2QYZA

Crystal structure of the uncharacterized protein ctc02137 from clostridium tetani e88
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
NREVKFRAWDKELNMMVYTKEQTGHIEYNTNPADTINIILNQDDYGYVFMQYTGLKDKNEKEIYEGDIIKKSNRSSNLYEIIYQDSIACFRCKVIKGDIKSFPCLNIGTVRNCEVIGNIYENPELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the uncharacterized protein CTC02137 from Clostridium tetani E88.
rcsb
source organism Clostridium tetani e88
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.290 Mainly Beta Roll SH3 type barrels. YopX-like domains 2qyzA02
3.30.1490.160 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ctc02137 like domains 2qyzA01
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH superfamily
2JW4A 2CZ7B 4PJLA 5KFOA 1NPPA 1RK5A 3OA6A 1KJ9A 4LF8H 4FIBA 1GFDA 4MV8A 4XYMB 3BAAA 4BDZA 3WVEB 2W6QA 2FPDA 1KC8U 3T5JA 4ETSA 4DL2A 3ASKA 1CS0A 1EIFA 3LH5A 5GMKi 2GGRA 4PL6A 1JO8A 2RF0A 3A8HB 1VQKA 2V1QA 3KHLA 3E9FA 1GSAA 2E6NA 1H641 2LQ8A 3E19A 4RB2C 4CC4B 2UUBH 2NUPB 4M7AG 3G6ET 4BB7A 2CP0A 3OSVA 1VBGA 1ZLMA 3I56Q 3CC2Q 2VPSA 1DV2A 2JMAA 2HBWA 3IQLA 2OTLQ 2RK1A 4J9EA 5A2QE 1Q7YR 1BYMA 3JSLA 1OX8A 2K6DA 1Y71A 4C8QA 1WX6A 1RI9A 2DXUA 1PHTA 3REAB 4J0MA 3H41A 2K9GA 3TREA 4ED2A 4HA8A 4JUZA 2RGRA 3VPBA 4DQ2A 2JEFA 2KYBA 4OB1B 1KJJA 4HNTA 3RR6A 3QYHB 3RJ0A 2DYIA 3JCMh 4Q8EA 3Q8SB 4JS5A 2NU7B 5EDWA 1AWWA 1IOVA 3A8GB 4O3NA 3WO1A 3TQ1A 1AZEA 2R92A 3LX7A 3CPFA 4F7UA 3PO2G 1OZ3A 2J6KA 3JB9H 2WAQE 2KT1A 3JCMf 5LJ5d 2BQ3A 5LJ5e 1VQLA 1E4EA 2GFUA 2YHTA 1JXMA 2EW3A 1S72Q 1TTHB 2JVVA 2O9SA 1ZX6A 3PMIA 1S9FA 1UHFA 2EGEA 3CVZA 2LX9A 3VUZA 4RTTA 2K7AA 4M78G 4IAJA 2R8KA 4LH7A 3FKIG 3MWMA 4E7IA 3JCMX 4O4HF 1M5Q1 5CKEA 2J7IA 2KR3A 4LUDA 1M2OA 3PVXA 2D0NA 1HXDA 3EFSA 2D8JA 1I1JA 2E2IA 2DPPB 1BGWA 3KBGA 2KMTA 5DG7A 5IT9E 4B3RH 2JA5A 2KGTA 2YS7A 3RIZA 2GCXA 1FWZA 2YUNA 1WI7A 2ZZDA 4Z89A 3MKDA 2FK3A 2DD5A 4ECVA 1S0NA 3SE7A 4UCOA 2FMAA 1P92A 5LJ5j 4R8UB 3RESA 3T1YH 4ELZC 2RI2A 4A4GA 1K8AU 4J9RA 2DIQA 1UJYA 2EFIA 1K1SA 1D3BB 2W10A 5IN1A 4A4FA 2DLNA 2DJZA 4YP3A 5KFXA 4DV7H 1GFCA 4KUDK 1A9XA 2EQIA 1TWCA 3I9QA 1UJ0A 4IIMA 3N41B 2LCSA 3I55Q 2RHZA 3BABA 3AYHB 3KXYT 3KUFA 4JRKA 1VQ7Q 3R5XA 1NLOC 4ME7A 4JV5H 4EMKB 2XKOC 1SHGA 4YHHH 3HTRA 3LLRA 2KDSA 4LDUA 2C2DA 4IR9A 2Y4XA 4C92D 2HJWA 1IREB 4X62H 4JI0H 5A0GA 4GKJH 2KEAA 3S6WA 2DKGA 2JTMA 1QLYA 3OYMA 2ZPFB 1WYXA 5L1IA 1Q86C 1RAGB 1CKAA 5KFPA 4EGJA 4PJOB 2QEXA 3ETJA 1Y1WG 5FPRA 2L5QA 2CW8A 1TWAA 2UXDH 2UXCH 2LJ0A 4HKEA 5FPOA 4ZOLF 2GF7A 2K5LA 4C0DB 1VQ4T 3MR6A 2JUFA 3CBOA 4L6V5 4OGEA 2YS6A 3GOXA 3JB9D 4I55F 2RHIA 2CZGA 2YL2A 2PUKB 3JCMd 2YRVA 1UGPB 3G71T 2LT4A 5KE2A 1EUDB 2VB6A 1S1NA 2PVDB 2KXCA 4ZTFA 5CKFA 2KI7A 2V4QA 1W4SA 4M77D 2W70A 1YIJQ 1QVGA 1H3HA 1I7NA 2EGAA 1AT1B 4Z88A 3I55T 5GJVB 4MV4A 1WA7A 2X0SA 4FW2A 4F4WA 2DO3A 2C06A 3QFFA 3S3MA 2W71A 2ZM6H 1PKTA 1SRMA 1PNJA 1J3TA 2FPPB 4PWQA 2FB7A 4KT0E 1XMOH 1M3BA 3TINA 3PIPA 1VQ7T 5KG5A 4OMOA 3J80E 2DPIA 1VQMQ 4JYAH 4IURA 5ECAA 2PQWA 4DL3A 4J5YA 2R87A 3Q1KA 2EKHA 2NUTA 3WO0A 4C5EA 1W70A 2NVYA 2PVPA 1MMAA 4KGXB 5KFDA 4ZHQF 4J9OA 3QO3A 3CCQQ 1JDEA 4DR6H 4TUYF 5IYCG 4PFZA 2R7MA 3OSPA 2R7ZA 5CQXA 1Q82U 1K9MC 1JEGA 1K8AC 3R23A 3Q8QB 4DR2H 2RO0A 1DV1A 1X6GA 4LSXA 1TUCA 4ED3A 3HFOA 4WCIA 2VUBA 2JA7A 4L59A 4JJCA 3X28B 4C0ZA 3VS3A 3FC3A 5IP7G 2E10A 1ZUKA 4EDUA 1IHVA 4QW9A 1VYUA 3LH0A 4UCVA 1JRIA 1KC7A 4RTXA 3Q2OA 4E7KA 1P8LA 3LMLA 3OQ5A 1B04A 4KBMB 1X6OA 4N0AC 3OTOH 3G6VA 4LFAH 4WBNF 2OTLT 4NXMH 5FRNA 3H20A 3I12A 4DR4H 3RIRA 1XQHA 1X27A 2JA6G 3L2VA 3BDLA 1HJDA 2GFAA 4DUYH 4DL5A 1WXBA 4M4ZA 2XCLA 1SFOA 1QKWA 3QZ9B 2IVWA 3MEAA 5C6SA 1VQ5A 4JZ3A 2I8CA 1X01A 4MA5A 4BE0A 5DG8A 4RG2A 2NVXA 1S97A 2ZGWA 3HRUA 5DY9A 5GAN5 1BXRA 1JQQA 4RAZA 2A3LA 2DYBA 5A0DA 2F5KA 3PN1A 4OMFB 5I22A 2EVRA 3HRTA 2DIKA 4PLIA 1B07A 4XTYA 5FLXE 3MJXA 1KEEA 4GC7A 4GLXA 4EFBA 2LT1A 5KFVA 3QSUA 1KSWA 4PFPA 4M9UA 4FS2A 2EQMA 5GAMj 4XU3A 4R0KA 5JVLA 4JI8H 4JJBA 4J9SA 2RQVA 1Q81U 2NYSA 3JZIA 4AFQC 1MV0B 3J80W 1JIHA 5D7UA 2R7LA 1HD3A 1DGSA 2DFUA 3JCMV 4A4HA 1ZETA 1GBRA 4M77G 4AFSC 2VWFA 3I4MG 3N44B 4IZOA 4ELYC 1VYVA 2E70A 3OYNA 4ATOA 4O3PA 4KHPH 1D1AA 3PR4A 3QHSA 1M2VA 2FEIA 5GAN3 4K11A 4EMKA 2OTLA 1AHJB 4UCRA 4EG0A 4V2SA 3GTQA 1FYNA 1K73C 4RCBA 5IXFA 4IWXA 2AZVA 2RGVA 4OVAA 4E7JA 4UCUA 2P84A 3RDVA 3MCAB 3EG9A 2J6UA 3INZA 2CDTA 2F2XA 2E6ZA 4E7LA 4M7DG 3DF7A 3MEWA 2CH4W 2M1HA 3GIIA 4ECTA 1Y96B 2VUGA 2QQSA 2X4YA 5KG3A 4YR3A 3WXMB 2HVSA 2CZ0B 1Y1WA 1ZBXA 5GAMd 2X3WD 1LCKA 1TWFA 2RF4A 1WHJA 4FSSA 3URGA 1N8RR 1KIKA 4C2MA 1Q86U 2OWOA 3SFMA 3M55A 4OMQA 3M54A 3QG1A 4RUAA 2K3BA 2LRQA 1M1KU 2EYYA 2O2OA 3M57A 5GAN2 2ROTA 1IZ6A 3CPWP 4L5GA 1B34A 5CO7A 3FB9A 3S3OA 3EGXB 2VV5A 1RI0A 1PSEA 4JRQA 3NMZC 4DL7A 1UNNC 1HYOA 5LOVF 4TQRA 2DVJA 4LNPA 2PZ1A 3V7CA 1Q81R 2EBPA 1S68A 2OJ2A 7AT1B 2QA4Q 2EQUA 2R93A 3OYEA 1WHMA 5AYFA 2BZYA 4DOVA 5DQGA 2J6SA 2D9TA 4DR3H 4EEQA 5KT5A 1AEYA 4Q44A 3JB9F 1IBMH 1KJIA 4FS1A 4EYIB 1IOWA 3H3VH 1VQ4A 4IUUA 1WPYA 2QQBA 5GAOp 2ATLA 2ZPGB 2LNVA 1KQSS 1PC0A 4F7UB 3QJYA 3CXCS 1BI3A 1RUWA 4M78B 3ZL7C 1JX4A 3RFCA 4M7EA 1TG0A 2K2MA 1G3SA 4Q43A 2RJFA 1OI1A 3EG9B 2P0PA 3BQ0A 3VS2A 3TEEA 1UC8A 2W7PA 1VA7A 4LE9A 1VQPA 2C22A 1WIEA 2R5AA 2XG8D 3UPUA 2RH2A 5LA6F 2V8JA 4PFOA 4C8QD 1QW1A 4YJ3F 2A28A 3G8CA 1M1GA 3GPLA 2J6TA 4C8QB 4YAKB 3L1AA 3RUXA 2FL7A 2LVMA 2G3RA 4MV7A 4DLKA 4C5HA 1A0NB 2DERA 1RYSA 2A08A 4M75A 2E5QA 4XZ3B 2GBQA 3TQTA 2AU0A 4BY1G 3M56A 2PVGB 1WXTA 2YDLA 5KYYA 1HNWH 3CCRQ 2HVQA 2RDJA 3RB6A 2C28A 4NL2A 1KJQA 1MNDA 3PW5A 4LSAA 2RQTA 5KYXA 3U23A 5KFCA 1NJIU 2ZAEA 4PJJA 4CC2A 2I80A 5CA1F 2BE9B 2I0NA 3CBMA 4JI7H 5CR2A 4F14A 1V4YA 2DBMA 2PU9B 3CMAA 2K5FA 1X9NA 4LFCH 2UXBH 3TCJA 2KSSA 1K0SA 4BWSC 1BIBA 4RNNA 1LPLA 1WJSA 2EQJA 2EIFA 2CW7A 3GV7B 3GIQA 4UC4A 3V4ZA 4RB3C 1Y7XA 4QWEA 4F04B 2FG0A 2DM1A 5JH7F 3VRYA 3CCLA 2O88A 4A63B 3CCVA 3RGZA 3CD6A 3KHHA 2L3RA 4P5NA 5HCKA 3VYHB 4OX9H 1CSKA 3VRZA 4II1A 3CCSA 4C5IA 2CSIA 3I56T 3CC2T 1QCNA 2LTOA 4RG8A 3CMAQ 3CCJT 5T14A 3UA7A 3CC7A 1HR0H 2B63G 2DZ9A 2FLNA 2VXEA 3DB3A 3TQ7P 1XMQH 2XDPA 2FKLA 4ED6A 2XK0A 4C8QF 4A3IG 1NLPC 5BR8H 3JB9G 4QVCA 3C0CA 2W6NA 2DWCA 1V29B 1YITQ 1CE8A 1EFNA 4X64H 3RV4A 1Z2PX 4A3DG 3A8MB 2KBTA 2P4TA 2KAFA 2ATCB 1ZHIA 1ZSZA 4J9MA 1TWBA 2W6OA 3ZBDA 5L1LA 3HRSA 2XMFA 4E6RA 2WTFA 4M78E 1DIKA 4OMNA 2DXCA 4JZ4A 3CC7T 1JKJB 2DPJA 2NUTB 2C0IA 3M9OB 3MR2A 4A3LG 3UATA 1I81A 3OS1A 3MWEA 4C5BA 1KD1C 2D1XA 3X26B 2YRDA 4M75E 5GAN4 4N4GA 2BQRA 3CCST 1YIJT 3HFNA 3QWYA 2YW2A 1VIEA 4ECRA 5KT6A 2V58A 1WHHA 1ZA1B 2FPEA 2M05A 3QDRB 5A0LA 5KYYB 5L1JA 1VUBA 4G3IA 3CCLT 4EFEA 1VQKT 2DAQA 2NWMA 2QAZA 2OAWA 3SWNB 3GIPA 5KKNB 3L2UA 4GBQA 3VS0A 5GAN7 3H0HA 2V5AA 4Q0YA 3UA6A 4PLLA 4XYLB 3M9MB 3WNZA 5JUMA 2LJ1A 1ZSZC 4KH1B 3TIIA 5C3EG 4RUGA 2X3XD 8AT1B 3TSWA 2FK1A 4ZGJB 3Q8PB 3UDCA 3BW1A 3HL8A 4HCZA 4F4XA 4HYKA 2CZ6B 2UVUA 2CUDA 4RTZA 3LWIA 2MK5A 5LYJF 1X69A 3GNGA 4O4LF 2QXFA 3NTKA 1E6GA 1VQOQ 1AWOA 4A3KG 1PK8A 5LJ5h 3T5KA 4ZN1A 3RGXA 2IA6A 1NBEB 1YCSB 2JS0A 5C44G 2DX1A 2F2VA 2J9GA 3HB9A 2FZKB 1RJQA 2QK4A 4IRCA 3I35A 2Q2UA 2GQVA 1KHIA 5IHKA 1VQ9Q 2Z0WA 2JTFA 1GRIA 4QKUA 2FO0A 4IRKA 4L1KA 1VBHA 1YI2Q 4QW2A 2UUCH 2HNIA 1UGRB 1H3ZA 1UEBA 1D09B 2GTOA 2YUOA 4DL4A 3BFMA 1VQPT 2V9WA 4X9CA 2W6PA 4A3GG 4DR1H 4RTYA 1DJ7B 2ESWA 4BE2A 3OMCA 4JRIA 4U6PA 3NTIA 2W9CB 4WF2A 4N4HA 4AT1B 2XDDA 2ROLA 3EG0A 3PVLA 1KC8R 3VPCA 1BI0A 2LNHB 1WQWA 1GLVA 2RM4A 2HVRA 1SG5A 1AWXA 3OYCA 1N8RC 4R8UA 2OLSA 5D1PA 4FT2A 4EMGA 4DA4A 4BXXG 1EYZA 4J9HA 3PZPA 2YZGA 4MV1A 1YJWT 5KH6A 3RV3A 1PSFA 3JCMJ 3QIIA 4C92F 1VQ8A 1MV3A 5KFUA 5A2QW 3R5HA 3V4SA 1T0HA 2DL7A 5HV6A 2FK2A 3K5HA 1YN8A 3RERA 4YBZB 1SF9A 2E64A 1W96A 3PW7A 1N5ZA 4CRIA 4HNUA 5FWBA 5LXTF 2QDLA 1BB9A 1KQ2A 4QQ6A 4J6XA 4IUPA 2EYQA 3RMQA 4AFUC 5CKDA 4QW8A 4J9FA 3G7ZA 2DRKA 3L42A 3QJ6A 2V59A 3L4JA 3RAQA 3DLMA 2LZ6B 1ZBJA 4QT7A 2C00A 3CPWS 3L2QA 2ECZA 4CC5A 3CCQA 2YRWA 5D1OB 3LP8A 4BI3A 3CCET 1I5LA 3OBYA 3EYYA 5AT1B 4OGCA 1UGSB 2DIGA 3X25B 2LCCA 3A8LB 8ATCB 2PMZE 1KBLA 4PKCC 4M78D 4AG1C 3QZ7A 3JSCA 4OMLA 1Y1VA 4DBFA 4JI4H 5GJWB 1TXQA 4AFZC 4JI2H 1YWPA 3J81W 5J3BA 3U9SA 3CQTA 3PW4A 1RAAB 1R0BG 4FU6A 1G3YA 2XIGA 4OMMA 4RU9A 1B3QA 4XAXB 3GV5B 2RDIA 1QVPA 3QYGB 1FMVA 2RHUA 2CGHA 4GLMA 4C92B 4I4TF 5KT2A 2QGFB 1N8RU 2E5LH 1ULZA 2YSQA 3E1SA 3CCEA 3OYHA 3PT9A 3G6YA 1IO6A 4J6YA 2IG0A 1WFWA 3OW2A 4C92A 2WB1A 3KAKA 4ECUA 2SCUB 1XNRH 3RB4A 3VV0A 2XCPA 3M0SA 4FBTA 3CD6Q 2HCKA 3OYYA 3M4GA 5J2TF 1M90C 1S10A 2D8HA 1WGSA 3VU3C 4HCBA 4LD9K 2ZJTA 1N32H 4EMHA 2BTTA 1RJRA 4A3EG 4JJDA 4C8QG 1WLPB 2XGQA 2YLCA 1S03G 4QVZA 2P0KA 4YB8B 5EOYA 2QQRA 1VQ8T 3M58A 3M5AA 5FW9A 3IN5A 5L9XA 1I50A 2WE6A 2MMPA 1YJWA 2OTJT 1CQJB 5KFGA 6AT1B 2JXBA 2FZCB 2M0OA 4RTUA 5GANf 2ASDA 4ECQA 3HSBA 2JA5G 4LF4H 1NYFA 2DEUA 1VQKQ 3CCRA 4IKFA 5DLGA 1YI2A 3GQCA 4DR5H 2HKNA 2R92G 2X9HA 5GMKm 2EKOA 5GAMg 3N40P 4X66H 5DG9A 4MDXA 5FU6C 2V8KA 2L89A 3BQ2A 2YZMA 1X2QA 1K73R 3JAME 1MMGA 3C95A 3A1PA 2V26A 5LJ3j 2FLPA 4JUVA 2CREA 5K2MA 3BA8A 2R8IA 4YTLA 3M0UA 2VVKA 4DBRA 3CCUT 3OY9A 1LNXA 5IYZF 2UVVA 2GQIA 2YUQA 3ETHA 4RKUE 1KC8C 3REBB 4Y92A 1V51A 2CYZB 1ZSGA 2CUBA 2IMWP 5LJ5g 5KFJA 1W93A 4Q8FA 5CKHA 1KFZA 4M77B 3ULRB 3FIFA 2NUZA 1U3OA 4KGZB 4F4YA 4LN2A 2DL4A 1VAJA 2HDAA 4NS5A 2HSPA 1X6BA 4M78F 5KFAA 5GAOn 3ORQA 1JXLA 2DILA 1IRXA 4ZTJA 3GTOA 4N0AA 2P0QA 5KFSA 1SKUB 5IXBA 5FWCA 1Z2NX 5LL6S 4DEYA 2MAMA 1M3CA 3F70A 2ZPBB 3JCMP 1ZA2B 2ZDQA 2V1RA 1HNZH 1UFFA 1YCYA 4KGVB 2Y0SE 1I8FA 1I7LA 4JPBW 1BIAA 3RKYA 1TOVA 2DF6A 4CI0C 1YWOA 2R84A 1BJTA 4FYWB 4M7DF 1VQNT 5LJ3h 3X20B 2HKQB 2X51A 5KFWA 2K4YA 2O03A 1KQ1A 4XTUA 2DK3A 1U1SA 4C0FA 3THKA 4C92C 2RK2A 3JB9I 3N5BB 1G3WA 3HKZE 4EYHB 2H3JA 2R5MA 1X2KA 3GF5A 2RMOA 4FL6A 2QEXT 1YIJA 4DV0H 2B63A 2HQXA 1K76A 2NU8B 3U9TA 4QWBA 2KNBB 4C5CA 1TWGA 1JLLB 3OS0A 5C1OA 1D0XA 5C1PA 2AHJB 1D3BA 4IUVA 3JCMg 1U1TA 4YQWA 4ECSA 2BUDA 3LWHA 4IUQA 5D6XA 3DLLA 3AHUA 4C92G 1SHFA 2OAUA 4ED0A 5GAN6 3MP6A 3PE0A 5CQYA 5KFYA 4XTZA 2VQEH 1PRMC 2JA6A 3RMSA 1RK6A 4RZRA 2F4VH 2UUAH 4BE1A 1NJIC 3CCEQ 5J2UF 1M6VA 2BZXA 2QTXA 4PJOC 1X43A 3OYKA 4B3SH 2R6FA 3GLKA 4A3BG 2XIDA 3CCJA 1KG1A 3JRXA 4EBEA 3I56A 3CC2A 1EX4A 3H0GG 4I7HA 2R8GA 2KY9A 2GLTA 2YRCA 4OB2B 1S0OA 1YJ9T 3GNFB 1EZZB 1TSFA 2RB6A 4Y91A 3CCMT 5KFIA 1ZHQA 2FVUA 1JJ2S 3X24B 4LDXA 3OUZA 2K57A 3CD6T 1RAIB 1ZUYA 2R57A 3CCVT 1AUVA 2K3XA 5L23A 2KXDA 4A54A 1VOMA 2WSCE 2MYSA 4TVRA 3T5HA 1RJPA 4OB3B 3QZ8A 2VKNA 4M78C 3EG1A 4ECZA 4DV3H 4ME6A 5M9OA 2HQEA 3KHGA 4OF1A 1K9MR 3TVTA 1N36H 3I4NG 3QBYA 1I6UA 5C0MA 1QVFP 2O9VA 4PJOE 4HNVA 4ED7A 2F69A 3CMAT 3SI8A 2FRYA 2DEQA 1OV3A 3CCMA 3OYDA 1YJ9A 2RNAA 5KG0A 1U5SA 1NEBA 1JJ2A 3CPWA 1XNQH 3EFOB 5GAN8 2H3EB 1BCMA 5IHNA 4AG2C 3OYAA 1OU9A 1VQLT 3GTLA 3UWNA 3RKXA 3T5LA 5KFZA 2R58A 2R86A 2MWPA 3FDSA 5DQHA 1PD0A 4YJ2F 2I2LA 2MWOA 2YYAA 1IXDA 3QXEB 2DBKA 4LDYA 4LF6H 1WDXA 3CBPA 1SEIA 2GPWA 2LQNA 1FMWA 4RB0A 1N33H 1IHWA 2F2WA 5KYNA 2J6FA 2Y0SA 3T1HH 3O8VA 2GPSA 4MZTA 5I21A 4OMPA 3V6KA 5JVDF 2P4RA 4FBUA 3EH2A 2V8IA 5CVIA 1R8OB 1WJRA 1QVFS 3CCSQ 2VGNA 2C2RA 2AKLA 4X9DA 4R56A 1Q7YC 4MMLA 1M1KC 2E1HA 4MV9A 1NG2A 4J8OA 3ZEHA 2VA3A 5KFNA 1OYXA 2HZYA 5KFRA 4BI4A 4QQGA 4ZNXA 2EYWA 3J81E 2W8LA 3MJFA 5F9LA 3JRWA 3RTXA 2VA2A 4LD6A 3G6EA 1OU8A 2NU6B 1JU5C 1UE9A 2WSFE 1YJWQ 3MFHA 1IGQA 4TQSA 4J9LA 1D0YA 4ECWA 3EFOA 4TV9F 2RHXA 1YITT 1NYGA 3KTMA 4J9CA 1SPKA 2COYA 2R93G 1VQNA 1GL5A 3OS2A 4ORZA 3IG0A 2JOYA 3V7RA 4D8KA 4BDYA 1RACB 3CMEQ 1SCUB 4EIKA 1Q82C 1K9MU 2QI2A 3VPDA 3E2UA 4XU0A 3VMMA 2K2VA 3L4KA 2C35B 3VS4A 1YHQQ 3R6OA 2L3QA 2KSWA 3HBLA 1KD1R 1KQSA 2D6FA 1RLQC 5LP6F 4DL6A 1VQ6Q 4AQYH 1ARKA 3HKZA 2LJ3A 5I2SA 3GILA 5IWAH 2DNUA 3Q1JA 4BUGA 1QWFA 4CC7A 3OS5A 4JLGA 2L3PA 3H9NA 3RB0A 2QEXQ 3OYIA 3UFXB 2DMOA 1XTDA 4BY7G 5KFQA 3GV8B 1O75A 4PK4A 3EH1A 2AGQA 1Q95G 2W9BA 1Y1VG 2VPQA 3NGDA 2CP5A 1AVZC 2EJGA 4HVVA 3CCUA 1U8RA 1TU0B 2QQAA 1ZQ1A 3OW2S 5FJ8G 5I47A 1B34B 2W7OA 5EG2A 1QCFA 2YT6A 1WCMA 4RCCA 1BK2A 2CZ1B 4J9BA 3CCMQ 1JJ2P 4QWDA 4PJNA 3V7SA 3UQ8A 4KH0B 4DV6H 4BBRG 1TUDA 5LJ3e 4RTWA 3CMET 3FDRA 3JCMc 2FJZA 3LW5E 3LGFA 1GCPA 1Q7YU 1VQ9T 1YJ9Q 5GAOl 1T0JA 3EPGA 1AUXA 1RLPC 5D8DA 2GTJA 5H80A 1AN7A 5KFBA 4F16A 1VQMT 4M75D 3E9GA 2PTKA 2CT3A 2E65A 1T3LA 4QIWA 1FMKA 2QQ9A 5LJ3f 2QA4A 3BA9A 5HK0A 2DE0X 4MV3A 4LDVA 4J9DA 1JBMA 3QUIA 1VQLQ 2R7KA 2MF2A 4DV1H 2EQKA 3VJPA 1YJNQ 2LMJA 4JRPA 3GIBA 1BBZA 1QWEA 4RNMA 3I5SA 3V6HA 2KYMA 5CIUA 3VS5A 3L2ZA 1GBQA 1WHLA 4NXNH 3R6NA 4A93G 5EZYF 1S72A 4OP0A 2X35A 1K73U 2EYZA 2BZ8A 2DZCA 4J9IA 3CCLQ 4RTVA 2XD4A 1I3QA 1SRLA 2IBKA 4M7AA 4M7AB 5GAMh 3OBWA 4PJOG 3H0FA 3FJ5A 2VOBA 5GAMf 2JS2A 1KJWA 1YBYA 4CC3A 4M77E 2SRCA 2VUMA 2LX7A 3M0QA 2VR1A 3JB9J 5EWFA 1HNXH 1PX2A 1ZSZB 2ZPEB 1OZ2A 1QQJA 2MCTA 3GIJA 5GAOr 4EBDA 5DLFA 2ASLA 2C2EA 3LWBA 1SSFA 3QKJA 2FRWA 2X4XA 4M75F 5GMKh 1T36A 1I0CA 1Y07A 4C92E 2WB1E 5KG6A 1FX7A 4J9GA 1ZHSA 2XC9A 2EJ9A 3HOWG 2JN0A 1U06A 2DRMA 1B7TA 4LMYA 1K8AR 3CCQT 4O3OA 2E4HA 1EZ1A 2RI3A 4M7DC 3HOZG 5KCHA 2D0QB 4ANJA 3LYIA 2ENMA 5FU7C 3VUBA 2NU9B 2JEGA 4M7DE 3VKIA 1AD5A 3EG2A 3JCMQ 1VQOA 4A3CG 1VQ7A 4PJOD 5J26A 2CP6A 3A5ZB 5GANh 3L2WA 1A0IA 4IWYA 4GLKA 1ABQA 1M8MA 2Q2TA 1WHGA 1M3AA 1VQ6T 3UF4A 5KFTA 1VQ6A 1T3NA 1M0WA 2KRSA 2RQWA 2MIOA 4HQ6A 2B86A 5LMNH 4Q5WA 5CAEB 1MHNA 1Z9QA 2VASA 2RHYA 1GGOA 3H4BA 2BR0A 3R5FA 3D7SB 2VXFA 2J6OA 5GMKj 1TA8A 1Z2OX 2CS7A 4DV2H 2YCHA 2KT8A 4J83A 1RADB 4I50F 1OOTA 5LJ3d 3G4ST 4ED8A 2M16A 3PR5B 4EBCA 5KG4A 2AZSA 2NUAB 5DQIA 2R7NA 1NZ9A 3OYLA 2L0AA 4BD3A 5GAOm 3ORRA 1WCMG 2CP7A 4RB1A 1OULA 1UECA 4M75B 3OYFA 3RF2A 4BI8B 4ZQIA 5IH2A 2FLLA 4R55A 2NUPA 3RKWA 1NEGA 5IT9W 5FLXW 2CH4A 2KQWA 4B9WA 3GP8A 4J9PA 3OMGA 2AGPA 2E3HA 3OSSC 3META 1HK9A 1W1FA 1S72T 3CCVQ 1BU1A 3T9NA 4FT4A 4F7UE 3RUPA 4EEYA 2RD1A 4E47A 1TS9A 2K5IA 4F17A 1M90U 4ED1A 4FYXB 5DGAA 1GSHA 4PDBA 1M4ZA 5KYUA 4BACA 1C1AA 3P8HA 4MZMA 4M78A 5KFEA 2JEIA 2EPDA 3FJPA 4R7RA 5KFKA 2O01E 2COWA 3H8ZA 5GAOq 4D6WA 3N42B 4O3SA 5D1OA 2WYOA 2QA4T 5GONF 1LVKA 4J7FA 4RZQA 2YXYA 3QPHA 4FSXA 3HOVG 2F1LA 4JI1H 2DLPA 1KJ8A 1AWJA 1PM3A 2BE7D 2W0ZA 1WJQA 4MTEA 1K83A 2COZA 4QQDA 3GTJA 3PMTA 1VQ9A 2HAXA 2WACA 3AT1B 3FEOA 3MP8A 4DOWA 2DETA 1VQNQ 1YHQA 2YU9A 3EGDA 1ACMB 2DL8A 3ZFJA 3JCMW 3OHBA 1G83A 4RNOA 3CMEA 2XU8A 5BPFA 4MAMA 2HEQA 2A36A 5CA0F 1WSCA 1N9RA 4M7AD 4A2AA 3MFIA 5L1KA 1N9SA 2ZDGA 1T94A 1D1BA 3C94A 4O6JA 2YLBA 2W9AA 2B8AA 2PMZA 1YNZA 4IUTA 4YR0A 3H4DA 1D0ZA 3V8JA 4M7AC 4NL3A 1UGVA 2X4JA 2R8JA 1ABOA 3O5ZA 1Y96A 2YWWA 3QDFA 5LL6b 2JEJA 4C0GA 2LDMA 3OB9A 1NM7A 3RBDA 4O4IF 5BMVF 5I2MA 1FKAH 4M7DD 4CC6A 1I4K1 2UVWA 3CXCA 1MNEA 2L3SA 4FYYB 3WVDB 4M75C 4MZPA 1PRLC 1E6HA 3SWNC 1K1QA 5IYBG 1QKXA 1OX9A 1UB4A 1M90R 3G6XA 1I5OB 2QASA 2HD0A 2R82A 4E4TA 1M2VB 4DBQA 3MR5A 3GIMA 2A37A 1IBLH 1R9TA 4X1VA 3FRNA 2E5KA 2XGPA 2PBZA 5FU6B 3M53A 1IBKH 1N27A 3BQ1A 4JV2A 1JXOA 1X75C 2W8KA 5I11A 3RBEA 2ED1A 2AK5A 2MCNA 3SEMA 3VYGA 4XU2A 3OYBA 4HT8A 4ZGDB 4K0KH 1VYTA 1K9AA 2DXBA 1K1ZA 1LJOA 1YITA 1NJIR 2KVQG 5KFLA 3G71Q 1W2BA 1UHCA 3P8BB 3GTPA 2RN8A 4XTWA 1VQ8Q 4AMCA 4M7AF 3M59A 4M77F 2GNCA 5BPHA 1OWTA 2FE3A 3VS7A 1Q86R 4IRDA 4PJOF 2KK4A 1BNCA 3TSZA 4LUEA 1RL2A 1BI2A 4Z8AA 2CQYA 4C8QE 1RYRA 5C8YF 5GANd 1IB8A 5C5JA 1T3SA 2SEMA 3PTAA 5IP9G 2R7ZG 2PUOB 4MTDA 4JV1A 1VIFA 3KXTA 1G8XA 3GIDA 3SHWA 3JCMb 2A0FB 3V8KA 3RB3A 5EC7A 1ZQ7A 2JA7G 1KHCA 3TIGA 4D8DA 5GANj 3GTMA 1GO3E 2AQ4A 4RUCA 3NHNA 1YJNT 4JDSA 4O3QA 4NLGA 2E41A 4XTXA 4A3JG 1WXUA 4MMKA 2W6MA 1TWHA 1C0MA 2H8HA 4Z02A 2Y4YA 2XDBA 2YZNA 5LMUH 3JCMe 2RI5A 3N8DA 2ASJA 2ED0A 4EMKC 3PVQA 3G4SQ 2KROA 3HOUG 3F8NA 1OQKA 2HL3A 2VYTA 3NPFA 5L8RE 2DD4A 2M51A 2X4WA 5J39A 5FLMG 1V76A 5DLOA 2LC4A 5D6YA 4E7ZA 2EAYA 5FU7B 1UC9A 1M8VA 3GTGA 3A98A 3BE3A 2MOXA 3HP9A 1N34H 4O5VA 1QP3A 3MR3A 3L2PA 1PWTA 1VQ5Q 2JNGA 1K4US 2JJ9A 3M4IA 4FW1A 1QVGP 1RAFB 1QP2A 3MO8A 2IP4A 1B6RA 2EYXA 2OH2A 4HT9A 2G6FX 5KYWB 2P0AA 4LFBH 1XNIA 1E7OA 4A3FG 1MGQA 2HBPA 4J9QA 1MMDA 5KG2A 1N6AA 2FB9A 5HK3A 3SDZA 1MZBA 4LXCA 1PG5B 3PFSA 2JM8A 1QVGS 4KRTA 4FYVB 1F1BB 1M9SA 5IAYA 4VUBA 3CC4T 3VS1A 4HR7A 1MMNA 3C4SA 3P8DA 1JB0E 3PNWC 1RABB 1C3OA 1QCOA 2AGOA 1Y0MA 3S3NA 2FPFA 3A8OB 4B9XA 4AYBA 1TH7A 5KYXB 2RQUA 1L2ZA 4PJOA 5FRMA 2JMCA 3OHAA 3H0IA 4FCYA 1JDBB 1Z9ZA 1WR2A 3PIOA 2XCAA 1W2BP 1SSHA 2JTEA 2RJDA 3DB4A 4DV4H 3GTKA 2FHDA 1LOJA 1PKSA 2O4XB 3PW2A 2QK0A 3M0RA 3KHRA 2BQUA 3HHTB 2XICA 3OYJA 4M7DA 2LP5A 2QG9B 4HXJA 4BY6C 1YP5A 1VKZA 5KFFA 5FD5A 1M1FA 4IHJF 4QWCA 4GY5A 4YR2A 4HVUA 3M4YA 3UT1A 3I5RA 3H0GA 4ZGEB 1IGUA 4N4IA 5GMKl 2R85A 4A2BA 1WZOA 1HSQA 4U7CA 1YHQT 1BCOA 5CKBA 4DUZH 2ZPIB 4E7SA 3MWDA 4A3MG 1PD1A 5KT7A 2VC8A 1VQ4Q 5GANe 5DM7R 4M75G 3EGUA 4LH6A 3CC4Q 5C4XG 3HOYG 4GC6A 5HKCA 4DBHA 3NTHA 2E2HA 4E7HA 1B33N 2M9UA 1XJWB 4O2AF 3HOXG 4QWAA 2RPNA 2FYKA 2YRXA 1TAEA 4M7AE 1S0MA 4WD3A 4M7DB 5HBRB 1WHKA 2HL5C 1GYFA 5CK9A 2PN1A 2CP2A 2R8HA 3V8LA 3CQZA 3FLGA 4B6MA 1V1CA 1M1KR 2C0OA 4IIOA 2HMAA 3FMAA 3GLXA 2KRMA 4MA0A 2WSEE 2RJCA 3OUUA 1UG1A 4EPCA 1W2BS 1AOJA 2M02A 1M30A 5KG1A 3OSNA 1VQ5T 1H92A 3QZ5B 2E3IA 2FP4B 2M0YA 5CCAA 4WTOB 1XOVA 3DKMA 3EGXA 2VQFH 4RMOA 1RAEB 2KE9A 4ZN3A 3G1JA 3NGPA 1M27C 4DEXA 4LF5H 2ALZA 2FPGB 2QTVA 4F7UG 4BY6B 1WQ7A 4O3RA 3BJYA 2AKKA 4LDWA 4MV6A 2CKKA 4XTVA 3EPIA 1EUCB 3BDUA 4J6WA 4JI6H 3M9QA 1E4EB 2RA2A 4M77C 1K0XA 1UDLA 2W57A 2JM9A 2HGSA 4Y8VB 3BG5A 4LF9H 3EG3A 2DTIA 2MI6A 2DZDA 2IPOB 3OYGA 3EHQA 2DJQA 1ZUUA 5KYWA 5KX5F 5DGBA 1I07A 1V9PA 5GAMe 3KAJA 1CKBA 1GXIE 2V4RA 5DLQE 3J7AF 4Q45A 3G4SA 2EJFA 2ZCFB 4O2BF 2DL5A 1YI2T 3HPWA 3CCRT 1Q82R 4XX0B 1J5EH 2CP3A 4ESRA 5GANg 3MHXA 2HQHA 1AZGB 3MEVA 2K3YA 4RAYA 2ZPHB 1KD1U 1BKBA 5EWGA 3NFCA 2JZ2A 2OTJA 1G2BA 2O31A 2CKZB 1O9SA 2K79A 2AT1B 3H40A 2W6ZA 2OX7A 4FU0A 4F7UF 3CXCP 4BBSG 1M0TA 1MUZA 4PJMA 4HCCA 1QVFA 2IIMA 2NLUA 3SB2A 3V6JA 4DR7H 4PNOA 4C0DC 2DXTA 1M7JA 3I55A 4QJFA 3PO3G 4XQ3A 1R0CB 4J9KA 2E12A 1UUEA 5EWEA 2BKDN 2VQDA 2Y90A 2L8DA 1VQOT 1YFNA 1I94H 1G5VA 3Q8RB 2J05A 2XD0A 1GCQC 2MPXC 4JI3H 1G3TA 3G71A 2ABLA 1XDNA 2KRNA 1SYXB 2L2PA 3GBQA 2W9CA 3M9NB 1GCQA 2OTJQ 2OI3A 2LQWA 4FM9A 4NOYA 3EFRA 3K5IA 1OPKA 3JSNA 1Y57A 1C6VX 2AIRB 3KFVA 1KQSP 4B3TH 5IHIA 4QIWE 5D6WA 2EWNA 2CT4A 3C12A 3RBBB 3RNJA 5IYDG 2DVEA 5GMKe 3MEUA 3SD4A 4Y28E 2WDTA 3CCUQ 1D1CA 1NPRA 4JLIA 3RAXA 4UFZA 4ZI7F 3GIKA 4XK8E 1FJGH 5KYUB 1E4GT 4XU1A 1WH2A 1R77A 2I87A 2FZGB 5LJ5f 3KALA 3EHRA 4HVWA 2F5TX 3CC7Q 4APMA 3J7AK 1FXXA 2PVOB 3HXLA 1KK7A 4J7IA 4QVDA 4UCTA 4F50A 1OPLA 3H6ZA 4A4EA 1QMCA 3CC4A 3ME9A 5F9NA 4UCSA 4C8QC 4JI5H 3PGGA 1OEBA 5KG7A 2PNIA 2DL3A 3JV3A 4HCKA 4OB0B 3C0FB 4ECYA 5HY6A 3FKIA 2HHHH 2WAQA 3VS6A 2O4XA 2XHCA 4A53A 4E2FB 2J06A 3G6EQ 5KFHA 2UVRA 4TV8F 4F4ZA 3SWNA 1C30A 2JA8G 1VQMA 1E4FT 5KT4A 4MDWA 3E5NA 1N48A 3MPUB 2DA9A 2JT4A 4J9NA 1WNLA 1TUGB 4JV0A 2BIVA 2C0TA 5CB4F 4A4KA 1Y14B 3JRZA 1CQIB 1UGQB 1PCXA 3LGLA 4KUIA 3PW0A 1RAHB 3CEYA 5FD6A 3BY7A 5FROA 1VS0A 4ECXA 2W9BB 1W6XA 4M77A 2DTHA 4AYBE 4JS4A 4C5AA 1SEMA 2FPIB 5KE3A 4GKKH 2LCLA 1GSOA 2YUPA 2CSQA 2ZDHA 3N6XA 2RJEA 1UTIA 2EGCA 3EAEA 1B6SA 4C5GA 3JAMW 1Q81C 5JQWA 2UU9H 2A7YA 1FVIA 3M0TA 4DV5H 4B3MH 2QYZA 3ER0A 2DTOA 1YJNA 3OW2P 3TU4K 3EGDB 1VQPQ 5CAIA 5KFMA 1EHIA 2QGGA 1N56A 3L2RA 4YY3H 4X65H 2RQRA 4X34A 4JJNK 3K3PA 5KCOA 2XI9A 3M0PA 3N43B 4KULA 3K3VA 1NE8A 2QDYB 2LQKA 3QWXX 1H8KA 4EGQA 5LJ3g 1BI1A 4IR1A 4LF7H 3HKSA 4FM4B 4YAJB 2VGMA 3MP1A 9ATCB 2VUMG 3CCJQ 2HSEB 5KT3A
chains in the Genus database with same CATH topology
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYZ A;  2P84 A;  2OX7 A; 
#chains in the Genus database with same CATH topology
 2JW4 A;  2CZ7 B;  4PJL A;  5KFO A;  1NPP A;  1RK5 A;  3OA6 A;  1KJ9 A;  4LF8 H;  4FIB A;  1GFD A;  4MV8 A;  4XYM B;  3BAA A;  4BDZ A;  3WVE B;  2W6Q A;  2FPD A;  1KC8 U;  3T5J A;  4ETS A;  4DL2 A;  3ASK A;  1CS0 A;  1EIF A;  3LH5 A;  5GMK i;  2GGR A;  4PL6 A;  1JO8 A;  2RF0 A;  3A8H B;  1VQK A;  2V1Q A;  3KHL A;  3E9F A;  1GSA A;  2E6N A;  1H64 1;  2LQ8 A;  3E19 A;  4RB2 C;  4CC4 B;  2UUB H;  2NUP B;  4M7A G;  3G6E T;  4BB7 A;  2CP0 A;  3OSV A;  1VBG A;  1ZLM A;  3I56 Q;  3CC2 Q;  2VPS A;  1DV2 A;  2JMA A;  2HBW A;  3IQL A;  2OTL Q;  2RK1 A;  4J9E A;  5A2Q E;  1Q7Y R;  1BYM A;  3JSL A;  1OX8 A;  2K6D A;  1Y71 A;  4C8Q A;  1WX6 A;  1RI9 A;  2DXU A;  1PHT A;  3REA B;  4J0M A;  3H41 A;  2K9G A;  3TRE A;  4ED2 A;  4HA8 A;  4JUZ A;  2RGR A;  3VPB A;  4DQ2 A;  2JEF A;  2KYB A;  4OB1 B;  1KJJ A;  4HNT A;  3RR6 A;  3QYH B;  3RJ0 A;  2DYI A;  3JCM h;  4Q8E A;  3Q8S B;  4JS5 A;  2NU7 B;  5EDW A;  1AWW A;  1IOV A;  3A8G B;  4O3N A;  3WO1 A;  3TQ1 A;  1AZE A;  2R92 A;  3LX7 A;  3CPF A;  4F7U A;  3PO2 G;  1OZ3 A;  2J6K A;  3JB9 H;  2WAQ E;  2KT1 A;  3JCM f;  5LJ5 d;  2BQ3 A;  5LJ5 e;  1VQL A;  1E4E A;  2GFU A;  2YHT A;  1JXM A;  2EW3 A;  1S72 Q;  1TTH B;  2JVV A;  2O9S A;  1ZX6 A;  3PMI A;  1S9F A;  1UHF A;  2EGE A;  3CVZ A;  2LX9 A;  3VUZ A;  4RTT A;  2K7A A;  4M78 G;  4IAJ A;  2R8K A;  4LH7 A;  3FKI G;  3MWM A;  4E7I A;  3JCM X;  4O4H F;  1M5Q 1;  5CKE A;  2J7I A;  2KR3 A;  4LUD A;  1M2O A;  3PVX A;  2D0N A;  1HXD A;  3EFS A;  2D8J A;  1I1J A;  2E2I A;  2DPP B;  1BGW A;  3KBG A;  2KMT A;  5DG7 A;  5IT9 E;  4B3R H;  2JA5 A;  2KGT A;  2YS7 A;  3RIZ A;  2GCX A;  1FWZ A;  2YUN A;  1WI7 A;  2ZZD A;  4Z89 A;  3MKD A;  2FK3 A;  2DD5 A;  4ECV A;  1S0N A;  3SE7 A;  4UCO A;  2FMA A;  1P92 A;  5LJ5 j;  4R8U B;  3RES A;  3T1Y H;  4ELZ C;  2RI2 A;  4A4G A;  1K8A U;  4J9R A;  2DIQ A;  1UJY A;  2EFI A;  1K1S A;  1D3B B;  2W10 A;  5IN1 A;  4A4F A;  2DLN A;  2DJZ A;  4YP3 A;  5KFX A;  4DV7 H;  1GFC A;  4KUD K;  1A9X A;  2EQI A;  1TWC A;  3I9Q A;  1UJ0 A;  4IIM A;  3N41 B;  2LCS A;  3I55 Q;  2RHZ A;  3BAB A;  3AYH B;  3KXY T;  3KUF A;  4JRK A;  1VQ7 Q;  3R5X A;  1NLO C;  4ME7 A;  4JV5 H;  4EMK B;  2XKO C;  1SHG A;  4YHH H;  3HTR A;  3LLR A;  2KDS A;  4LDU A;  2C2D A;  4IR9 A;  2Y4X A;  4C92 D;  2HJW A;  1IRE B;  4X62 H;  4JI0 H;  5A0G A;  4GKJ H;  2KEA A;  3S6W A;  2DKG A;  2JTM A;  1QLY A;  3OYM A;  2ZPF B;  1WYX A;  5L1I A;  1Q86 C;  1RAG B;  1CKA A;  5KFP A;  4EGJ A;  4PJO B;  2QEX A;  3ETJ A;  1Y1W G;  5FPR A;  2L5Q A;  2CW8 A;  1TWA A;  2UXD H;  2UXC H;  2LJ0 A;  4HKE A;  5FPO A;  4ZOL F;  2GF7 A;  2K5L A;  4C0D B;  1VQ4 T;  3MR6 A;  2JUF A;  3CBO A;  4L6V 5;  4OGE A;  2YS6 A;  3GOX A;  3JB9 D;  4I55 F;  2RHI A;  2CZG A;  2YL2 A;  2PUK B;  3JCM d;  2YRV A;  1UGP B;  3G71 T;  2LT4 A;  5KE2 A;  1EUD B;  2VB6 A;  1S1N A;  2PVD B;  2KXC A;  4ZTF A;  5CKF A;  2KI7 A;  2V4Q A;  1W4S A;  4M77 D;  2W70 A;  1YIJ Q;  1QVG A;  1H3H A;  1I7N A;  2EGA A;  1AT1 B;  4Z88 A;  3I55 T;  5GJV B;  4MV4 A;  1WA7 A;  2X0S A;  4FW2 A;  4F4W A;  2DO3 A;  2C06 A;  3QFF A;  3S3M A;  2W71 A;  2ZM6 H;  1PKT A;  1SRM A;  1PNJ A;  1J3T A;  2FPP B;  4PWQ A;  2FB7 A;  4KT0 E;  1XMO H;  1M3B A;  3TIN A;  3PIP A;  1VQ7 T;  5KG5 A;  4OMO A;  3J80 E;  2DPI A;  1VQM Q;  4JYA H;  4IUR A;  5ECA A;  2PQW A;  4DL3 A;  4J5Y A;  2R87 A;  3Q1K A;  2EKH A;  2NUT A;  3WO0 A;  4C5E A;  1W70 A;  2NVY A;  2PVP A;  1MMA A;  4KGX B;  5KFD A;  4ZHQ F;  4J9O A;  3QO3 A;  3CCQ Q;  1JDE A;  4DR6 H;  4TUY F;  5IYC G;  4PFZ A;  2R7M A;  3OSP A;  2R7Z A;  5CQX A;  1Q82 U;  1K9M C;  1JEG A;  1K8A C;  3R23 A;  3Q8Q B;  4DR2 H;  2RO0 A;  1DV1 A;  1X6G A;  4LSX A;  1TUC A;  4ED3 A;  3HFO A;  4WCI A;  2VUB A;  2JA7 A;  4L59 A;  4JJC A;  3X28 B;  4C0Z A;  3VS3 A;  3FC3 A;  5IP7 G;  2E10 A;  1ZUK A;  4EDU A;  1IHV A;  4QW9 A;  1VYU A;  3LH0 A;  4UCV A;  1JRI A;  1KC7 A;  4RTX A;  3Q2O A;  4E7K A;  1P8L A;  3LML A;  3OQ5 A;  1B04 A;  4KBM B;  1X6O A;  4N0A C;  3OTO H;  3G6V A;  4LFA H;  4WBN F;  2OTL T;  4NXM H;  5FRN A;  3H20 A;  3I12 A;  4DR4 H;  3RIR A;  1XQH A;  1X27 A;  2JA6 G;  3L2V A;  3BDL A;  1HJD A;  2GFA A;  4DUY H;  4DL5 A;  1WXB A;  4M4Z A;  2XCL A;  1SFO A;  1QKW A;  3QZ9 B;  2IVW A;  3MEA A;  5C6S A;  1VQ5 A;  4JZ3 A;  2I8C A;  1X01 A;  4MA5 A;  4BE0 A;  5DG8 A;  4RG2 A;  2NVX A;  1S97 A;  2ZGW A;  3HRU A;  5DY9 A;  5GAN 5;  1BXR A;  1JQQ A;  4RAZ A;  2A3L A;  2DYB A;  5A0D A;  2F5K A;  3PN1 A;  4OMF B;  5I22 A;  2EVR A;  3HRT A;  2DIK A;  4PLI A;  1B07 A;  4XTY A;  5FLX E;  3MJX A;  1KEE A;  4GC7 A;  4GLX A;  4EFB A;  2LT1 A;  5KFV A;  3QSU A;  1KSW A;  4PFP A;  4M9U A;  4FS2 A;  2EQM A;  5GAM j;  4XU3 A;  4R0K A;  5JVL A;  4JI8 H;  4JJB A;  4J9S A;  2RQV A;  1Q81 U;  2NYS A;  3JZI A;  4AFQ C;  1MV0 B;  3J80 W;  1JIH A;  5D7U A;  2R7L A;  1HD3 A;  1DGS A;  2DFU A;  3JCM V;  4A4H A;  1ZET A;  1GBR A;  4M77 G;  4AFS C;  2VWF A;  3I4M G;  3N44 B;  4IZO A;  4ELY C;  1VYV A;  2E70 A;  3OYN A;  4ATO A;  4O3P A;  4KHP H;  1D1A A;  3PR4 A;  3QHS A;  1M2V A;  2FEI A;  5GAN 3;  4K11 A;  4EMK A;  2OTL A;  1AHJ B;  4UCR A;  4EG0 A;  4V2S A;  3GTQ A;  1FYN A;  1K73 C;  4RCB A;  5IXF A;  4IWX A;  2AZV A;  2RGV A;  4OVA A;  4E7J A;  4UCU A;  2P84 A;  3RDV A;  3MCA B;  3EG9 A;  2J6U A;  3INZ A;  2CDT A;  2F2X A;  2E6Z A;  4E7L A;  4M7D G;  3DF7 A;  3MEW A;  2CH4 W;  2M1H A;  3GII A;  4ECT A;  1Y96 B;  2VUG A;  2QQS A;  2X4Y A;  5KG3 A;  4YR3 A;  3WXM B;  2HVS A;  2CZ0 B;  1Y1W A;  1ZBX A;  5GAM d;  2X3W D;  1LCK A;  1TWF A;  2RF4 A;  1WHJ A;  4FSS A;  3URG A;  1N8R R;  1KIK A;  4C2M A;  1Q86 U;  2OWO A;  3SFM A;  3M55 A;  4OMQ A;  3M54 A;  3QG1 A;  4RUA A;  2K3B A;  2LRQ A;  1M1K U;  2EYY A;  2O2O A;  3M57 A;  5GAN 2;  2ROT A;  1IZ6 A;  3CPW P;  4L5G A;  1B34 A;  5CO7 A;  3FB9 A;  3S3O A;  3EGX B;  2VV5 A;  1RI0 A;  1PSE A;  4JRQ A;  3NMZ C;  4DL7 A;  1UNN C;  1HYO A;  5LOV F;  4TQR A;  2DVJ A;  4LNP A;  2PZ1 A;  3V7C A;  1Q81 R;  2EBP A;  1S68 A;  2OJ2 A;  7AT1 B;  2QA4 Q;  2EQU A;  2R93 A;  3OYE A;  1WHM A;  5AYF A;  2BZY A;  4DOV A;  5DQG A;  2J6S A;  2D9T A;  4DR3 H;  4EEQ A;  5KT5 A;  1AEY A;  4Q44 A;  3JB9 F;  1IBM H;  1KJI A;  4FS1 A;  4EYI B;  1IOW A;  3H3V H;  1VQ4 A;  4IUU A;  1WPY A;  2QQB A;  5GAO p;  2ATL A;  2ZPG B;  2LNV A;  1KQS S;  1PC0 A;  4F7U B;  3QJY A;  3CXC S;  1BI3 A;  1RUW A;  4M78 B;  3ZL7 C;  1JX4 A;  3RFC A;  4M7E A;  1TG0 A;  2K2M A;  1G3S A;  4Q43 A;  2RJF A;  1OI1 A;  3EG9 B;  2P0P A;  3BQ0 A;  3VS2 A;  3TEE A;  1UC8 A;  2W7P A;  1VA7 A;  4LE9 A;  1VQP A;  2C22 A;  1WIE A;  2R5A A;  2XG8 D;  3UPU A;  2RH2 A;  5LA6 F;  2V8J A;  4PFO A;  4C8Q D;  1QW1 A;  4YJ3 F;  2A28 A;  3G8C A;  1M1G A;  3GPL A;  2J6T A;  4C8Q B;  4YAK B;  3L1A A;  3RUX A;  2FL7 A;  2LVM A;  2G3R A;  4MV7 A;  4DLK A;  4C5H A;  1A0N B;  2DER A;  1RYS A;  2A08 A;  4M75 A;  2E5Q A;  4XZ3 B;  2GBQ A;  3TQT A;  2AU0 A;  4BY1 G;  3M56 A;  2PVG B;  1WXT A;  2YDL A;  5KYY A;  1HNW H;  3CCR Q;  2HVQ A;  2RDJ A;  3RB6 A;  2C28 A;  4NL2 A;  1KJQ A;  1MND A;  3PW5 A;  4LSA A;  2RQT A;  5KYX A;  3U23 A;  5KFC A;  1NJI U;  2ZAE A;  4PJJ A;  4CC2 A;  2I80 A;  5CA1 F;  2BE9 B;  2I0N A;  3CBM A;  4JI7 H;  5CR2 A;  4F14 A;  1V4Y A;  2DBM A;  2PU9 B;  3CMA A;  2K5F A;  1X9N A;  4LFC H;  2UXB H;  3TCJ A;  2KSS A;  1K0S A;  4BWS C;  1BIB A;  4RNN A;  1LPL A;  1WJS A;  2EQJ A;  2EIF A;  2CW7 A;  3GV7 B;  3GIQ A;  4UC4 A;  3V4Z A;  4RB3 C;  1Y7X A;  4QWE A;  4F04 B;  2FG0 A;  2DM1 A;  5JH7 F;  3VRY A;  3CCL A;  2O88 A;  4A63 B;  3CCV A;  3RGZ A;  3CD6 A;  3KHH A;  2L3R A;  4P5N A;  5HCK A;  3VYH B;  4OX9 H;  1CSK A;  3VRZ A;  4II1 A;  3CCS A;  4C5I A;  2CSI A;  3I56 T;  3CC2 T;  1QCN A;  2LTO A;  4RG8 A;  3CMA Q;  3CCJ T;  5T14 A;  3UA7 A;  3CC7 A;  1HR0 H;  2B63 G;  2DZ9 A;  2FLN A;  2VXE A;  3DB3 A;  3TQ7 P;  1XMQ H;  2XDP A;  2FKL A;  4ED6 A;  2XK0 A;  4C8Q F;  4A3I G;  1NLP C;  5BR8 H;  3JB9 G;  4QVC A;  3C0C A;  2W6N A;  2DWC A;  1V29 B;  1YIT Q;  1CE8 A;  1EFN A;  4X64 H;  3RV4 A;  1Z2P X;  4A3D G;  3A8M B;  2KBT A;  2P4T A;  2KAF A;  2ATC B;  1ZHI A;  1ZSZ A;  4J9M A;  1TWB A;  2W6O A;  3ZBD A;  5L1L A;  3HRS A;  2XMF A;  4E6R A;  2WTF A;  4M78 E;  1DIK A;  4OMN A;  2DXC A;  4JZ4 A;  3CC7 T;  1JKJ B;  2DPJ A;  2NUT B;  2C0I A;  3M9O B;  3MR2 A;  4A3L G;  3UAT A;  1I81 A;  3OS1 A;  3MWE A;  4C5B A;  1KD1 C;  2D1X A;  3X26 B;  2YRD A;  4M75 E;  5GAN 4;  4N4G A;  2BQR A;  3CCS T;  1YIJ T;  3HFN A;  3QWY A;  2YW2 A;  1VIE A;  4ECR A;  5KT6 A;  2V58 A;  1WHH A;  1ZA1 B;  2FPE A;  2M05 A;  3QDR B;  5A0L A;  5KYY B;  5L1J A;  1VUB A;  4G3I A;  3CCL T;  4EFE A;  1VQK T;  2DAQ A;  2NWM A;  2QAZ A;  2OAW A;  3SWN B;  3GIP A;  5KKN B;  3L2U A;  4GBQ A;  3VS0 A;  5GAN 7;  3H0H A;  2V5A A;  4Q0Y A;  3UA6 A;  4PLL A;  4XYL B;  3M9M B;  3WNZ A;  5JUM A;  2LJ1 A;  1ZSZ C;  4KH1 B;  3TII A;  5C3E G;  4RUG A;  2X3X D;  8AT1 B;  3TSW A;  2FK1 A;  4ZGJ B;  3Q8P B;  3UDC A;  3BW1 A;  3HL8 A;  4HCZ A;  4F4X A;  4HYK A;  2CZ6 B;  2UVU A;  2CUD A;  4RTZ A;  3LWI A;  2MK5 A;  5LYJ F;  1X69 A;  3GNG A;  4O4L F;  2QXF A;  3NTK A;  1E6G A;  1VQO Q;  1AWO A;  4A3K G;  1PK8 A;  5LJ5 h;  3T5K A;  4ZN1 A;  3RGX A;  2IA6 A;  1NBE B;  1YCS B;  2JS0 A;  5C44 G;  2DX1 A;  2F2V A;  2J9G A;  3HB9 A;  2FZK B;  1RJQ A;  2QK4 A;  4IRC A;  3I35 A;  2Q2U A;  2GQV A;  1KHI A;  5IHK A;  1VQ9 Q;  2Z0W A;  2JTF A;  1GRI A;  4QKU A;  2FO0 A;  4IRK A;  4L1K A;  1VBH A;  1YI2 Q;  4QW2 A;  2UUC H;  2HNI A;  1UGR B;  1H3Z A;  1UEB A;  1D09 B;  2GTO A;  2YUO A;  4DL4 A;  3BFM A;  1VQP T;  2V9W A;  4X9C A;  2W6P A;  4A3G G;  4DR1 H;  4RTY A;  1DJ7 B;  2ESW A;  4BE2 A;  3OMC A;  4JRI A;  4U6P A;  3NTI A;  2W9C B;  4WF2 A;  4N4H A;  4AT1 B;  2XDD A;  2ROL A;  3EG0 A;  3PVL A;  1KC8 R;  3VPC A;  1BI0 A;  2LNH B;  1WQW A;  1GLV A;  2RM4 A;  2HVR A;  1SG5 A;  1AWX A;  3OYC A;  1N8R C;  4R8U A;  2OLS A;  5D1P A;  4FT2 A;  4EMG A;  4DA4 A;  4BXX G;  1EYZ A;  4J9H A;  3PZP A;  2YZG A;  4MV1 A;  1YJW T;  5KH6 A;  3RV3 A;  1PSF A;  3JCM J;  3QII A;  4C92 F;  1VQ8 A;  1MV3 A;  5KFU A;  5A2Q W;  3R5H A;  3V4S A;  1T0H A;  2DL7 A;  5HV6 A;  2FK2 A;  3K5H A;  1YN8 A;  3RER A;  4YBZ B;  1SF9 A;  2E64 A;  1W96 A;  3PW7 A;  1N5Z A;  4CRI A;  4HNU A;  5FWB A;  5LXT F;  2QDL A;  1BB9 A;  1KQ2 A;  4QQ6 A;  4J6X A;  4IUP A;  2EYQ A;  3RMQ A;  4AFU C;  5CKD A;  4QW8 A;  4J9F A;  3G7Z A;  2DRK A;  3L42 A;  3QJ6 A;  2V59 A;  3L4J A;  3RAQ A;  3DLM A;  2LZ6 B;  1ZBJ A;  4QT7 A;  2C00 A;  3CPW S;  3L2Q A;  2ECZ A;  4CC5 A;  3CCQ A;  2YRW A;  5D1O B;  3LP8 A;  4BI3 A;  3CCE T;  1I5L A;  3OBY A;  3EYY A;  5AT1 B;  4OGC A;  1UGS B;  2DIG A;  3X25 B;  2LCC A;  3A8L B;  8ATC B;  2PMZ E;  1KBL A;  4PKC C;  4M78 D;  4AG1 C;  3QZ7 A;  3JSC A;  4OML A;  1Y1V A;  4DBF A;  4JI4 H;  5GJW B;  1TXQ A;  4AFZ C;  4JI2 H;  1YWP A;  3J81 W;  5J3B A;  3U9S A;  3CQT A;  3PW4 A;  1RAA B;  1R0B G;  4FU6 A;  1G3Y A;  2XIG A;  4OMM A;  4RU9 A;  1B3Q A;  4XAX B;  3GV5 B;  2RDI A;  1QVP A;  3QYG B;  1FMV A;  2RHU A;  2CGH A;  4GLM A;  4C92 B;  4I4T F;  5KT2 A;  2QGF B;  1N8R U;  2E5L H;  1ULZ A;  2YSQ A;  3E1S A;  3CCE A;  3OYH A;  3PT9 A;  3G6Y A;  1IO6 A;  4J6Y A;  2IG0 A;  1WFW A;  3OW2 A;  4C92 A;  2WB1 A;  3KAK A;  4ECU A;  2SCU B;  1XNR H;  3RB4 A;  3VV0 A;  2XCP A;  3M0S A;  4FBT A;  3CD6 Q;  2HCK A;  3OYY A;  3M4G A;  5J2T F;  1M90 C;  1S10 A;  2D8H A;  1WGS A;  3VU3 C;  4HCB A;  4LD9 K;  2ZJT A;  1N32 H;  4EMH A;  2BTT A;  1RJR A;  4A3E G;  4JJD A;  4C8Q G;  1WLP B;  2XGQ A;  2YLC A;  1S03 G;  4QVZ A;  2P0K A;  4YB8 B;  5EOY A;  2QQR A;  1VQ8 T;  3M58 A;  3M5A A;  5FW9 A;  3IN5 A;  5L9X A;  1I50 A;  2WE6 A;  2MMP A;  1YJW A;  2OTJ T;  1CQJ B;  5KFG A;  6AT1 B;  2JXB A;  2FZC B;  2M0O A;  4RTU A;  5GAN f;  2ASD A;  4ECQ A;  3HSB A;  2JA5 G;  4LF4 H;  1NYF A;  2DEU A;  1VQK Q;  3CCR A;  4IKF A;  5DLG A;  1YI2 A;  3GQC A;  4DR5 H;  2HKN A;  2R92 G;  2X9H A;  5GMK m;  2EKO A;  5GAM g;  3N40 P;  4X66 H;  5DG9 A;  4MDX A;  5FU6 C;  2V8K A;  2L89 A;  3BQ2 A;  2YZM A;  1X2Q A;  1K73 R;  3JAM E;  1MMG A;  3C95 A;  3A1P A;  2V26 A;  5LJ3 j;  2FLP A;  4JUV A;  2CRE A;  5K2M A;  3BA8 A;  2R8I A;  4YTL A;  3M0U A;  2VVK A;  4DBR A;  3CCU T;  3OY9 A;  1LNX A;  5IYZ F;  2UVV A;  2GQI A;  2YUQ A;  3ETH A;  4RKU E;  1KC8 C;  3REB B;  4Y92 A;  1V51 A;  2CYZ B;  1ZSG A;  2CUB A;  2IMW P;  5LJ5 g;  5KFJ A;  1W93 A;  4Q8F A;  5CKH A;  1KFZ A;  4M77 B;  3ULR B;  3FIF A;  2NUZ A;  1U3O A;  4KGZ B;  4F4Y A;  4LN2 A;  2DL4 A;  1VAJ A;  2HDA A;  4NS5 A;  2HSP A;  1X6B A;  4M78 F;  5KFA A;  5GAO n;  3ORQ A;  1JXL A;  2DIL A;  1IRX A;  4ZTJ A;  3GTO A;  4N0A A;  2P0Q A;  5KFS A;  1SKU B;  5IXB A;  5FWC A;  1Z2N X;  5LL6 S;  4DEY A;  2MAM A;  1M3C A;  3F70 A;  2ZPB B;  3JCM P;  1ZA2 B;  2ZDQ A;  2V1R A;  1HNZ H;  1UFF A;  1YCY A;  4KGV B;  2Y0S E;  1I8F A;  1I7L A;  4JPB W;  1BIA A;  3RKY A;  1TOV A;  2DF6 A;  4CI0 C;  1YWO A;  2R84 A;  1BJT A;  4FYW B;  4M7D F;  1VQN T;  5LJ3 h;  3X20 B;  2HKQ B;  2X51 A;  5KFW A;  2K4Y A;  2O03 A;  1KQ1 A;  4XTU A;  2DK3 A;  1U1S A;  4C0F A;  3THK A;  4C92 C;  2RK2 A;  3JB9 I;  3N5B B;  1G3W A;  3HKZ E;  4EYH B;  2H3J A;  2R5M A;  1X2K A;  3GF5 A;  2RMO A;  4FL6 A;  2QEX T;  1YIJ A;  4DV0 H;  2B63 A;  2HQX A;  1K76 A;  2NU8 B;  3U9T A;  4QWB A;  2KNB B;  4C5C A;  1TWG A;  1JLL B;  3OS0 A;  5C1O A;  1D0X A;  5C1P A;  2AHJ B;  1D3B A;  4IUV A;  3JCM g;  1U1T A;  4YQW A;  4ECS A;  2BUD A;  3LWH A;  4IUQ A;  5D6X A;  3DLL A;  3AHU A;  4C92 G;  1SHF A;  2OAU A;  4ED0 A;  5GAN 6;  3MP6 A;  3PE0 A;  5CQY A;  5KFY A;  4XTZ A;  2VQE H;  1PRM C;  2JA6 A;  3RMS A;  1RK6 A;  4RZR A;  2F4V H;  2UUA H;  4BE1 A;  1NJI C;  3CCE Q;  5J2U F;  1M6V A;  2BZX A;  2QTX A;  4PJO C;  1X43 A;  3OYK A;  4B3S H;  2R6F A;  3GLK A;  4A3B G;  2XID A;  3CCJ A;  1KG1 A;  3JRX A;  4EBE A;  3I56 A;  3CC2 A;  1EX4 A;  3H0G G;  4I7H A;  2R8G A;  2KY9 A;  2GLT A;  2YRC A;  4OB2 B;  1S0O A;  1YJ9 T;  3GNF B;  1EZZ B;  1TSF A;  2RB6 A;  4Y91 A;  3CCM T;  5KFI A;  1ZHQ A;  2FVU A;  1JJ2 S;  3X24 B;  4LDX A;  3OUZ A;  2K57 A;  3CD6 T;  1RAI B;  1ZUY A;  2R57 A;  3CCV T;  1AUV A;  2K3X A;  5L23 A;  2KXD A;  4A54 A;  1VOM A;  2WSC E;  2MYS A;  4TVR A;  3T5H A;  1RJP A;  4OB3 B;  3QZ8 A;  2VKN A;  4M78 C;  3EG1 A;  4ECZ A;  4DV3 H;  4ME6 A;  5M9O A;  2HQE A;  3KHG A;  4OF1 A;  1K9M R;  3TVT A;  1N36 H;  3I4N G;  3QBY A;  1I6U A;  5C0M A;  1QVF P;  2O9V A;  4PJO E;  4HNV A;  4ED7 A;  2F69 A;  3CMA T;  3SI8 A;  2FRY A;  2DEQ A;  1OV3 A;  3CCM A;  3OYD A;  1YJ9 A;  2RNA A;  5KG0 A;  1U5S A;  1NEB A;  1JJ2 A;  3CPW A;  1XNQ H;  3EFO B;  5GAN 8;  2H3E B;  1BCM A;  5IHN A;  4AG2 C;  3OYA A;  1OU9 A;  1VQL T;  3GTL A;  3UWN A;  3RKX A;  3T5L A;  5KFZ A;  2R58 A;  2R86 A;  2MWP A;  3FDS A;  5DQH A;  1PD0 A;  4YJ2 F;  2I2L A;  2MWO A;  2YYA A;  1IXD A;  3QXE B;  2DBK A;  4LDY A;  4LF6 H;  1WDX A;  3CBP A;  1SEI A;  2GPW A;  2LQN A;  1FMW A;  4RB0 A;  1N33 H;  1IHW A;  2F2W A;  5KYN A;  2J6F A;  2Y0S A;  3T1H H;  3O8V A;  2GPS A;  4MZT A;  5I21 A;  4OMP A;  3V6K A;  5JVD F;  2P4R A;  4FBU A;  3EH2 A;  2V8I A;  5CVI A;  1R8O B;  1WJR A;  1QVF S;  3CCS Q;  2VGN A;  2C2R A;  2AKL A;  4X9D A;  4R56 A;  1Q7Y C;  4MML A;  1M1K C;  2E1H A;  4MV9 A;  1NG2 A;  4J8O A;  3ZEH A;  2VA3 A;  5KFN A;  1OYX A;  2HZY A;  5KFR A;  4BI4 A;  4QQG A;  4ZNX A;  2EYW A;  3J81 E;  2W8L A;  3MJF A;  5F9L A;  3JRW A;  3RTX A;  2VA2 A;  4LD6 A;  3G6E A;  1OU8 A;  2NU6 B;  1JU5 C;  1UE9 A;  2WSF E;  1YJW Q;  3MFH A;  1IGQ A;  4TQS A;  4J9L A;  1D0Y A;  4ECW A;  3EFO A;  4TV9 F;  2RHX A;  1YIT T;  1NYG A;  3KTM A;  4J9C A;  1SPK A;  2COY A;  2R93 G;  1VQN A;  1GL5 A;  3OS2 A;  4ORZ A;  3IG0 A;  2JOY A;  3V7R A;  4D8K A;  4BDY A;  1RAC B;  3CME Q;  1SCU B;  4EIK A;  1Q82 C;  1K9M U;  2QI2 A;  3VPD A;  3E2U A;  4XU0 A;  3VMM A;  2K2V A;  3L4K A;  2C35 B;  3VS4 A;  1YHQ Q;  3R6O A;  2L3Q A;  2KSW A;  3HBL A;  1KD1 R;  1KQS A;  2D6F A;  1RLQ C;  5LP6 F;  4DL6 A;  1VQ6 Q;  4AQY H;  1ARK A;  3HKZ A;  2LJ3 A;  5I2S A;  3GIL A;  5IWA H;  2DNU A;  3Q1J A;  4BUG A;  1QWF A;  4CC7 A;  3OS5 A;  4JLG A;  2L3P A;  3H9N A;  3RB0 A;  2QEX Q;  3OYI A;  3UFX B;  2DMO A;  1XTD A;  4BY7 G;  5KFQ A;  3GV8 B;  1O75 A;  4PK4 A;  3EH1 A;  2AGQ A;  1Q95 G;  2W9B A;  1Y1V G;  2VPQ A;  3NGD A;  2CP5 A;  1AVZ C;  2EJG A;  4HVV A;  3CCU A;  1U8R A;  1TU0 B;  2QQA A;  1ZQ1 A;  3OW2 S;  5FJ8 G;  5I47 A;  1B34 B;  2W7O A;  5EG2 A;  1QCF A;  2YT6 A;  1WCM A;  4RCC A;  1BK2 A;  2CZ1 B;  4J9B A;  3CCM Q;  1JJ2 P;  4QWD A;  4PJN A;  3V7S A;  3UQ8 A;  4KH0 B;  4DV6 H;  4BBR G;  1TUD A;  5LJ3 e;  4RTW A;  3CME T;  3FDR A;  3JCM c;  2FJZ A;  3LW5 E;  3LGF A;  1GCP A;  1Q7Y U;  1VQ9 T;  1YJ9 Q;  5GAO l;  1T0J A;  3EPG A;  1AUX A;  1RLP C;  5D8D A;  2GTJ A;  5H80 A;  1AN7 A;  5KFB A;  4F16 A;  1VQM T;  4M75 D;  3E9G A;  2PTK A;  2CT3 A;  2E65 A;  1T3L A;  4QIW A;  1FMK A;  2QQ9 A;  5LJ3 f;  2QA4 A;  3BA9 A;  5HK0 A;  2DE0 X;  4MV3 A;  4LDV A;  4J9D A;  1JBM A;  3QUI A;  1VQL Q;  2R7K A;  2MF2 A;  4DV1 H;  2EQK A;  3VJP A;  1YJN Q;  2LMJ A;  4JRP A;  3GIB A;  1BBZ A;  1QWE A;  4RNM A;  3I5S A;  3V6H A;  2KYM A;  5CIU A;  3VS5 A;  3L2Z A;  1GBQ A;  1WHL A;  4NXN H;  3R6N A;  4A93 G;  5EZY F;  1S72 A;  4OP0 A;  2X35 A;  1K73 U;  2EYZ A;  2BZ8 A;  2DZC A;  4J9I A;  3CCL Q;  4RTV A;  2XD4 A;  1I3Q A;  1SRL A;  2IBK A;  4M7A A;  4M7A B;  5GAM h;  3OBW A;  4PJO G;  3H0F A;  3FJ5 A;  2VOB A;  5GAM f;  2JS2 A;  1KJW A;  1YBY A;  4CC3 A;  4M77 E;  2SRC A;  2VUM A;  2LX7 A;  3M0Q A;  2VR1 A;  3JB9 J;  5EWF A;  1HNX H;  1PX2 A;  1ZSZ B;  2ZPE B;  1OZ2 A;  1QQJ A;  2MCT A;  3GIJ A;  5GAO r;  4EBD A;  5DLF A;  2ASL A;  2C2E A;  3LWB A;  1SSF A;  3QKJ A;  2FRW A;  2X4X A;  4M75 F;  5GMK h;  1T36 A;  1I0C A;  1Y07 A;  4C92 E;  2WB1 E;  5KG6 A;  1FX7 A;  4J9G A;  1ZHS A;  2XC9 A;  2EJ9 A;  3HOW G;  2JN0 A;  1U06 A;  2DRM A;  1B7T A;  4LMY A;  1K8A R;  3CCQ T;  4O3O A;  2E4H A;  1EZ1 A;  2RI3 A;  4M7D C;  3HOZ G;  5KCH A;  2D0Q B;  4ANJ A;  3LYI A;  2ENM A;  5FU7 C;  3VUB A;  2NU9 B;  2JEG A;  4M7D E;  3VKI A;  1AD5 A;  3EG2 A;  3JCM Q;  1VQO A;  4A3C G;  1VQ7 A;  4PJO D;  5J26 A;  2CP6 A;  3A5Z B;  5GAN h;  3L2W A;  1A0I A;  4IWY A;  4GLK A;  1ABQ A;  1M8M A;  2Q2T A;  1WHG A;  1M3A A;  1VQ6 T;  3UF4 A;  5KFT A;  1VQ6 A;  1T3N A;  1M0W A;  2KRS A;  2RQW A;  2MIO A;  4HQ6 A;  2B86 A;  5LMN H;  4Q5W A;  5CAE B;  1MHN A;  1Z9Q A;  2VAS A;  2RHY A;  1GGO A;  3H4B A;  2BR0 A;  3R5F A;  3D7S B;  2VXF A;  2J6O A;  5GMK j;  1TA8 A;  1Z2O X;  2CS7 A;  4DV2 H;  2YCH A;  2KT8 A;  4J83 A;  1RAD B;  4I50 F;  1OOT A;  5LJ3 d;  3G4S T;  4ED8 A;  2M16 A;  3PR5 B;  4EBC A;  5KG4 A;  2AZS A;  2NUA B;  5DQI A;  2R7N A;  1NZ9 A;  3OYL A;  2L0A A;  4BD3 A;  5GAO m;  3ORR A;  1WCM G;  2CP7 A;  4RB1 A;  1OUL A;  1UEC A;  4M75 B;  3OYF A;  3RF2 A;  4BI8 B;  4ZQI A;  5IH2 A;  2FLL A;  4R55 A;  2NUP A;  3RKW A;  1NEG A;  5IT9 W;  5FLX W;  2CH4 A;  2KQW A;  4B9W A;  3GP8 A;  4J9P A;  3OMG A;  2AGP A;  2E3H A;  3OSS C;  3MET A;  1HK9 A;  1W1F A;  1S72 T;  3CCV Q;  1BU1 A;  3T9N A;  4FT4 A;  4F7U E;  3RUP A;  4EEY A;  2RD1 A;  4E47 A;  1TS9 A;  2K5I A;  4F17 A;  1M90 U;  4ED1 A;  4FYX B;  5DGA A;  1GSH A;  4PDB A;  1M4Z A;  5KYU A;  4BAC A;  1C1A A;  3P8H A;  4MZM A;  4M78 A;  5KFE A;  2JEI A;  2EPD A;  3FJP A;  4R7R A;  5KFK A;  2O01 E;  2COW A;  3H8Z A;  5GAO q;  4D6W A;  3N42 B;  4O3S A;  5D1O A;  2WYO A;  2QA4 T;  5GON F;  1LVK A;  4J7F A;  4RZQ A;  2YXY A;  3QPH A;  4FSX A;  3HOV G;  2F1L A;  4JI1 H;  2DLP A;  1KJ8 A;  1AWJ A;  1PM3 A;  2BE7 D;  2W0Z A;  1WJQ A;  4MTE A;  1K83 A;  2COZ A;  4QQD A;  3GTJ A;  3PMT A;  1VQ9 A;  2HAX A;  2WAC A;  3AT1 B;  3FEO A;  3MP8 A;  4DOW A;  2DET A;  1VQN Q;  1YHQ A;  2YU9 A;  3EGD A;  1ACM B;  2DL8 A;  3ZFJ A;  3JCM W;  3OHB A;  1G83 A;  4RNO A;  3CME A;  2XU8 A;  5BPF A;  4MAM A;  2HEQ A;  2A36 A;  5CA0 F;  1WSC A;  1N9R A;  4M7A D;  4A2A A;  3MFI A;  5L1K A;  1N9S A;  2ZDG A;  1T94 A;  1D1B A;  3C94 A;  4O6J A;  2YLB A;  2W9A A;  2B8A A;  2PMZ A;  1YNZ A;  4IUT A;  4YR0 A;  3H4D A;  1D0Z A;  3V8J A;  4M7A C;  4NL3 A;  1UGV A;  2X4J A;  2R8J A;  1ABO A;  3O5Z A;  1Y96 A;  2YWW A;  3QDF A;  5LL6 b;  2JEJ A;  4C0G A;  2LDM A;  3OB9 A;  1NM7 A;  3RBD A;  4O4I F;  5BMV F;  5I2M A;  1FKA H;  4M7D D;  4CC6 A;  1I4K 1;  2UVW A;  3CXC A;  1MNE A;  2L3S A;  4FYY B;  3WVD B;  4M75 C;  4MZP A;  1PRL C;  1E6H A;  3SWN C;  1K1Q A;  5IYB G;  1QKX A;  1OX9 A;  1UB4 A;  1M90 R;  3G6X A;  1I5O B;  2QAS A;  2HD0 A;  2R82 A;  4E4T A;  1M2V B;  4DBQ A;  3MR5 A;  3GIM A;  2A37 A;  1IBL H;  1R9T A;  4X1V A;  3FRN A;  2E5K A;  2XGP A;  2PBZ A;  5FU6 B;  3M53 A;  1IBK H;  1N27 A;  3BQ1 A;  4JV2 A;  1JXO A;  1X75 C;  2W8K A;  5I11 A;  3RBE A;  2ED1 A;  2AK5 A;  2MCN A;  3SEM A;  3VYG A;  4XU2 A;  3OYB A;  4HT8 A;  4ZGD B;  4K0K H;  1VYT A;  1K9A A;  2DXB A;  1K1Z A;  1LJO A;  1YIT A;  1NJI R;  2KVQ G;  5KFL A;  3G71 Q;  1W2B A;  1UHC A;  3P8B B;  3GTP A;  2RN8 A;  4XTW A;  1VQ8 Q;  4AMC A;  4M7A F;  3M59 A;  4M77 F;  2GNC A;  5BPH A;  1OWT A;  2FE3 A;  3VS7 A;  1Q86 R;  4IRD A;  4PJO F;  2KK4 A;  1BNC A;  3TSZ A;  4LUE A;  1RL2 A;  1BI2 A;  4Z8A A;  2CQY A;  4C8Q E;  1RYR A;  5C8Y F;  5GAN d;  1IB8 A;  5C5J A;  1T3S A;  2SEM A;  3PTA A;  5IP9 G;  2R7Z G;  2PUO B;  4MTD A;  4JV1 A;  1VIF A;  3KXT A;  1G8X A;  3GID A;  3SHW A;  3JCM b;  2A0F B;  3V8K A;  3RB3 A;  5EC7 A;  1ZQ7 A;  2JA7 G;  1KHC A;  3TIG A;  4D8D A;  5GAN j;  3GTM A;  1GO3 E;  2AQ4 A;  4RUC A;  3NHN A;  1YJN T;  4JDS A;  4O3Q A;  4NLG A;  2E41 A;  4XTX A;  4A3J G;  1WXU A;  4MMK A;  2W6M A;  1TWH A;  1C0M A;  2H8H A;  4Z02 A;  2Y4Y A;  2XDB A;  2YZN A;  5LMU H;  3JCM e;  2RI5 A;  3N8D A;  2ASJ A;  2ED0 A;  4EMK C;  3PVQ A;  3G4S Q;  2KRO A;  3HOU G;  3F8N A;  1OQK A;  2HL3 A;  2VYT A;  3NPF A;  5L8R E;  2DD4 A;  2M51 A;  2X4W A;  5J39 A;  5FLM G;  1V76 A;  5DLO A;  2LC4 A;  5D6Y A;  4E7Z A;  2EAY A;  5FU7 B;  1UC9 A;  1M8V A;  3GTG A;  3A98 A;  3BE3 A;  2MOX A;  3HP9 A;  1N34 H;  4O5V A;  1QP3 A;  3MR3 A;  3L2P A;  1PWT A;  1VQ5 Q;  2JNG A;  1K4U S;  2JJ9 A;  3M4I A;  4FW1 A;  1QVG P;  1RAF B;  1QP2 A;  3MO8 A;  2IP4 A;  1B6R A;  2EYX A;  2OH2 A;  4HT9 A;  2G6F X;  5KYW B;  2P0A A;  4LFB H;  1XNI A;  1E7O A;  4A3F G;  1MGQ A;  2HBP A;  4J9Q A;  1MMD A;  5KG2 A;  1N6A A;  2FB9 A;  5HK3 A;  3SDZ A;  1MZB A;  4LXC A;  1PG5 B;  3PFS A;  2JM8 A;  1QVG S;  4KRT A;  4FYV B;  1F1B B;  1M9S A;  5IAY A;  4VUB A;  3CC4 T;  3VS1 A;  4HR7 A;  1MMN A;  3C4S A;  3P8D A;  1JB0 E;  3PNW C;  1RAB B;  1C3O A;  1QCO A;  2AGO A;  1Y0M A;  3S3N A;  2FPF A;  3A8O B;  4B9X A;  4AYB A;  1TH7 A;  5KYX B;  2RQU A;  1L2Z A;  4PJO A;  5FRM A;  2JMC A;  3OHA A;  3H0I A;  4FCY A;  1JDB B;  1Z9Z A;  1WR2 A;  3PIO A;  2XCA A;  1W2B P;  1SSH A;  2JTE A;  2RJD A;  3DB4 A;  4DV4 H;  3GTK A;  2FHD A;  1LOJ A;  1PKS A;  2O4X B;  3PW2 A;  2QK0 A;  3M0R A;  3KHR A;  2BQU A;  3HHT B;  2XIC A;  3OYJ A;  4M7D A;  2LP5 A;  2QG9 B;  4HXJ A;  4BY6 C;  1YP5 A;  1VKZ A;  5KFF A;  5FD5 A;  1M1F A;  4IHJ F;  4QWC A;  4GY5 A;  4YR2 A;  4HVU A;  3M4Y A;  3UT1 A;  3I5R A;  3H0G A;  4ZGE B;  1IGU A;  4N4I A;  5GMK l;  2R85 A;  4A2B A;  1WZO A;  1HSQ A;  4U7C A;  1YHQ T;  1BCO A;  5CKB A;  4DUZ H;  2ZPI B;  4E7S A;  3MWD A;  4A3M G;  1PD1 A;  5KT7 A;  2VC8 A;  1VQ4 Q;  5GAN e;  5DM7 R;  4M75 G;  3EGU A;  4LH6 A;  3CC4 Q;  5C4X G;  3HOY G;  4GC6 A;  5HKC A;  4DBH A;  3NTH A;  2E2H A;  4E7H A;  1B33 N;  2M9U A;  1XJW B;  4O2A F;  3HOX G;  4QWA A;  2RPN A;  2FYK A;  2YRX A;  1TAE A;  4M7A E;  1S0M A;  4WD3 A;  4M7D B;  5HBR B;  1WHK A;  2HL5 C;  1GYF A;  5CK9 A;  2PN1 A;  2CP2 A;  2R8H A;  3V8L A;  3CQZ A;  3FLG A;  4B6M A;  1V1C A;  1M1K R;  2C0O A;  4IIO A;  2HMA A;  3FMA A;  3GLX A;  2KRM A;  4MA0 A;  2WSE E;  2RJC A;  3OUU A;  1UG1 A;  4EPC A;  1W2B S;  1AOJ A;  2M02 A;  1M30 A;  5KG1 A;  3OSN A;  1VQ5 T;  1H92 A;  3QZ5 B;  2E3I A;  2FP4 B;  2M0Y A;  5CCA A;  4WTO B;  1XOV A;  3DKM A;  3EGX A;  2VQF H;  4RMO A;  1RAE B;  2KE9 A;  4ZN3 A;  3G1J A;  3NGP A;  1M27 C;  4DEX A;  4LF5 H;  2ALZ A;  2FPG B;  2QTV A;  4F7U G;  4BY6 B;  1WQ7 A;  4O3R A;  3BJY A;  2AKK A;  4LDW A;  4MV6 A;  2CKK A;  4XTV A;  3EPI A;  1EUC B;  3BDU A;  4J6W A;  4JI6 H;  3M9Q A;  1E4E B;  2RA2 A;  4M77 C;  1K0X A;  1UDL A;  2W57 A;  2JM9 A;  2HGS A;  4Y8V B;  3BG5 A;  4LF9 H;  3EG3 A;  2DTI A;  2MI6 A;  2DZD A;  2IPO B;  3OYG A;  3EHQ A;  2DJQ A;  1ZUU A;  5KYW A;  5KX5 F;  5DGB A;  1I07 A;  1V9P A;  5GAM e;  3KAJ A;  1CKB A;  1GXI E;  2V4R A;  5DLQ E;  3J7A F;  4Q45 A;  3G4S A;  2EJF A;  2ZCF B;  4O2B F;  2DL5 A;  1YI2 T;  3HPW A;  3CCR T;  1Q82 R;  4XX0 B;  1J5E H;  2CP3 A;  4ESR A;  5GAN g;  3MHX A;  2HQH A;  1AZG B;  3MEV A;  2K3Y A;  4RAY A;  2ZPH B;  1KD1 U;  1BKB A;  5EWG A;  3NFC A;  2JZ2 A;  2OTJ A;  1G2B A;  2O31 A;  2CKZ B;  1O9S A;  2K79 A;  2AT1 B;  3H40 A;  2W6Z A;  2OX7 A;  4FU0 A;  4F7U F;  3CXC P;  4BBS G;  1M0T A;  1MUZ A;  4PJM A;  4HCC A;  1QVF A;  2IIM A;  2NLU A;  3SB2 A;  3V6J A;  4DR7 H;  4PNO A;  4C0D C;  2DXT A;  1M7J A;  3I55 A;  4QJF A;  3PO3 G;  4XQ3 A;  1R0C B;  4J9K A;  2E12 A;  1UUE A;  5EWE A;  2BKD N;  2VQD A;  2Y90 A;  2L8D A;  1VQO T;  1YFN A;  1I94 H;  1G5V A;  3Q8R B;  2J05 A;  2XD0 A;  1GCQ C;  2MPX C;  4JI3 H;  1G3T A;  3G71 A;  2ABL A;  1XDN A;  2KRN A;  1SYX B;  2L2P A;  3GBQ A;  2W9C A;  3M9N B;  1GCQ A;  2OTJ Q;  2OI3 A;  2LQW A;  4FM9 A;  4NOY A;  3EFR A;  3K5I A;  1OPK A;  3JSN A;  1Y57 A;  1C6V X;  2AIR B;  3KFV A;  1KQS P;  4B3T H;  5IHI A;  4QIW E;  5D6W A;  2EWN A;  2CT4 A;  3C12 A;  3RBB B;  3RNJ A;  5IYD G;  2DVE A;  5GMK e;  3MEU A;  3SD4 A;  4Y28 E;  2WDT A;  3CCU Q;  1D1C A;  1NPR A;  4JLI A;  3RAX A;  4UFZ A;  4ZI7 F;  3GIK A;  4XK8 E;  1FJG H;  5KYU B;  1E4G T;  4XU1 A;  1WH2 A;  1R77 A;  2I87 A;  2FZG B;  5LJ5 f;  3KAL A;  3EHR A;  4HVW A;  2F5T X;  3CC7 Q;  4APM A;  3J7A K;  1FXX A;  2PVO B;  3HXL A;  1KK7 A;  4J7I A;  4QVD A;  4UCT A;  4F50 A;  1OPL A;  3H6Z A;  4A4E A;  1QMC A;  3CC4 A;  3ME9 A;  5F9N A;  4UCS A;  4C8Q C;  4JI5 H;  3PGG A;  1OEB A;  5KG7 A;  2PNI A;  2DL3 A;  3JV3 A;  4HCK A;  4OB0 B;  3C0F B;  4ECY A;  5HY6 A;  3FKI A;  2HHH H;  2WAQ A;  3VS6 A;  2O4X A;  2XHC A;  4A53 A;  4E2F B;  2J06 A;  3G6E Q;  5KFH A;  2UVR A;  4TV8 F;  4F4Z A;  3SWN A;  1C30 A;  2JA8 G;  1VQM A;  1E4F T;  5KT4 A;  4MDW A;  3E5N A;  1N48 A;  3MPU B;  2DA9 A;  2JT4 A;  4J9N A;  1WNL A;  1TUG B;  4JV0 A;  2BIV A;  2C0T A;  5CB4 F;  4A4K A;  1Y14 B;  3JRZ A;  1CQI B;  1UGQ B;  1PCX A;  3LGL A;  4KUI A;  3PW0 A;  1RAH B;  3CEY A;  5FD6 A;  3BY7 A;  5FRO A;  1VS0 A;  4ECX A;  2W9B B;  1W6X A;  4M77 A;  2DTH A;  4AYB E;  4JS4 A;  4C5A A;  1SEM A;  2FPI B;  5KE3 A;  4GKK H;  2LCL A;  1GSO A;  2YUP A;  2CSQ A;  2ZDH A;  3N6X A;  2RJE A;  1UTI A;  2EGC A;  3EAE A;  1B6S A;  4C5G A;  3JAM W;  1Q81 C;  5JQW A;  2UU9 H;  2A7Y A;  1FVI A;  3M0T A;  4DV5 H;  4B3M H;  2QYZ A;  3ER0 A;  2DTO A;  1YJN A;  3OW2 P;  3TU4 K;  3EGD B;  1VQP Q;  5CAI A;  5KFM A;  1EHI A;  2QGG A;  1N56 A;  3L2R A;  4YY3 H;  4X65 H;  2RQR A;  4X34 A;  4JJN K;  3K3P A;  5KCO A;  2XI9 A;  3M0P A;  3N43 B;  4KUL A;  3K3V A;  1NE8 A;  2QDY B;  2LQK A;  3QWX X;  1H8K A;  4EGQ A;  5LJ3 g;  1BI1 A;  4IR1 A;  4LF7 H;  3HKS A;  4FM4 B;  4YAJ B;  2VGM A;  3MP1 A;  9ATC B;  2VUM G;  3CCJ Q;  2HSE B;  5KT3 A; 
#chains in the Genus database with same CATH homology
 2QYZ A;  2P84 A;  2OX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...