2QYZA

Crystal structure of the uncharacterized protein ctc02137 from clostridium tetani e88
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
NREVKFRAWDKELNMMVYTKEQTGHIEYNTNPADTINIILNQDDYGYVFMQYTGLKDKNEKEIYEGDIIKKSNRSSNLYEIIYQDSIACFRCKVIKGDIKSFPCLNIGTVRNCEVIGNIYENPELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of the uncharacterized protein CTC02137 from Clostridium tetani E88.
rcsb
source organism Clostridium tetani e88
molecule tags Structural genomics, unknown function
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.290 Mainly Beta Roll SH3 type barrels. YopX-like domains 2qyzA02
3.30.1490.160 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ctc02137 like domains 2qyzA01
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH superfamily
2XDBA 1GXIE 3Q2OA 4IRKA 4HKEA 1PC0A 1Y57A 2NUPA 2RD1A 2YS7A 3NGDA 3PW4A 1VQPT 3EFRA 1BJTA 3VS0A 2JA5A 2COZA 2CP5A 3SI8A 2DIQA 4BACA 3V8KA 3CC4A 1JXOA 4OGEA 4O3QA 1I3QA 1ZETA 2X51A 3S3OA 2JEFA 1BI3A 2GLTA 4YJ3F 3PO3G 3J81W 1WHGA 2KMTA 1CE8A 2IVWA 1UJYA 5ECAA 5EG2A 1M1FA 4M78C 1R8OB 4V2SA 4QT7A 1MZBA 1YJNT 2FE3A 1Y1WG 1YJWT 3M9NB 4DL4A 2MWOA 1KC8R 2A36A 2UU9H 4NXNH 5KFGA 2XHCA 2EGAA 3TCJA 1AVZC 2NU6B 4EMGA 1NZ9A 5KFEA 2NUTA 3VJPA 4UCOA 3TREA 2RQUA 2XKOC 2RI5A 3NTIA 3R6NA 2LC4A 5LJ5e 3JAME 1M90R 4MTDA 2DXUA 1RJRA 3BJYA 1RABB 4OMQA 1VQ6T 3RERA 1D1BA 3M53A 4DEXA 3E5NA 5KFXA 1KJ8A 2YS6A 5KFDA 3KFVA 2CUDA 5KFTA 1YWPA 5CKFA 2OTLQ 3RR6A 3NMZC 2I80A 2YUOA 4F16A 1UB4A 3H4DA 3GNFB 4HVWA 2RI2A 4JPBW 4A3IG 1N5ZA 2EYXA 4KBMB 1VQ5T 1WH2A 5JUMA 2FPPB 2CKZB 5KFAA 4RNOA 3QZ8A 2RH2A 4PJOC 1VQKA 1YIJQ 2RHUA 3N44B 1KQ1A 4KT0E 1DV2A 1JRIA 1P92A 2QGGA 1PNJA 5JVLA 3CCSQ 4M77C 2DBKA 3PNWC 5D6WA 3JCMP 1KJ9A 3HRUA 3RKWA 2HGSA 2HNIA 3M0TA 1CKBA 4LD9K 4C2MA 4O3PA 4IR1A 2P0AA 4X66H 1KHIA 2F2XA 1TWAA 1D3BB 2FPIB 4IWXA 4WD3A 5L8RE 3SEMA 3VRZA 5FLXE 1M2VA 3OYBA 3G4SA 1H641 2PVDB 3CMEA 5CAEB 4BBSG 5J26A 2VOBA 4ETSA 5KYWB 4RZRA 4NXMH 2EIFA 4XX0B 3CCVA 3JCMJ 4LF8H 3EFOB 2BQRA 4FYWB 1RAHB 3HOYG 2ATCB 2FLLA 1JJ2P 2I2LA 5I2SA 2DRMA 4XAXB 4R56A 2AU0A 4R8UA 4M7DB 3FB9A 2DEUA 4DL2A 1QKXA 4JV0A 3CCJQ 3J80E 3CC7T 2CP0A 3M0RA 1VQNA 2HQXA 1HR0H 4J6YA 2IBKA 3C12A 1UTIA 3H0HA 5KFPA 2Z0WA 2JS2A 2LNHB 3FJ5A 3OW2P 2SRCA 3VMMA 1BI2A 4DBHA 2VYTA 2DBMA 3MEAA 1YIJA 2WTFA 1YITQ 3UFXB 1B34B 4C8QB 2HD0A 4M75F 1K0XA 3V8JA 3CCQA 5HV6A 2R7LA 4HNVA 4DL3A 4Q45A 2LQKA 2E70A 4WBNF 1M3BA 4BD3A 5CAIA 3U9SA 5LP6F 1I0CA 3ZL7C 3CXCA 4JI7H 4A2BA 1X6OA 4ELZC 4JLGA 5IP7G 1AWJA 5IT9E 2VC8A 2R93A 3G6XA 5KT6A 3GV7B 4C0FA 1BK2A 4EBDA 3DKMA 4E7KA 3HPWA 3SWNA 4L6V5 3I5RA 5FU7C 2DNUA 2W8LA 1VOMA 2H3EB 4OMNA 2ZDHA 3KHLA 3JZIA 2JXBA 3HHTB 4C5GA 2QK4A 3KALA 3FIFA 4J9KA 1NJIC 2DPJA 2R92A 4M7AG 5GAOr 2EKOA 1MNDA 2J05A 2KROA 3X26B 1TTHB 1VQ8A 2RHZA 1WHHA 2XK0A 1KQSP 4DOWA 4B6MA 2E64A 5GAMg 4TQRA 1WLPB 3VUZA 2RM4A 5EOYA 2R8JA 4C0GA 1I6UA 3GTKA 2P0QA 1VQOQ 4JV5H 5C1PA 4J6WA 1Q86C 2KNBB 4RB2C 2F1LA 3LX7A 4PJLA 2J9GA 2C0IA 2QI2A 2LZ6B 1SRMA 3GTOA 2K2VA 4JJNK 3A8GB 2R57A 3MR2A 1YBYA 1VIFA 2LT4A 3J7AK 2O9VA 4A3KG 1K0SA 2UVWA 1WXUA 2JA8G 4HNUA 1IBLH 4EMKB 3EGXB 4OMLA 5C3EG 1MMDA 1UDLA 1N56A 3H8ZA 2JA6A 3PR5B 5L1LA 4JJDA 3OSSC 2PMZA 2Y4XA 3VUBA 5KFBA 2XC9A 1VQ7T 1EUCB 3THKA 1SF9A 1AOJA 1BI0A 4FT2A 3JCMX 4XTXA 2J6UA 3S6WA 3OS1A 4J8OA 2UVVA 2QDYB 5L9XA 2DIKA 1GSAA 3PGGA 3OYEA 2ZPFB 2LRQA 3FKIA 4GKJH 1DGSA 3Q8RB 1NJIR 1WCMG 2BE9B 2DETA 4OGCA 3VS7A 1MMGA 3M0PA 2NUZA 1Z9QA 4MDWA 4G3IA 2XCLA 3VS6A 4PJJA 5IXBA 1G3WA 2ZPIB 1FMWA 4O2BF 4C5EA 2GCXA 2YYAA 1VQPQ 2JJ9A 1Q86R 4AT1B 1UJ0A 4CRIA 2NU7B 4LFCH 5CIUA 1VUBA 1I8FA 2DYBA 2VGMA 2ATLA 1KFZA 4LDXA 3V6JA 1GGOA 4ECUA 5KCOA 1UHCA 2AT1B 4ECWA 2BQ3A 4LFAH 4U7CA 1ZHIA 3Q8QB 4MMKA 2XG8D 1ZHQA 1K9MC 2LCSA 1OX9A 1TG0A 2B86A 3GPLA 3CC4T 5EWEA 2V8KA 1YJNQ 2HQEA 1YJWQ 3DLLA 4Y8VB 4ZTJA 1KC8U 1QVPA 4IRDA 2DL8A 2RJDA 4RTYA 3RFCA 3N43B 3RF2A 4A4EA 3C0CA 3G6VA 3R5HA 4M7DD 2ZPHB 1GO3E 2QG9B 4F7UF 2OH2A 2MPXC 4J9DA 2EJFA 4HXJA 3RBBB 5AT1B 2W6PA 1ZUYA 1QCFA 2VA3A 2KK4A 3OYIA 1K1ZA 1WYXA 4Q8EA 5KYXB 4C8QG 2R7NA 2FZGB 2MK5A 2DPIA 4J83A 1M90U 4F7UE 1KJWA 2C2EA 4MV7A 3PE0A 2IG0A 5CQXA 5LOVF 4EIKA 1QVGA 2GBQA 4NLGA 2WSFE 1T3LA 1B6RA 1D0YA 2KI7A 1B07A 3BQ1A 3KXTA 3CMAA 4II1A 3F8NA 2CS7A 3A8MB 3R5FA 1LOJA 4OB0B 1OU8A 3GIPA 3OYCA 1D3BA 3RMSA 4QWCA 2CP6A 2MIOA 4FT4A 3J81E 3HKZE 4EYHB 4Z8AA 1B3QA 3RNJA 4LF6H 3QIIA 5KYWA 3MWDA 2JUFA 3GIKA 5IHNA 4HNTA 2ABLA 3EFOA 3P8DA 3QG1A 5KYYB 1ZSZB 3SB2A 1WI7A 3ETHA 4BY1G 4DV3H 1SFOA 3HFOA 1IXDA 2A7YA 2CZGA 2K57A 4M7DA 4VUBA 3HB9A 1M1GA 2X4JA 1EFNA 1VYUA 1YHQA 1K1QA 1VQKT 2PNIA 4C92C 2EKHA 1QKWA 1AD5A 1K9MR 1QLYA 2VVKA 2R82A 1SEIA 3RBDA 1XOVA 1IGQA 5KFNA 2J6SA 3C95A 4PJOF 3QBYA 3K3VA 4Q0YA 4ZGJB 2FKLA 1B34A 1UE9A 1T36A 4C8QA 1K9AA 2YU9A 3UQ8A 2HVQA 3MCAB 4M77F 1UGPB 3PVQA 4PJOE 2HMAA 1VQ4A 3GV5B 3G4ST 2X3WD 4M9UA 4PJMA 4QVZA 3CMET 3E1SA 2ENMA 2KY9A 4M77E 1KD1R 4LXCA 5KFUA 4XTUA 2LQ8A 1YJ9Q 1AZEA 3OSPA 2OTLT 5KG4A 5DGBA 3MFIA 3C4SA 3N42B 3GTLA 1YCSB 4MMLA 3OYAA 1WPYA 1MGQA 2QQBA 3EG1A 5CKHA 4RU9A 2K7AA 3FJPA 1VQLQ 2HDAA 3L1AA 3FC3A 3OSVA 3URGA 2NUTB 2O2OA 2X4WA 3H0IA 3S3MA 1MV0B 1I07A 3JB9G 1M8MA 5CA1F 2GTOA 2VGNA 2G6FX 2VV5A 5KE2A 1KJQA 4FYYB 1YIJT 2Q2TA 1MV3A 4YJ2F 4FBUA 5F9LA 4RNNA 5BMVF 4FL6A 2FRWA 5KFHA 1BBZA 2JS0A 2DTOA 1J5EH 3RIRA 1QCNA 2KRNA 1T3SA 2COYA 2BE7D 3M9OB 2K5LA 4WTOB 3CCRQ 2V9WA 1N27A 4MDXA 1UNNC 5KYUB 2ZAEA 1TOVA 3JCMW 3OYYA 5LJ5d 5KFZA 4UCUA 1YJ9A 2JNGA 1TU0B 4RMOA 4FM4B 3HKSA 1W96A 2WDTA 2X4YA 2W6ZA 4E7ZA 4E2FB 4BWSC 2BQUA 3UA6A 1VQLA 4OF1A 3VS3A 5KFFA 1TH7A 1QP3A 1ARKA 1TSFA 2D9TA 1V76A 3TVTA 3KAJA 1K73C 1RAGB 4QWAA 4XYLB 3GIIA 3VV0A 5FRMA 5KE3A 2NU9B 3OA6A 3EYYA 4EBEA 5L23A 3NPFA 5GANf 5KG7A 3FDSA 3WNZA 2ALZA 1Y0MA 3L4JA 3M0SA 4LSXA 4N4IA 2LX9A 4N4HA 4EMKA 1WHMA 3EGXA 1YITT 4A4HA 4RZQA 4JI2H 4Q44A 2JMCA 2YDLA 1X27A 5C6SA 4MV6A 2I0NA 5EDWA 2HL5C 5BPFA 1SKUB 3BY7A 4AMCA 5IHIA 3MP1A 3QZ9B 3KXYT 2DK3A 4J9HA 3OSNA 2CREA 2O31A 5FWBA 1SYXB 2PVPA 2CT3A 5LL6b 2XIGA 3I55A 2B63G 2DAQA 2V59A 2LDMA 4A3MG 1WJSA 1Q81C 5KKNB 3OHAA 2HKNA 5LMNH 3PW2A 1NG2A 4AFSC 4AFZC 4I4TF 1QWEA 3SHWA 1UGRB 4U6PA 1RAEB 5GMKh 3I4MG 3GTQA 3CCMQ 2BUDA 2JTEA 1N33H 4B9XA 2V58A 3M5AA 2V1RA 9ATCB 4JYAH 3RKXA 1AWXA 1EYZA 5LJ3f 3OYMA 3G71Q 2D6FA 2WACA 4MV1A 2OAUA 3JSCA 2DZ9A 4J9CA 3G6EQ 3CBPA 5BR8H 3M9MB 3HSBA 2M0YA 1K73R 3SE7A 2RHYA 2YW2A 1UC8A 2AQ4A 3GQCA 4OMFB 2DERA 1Q7YC 3L2ZA 3ULRB 2YRDA 3PIPA 4DLKA 1XMQH 4DV0H 1FKAH 3M55A 1PWTA 3V7RA 3A98A 1LPLA 3PW0A 3NTKA 2AGOA 2R7KA 4O4LF 2DL7A 2E2HA 1PKSA 2JA5G 2PUOB 2B63A 5KYXA 5CR2A 2YXYA 5GAMj 3N40P 4J9QA 1RUWA 4DR5H 4J9RA 1I94H 2A28A 5GANe 4A3EG 5DLFA 2O88A 3T5JA 1MHNA 5LXTF 2B8AA 5GAN6 4GC7A 4BI4A 2DPPB 3CC4Q 4B9WA 1TAEA 2VB6A 3G71A 1Q81R 4YP3A 4D8DA 1RLPC 4MV9A 1MUZA 1WXBA 5DY9A 3N8DA 2F2WA 5HK3A 4DR1H 1X2QA 4A3CG 5FU6C 2FPEA 1M1KR 1SCUB 1X69A 2MMPA 4A63B 5KT3A 1AUXA 4LF9H 3M0QA 2IP4A 1X01A 5KYYA 3F70A 1IZ6A 1ZSZA 3A8LB 3QWYA 3LWIA 2V4RA 4QQDA 4M75D 1GBRA 2KRMA 1IBMH 3TQ7P 1S72A 5J39A 4HT8A 3QHSA 2LCCA 4UFZA 4JLIA 1Q7YR 3ZFJA 2R7ZG 2KVQG 2NWMA 1CSKA 1Y1VG 3UATA 3VS2A 4UCSA 2FZCB 3QYGB 5LJ3e 4FW2A 1FMVA 1Y96B 3H0FA 2LNVA 4DV1H 1GSOA 3V4ZA 2BZXA 5DQIA 4X9CA 3L2QA 1PKTA 1ZQ1A 3KHGA 3NFCA 4I50F 5HY6A 4UCVA 1N32H 1WZOA 5GAN7 5DM7R 1X6GA 4ECSA 1L2ZA 5KFLA 1I1JA 1ZBJA 3JV3A 1VQKQ 4PJOB 5IHKA 2YL2A 1K9MU 4A3LG 3N41B 1VQMQ 3HFNA 3JRXA 3PO2G 2RHIA 4Z88A 1KHCA 4M77B 2ROLA 4OP0A 4L5GA 2M1HA 1N34H 3CXCS 1YHQT 4Y28E 7AT1B 5KFSA 3KTMA 2R85A 4IIOA 2XD4A 2KEAA 5GAMf 3BQ0A 2J7IA 2HVRA 3GP8A 3G4SQ 1B33N 3CMEQ 4C92F 2VQEH 1KD1U 1GFCA 3CCVQ 1PD0A 4Y91A 1NLOC 2NUAB 3OTOH 2P84A 5GAN8 2JZ2A 5C44G 3RAXA 4C92E 1PSEA 4PLIA 4Z02A 4RAYA 2DWCA 2R7ZA 3SFMA 3M0UA 1Y1VA 5IH2A 2K5IA 4PDBA 1KIKA 3DB3A 5GJVB 2CP3A 1VQNQ 2EGCA 1IHVA 5KYUA 1PCXA 2E6ZA 3U9TA 4R0KA 2XGPA 3HOWG 1N48A 3RBEA 3REAB 1KEEA 1Q82R 3G6YA 3MJFA 3H41A 4Y92A 4ECVA 1NPPA 5KCHA 2KT8A 4UC4A 4M7AC 2M0OA 2RQRA 4RCCA 2QAZA 2CP2A 1VQMA 5GAN3 2DZDA 1T0HA 2KYBA 1BI1A 2E10A 3Q8SB 2DLPA 1KJIA 1QQJA 4APMA 3CCQQ 4E47A 2ECZA 3MR6A 2L8DA 5LJ3h 1XDNA 2QQ9A 2NLUA 2R93G 4TUYF 2F2VA 3EPIA 3UA7A 3OHBA 4ZNXA 1ZLMA 1GCQA 2DJZA 2XDPA 1K8AC 4QIWE 1RACB 3OMGA 2EFIA 2VASA 4DEYA 2EYQA 4N0AC 2RF4A 1YJ9T 2R8KA 1IB8A 1NYGA 5LJ5g 2R92G 3M54A 2YZGA 1IO6A 1N9SA 4MZMA 1VQLT 5LJ5h 4BBRG 2C2DA 1WNLA 1W2BS 4E7LA 1TWGA 1ZX6A 2CH4W 1RJPA 4JI0H 8ATCB 4ECZA 4DR4H 1QWFA 1VQ8Q 5C0MA 4RTUA 3BA8A 2E2IA 5GAMe 1BB9A 2CGHA 4JZ4A 3OS2A 2JVVA 4ANJA 5GAOn 1W70A 1W93A 1T94A 2OTJA 3P8HA 3VPDA 4M75E 2HHHH 1U1SA 2HKQB 3EFSA 3QSUA 2DLNA 3RKYA 4DV2H 1FYNA 2FZKB 4M78D 2DILA 3P8BB 4IURA 2C28A 4OB2B 3CCRT 2QA4Q 2R6FA 4ED3A 2FRYA 2R5MA 2BR0A 2JA6G 2P0KA 3KBGA 3I55T 4C5BA 2DO3A 3EGDB 5LMUH 4ESRA 4AG2C 3X24B 1AN7A 3TIIA 2DXCA 1S0OA 3RIZA 4LNPA 5EWGA 1W4SA 4LD6A 3PVLA 1K8AR 4B3MH 3T5HA 2JTMA 1I5LA 3JCMb 4YR2A 2OLSA 2UUAH 4BE1A 3JSLA 3FKIG 4A54A 1S68A 1TS9A 3CD6A 2PQWA 2GFUA 1K73U 2VUMG 1VBGA 3ZBDA 2R5AA 4JZ3A 2C35B 2R8IA 1FWZA 4A3JG 1OZ3A 4JI4H 1D0XA 4EPCA 2YRXA 2FHDA 5IYCG 3BG5A 2ED0A 4AFUC 4ECXA 4JV1A 4YBZB 4F7UA 5HCKA 4X1VA 4RG8A 5GMKl 1QVGS 1TXQA 4C8QC 4D6WA 3L4KA 4JI3H 3HL8A 4BY6C 2DTIA 2QA4A 4PJOD 4DV4H 2HZYA 1RI9A 3CXCP 1S0NA 1PHTA 1HXDA 2YWWA 3I5SA 4M77D 2VXEA 2JOYA 1NE8A 1X43A 5KFCA 3HKZA 4PKCC 2VUGA 4PL6A 5L1JA 1F1BB 4IUUA 1AUVA 1Q81U 3OYNA 5KG2A 2DD5A 2V8IA 3CCMT 2W70A 4A53A 2AGQA 3MEVA 4J7FA 5DG7A 1I7NA 5D1OB 5DQGA 1QVFA 2XICA 2OWOA 4C5CA 1I7LA 2YRCA 1M1KU 1W2BA 3G71T 4A3BG 4DQ2A 4JRQA 4A4FA 3MFHA 4FS1A 4A3FG 3JB9H 3G6ET 2WAQE 2E4HA 4LF5H 2YUPA 1Y96A 1B04A 2VUMA 3L42A 4FSXA 4O4IF 1A0NB 1ULZA 4F14A 4EG0A 3T5KA 4B3TH 1KC7A 4GLXA 2W6OA 4JI1H 4E7HA 1GLVA 2F4VH 1LVKA 2V8JA 2XCAA 3H0GA 1T0JA 4ED1A 3MHXA 2D0NA 3GNGA 5DG9A 2M05A 5KFKA 4PJOA 4DV7H 1Q7YU 5C8YF 2RJEA 1D1CA 2A37A 1MNEA 4M77A 3RB0A 2ZDGA 2UXDH 1JO8A 3CMAQ 1Y07A 4KGVB 2LP5A 2QEXA 1VQ9A 1ZUKA 2J6OA 8AT1B 1JBMA 2EQJA 2DTHA 2O01E 2EYZA 4KUIA 1QCOA 1XNRH 2ZGWA 4M7DG 3GIBA 1M6VA 1BIBA 4FU6A 4LDUA 5FPOA 4QWBA 4IRCA 3CCEQ 4IHJF 5IYBG 5EC7A 1JXMA 1JLLB 3CQZA 1IGUA 1WQWA 2F69A 3SDZA 1RAAB 1C6VX 2GTJA 2FMAA 4EGQA 5C4XG 3J7AF 1YHQQ 5FLMG 2CZ0B 3AHUA 4C92B 2OX7A 4M78F 1KD1C 4DL7A 4KULA 3VS4A 3ORQA 4A3GG 4FYVB 2ZJTA 2FEIA 4M78E 4O3NA 2V1QA 4M7EA 5CKBA 4F4XA 4ZTFA 1VQ4Q 3HRSA 4ECYA 5L1KA 3E9GA 3EPGA 5GAOl 3I9QA 2CQYA 1XNQH 4HT9A 3V6HA 1WIEA 1IOVA 4OMPA 1VA7A 3CQTA 4IWYA 4XK8E 3L2WA 4NOYA 1Q82U 2HQHA 3JCMf 2DRKA 4PJNA 5GANd 3CCEA 1M2OA 3TSWA 2JW4A 5L1IA 5KFVA 4X64H 4JDSA 4DR6H 2W6MA 2DE0X 3PTAA 4IZOA 1BCOA 1M0TA 1HNXH 1B7TA 2GFAA 1DIKA 4LUDA 1PK8A 2D8HA 1VQMT 1UEBA 5CCAA 5D8DA 1OQKA 2ZDQA 3JSNA 3MP6A 3TSZA 1KG1A 3TU4K 3QYHB 4M7AF 3K3PA 2JEJA 4JI5H 3JCMV 3FMAA 4FS2A 5KG3A 2MOXA 3GTPA 1WX6A 5EWFA 4M7AE 1G5VA 2ESWA 2DL4A 2AZVA 4AG1C 1VKZA 2W7PA 3O5ZA 3QDFA 3I56A 1QVGP 3CCVT 2XDDA 4RTTA 2QTVA 2A3LA 2EWNA 1R0BG 4BXXG 1ABQA 2QYZA 2ZPBB 4IUVA 1VQ6A 4IKFA 4A2AA 4QW2A 1RYRA 2X4XA 3JRZA 2DD4A 4ME7A 5A0LA 1PRMC 1D09B 1K1SA 1VQNT 3QJYA 5LJ3d 1OULA 2IMWP 4M75B 4F17A 4A3DG 3I4NG 4KGZB 1XNIA 3RMQA 2CZ7B 1RL2A 1WA7A 2XI9A 2K2MA 3GLXA 2O9SA 3OS5A 1N8RC 2X35A 3OYFA 1FX7A 3EGDA 2DXBA 3H3VH 1WHLA 3IQLA 3KHRA 1AT1B 3OYDA 1FMKA 3CPWA 1AEYA 3EG2A 2W9CB 1BIAA 2RB6A 4MA0A 1ZSZC 2R86A 2EYYA 2XIDA 4HCZA 3CCQT 3PMTA 3QZ5B 4TVRA 5J2UF 2L89A 4BE0A 2OTJT 1KJJA 2ZPGB 5KFRA 3HOXG 3KHHA 1RK6A 1R0CB 1UG1A 1CQJB 1T3NA 1X6BA 3HOVG 1OZ2A 2E3HA 4TV8F 1KK7A 4F04B 4AYBE 3I55Q 3JCMc 3EG9B 2GGRA 4PK4A 1X75C 3MWMA 3CEYA 3PW5A 1M27C 4E7JA 3JCMe 1V51A 3CCUQ 1H92A 4Q5WA 3PIOA 1O75A 3MEWA 3MP8A 4JS4A 2D0QB 1K8AU 2A0FB 3K5HA 4ZN3A 3OUZA 3Q1KA 3CPFA 4RUAA 1RAIB 2W8KA 5KFIA 5KT5A 3QJ6A 3OYGA 3GTGA 2KSWA 4FSSA 5CK9A 4C5IA 2L3SA 4LF7H 4DOVA 3CC7A 4ZGEB 3D7SB 1JXLA 2HCKA 3QDRB 1U1TA 1OWTA 4DL6A 3OY9A 3LGFA 1VQ8T 4XTWA 4BY7G 3PT9A 5HKCA 1NEBA 2WSCE 4XU1A 3EHQA 3IN5A 4CC4B 5LJ5j 4GKKH 5D1OA 4F4WA 1N8RR 1YI2A 3A8OB 1NEGA 2O4XB 2YUNA 2R87A 5FWCA 5KFOA 5IP9G 2E5QA 2BTTA 2FK3A 2ZZDA 4FCYA 3H40A 1E6HA 3NGPA 3C0FB 1K83A 4C0DB 3GBQA 4OB3B 3CCUA 2QA4T 4X9DA 4C92D 4C8QF 4ED2A 2OAWA 3CC2Q 4CC7A 1OX8A 4X34A 1M1KC 3EG3A 2WB1E 3HOZG 3MR5A 2JEIA 1JU5C 3WXMB 4CI0C 2DA9A 1M7JA 3JRWA 1BCMA 2E12A 2J06A 4NL3A 4ORZA 3RDVA 4FM9A 1UECA 4YHHH 2V4QA 4AQYH 1U06A 1HNZH 2PN1A 1JX4A 3PMIA 1M3AA 3QPHA 2QQSA 5FU6B 4GLKA 4NS5A 3JCMh 3LLRA 1OPKA 5IYDG 4JI8H 3CCLA 1FXXA 2DX1A 2KQWA 5I21A 3L2RA 4QVCA 2DF6A 1V4YA 1Z9ZA 3QZ7A 1X9NA 2W6QA 1ZA1B 3WO1A 1S72Q 3META 5A2QW 4BI8B 5F9NA 4YTLA 2KSSA 3T1YH 2EJGA 2LMJA 3GIMA 5D6YA 3ZEHA 2K3XA 4C92A 3CC2A 1S1NA 3JB9J 3X20B 2FP4B 2PVGB 3QKJA 4HCBA 3IG0A 5D1PA 3Q8PB 1M3CA 4A4GA 5KFMA 4RUGA 1SPKA 3TINA 5KX5F 2QEXT 1M8VA 1G83A 2YLBA 2OI3A 2PU9B 4DBRA 2DVEA 4YAKB 3E19A 4F7UB 3RB3A 2KGTA 4RTWA 2FPGB 4EEQA 4LH7A 4KRTA 4M78B 2CDTA 4DUYH 4XZ3B 1VQ7A 4M75G 1SSHA 2HL3A 3RV3A 3L2UA 3V4SA 3ME9A 5BPHA 4QQGA 3U23A 2YSQA 1PSFA 3LH5A 2CZ6B 4HVVA 1EHIA 3GOXA 4J9NA 1UGSB 3OYJA 3R6OA 1AWWA 2BZ8A 4QIWA 4ED7A 1HK9A 3V6KA 1JQQA 2D8JA 2FO0A 3SWNC 4KH0B 2ROTA 1Q82C 3QO3A 4J9IA 2XU8A 5FW9A 3CMAT 1E4GT 4DR3H 1WQ7A 1C0MA 2L3PA 2YZMA 5I22A 4J9MA 1NLPC 5CA0F 2W9AA 2P0PA 1PG5B 1RADB 2CYZB 2W57A 4ED6A 2QTXA 2ZM6H 4YAJB 1XMOH 1C3OA 4RB0A 3RGZA 3LH0A 4HCKA 5LA6F 2EQMA 5KG1A 6AT1B 3CCET 1I4K1 2QDLA 4M7AB 2AKLA 1Z2NX 2RI3A 5GANg 1GL5A 1FVIA 1AHJB 4KGXB 4DV5H 1KQSS 1E4EB 1UHFA 4M75A 5M9OA 4OB1B 5GANh 4QW8A 1S0MA 2XCPA 4LF4H 4PFOA 4Z89A 1GRIA 2Y4YA 3DB4A 3BW1A 5IAYA 1QW1A 4JRKA 4QKUA 3INZA 1JDBB 1IHWA 1TWFA 4RTVA 5GAOp 2PVOB 5I2MA 1SG5A 3L2PA 2L2PA 5GJWB 3V7CA 2W9CA 1VQ4T 2KYMA 3OBYA 1UUEA 2C0TA 1H8KA 5FRNA 3RAQA 4XTYA 2FLPA 1LJOA 4C5HA 4JUZA 3I56T 2KXCA 3M56A 1JJ2A 2CKKA 2FB9A 1TA8A 1FJGH 3GV8B 3RUPA 5J2TF 3MKDA 1E4FT 4J9FA 4YY3H 3EG9A 1SRLA 2HSPA 3GIQA 4XYMB 2RGRA 3OW2A 2P4TA 2KR3A 1TUCA 3BQ2A 3V7SA 5LJ3g 3H9NA 3PFSA 1XQHA 2JN0A 1VYVA 2M51A 3G7ZA 4HCCA 1JEGA 1O9SA 4LMYA 2EYWA 4WCIA 1Z2PX 3QXEB 2PTKA 3VKIA 4BI3A 2I8CA 2W9BB 3UF4A 2OTJQ 5IYZF 3HXLA 1LCKA 2RK2A 2L0AA 4DBFA 2RO0A 2V26A 1ZHSA 1YN8A 3LWHA 3R23A 3EAEA 2VQDA 2FG0A 5CKDA 1VAJA 2GQVA 1ABOA 1Y1WA 2E41A 4NL2A 2EQKA 3MWEA 4RAZA 1Y7XA 1OPLA 2R84A 1TWCA 1I81A 4O6JA 2KRSA 2YUQA 1VS0A 2C2RA 2O4XA 4HVUA 5FU7B 2Y0SE 2NVXA 1YFNA 4F50A 3ER0A 4C0ZA 3OMCA 1QVFS 2QQRA 2OTLA 2MWPA 4J9GA 1OOTA 4J7IA 2O03A 4RKUE 2AHJB 5I11A 1WHKA 4HA8A 4Q43A 2YZNA 3CD6Q 4RTXA 4JJCA 2WAQA 4O3RA 4J9EA 2D1XA 5DQHA 4BE2A 4F7UG 2LT1A 1AWOA 1WR2A 1N8RU 2KE9A 2RMOA 1S03G 2K5FA 2C06A 4M78G 1KQSA 3T9NA 1WXTA 2VPSA 2Q2UA 5GAOq 2QASA 4PLLA 1S9FA 3CCSA 2UUBH 3BE3A 1RLQC 1SSFA 4ZN1A 1TWBA 1YI2T 4UCRA 4BY6B 3OYKA 3M58A 4F4YA 1QMCA 2ED1A 4RG2A 3QFFA 2IA6A 4FU0A 1M9SA 4QJFA 2VXFA 2OJ2A 4EEYA 5FJ8G 4FIBA 4LE9A 3CCUT 3RUXA 4IR9A 4IUTA 4K11A 2JM8A 4LDWA 1HJDA 2RJCA 4CC3A 2VUBA 3G1JA 4IUQA 2HAXA 3PR4A 3OS0A 4M7DC 5FPRA 2HBWA 2IIMA 2JT4A 2DKGA 2L5QA 4MV3A 2A08A 3GIDA 3CCJA 4QVDA 3OYLA 2K6DA 2QK0A 2X3XD 4BDYA 4RCBA 2RN8A 3GTMA 4DBQA 3OUUA 4JUVA 4DUZH 4LDYA 3H0GG 2MAMA 3M57A 4E7SA 4RNMA 1V29B 1YITA 3RGXA 1VIEA 2M02A 4PJOG 1BNCA 2KXDA 5GMKm 2LJ1A 2W0ZA 2BKDN 2EQIA 2VR1A 5FD5A 4M78A 2YHTA 1J3TA 4M77G 3VU3C 3CCLT 2K79A 4K0KH 1D0ZA 2DEQA 1H3HA 4M7AD 2CZ1B 4JV2A 1M0WA 4TQSA 1GFDA 4P5NA 3OBWA 5GAMh 5KH6A 1DV1A 2QEXQ 1VQ9Q 2JMAA 1OEBA 1C1AA 4XQ3A 4ED0A 3CC2T 3JB9I 4KUDK 3MO8A 2UXBH 5LL6S 3JCMd 4IUPA 1R77A 2KBTA 5DLGA 1BXRA 2V5AA 3R5XA 1WSCA 4O3SA 4CC2A 5IWAH 1N36H 2GQIA 1NPRA 1ZSGA 2X9HA 2BZYA 3S3NA 2EGEA 3GTJA 1HNWH 2XMFA 2GF7A 2RQWA 1S97A 5GMKj 2F5KA 4XTZA 2WYOA 2ASLA 1WDXA 2HVSA 1M30A 4LUEA 3ORRA 1EZ1A 5KFJA 2ASDA 1EIFA 2AKKA 3UDCA 2W6NA 1P8LA 5A2QE 2FVUA 5KG5A 3K5IA 2NU8B 4N4GA 5DGAA 2KDSA 3BDLA 4RTZA 3LWBA 4M7AA 4EFEA 1HD3A 2KAFA 4OX9H 3H20A 3T5LA 2JM9A 1VQOA 1S72T 1OU9A 5EZYF 1E4EA 2JTFA 5CB4F 1BKBA 4GBQA 4J9OA 3LP8A 2ZCFB 2CSQA 4DR2H 1ZA2B 2DL3A 3BAAA 3GILA 1RYSA 3EHRA 2GNCA 1G3SA 4JJBA 2FK1A 4L1KA 1N6AA 4GC6A 1H3ZA 2PUKB 2UVRA 2QGFB 3NHNA 2M9UA 4YR3A 3OB9A 4EMKC 4LDVA 1E6GA 5KT4A 5FROA 2XGQA 2QXFA 4ME6A 4N0AA 3CPWS 2C00A 2BIVA 4F4ZA 2YT6A 1RJQA 3LW5E 1QVFP 2VPQA 3Q1JA 2FB7A 1W2BP 4GY5A 4KHPH 4DR7H 2AZSA 5D6XA 4ED8A 3LMLA 4MV8A 3CBOA 3M4IA 4EFBA 1WHJA 2C22A 4JS5A 5IN1A 5K2MA 4EMHA 3HOUG 2MYSA 5DLQE 4FW1A 1GSHA 3A5ZB 5KG6A 3WVEB 4ECQA 3EG0A 1UGQB 4I55F 2SEMA 5I47A 2NVYA 4AYBA 2LJ3A 2RK1A 4J9BA 4C5AA 5GAOm 2W9BA 2EPDA 3I56Q 4RB3C 1W1FA 1GYFA 1U3OA 1N9RA 3FEOA 5A0GA 3SD4A 4HQ6A 5T14A 2C0OA 1WCMA 3X25B 3V8LA 2K4YA 1VQ6Q 5JVDF 2MCNA 2CH4A 3WO0A 2Y90A 1LNXA 3REBB 1NYFA 4J9PA 4C8QD 4IAJA 2VA2A 1VYTA 3HTRA 1VQPA 3ETJA 1G8XA 3JAMW 3I35A 3NTHA 2DJQA 4XTVA 4QWEA 4ZI7F 1PX2A 3M4YA 3T1HH 4EBCA 1VBHA 1A9XA 1XTDA 2DYIA 2W10A 4PNOA 2FPDA 1R9TA 1VQ5Q 4EGJA 3UT1A 2AIRB 4XU0A 5GAN2 2DMOA 3AT1B 4MZTA 5A0DA 2LQNA 2PMZE 3L2VA 1YJNA 2W71A 1YP5A 3EGUA 1YJWA 3PN1A 2EAYA 4LN2A 4MA5A 2E65A 4XU2A 4RUCA 1S10A 1ACMB 1NBEB 2RHXA 2H8HA 2MCTA 4X65H 3FRNA 2EW3A 4X62H 2QQAA 5GONF 1CS0A 2HEQA 2NUPB 1RAFB 2CSIA 3M9QA 5D7UA 4E7IA 2GPWA 5GANj 3KUFA 2FYKA 3E9FA 1K4US 4J6XA 2RA2A 3GLKA 4KH1B 2WB1A 4JRIA 2DIGA 2HJWA 1JIHA 3MR3A 1TWHA 4O3OA 4ELYC 1EX4A 3VS1A 5FLXW 4RB1A 3GIJA 1E7OA 3A8HB 4A4KA 2HBPA 3VPCA 4ZGDB 2P4RA 5GAN5 3LGLA 1IRXA 3CC7Q 1HYOA 5KT2A 1VQ5A 1ZQ7A 1TUDA 3A1PA 3DF7A 3BFMA 4YB8B 1PRLC 3TQTA 4DL5A 4AFQC 2K3YA 3J80W 1SHGA 4PFZA 4BUGA 1K76A 2DFUA 2CW7A 1YI2Q 4TV9F 3TIGA 1ZUUA 2E5KA 4LFBH 2LVMA 4LH6A 2RNAA 1Y71A 3RB6A 5AYFA 4M4ZA 3CCST 2L3RA 3H6ZA 5GMKe 4OMOA 3JB9D 2CT4A 3AYHB 5JH7F 2F5TX 2K9GA 1BYMA 5LJ3j 2FPFA 1CKAA 1I5OB 1OI1A 3H4BA 2CW8A 2RDIA 2CUBA 1ZBXA 4ECTA 2RF0A 1Z2OX 2MF2A 2J6KA 2HSEB 1Y14B 1M4ZA 2CP7A 1M5Q1 2AGPA 4O2AF 3ASKA 2DXTA 4JI6H 2JA7G 3KAKA 4MTEA 2WSEE 3HBLA 4HYKA 1GCPA 2COWA 1QP2A 5IT9W 1WGSA 4QQ6A 3OYHA 5KFYA 1I50A 1KSWA 5C1OA 4CC5A 3CD6T 2DZCA 3E2UA 3CCJT 2G3RA 3QUIA 2RDJA 2PBZA 2LCLA 1G3YA 4M75C 1G3TA 2YCHA 4M7DF 2AK5A 1IREB 1Q95G 2R58A 1KQ2A 1M2VB 3CPWP 3CCLQ 3BA9A 4BDZA 1PD1A 2M16A 3RJ0A 4BB7A 5CO7A 4FYXB 4B3RH 1V9PA 4M7DE 3EH2A 4C92G 1UGVA 5HK0A 2K3BA 2PZ1A 3VRYA 3N5BB 3I12A 4HR7A 5KYNA 4EDUA 2RGVA 2R8GA 3C94A 4ECRA 3FDRA 4QWDA 4R8UB 5JQWA 4XU3A 5C5JA 4O4HF 2I87A 1JB0E 2RPNA 3CCRA 1MMAA 4C8QE 1C30A 5KFQA 3VPBA 4J5YA 2DVJA 2J6FA 2VWFA 4O5VA 4L59A 4PWQA 3FLGA 4LSAA 2UVUA 1IOWA 5GMKi 2KT1A 1WJQA 1V1CA 3CVZA 3RV4A 5DLOA 1A0IA 4GLMA 4YQWA 1B6SA 2JA7A 1PM3A 1JDEA 2WE6A 3JCMg 1YWOA 2J6TA 4MAMA 3UPUA 3LYIA 2FL7A 3PVXA 2GPSA 5KG0A 3GF5A 5GAN4 2E1HA 3BABA 5KFWA 5J3BA 3G8CA 1VQ7Q 4UCTA 2RJFA 2SCUB 5GAMd 3CBMA 2LJ0A 2W7OA 2IPOB 4OVAA 4R55A 2RQVA 5LYJF 3VS5A 1BU1A 1UFFA 1GCQC 1SHFA 3MJXA 4I7HA 4DA4A 5FD6A 4OMMA 2E3IA 1NJIU 4ZOLF 1MMNA 1UC9A 3M59A 1OYXA 3HP9A 5KT7A 4ATOA 3SWNB 2UXCH 4ZHQF 4JRPA 1EZZB 2VKNA 1JJ2S 1VQOT 1CQIB 3N6XA 3QWXX 4FBTA 5CVIA 1VQ9T 3PZPA 3RESA 1SEMA 1DJ7B 2DM1A 2YLCA 4YR0A 2R7MA 1WJRA 4C0DC 1Q86U 2FJZA 2FK2A 2EJ9A 2RQTA 5CKEA 3OW2S 4ZQIA 4PFPA 2JEGA 2L3QA 5LJ5f 2ZPEB 2YRWA 3O8VA 1XJWB 3VYHB 3RTXA 4QW9A 2FLNA 2E6NA 3BDUA 1OV3A 1BGWA 1X2KA 4J9SA 2UUCH 4IIMA 2EQUA 2YRVA 3CCMA 3TQ1A 2VQFH 4J9LA 1G2BA 1KC8C 5DG8A 3X28B 3VYGA 1EUDB 2X0SA 3MEUA 4R7RA 2R8HA 5CQYA 4E4TA 5HBRB 2DL5A 1RI0A 4A93G 1W6XA 4MZPA 3UWNA 3DLMA 3G6EA 2ASJA 3JB9F 3M4GA 1NM7A 1YNZA 3JCMQ 4CC6A 4B3SH 2NYSA 3OQ5A 1TUGB 1M90C 1AZGB 1GBQA 2XD0A 2MI6A 3PW7A 3TEEA 5H80A 2E5LH 5IXFA 2EVRA 1YCYA 2LTOA 1D1AA 3RB4A 1U5SA 2H3JA 1HSQA 1WFWA 3WVDB 2EBPA 3MPUB 2LX7A 4E6RA 1IBKH 4MV4A 2LQWA 4EYIB 1JKJB 4WF2A 2Y0SA 3EH1A 4Q8FA 1U8RA 3HRTA 1RK5A 4DV6H 4J0MA 1KBLA 4D8KA
chains in the Genus database with same CATH topology
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYZ A;  2P84 A;  2OX7 A; 
#chains in the Genus database with same CATH topology
 2XDB A;  1GXI E;  3Q2O A;  4IRK A;  4HKE A;  1PC0 A;  1Y57 A;  2NUP A;  2RD1 A;  2YS7 A;  3NGD A;  3PW4 A;  1VQP T;  3EFR A;  1BJT A;  3VS0 A;  2JA5 A;  2COZ A;  2CP5 A;  3SI8 A;  2DIQ A;  4BAC A;  3V8K A;  3CC4 A;  1JXO A;  4OGE A;  4O3Q A;  1I3Q A;  1ZET A;  2X51 A;  3S3O A;  2JEF A;  1BI3 A;  2GLT A;  4YJ3 F;  3PO3 G;  3J81 W;  1WHG A;  2KMT A;  1CE8 A;  2IVW A;  1UJY A;  5ECA A;  5EG2 A;  1M1F A;  4M78 C;  1R8O B;  4V2S A;  4QT7 A;  1MZB A;  1YJN T;  2FE3 A;  1Y1W G;  1YJW T;  3M9N B;  4DL4 A;  2MWO A;  1KC8 R;  2A36 A;  2UU9 H;  4NXN H;  5KFG A;  2XHC A;  2EGA A;  3TCJ A;  1AVZ C;  2NU6 B;  4EMG A;  1NZ9 A;  5KFE A;  2NUT A;  3VJP A;  4UCO A;  3TRE A;  2RQU A;  2XKO C;  2RI5 A;  3NTI A;  3R6N A;  2LC4 A;  5LJ5 e;  3JAM E;  1M90 R;  4MTD A;  2DXU A;  1RJR A;  3BJY A;  1RAB B;  4OMQ A;  1VQ6 T;  3RER A;  1D1B A;  3M53 A;  4DEX A;  3E5N A;  5KFX A;  1KJ8 A;  2YS6 A;  5KFD A;  3KFV A;  2CUD A;  5KFT A;  1YWP A;  5CKF A;  2OTL Q;  3RR6 A;  3NMZ C;  2I80 A;  2YUO A;  4F16 A;  1UB4 A;  3H4D A;  3GNF B;  4HVW A;  2RI2 A;  4JPB W;  4A3I G;  1N5Z A;  2EYX A;  4KBM B;  1VQ5 T;  1WH2 A;  5JUM A;  2FPP B;  2CKZ B;  5KFA A;  4RNO A;  3QZ8 A;  2RH2 A;  4PJO C;  1VQK A;  1YIJ Q;  2RHU A;  3N44 B;  1KQ1 A;  4KT0 E;  1DV2 A;  1JRI A;  1P92 A;  2QGG A;  1PNJ A;  5JVL A;  3CCS Q;  4M77 C;  2DBK A;  3PNW C;  5D6W A;  3JCM P;  1KJ9 A;  3HRU A;  3RKW A;  2HGS A;  2HNI A;  3M0T A;  1CKB A;  4LD9 K;  4C2M A;  4O3P A;  4IR1 A;  2P0A A;  4X66 H;  1KHI A;  2F2X A;  1TWA A;  1D3B B;  2FPI B;  4IWX A;  4WD3 A;  5L8R E;  3SEM A;  3VRZ A;  5FLX E;  1M2V A;  3OYB A;  3G4S A;  1H64 1;  2PVD B;  3CME A;  5CAE B;  4BBS G;  5J26 A;  2VOB A;  4ETS A;  5KYW B;  4RZR A;  4NXM H;  2EIF A;  4XX0 B;  3CCV A;  3JCM J;  4LF8 H;  3EFO B;  2BQR A;  4FYW B;  1RAH B;  3HOY G;  2ATC B;  2FLL A;  1JJ2 P;  2I2L A;  5I2S A;  2DRM A;  4XAX B;  4R56 A;  2AU0 A;  4R8U A;  4M7D B;  3FB9 A;  2DEU A;  4DL2 A;  1QKX A;  4JV0 A;  3CCJ Q;  3J80 E;  3CC7 T;  2CP0 A;  3M0R A;  1VQN A;  2HQX A;  1HR0 H;  4J6Y A;  2IBK A;  3C12 A;  1UTI A;  3H0H A;  5KFP A;  2Z0W A;  2JS2 A;  2LNH B;  3FJ5 A;  3OW2 P;  2SRC A;  3VMM A;  1BI2 A;  4DBH A;  2VYT A;  2DBM A;  3MEA A;  1YIJ A;  2WTF A;  1YIT Q;  3UFX B;  1B34 B;  4C8Q B;  2HD0 A;  4M75 F;  1K0X A;  3V8J A;  3CCQ A;  5HV6 A;  2R7L A;  4HNV A;  4DL3 A;  4Q45 A;  2LQK A;  2E70 A;  4WBN F;  1M3B A;  4BD3 A;  5CAI A;  3U9S A;  5LP6 F;  1I0C A;  3ZL7 C;  3CXC A;  4JI7 H;  4A2B A;  1X6O A;  4ELZ C;  4JLG A;  5IP7 G;  1AWJ A;  5IT9 E;  2VC8 A;  2R93 A;  3G6X A;  5KT6 A;  3GV7 B;  4C0F A;  1BK2 A;  4EBD A;  3DKM A;  4E7K A;  3HPW A;  3SWN A;  4L6V 5;  3I5R A;  5FU7 C;  2DNU A;  2W8L A;  1VOM A;  2H3E B;  4OMN A;  2ZDH A;  3KHL A;  3JZI A;  2JXB A;  3HHT B;  4C5G A;  2QK4 A;  3KAL A;  3FIF A;  4J9K A;  1NJI C;  2DPJ A;  2R92 A;  4M7A G;  5GAO r;  2EKO A;  1MND A;  2J05 A;  2KRO A;  3X26 B;  1TTH B;  1VQ8 A;  2RHZ A;  1WHH A;  2XK0 A;  1KQS P;  4DOW A;  4B6M A;  2E64 A;  5GAM g;  4TQR A;  1WLP B;  3VUZ A;  2RM4 A;  5EOY A;  2R8J A;  4C0G A;  1I6U A;  3GTK A;  2P0Q A;  1VQO Q;  4JV5 H;  5C1P A;  4J6W A;  1Q86 C;  2KNB B;  4RB2 C;  2F1L A;  3LX7 A;  4PJL A;  2J9G A;  2C0I A;  2QI2 A;  2LZ6 B;  1SRM A;  3GTO A;  2K2V A;  4JJN K;  3A8G B;  2R57 A;  3MR2 A;  1YBY A;  1VIF A;  2LT4 A;  3J7A K;  2O9V A;  4A3K G;  1K0S A;  2UVW A;  1WXU A;  2JA8 G;  4HNU A;  1IBL H;  4EMK B;  3EGX B;  4OML A;  5C3E G;  1MMD A;  1UDL A;  1N56 A;  3H8Z A;  2JA6 A;  3PR5 B;  5L1L A;  4JJD A;  3OSS C;  2PMZ A;  2Y4X A;  3VUB A;  5KFB A;  2XC9 A;  1VQ7 T;  1EUC B;  3THK A;  1SF9 A;  1AOJ A;  1BI0 A;  4FT2 A;  3JCM X;  4XTX A;  2J6U A;  3S6W A;  3OS1 A;  4J8O A;  2UVV A;  2QDY B;  5L9X A;  2DIK A;  1GSA A;  3PGG A;  3OYE A;  2ZPF B;  2LRQ A;  3FKI A;  4GKJ H;  1DGS A;  3Q8R B;  1NJI R;  1WCM G;  2BE9 B;  2DET A;  4OGC A;  3VS7 A;  1MMG A;  3M0P A;  2NUZ A;  1Z9Q A;  4MDW A;  4G3I A;  2XCL A;  3VS6 A;  4PJJ A;  5IXB A;  1G3W A;  2ZPI B;  1FMW A;  4O2B F;  4C5E A;  2GCX A;  2YYA A;  1VQP Q;  2JJ9 A;  1Q86 R;  4AT1 B;  1UJ0 A;  4CRI A;  2NU7 B;  4LFC H;  5CIU A;  1VUB A;  1I8F A;  2DYB A;  2VGM A;  2ATL A;  1KFZ A;  4LDX A;  3V6J A;  1GGO A;  4ECU A;  5KCO A;  1UHC A;  2AT1 B;  4ECW A;  2BQ3 A;  4LFA H;  4U7C A;  1ZHI A;  3Q8Q B;  4MMK A;  2XG8 D;  1ZHQ A;  1K9M C;  2LCS A;  1OX9 A;  1TG0 A;  2B86 A;  3GPL A;  3CC4 T;  5EWE A;  2V8K A;  1YJN Q;  2HQE A;  1YJW Q;  3DLL A;  4Y8V B;  4ZTJ A;  1KC8 U;  1QVP A;  4IRD A;  2DL8 A;  2RJD A;  4RTY A;  3RFC A;  3N43 B;  3RF2 A;  4A4E A;  3C0C A;  3G6V A;  3R5H A;  4M7D D;  2ZPH B;  1GO3 E;  2QG9 B;  4F7U F;  2OH2 A;  2MPX C;  4J9D A;  2EJF A;  4HXJ A;  3RBB B;  5AT1 B;  2W6P A;  1ZUY A;  1QCF A;  2VA3 A;  2KK4 A;  3OYI A;  1K1Z A;  1WYX A;  4Q8E A;  5KYX B;  4C8Q G;  2R7N A;  2FZG B;  2MK5 A;  2DPI A;  4J83 A;  1M90 U;  4F7U E;  1KJW A;  2C2E A;  4MV7 A;  3PE0 A;  2IG0 A;  5CQX A;  5LOV F;  4EIK A;  1QVG A;  2GBQ A;  4NLG A;  2WSF E;  1T3L A;  1B6R A;  1D0Y A;  2KI7 A;  1B07 A;  3BQ1 A;  3KXT A;  3CMA A;  4II1 A;  3F8N A;  2CS7 A;  3A8M B;  3R5F A;  1LOJ A;  4OB0 B;  1OU8 A;  3GIP A;  3OYC A;  1D3B A;  3RMS A;  4QWC A;  2CP6 A;  2MIO A;  4FT4 A;  3J81 E;  3HKZ E;  4EYH B;  4Z8A A;  1B3Q A;  3RNJ A;  4LF6 H;  3QII A;  5KYW A;  3MWD A;  2JUF A;  3GIK A;  5IHN A;  4HNT A;  2ABL A;  3EFO A;  3P8D A;  3QG1 A;  5KYY B;  1ZSZ B;  3SB2 A;  1WI7 A;  3ETH A;  4BY1 G;  4DV3 H;  1SFO A;  3HFO A;  1IXD A;  2A7Y A;  2CZG A;  2K57 A;  4M7D A;  4VUB A;  3HB9 A;  1M1G A;  2X4J A;  1EFN A;  1VYU A;  1YHQ A;  1K1Q A;  1VQK T;  2PNI A;  4C92 C;  2EKH A;  1QKW A;  1AD5 A;  1K9M R;  1QLY A;  2VVK A;  2R82 A;  1SEI A;  3RBD A;  1XOV A;  1IGQ A;  5KFN A;  2J6S A;  3C95 A;  4PJO F;  3QBY A;  3K3V A;  4Q0Y A;  4ZGJ B;  2FKL A;  1B34 A;  1UE9 A;  1T36 A;  4C8Q A;  1K9A A;  2YU9 A;  3UQ8 A;  2HVQ A;  3MCA B;  4M77 F;  1UGP B;  3PVQ A;  4PJO E;  2HMA A;  1VQ4 A;  3GV5 B;  3G4S T;  2X3W D;  4M9U A;  4PJM A;  4QVZ A;  3CME T;  3E1S A;  2ENM A;  2KY9 A;  4M77 E;  1KD1 R;  4LXC A;  5KFU A;  4XTU A;  2LQ8 A;  1YJ9 Q;  1AZE A;  3OSP A;  2OTL T;  5KG4 A;  5DGB A;  3MFI A;  3C4S A;  3N42 B;  3GTL A;  1YCS B;  4MML A;  3OYA A;  1WPY A;  1MGQ A;  2QQB A;  3EG1 A;  5CKH A;  4RU9 A;  2K7A A;  3FJP A;  1VQL Q;  2HDA A;  3L1A A;  3FC3 A;  3OSV A;  3URG A;  2NUT B;  2O2O A;  2X4W A;  3H0I A;  3S3M A;  1MV0 B;  1I07 A;  3JB9 G;  1M8M A;  5CA1 F;  2GTO A;  2VGN A;  2G6F X;  2VV5 A;  5KE2 A;  1KJQ A;  4FYY B;  1YIJ T;  2Q2T A;  1MV3 A;  4YJ2 F;  4FBU A;  5F9L A;  4RNN A;  5BMV F;  4FL6 A;  2FRW A;  5KFH A;  1BBZ A;  2JS0 A;  2DTO A;  1J5E H;  3RIR A;  1QCN A;  2KRN A;  1T3S A;  2COY A;  2BE7 D;  3M9O B;  2K5L A;  4WTO B;  3CCR Q;  2V9W A;  1N27 A;  4MDX A;  1UNN C;  5KYU B;  2ZAE A;  1TOV A;  3JCM W;  3OYY A;  5LJ5 d;  5KFZ A;  4UCU A;  1YJ9 A;  2JNG A;  1TU0 B;  4RMO A;  4FM4 B;  3HKS A;  1W96 A;  2WDT A;  2X4Y A;  2W6Z A;  4E7Z A;  4E2F B;  4BWS C;  2BQU A;  3UA6 A;  1VQL A;  4OF1 A;  3VS3 A;  5KFF A;  1TH7 A;  1QP3 A;  1ARK A;  1TSF A;  2D9T A;  1V76 A;  3TVT A;  3KAJ A;  1K73 C;  1RAG B;  4QWA A;  4XYL B;  3GII A;  3VV0 A;  5FRM A;  5KE3 A;  2NU9 B;  3OA6 A;  3EYY A;  4EBE A;  5L23 A;  3NPF A;  5GAN f;  5KG7 A;  3FDS A;  3WNZ A;  2ALZ A;  1Y0M A;  3L4J A;  3M0S A;  4LSX A;  4N4I A;  2LX9 A;  4N4H A;  4EMK A;  1WHM A;  3EGX A;  1YIT T;  4A4H A;  4RZQ A;  4JI2 H;  4Q44 A;  2JMC A;  2YDL A;  1X27 A;  5C6S A;  4MV6 A;  2I0N A;  5EDW A;  2HL5 C;  5BPF A;  1SKU B;  3BY7 A;  4AMC A;  5IHI A;  3MP1 A;  3QZ9 B;  3KXY T;  2DK3 A;  4J9H A;  3OSN A;  2CRE A;  2O31 A;  5FWB A;  1SYX B;  2PVP A;  2CT3 A;  5LL6 b;  2XIG A;  3I55 A;  2B63 G;  2DAQ A;  2V59 A;  2LDM A;  4A3M G;  1WJS A;  1Q81 C;  5KKN B;  3OHA A;  2HKN A;  5LMN H;  3PW2 A;  1NG2 A;  4AFS C;  4AFZ C;  4I4T F;  1QWE A;  3SHW A;  1UGR B;  4U6P A;  1RAE B;  5GMK h;  3I4M G;  3GTQ A;  3CCM Q;  2BUD A;  2JTE A;  1N33 H;  4B9X A;  2V58 A;  3M5A A;  2V1R A;  9ATC B;  4JYA H;  3RKX A;  1AWX A;  1EYZ A;  5LJ3 f;  3OYM A;  3G71 Q;  2D6F A;  2WAC A;  4MV1 A;  2OAU A;  3JSC A;  2DZ9 A;  4J9C A;  3G6E Q;  3CBP A;  5BR8 H;  3M9M B;  3HSB A;  2M0Y A;  1K73 R;  3SE7 A;  2RHY A;  2YW2 A;  1UC8 A;  2AQ4 A;  3GQC A;  4OMF B;  2DER A;  1Q7Y C;  3L2Z A;  3ULR B;  2YRD A;  3PIP A;  4DLK A;  1XMQ H;  4DV0 H;  1FKA H;  3M55 A;  1PWT A;  3V7R A;  3A98 A;  1LPL A;  3PW0 A;  3NTK A;  2AGO A;  2R7K A;  4O4L F;  2DL7 A;  2E2H A;  1PKS A;  2JA5 G;  2PUO B;  2B63 A;  5KYX A;  5CR2 A;  2YXY A;  5GAM j;  3N40 P;  4J9Q A;  1RUW A;  4DR5 H;  4J9R A;  1I94 H;  2A28 A;  5GAN e;  4A3E G;  5DLF A;  2O88 A;  3T5J A;  1MHN A;  5LXT F;  2B8A A;  5GAN 6;  4GC7 A;  4BI4 A;  2DPP B;  3CC4 Q;  4B9W A;  1TAE A;  2VB6 A;  3G71 A;  1Q81 R;  4YP3 A;  4D8D A;  1RLP C;  4MV9 A;  1MUZ A;  1WXB A;  5DY9 A;  3N8D A;  2F2W A;  5HK3 A;  4DR1 H;  1X2Q A;  4A3C G;  5FU6 C;  2FPE A;  1M1K R;  1SCU B;  1X69 A;  2MMP A;  4A63 B;  5KT3 A;  1AUX A;  4LF9 H;  3M0Q A;  2IP4 A;  1X01 A;  5KYY A;  3F70 A;  1IZ6 A;  1ZSZ A;  3A8L B;  3QWY A;  3LWI A;  2V4R A;  4QQD A;  4M75 D;  1GBR A;  2KRM A;  1IBM H;  3TQ7 P;  1S72 A;  5J39 A;  4HT8 A;  3QHS A;  2LCC A;  4UFZ A;  4JLI A;  1Q7Y R;  3ZFJ A;  2R7Z G;  2KVQ G;  2NWM A;  1CSK A;  1Y1V G;  3UAT A;  3VS2 A;  4UCS A;  2FZC B;  3QYG B;  5LJ3 e;  4FW2 A;  1FMV A;  1Y96 B;  3H0F A;  2LNV A;  4DV1 H;  1GSO A;  3V4Z A;  2BZX A;  5DQI A;  4X9C A;  3L2Q A;  1PKT A;  1ZQ1 A;  3KHG A;  3NFC A;  4I50 F;  5HY6 A;  4UCV A;  1N32 H;  1WZO A;  5GAN 7;  5DM7 R;  1X6G A;  4ECS A;  1L2Z A;  5KFL A;  1I1J A;  1ZBJ A;  3JV3 A;  1VQK Q;  4PJO B;  5IHK A;  2YL2 A;  1K9M U;  4A3L G;  3N41 B;  1VQM Q;  3HFN A;  3JRX A;  3PO2 G;  2RHI A;  4Z88 A;  1KHC A;  4M77 B;  2ROL A;  4OP0 A;  4L5G A;  2M1H A;  1N34 H;  3CXC S;  1YHQ T;  4Y28 E;  7AT1 B;  5KFS A;  3KTM A;  2R85 A;  4IIO A;  2XD4 A;  2KEA A;  5GAM f;  3BQ0 A;  2J7I A;  2HVR A;  3GP8 A;  3G4S Q;  1B33 N;  3CME Q;  4C92 F;  2VQE H;  1KD1 U;  1GFC A;  3CCV Q;  1PD0 A;  4Y91 A;  1NLO C;  2NUA B;  3OTO H;  2P84 A;  5GAN 8;  2JZ2 A;  5C44 G;  3RAX A;  4C92 E;  1PSE A;  4PLI A;  4Z02 A;  4RAY A;  2DWC A;  2R7Z A;  3SFM A;  3M0U A;  1Y1V A;  5IH2 A;  2K5I A;  4PDB A;  1KIK A;  3DB3 A;  5GJV B;  2CP3 A;  1VQN Q;  2EGC A;  1IHV A;  5KYU A;  1PCX A;  2E6Z A;  3U9T A;  4R0K A;  2XGP A;  3HOW G;  1N48 A;  3RBE A;  3REA B;  1KEE A;  1Q82 R;  3G6Y A;  3MJF A;  3H41 A;  4Y92 A;  4ECV A;  1NPP A;  5KCH A;  2KT8 A;  4UC4 A;  4M7A C;  2M0O A;  2RQR A;  4RCC A;  2QAZ A;  2CP2 A;  1VQM A;  5GAN 3;  2DZD A;  1T0H A;  2KYB A;  1BI1 A;  2E10 A;  3Q8S B;  2DLP A;  1KJI A;  1QQJ A;  4APM A;  3CCQ Q;  4E47 A;  2ECZ A;  3MR6 A;  2L8D A;  5LJ3 h;  1XDN A;  2QQ9 A;  2NLU A;  2R93 G;  4TUY F;  2F2V A;  3EPI A;  3UA7 A;  3OHB A;  4ZNX A;  1ZLM A;  1GCQ A;  2DJZ A;  2XDP A;  1K8A C;  4QIW E;  1RAC B;  3OMG A;  2EFI A;  2VAS A;  4DEY A;  2EYQ A;  4N0A C;  2RF4 A;  1YJ9 T;  2R8K A;  1IB8 A;  1NYG A;  5LJ5 g;  2R92 G;  3M54 A;  2YZG A;  1IO6 A;  1N9S A;  4MZM A;  1VQL T;  5LJ5 h;  4BBR G;  2C2D A;  1WNL A;  1W2B S;  4E7L A;  1TWG A;  1ZX6 A;  2CH4 W;  1RJP A;  4JI0 H;  8ATC B;  4ECZ A;  4DR4 H;  1QWF A;  1VQ8 Q;  5C0M A;  4RTU A;  3BA8 A;  2E2I A;  5GAM e;  1BB9 A;  2CGH A;  4JZ4 A;  3OS2 A;  2JVV A;  4ANJ A;  5GAO n;  1W70 A;  1W93 A;  1T94 A;  2OTJ A;  3P8H A;  3VPD A;  4M75 E;  2HHH H;  1U1S A;  2HKQ B;  3EFS A;  3QSU A;  2DLN A;  3RKY A;  4DV2 H;  1FYN A;  2FZK B;  4M78 D;  2DIL A;  3P8B B;  4IUR A;  2C28 A;  4OB2 B;  3CCR T;  2QA4 Q;  2R6F A;  4ED3 A;  2FRY A;  2R5M A;  2BR0 A;  2JA6 G;  2P0K A;  3KBG A;  3I55 T;  4C5B A;  2DO3 A;  3EGD B;  5LMU H;  4ESR A;  4AG2 C;  3X24 B;  1AN7 A;  3TII A;  2DXC A;  1S0O A;  3RIZ A;  4LNP A;  5EWG A;  1W4S A;  4LD6 A;  3PVL A;  1K8A R;  4B3M H;  3T5H A;  2JTM A;  1I5L A;  3JCM b;  4YR2 A;  2OLS A;  2UUA H;  4BE1 A;  3JSL A;  3FKI G;  4A54 A;  1S68 A;  1TS9 A;  3CD6 A;  2PQW A;  2GFU A;  1K73 U;  2VUM G;  1VBG A;  3ZBD A;  2R5A A;  4JZ3 A;  2C35 B;  2R8I A;  1FWZ A;  4A3J G;  1OZ3 A;  4JI4 H;  1D0X A;  4EPC A;  2YRX A;  2FHD A;  5IYC G;  3BG5 A;  2ED0 A;  4AFU C;  4ECX A;  4JV1 A;  4YBZ B;  4F7U A;  5HCK A;  4X1V A;  4RG8 A;  5GMK l;  1QVG S;  1TXQ A;  4C8Q C;  4D6W A;  3L4K A;  4JI3 H;  3HL8 A;  4BY6 C;  2DTI A;  2QA4 A;  4PJO D;  4DV4 H;  2HZY A;  1RI9 A;  3CXC P;  1S0N A;  1PHT A;  1HXD A;  2YWW A;  3I5S A;  4M77 D;  2VXE A;  2JOY A;  1NE8 A;  1X43 A;  5KFC A;  3HKZ A;  4PKC C;  2VUG A;  4PL6 A;  5L1J A;  1F1B B;  4IUU A;  1AUV A;  1Q81 U;  3OYN A;  5KG2 A;  2DD5 A;  2V8I A;  3CCM T;  2W70 A;  4A53 A;  2AGQ A;  3MEV A;  4J7F A;  5DG7 A;  1I7N A;  5D1O B;  5DQG A;  1QVF A;  2XIC A;  2OWO A;  4C5C A;  1I7L A;  2YRC A;  1M1K U;  1W2B A;  3G71 T;  4A3B G;  4DQ2 A;  4JRQ A;  4A4F A;  3MFH A;  4FS1 A;  4A3F G;  3JB9 H;  3G6E T;  2WAQ E;  2E4H A;  4LF5 H;  2YUP A;  1Y96 A;  1B04 A;  2VUM A;  3L42 A;  4FSX A;  4O4I F;  1A0N B;  1ULZ A;  4F14 A;  4EG0 A;  3T5K A;  4B3T H;  1KC7 A;  4GLX A;  2W6O A;  4JI1 H;  4E7H A;  1GLV A;  2F4V H;  1LVK A;  2V8J A;  2XCA A;  3H0G A;  1T0J A;  4ED1 A;  3MHX A;  2D0N A;  3GNG A;  5DG9 A;  2M05 A;  5KFK A;  4PJO A;  4DV7 H;  1Q7Y U;  5C8Y F;  2RJE A;  1D1C A;  2A37 A;  1MNE A;  4M77 A;  3RB0 A;  2ZDG A;  2UXD H;  1JO8 A;  3CMA Q;  1Y07 A;  4KGV B;  2LP5 A;  2QEX A;  1VQ9 A;  1ZUK A;  2J6O A;  8AT1 B;  1JBM A;  2EQJ A;  2DTH A;  2O01 E;  2EYZ A;  4KUI A;  1QCO A;  1XNR H;  2ZGW A;  4M7D G;  3GIB A;  1M6V A;  1BIB A;  4FU6 A;  4LDU A;  5FPO A;  4QWB A;  4IRC A;  3CCE Q;  4IHJ F;  5IYB G;  5EC7 A;  1JXM A;  1JLL B;  3CQZ A;  1IGU A;  1WQW A;  2F69 A;  3SDZ A;  1RAA B;  1C6V X;  2GTJ A;  2FMA A;  4EGQ A;  5C4X G;  3J7A F;  1YHQ Q;  5FLM G;  2CZ0 B;  3AHU A;  4C92 B;  2OX7 A;  4M78 F;  1KD1 C;  4DL7 A;  4KUL A;  3VS4 A;  3ORQ A;  4A3G G;  4FYV B;  2ZJT A;  2FEI A;  4M78 E;  4O3N A;  2V1Q A;  4M7E A;  5CKB A;  4F4X A;  4ZTF A;  1VQ4 Q;  3HRS A;  4ECY A;  5L1K A;  3E9G A;  3EPG A;  5GAO l;  3I9Q A;  2CQY A;  1XNQ H;  4HT9 A;  3V6H A;  1WIE A;  1IOV A;  4OMP A;  1VA7 A;  3CQT A;  4IWY A;  4XK8 E;  3L2W A;  4NOY A;  1Q82 U;  2HQH A;  3JCM f;  2DRK A;  4PJN A;  5GAN d;  3CCE A;  1M2O A;  3TSW A;  2JW4 A;  5L1I A;  5KFV A;  4X64 H;  4JDS A;  4DR6 H;  2W6M A;  2DE0 X;  3PTA A;  4IZO A;  1BCO A;  1M0T A;  1HNX H;  1B7T A;  2GFA A;  1DIK A;  4LUD A;  1PK8 A;  2D8H A;  1VQM T;  1UEB A;  5CCA A;  5D8D A;  1OQK A;  2ZDQ A;  3JSN A;  3MP6 A;  3TSZ A;  1KG1 A;  3TU4 K;  3QYH B;  4M7A F;  3K3P A;  2JEJ A;  4JI5 H;  3JCM V;  3FMA A;  4FS2 A;  5KG3 A;  2MOX A;  3GTP A;  1WX6 A;  5EWF A;  4M7A E;  1G5V A;  2ESW A;  2DL4 A;  2AZV A;  4AG1 C;  1VKZ A;  2W7P A;  3O5Z A;  3QDF A;  3I56 A;  1QVG P;  3CCV T;  2XDD A;  4RTT A;  2QTV A;  2A3L A;  2EWN A;  1R0B G;  4BXX G;  1ABQ A;  2QYZ A;  2ZPB B;  4IUV A;  1VQ6 A;  4IKF A;  4A2A A;  4QW2 A;  1RYR A;  2X4X A;  3JRZ A;  2DD4 A;  4ME7 A;  5A0L A;  1PRM C;  1D09 B;  1K1S A;  1VQN T;  3QJY A;  5LJ3 d;  1OUL A;  2IMW P;  4M75 B;  4F17 A;  4A3D G;  3I4N G;  4KGZ B;  1XNI A;  3RMQ A;  2CZ7 B;  1RL2 A;  1WA7 A;  2XI9 A;  2K2M A;  3GLX A;  2O9S A;  3OS5 A;  1N8R C;  2X35 A;  3OYF A;  1FX7 A;  3EGD A;  2DXB A;  3H3V H;  1WHL A;  3IQL A;  3KHR A;  1AT1 B;  3OYD A;  1FMK A;  3CPW A;  1AEY A;  3EG2 A;  2W9C B;  1BIA A;  2RB6 A;  4MA0 A;  1ZSZ C;  2R86 A;  2EYY A;  2XID A;  4HCZ A;  3CCQ T;  3PMT A;  3QZ5 B;  4TVR A;  5J2U F;  2L89 A;  4BE0 A;  2OTJ T;  1KJJ A;  2ZPG B;  5KFR A;  3HOX G;  3KHH A;  1RK6 A;  1R0C B;  1UG1 A;  1CQJ B;  1T3N A;  1X6B A;  3HOV G;  1OZ2 A;  2E3H A;  4TV8 F;  1KK7 A;  4F04 B;  4AYB E;  3I55 Q;  3JCM c;  3EG9 B;  2GGR A;  4PK4 A;  1X75 C;  3MWM A;  3CEY A;  3PW5 A;  1M27 C;  4E7J A;  3JCM e;  1V51 A;  3CCU Q;  1H92 A;  4Q5W A;  3PIO A;  1O75 A;  3MEW A;  3MP8 A;  4JS4 A;  2D0Q B;  1K8A U;  2A0F B;  3K5H A;  4ZN3 A;  3OUZ A;  3Q1K A;  3CPF A;  4RUA A;  1RAI B;  2W8K A;  5KFI A;  5KT5 A;  3QJ6 A;  3OYG A;  3GTG A;  2KSW A;  4FSS A;  5CK9 A;  4C5I A;  2L3S A;  4LF7 H;  4DOV A;  3CC7 A;  4ZGE B;  3D7S B;  1JXL A;  2HCK A;  3QDR B;  1U1T A;  1OWT A;  4DL6 A;  3OY9 A;  3LGF A;  1VQ8 T;  4XTW A;  4BY7 G;  3PT9 A;  5HKC A;  1NEB A;  2WSC E;  4XU1 A;  3EHQ A;  3IN5 A;  4CC4 B;  5LJ5 j;  4GKK H;  5D1O A;  4F4W A;  1N8R R;  1YI2 A;  3A8O B;  1NEG A;  2O4X B;  2YUN A;  2R87 A;  5FWC A;  5KFO A;  5IP9 G;  2E5Q A;  2BTT A;  2FK3 A;  2ZZD A;  4FCY A;  3H40 A;  1E6H A;  3NGP A;  3C0F B;  1K83 A;  4C0D B;  3GBQ A;  4OB3 B;  3CCU A;  2QA4 T;  4X9D A;  4C92 D;  4C8Q F;  4ED2 A;  2OAW A;  3CC2 Q;  4CC7 A;  1OX8 A;  4X34 A;  1M1K C;  3EG3 A;  2WB1 E;  3HOZ G;  3MR5 A;  2JEI A;  1JU5 C;  3WXM B;  4CI0 C;  2DA9 A;  1M7J A;  3JRW A;  1BCM A;  2E12 A;  2J06 A;  4NL3 A;  4ORZ A;  3RDV A;  4FM9 A;  1UEC A;  4YHH H;  2V4Q A;  4AQY H;  1U06 A;  1HNZ H;  2PN1 A;  1JX4 A;  3PMI A;  1M3A A;  3QPH A;  2QQS A;  5FU6 B;  4GLK A;  4NS5 A;  3JCM h;  3LLR A;  1OPK A;  5IYD G;  4JI8 H;  3CCL A;  1FXX A;  2DX1 A;  2KQW A;  5I21 A;  3L2R A;  4QVC A;  2DF6 A;  1V4Y A;  1Z9Z A;  3QZ7 A;  1X9N A;  2W6Q A;  1ZA1 B;  3WO1 A;  1S72 Q;  3MET A;  5A2Q W;  4BI8 B;  5F9N A;  4YTL A;  2KSS A;  3T1Y H;  2EJG A;  2LMJ A;  3GIM A;  5D6Y A;  3ZEH A;  2K3X A;  4C92 A;  3CC2 A;  1S1N A;  3JB9 J;  3X20 B;  2FP4 B;  2PVG B;  3QKJ A;  4HCB A;  3IG0 A;  5D1P A;  3Q8P B;  1M3C A;  4A4G A;  5KFM A;  4RUG A;  1SPK A;  3TIN A;  5KX5 F;  2QEX T;  1M8V A;  1G83 A;  2YLB A;  2OI3 A;  2PU9 B;  4DBR A;  2DVE A;  4YAK B;  3E19 A;  4F7U B;  3RB3 A;  2KGT A;  4RTW A;  2FPG B;  4EEQ A;  4LH7 A;  4KRT A;  4M78 B;  2CDT A;  4DUY H;  4XZ3 B;  1VQ7 A;  4M75 G;  1SSH A;  2HL3 A;  3RV3 A;  3L2U A;  3V4S A;  3ME9 A;  5BPH A;  4QQG A;  3U23 A;  2YSQ A;  1PSF A;  3LH5 A;  2CZ6 B;  4HVV A;  1EHI A;  3GOX A;  4J9N A;  1UGS B;  3OYJ A;  3R6O A;  1AWW A;  2BZ8 A;  4QIW A;  4ED7 A;  1HK9 A;  3V6K A;  1JQQ A;  2D8J A;  2FO0 A;  3SWN C;  4KH0 B;  2ROT A;  1Q82 C;  3QO3 A;  4J9I A;  2XU8 A;  5FW9 A;  3CMA T;  1E4G T;  4DR3 H;  1WQ7 A;  1C0M A;  2L3P A;  2YZM A;  5I22 A;  4J9M A;  1NLP C;  5CA0 F;  2W9A A;  2P0P A;  1PG5 B;  1RAD B;  2CYZ B;  2W57 A;  4ED6 A;  2QTX A;  2ZM6 H;  4YAJ B;  1XMO H;  1C3O A;  4RB0 A;  3RGZ A;  3LH0 A;  4HCK A;  5LA6 F;  2EQM A;  5KG1 A;  6AT1 B;  3CCE T;  1I4K 1;  2QDL A;  4M7A B;  2AKL A;  1Z2N X;  2RI3 A;  5GAN g;  1GL5 A;  1FVI A;  1AHJ B;  4KGX B;  4DV5 H;  1KQS S;  1E4E B;  1UHF A;  4M75 A;  5M9O A;  4OB1 B;  5GAN h;  4QW8 A;  1S0M A;  2XCP A;  4LF4 H;  4PFO A;  4Z89 A;  1GRI A;  2Y4Y A;  3DB4 A;  3BW1 A;  5IAY A;  1QW1 A;  4JRK A;  4QKU A;  3INZ A;  1JDB B;  1IHW A;  1TWF A;  4RTV A;  5GAO p;  2PVO B;  5I2M A;  1SG5 A;  3L2P A;  2L2P A;  5GJW B;  3V7C A;  2W9C A;  1VQ4 T;  2KYM A;  3OBY A;  1UUE A;  2C0T A;  1H8K A;  5FRN A;  3RAQ A;  4XTY A;  2FLP A;  1LJO A;  4C5H A;  4JUZ A;  3I56 T;  2KXC A;  3M56 A;  1JJ2 A;  2CKK A;  2FB9 A;  1TA8 A;  1FJG H;  3GV8 B;  3RUP A;  5J2T F;  3MKD A;  1E4F T;  4J9F A;  4YY3 H;  3EG9 A;  1SRL A;  2HSP A;  3GIQ A;  4XYM B;  2RGR A;  3OW2 A;  2P4T A;  2KR3 A;  1TUC A;  3BQ2 A;  3V7S A;  5LJ3 g;  3H9N A;  3PFS A;  1XQH A;  2JN0 A;  1VYV A;  2M51 A;  3G7Z A;  4HCC A;  1JEG A;  1O9S A;  4LMY A;  2EYW A;  4WCI A;  1Z2P X;  3QXE B;  2PTK A;  3VKI A;  4BI3 A;  2I8C A;  2W9B B;  3UF4 A;  2OTJ Q;  5IYZ F;  3HXL A;  1LCK A;  2RK2 A;  2L0A A;  4DBF A;  2RO0 A;  2V26 A;  1ZHS A;  1YN8 A;  3LWH A;  3R23 A;  3EAE A;  2VQD A;  2FG0 A;  5CKD A;  1VAJ A;  2GQV A;  1ABO A;  1Y1W A;  2E41 A;  4NL2 A;  2EQK A;  3MWE A;  4RAZ A;  1Y7X A;  1OPL A;  2R84 A;  1TWC A;  1I81 A;  4O6J A;  2KRS A;  2YUQ A;  1VS0 A;  2C2R A;  2O4X A;  4HVU A;  5FU7 B;  2Y0S E;  2NVX A;  1YFN A;  4F50 A;  3ER0 A;  4C0Z A;  3OMC A;  1QVF S;  2QQR A;  2OTL A;  2MWP A;  4J9G A;  1OOT A;  4J7I A;  2O03 A;  4RKU E;  2AHJ B;  5I11 A;  1WHK A;  4HA8 A;  4Q43 A;  2YZN A;  3CD6 Q;  4RTX A;  4JJC A;  2WAQ A;  4O3R A;  4J9E A;  2D1X A;  5DQH A;  4BE2 A;  4F7U G;  2LT1 A;  1AWO A;  1WR2 A;  1N8R U;  2KE9 A;  2RMO A;  1S03 G;  2K5F A;  2C06 A;  4M78 G;  1KQS A;  3T9N A;  1WXT A;  2VPS A;  2Q2U A;  5GAO q;  2QAS A;  4PLL A;  1S9F A;  3CCS A;  2UUB H;  3BE3 A;  1RLQ C;  1SSF A;  4ZN1 A;  1TWB A;  1YI2 T;  4UCR A;  4BY6 B;  3OYK A;  3M58 A;  4F4Y A;  1QMC A;  2ED1 A;  4RG2 A;  3QFF A;  2IA6 A;  4FU0 A;  1M9S A;  4QJF A;  2VXF A;  2OJ2 A;  4EEY A;  5FJ8 G;  4FIB A;  4LE9 A;  3CCU T;  3RUX A;  4IR9 A;  4IUT A;  4K11 A;  2JM8 A;  4LDW A;  1HJD A;  2RJC A;  4CC3 A;  2VUB A;  3G1J A;  4IUQ A;  2HAX A;  3PR4 A;  3OS0 A;  4M7D C;  5FPR A;  2HBW A;  2IIM A;  2JT4 A;  2DKG A;  2L5Q A;  4MV3 A;  2A08 A;  3GID A;  3CCJ A;  4QVD A;  3OYL A;  2K6D A;  2QK0 A;  2X3X D;  4BDY A;  4RCB A;  2RN8 A;  3GTM A;  4DBQ A;  3OUU A;  4JUV A;  4DUZ H;  4LDY A;  3H0G G;  2MAM A;  3M57 A;  4E7S A;  4RNM A;  1V29 B;  1YIT A;  3RGX A;  1VIE A;  2M02 A;  4PJO G;  1BNC A;  2KXD A;  5GMK m;  2LJ1 A;  2W0Z A;  2BKD N;  2EQI A;  2VR1 A;  5FD5 A;  4M78 A;  2YHT A;  1J3T A;  4M77 G;  3VU3 C;  3CCL T;  2K79 A;  4K0K H;  1D0Z A;  2DEQ A;  1H3H A;  4M7A D;  2CZ1 B;  4JV2 A;  1M0W A;  4TQS A;  1GFD A;  4P5N A;  3OBW A;  5GAM h;  5KH6 A;  1DV1 A;  2QEX Q;  1VQ9 Q;  2JMA A;  1OEB A;  1C1A A;  4XQ3 A;  4ED0 A;  3CC2 T;  3JB9 I;  4KUD K;  3MO8 A;  2UXB H;  5LL6 S;  3JCM d;  4IUP A;  1R77 A;  2KBT A;  5DLG A;  1BXR A;  2V5A A;  3R5X A;  1WSC A;  4O3S A;  4CC2 A;  5IWA H;  1N36 H;  2GQI A;  1NPR A;  1ZSG A;  2X9H A;  2BZY A;  3S3N A;  2EGE A;  3GTJ A;  1HNW H;  2XMF A;  2GF7 A;  2RQW A;  1S97 A;  5GMK j;  2F5K A;  4XTZ A;  2WYO A;  2ASL A;  1WDX A;  2HVS A;  1M30 A;  4LUE A;  3ORR A;  1EZ1 A;  5KFJ A;  2ASD A;  1EIF A;  2AKK A;  3UDC A;  2W6N A;  1P8L A;  5A2Q E;  2FVU A;  5KG5 A;  3K5I A;  2NU8 B;  4N4G A;  5DGA A;  2KDS A;  3BDL A;  4RTZ A;  3LWB A;  4M7A A;  4EFE A;  1HD3 A;  2KAF A;  4OX9 H;  3H20 A;  3T5L A;  2JM9 A;  1VQO A;  1S72 T;  1OU9 A;  5EZY F;  1E4E A;  2JTF A;  5CB4 F;  1BKB A;  4GBQ A;  4J9O A;  3LP8 A;  2ZCF B;  2CSQ A;  4DR2 H;  1ZA2 B;  2DL3 A;  3BAA A;  3GIL A;  1RYS A;  3EHR A;  2GNC A;  1G3S A;  4JJB A;  2FK1 A;  4L1K A;  1N6A A;  4GC6 A;  1H3Z A;  2PUK B;  2UVR A;  2QGF B;  3NHN A;  2M9U A;  4YR3 A;  3OB9 A;  4EMK C;  4LDV A;  1E6G A;  5KT4 A;  5FRO A;  2XGQ A;  2QXF A;  4ME6 A;  4N0A A;  3CPW S;  2C00 A;  2BIV A;  4F4Z A;  2YT6 A;  1RJQ A;  3LW5 E;  1QVF P;  2VPQ A;  3Q1J A;  2FB7 A;  1W2B P;  4GY5 A;  4KHP H;  4DR7 H;  2AZS A;  5D6X A;  4ED8 A;  3LML A;  4MV8 A;  3CBO A;  3M4I A;  4EFB A;  1WHJ A;  2C22 A;  4JS5 A;  5IN1 A;  5K2M A;  4EMH A;  3HOU G;  2MYS A;  5DLQ E;  4FW1 A;  1GSH A;  3A5Z B;  5KG6 A;  3WVE B;  4ECQ A;  3EG0 A;  1UGQ B;  4I55 F;  2SEM A;  5I47 A;  2NVY A;  4AYB A;  2LJ3 A;  2RK1 A;  4J9B A;  4C5A A;  5GAO m;  2W9B A;  2EPD A;  3I56 Q;  4RB3 C;  1W1F A;  1GYF A;  1U3O A;  1N9R A;  3FEO A;  5A0G A;  3SD4 A;  4HQ6 A;  5T14 A;  2C0O A;  1WCM A;  3X25 B;  3V8L A;  2K4Y A;  1VQ6 Q;  5JVD F;  2MCN A;  2CH4 A;  3WO0 A;  2Y90 A;  1LNX A;  3REB B;  1NYF A;  4J9P A;  4C8Q D;  4IAJ A;  2VA2 A;  1VYT A;  3HTR A;  1VQP A;  3ETJ A;  1G8X A;  3JAM W;  3I35 A;  3NTH A;  2DJQ A;  4XTV A;  4QWE A;  4ZI7 F;  1PX2 A;  3M4Y A;  3T1H H;  4EBC A;  1VBH A;  1A9X A;  1XTD A;  2DYI A;  2W10 A;  4PNO A;  2FPD A;  1R9T A;  1VQ5 Q;  4EGJ A;  3UT1 A;  2AIR B;  4XU0 A;  5GAN 2;  2DMO A;  3AT1 B;  4MZT A;  5A0D A;  2LQN A;  2PMZ E;  3L2V A;  1YJN A;  2W71 A;  1YP5 A;  3EGU A;  1YJW A;  3PN1 A;  2EAY A;  4LN2 A;  4MA5 A;  2E65 A;  4XU2 A;  4RUC A;  1S10 A;  1ACM B;  1NBE B;  2RHX A;  2H8H A;  2MCT A;  4X65 H;  3FRN A;  2EW3 A;  4X62 H;  2QQA A;  5GON F;  1CS0 A;  2HEQ A;  2NUP B;  1RAF B;  2CSI A;  3M9Q A;  5D7U A;  4E7I A;  2GPW A;  5GAN j;  3KUF A;  2FYK A;  3E9F A;  1K4U S;  4J6X A;  2RA2 A;  3GLK A;  4KH1 B;  2WB1 A;  4JRI A;  2DIG A;  2HJW A;  1JIH A;  3MR3 A;  1TWH A;  4O3O A;  4ELY C;  1EX4 A;  3VS1 A;  5FLX W;  4RB1 A;  3GIJ A;  1E7O A;  3A8H B;  4A4K A;  2HBP A;  3VPC A;  4ZGD B;  2P4R A;  5GAN 5;  3LGL A;  1IRX A;  3CC7 Q;  1HYO A;  5KT2 A;  1VQ5 A;  1ZQ7 A;  1TUD A;  3A1P A;  3DF7 A;  3BFM A;  4YB8 B;  1PRL C;  3TQT A;  4DL5 A;  4AFQ C;  2K3Y A;  3J80 W;  1SHG A;  4PFZ A;  4BUG A;  1K76 A;  2DFU A;  2CW7 A;  1YI2 Q;  4TV9 F;  3TIG A;  1ZUU A;  2E5K A;  4LFB H;  2LVM A;  4LH6 A;  2RNA A;  1Y71 A;  3RB6 A;  5AYF A;  4M4Z A;  3CCS T;  2L3R A;  3H6Z A;  5GMK e;  4OMO A;  3JB9 D;  2CT4 A;  3AYH B;  5JH7 F;  2F5T X;  2K9G A;  1BYM A;  5LJ3 j;  2FPF A;  1CKA A;  1I5O B;  1OI1 A;  3H4B A;  2CW8 A;  2RDI A;  2CUB A;  1ZBX A;  4ECT A;  2RF0 A;  1Z2O X;  2MF2 A;  2J6K A;  2HSE B;  1Y14 B;  1M4Z A;  2CP7 A;  1M5Q 1;  2AGP A;  4O2A F;  3ASK A;  2DXT A;  4JI6 H;  2JA7 G;  3KAK A;  4MTE A;  2WSE E;  3HBL A;  4HYK A;  1GCP A;  2COW A;  1QP2 A;  5IT9 W;  1WGS A;  4QQ6 A;  3OYH A;  5KFY A;  1I50 A;  1KSW A;  5C1O A;  4CC5 A;  3CD6 T;  2DZC A;  3E2U A;  3CCJ T;  2G3R A;  3QUI A;  2RDJ A;  2PBZ A;  2LCL A;  1G3Y A;  4M75 C;  1G3T A;  2YCH A;  4M7D F;  2AK5 A;  1IRE B;  1Q95 G;  2R58 A;  1KQ2 A;  1M2V B;  3CPW P;  3CCL Q;  3BA9 A;  4BDZ A;  1PD1 A;  2M16 A;  3RJ0 A;  4BB7 A;  5CO7 A;  4FYX B;  4B3R H;  1V9P A;  4M7D E;  3EH2 A;  4C92 G;  1UGV A;  5HK0 A;  2K3B A;  2PZ1 A;  3VRY A;  3N5B B;  3I12 A;  4HR7 A;  5KYN A;  4EDU A;  2RGV A;  2R8G A;  3C94 A;  4ECR A;  3FDR A;  4QWD A;  4R8U B;  5JQW A;  4XU3 A;  5C5J A;  4O4H F;  2I87 A;  1JB0 E;  2RPN A;  3CCR A;  1MMA A;  4C8Q E;  1C30 A;  5KFQ A;  3VPB A;  4J5Y A;  2DVJ A;  2J6F A;  2VWF A;  4O5V A;  4L59 A;  4PWQ A;  3FLG A;  4LSA A;  2UVU A;  1IOW A;  5GMK i;  2KT1 A;  1WJQ A;  1V1C A;  3CVZ A;  3RV4 A;  5DLO A;  1A0I A;  4GLM A;  4YQW A;  1B6S A;  2JA7 A;  1PM3 A;  1JDE A;  2WE6 A;  3JCM g;  1YWO A;  2J6T A;  4MAM A;  3UPU A;  3LYI A;  2FL7 A;  3PVX A;  2GPS A;  5KG0 A;  3GF5 A;  5GAN 4;  2E1H A;  3BAB A;  5KFW A;  5J3B A;  3G8C A;  1VQ7 Q;  4UCT A;  2RJF A;  2SCU B;  5GAM d;  3CBM A;  2LJ0 A;  2W7O A;  2IPO B;  4OVA A;  4R55 A;  2RQV A;  5LYJ F;  3VS5 A;  1BU1 A;  1UFF A;  1GCQ C;  1SHF A;  3MJX A;  4I7H A;  4DA4 A;  5FD6 A;  4OMM A;  2E3I A;  1NJI U;  4ZOL F;  1MMN A;  1UC9 A;  3M59 A;  1OYX A;  3HP9 A;  5KT7 A;  4ATO A;  3SWN B;  2UXC H;  4ZHQ F;  4JRP A;  1EZZ B;  2VKN A;  1JJ2 S;  1VQO T;  1CQI B;  3N6X A;  3QWX X;  4FBT A;  5CVI A;  1VQ9 T;  3PZP A;  3RES A;  1SEM A;  1DJ7 B;  2DM1 A;  2YLC A;  4YR0 A;  2R7M A;  1WJR A;  4C0D C;  1Q86 U;  2FJZ A;  2FK2 A;  2EJ9 A;  2RQT A;  5CKE A;  3OW2 S;  4ZQI A;  4PFP A;  2JEG A;  2L3Q A;  5LJ5 f;  2ZPE B;  2YRW A;  3O8V A;  1XJW B;  3VYH B;  3RTX A;  4QW9 A;  2FLN A;  2E6N A;  3BDU A;  1OV3 A;  1BGW A;  1X2K A;  4J9S A;  2UUC H;  4IIM A;  2EQU A;  2YRV A;  3CCM A;  3TQ1 A;  2VQF H;  4J9L A;  1G2B A;  1KC8 C;  5DG8 A;  3X28 B;  3VYG A;  1EUD B;  2X0S A;  3MEU A;  4R7R A;  2R8H A;  5CQY A;  4E4T A;  5HBR B;  2DL5 A;  1RI0 A;  4A93 G;  1W6X A;  4MZP A;  3UWN A;  3DLM A;  3G6E A;  2ASJ A;  3JB9 F;  3M4G A;  1NM7 A;  1YNZ A;  3JCM Q;  4CC6 A;  4B3S H;  2NYS A;  3OQ5 A;  1TUG B;  1M90 C;  1AZG B;  1GBQ A;  2XD0 A;  2MI6 A;  3PW7 A;  3TEE A;  5H80 A;  2E5L H;  5IXF A;  2EVR A;  1YCY A;  2LTO A;  1D1A A;  3RB4 A;  1U5S A;  2H3J A;  1HSQ A;  1WFW A;  3WVD B;  2EBP A;  3MPU B;  2LX7 A;  4E6R A;  1IBK H;  4MV4 A;  2LQW A;  4EYI B;  1JKJ B;  4WF2 A;  2Y0S A;  3EH1 A;  4Q8F A;  1U8R A;  3HRT A;  1RK5 A;  4DV6 H;  4J0M A;  1KBL A;  4D8K A; 
#chains in the Genus database with same CATH homology
 2QYZ A;  2P84 A;  2OX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...