZ A;  1FVI A;  4QW2 A;  1S0O A;  1EUC B;  4Y91 A;  2CSQ A;  2JA5 A;  1KD1 C;  1K9M R;  4J6Y A;  3TII A;  4OB1 B;  3CBM A;  4IIM A;  1V9P A;  1JU5 C;  5GAO l;  2QA4 Q;  1YBY A;  2RJE A;  3OA6 A;  3RKW A;  4ZQI A;  3QDR B;  4J9H A;  1W70 A;  1ZUK A;  1D0Y A;  1N33 H;  2ZPB B;  2QDY B;  3T1Y H;  5FWB A;  4J7F A;  2HVR A; 
#chains in the Genus database with same CATH homology
 2P84 A;  2OX7 A;  2QYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...