2QYZA

Crystal structure of the uncharacterized protein ctc02137 from clostridium tetani e88
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
NREVKFRAWDKELNMMVYTKEQTGHIEYNTNPADTINIILNQDDYGYVFMQYTGLKDKNEKEIYEGDIIKKSNRSSNLYEIIYQDSIACFRCKVIKGDIKSFPCLNIGTVRNCEVIGNIYENPELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of the uncharacterized protein CTC02137 from Clostridium tetani E88.
rcsb
source organism Clostridium tetani e88
molecule tags Structural genomics, unknown function
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.290 Mainly Beta Roll SH3 type barrels. YopX-like domains 2qyzA02
3.30.1490.160 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ctc02137 like domains 2qyzA01
2P84A 2OX7A 2QYZA
chains in the Genus database with same CATH superfamily
4C5AA 3FDSA 3J81W 2RHIA 4RB0A 3LWHA 3P8HA 2XCPA 4ELYC 4A3FG 2FJZA 3OS1A 2ZGWA 1BCOA 4KH0B 4E6RA 1BYMA 4R7RA 4A2BA 5FWBA 4M75G 4C92C 1RAIB 2F5KA 2GBQA 3VKIA 3CCVQ 2O88A 5HCKA 3BJYA 3SWNA 3LGFA 2M51A 3VRZA 3G7ZA 4E7JA 3M59A 1FMKA 1FXXA 2LVMA 4L1KA 1WZOA 2YWWA 5IP9G 4A2AA 3EPIA 2F1LA 4X62H 2CREA 2LZ6B 1JIHA 5FD5A 3MFHA 3OYYA 3G71T 1W2BP 2RQWA 2C35B 4IUVA 2X0SA 2ROLA 3A1PA 1KK7A 3T5HA 3EHRA 2BTTA 1VQ8Q 3FDRA 4JLIA 1QVGA 3CCQA 4Q0YA 4MZPA 2DEQA 2QI2A 1M0TA 3QPHA 2PVDB 5KFGA 2D9TA 5GMKe 1OU9A 3OYNA 4RMOA 1CSKA 1RI0A 2HL3A 2FLNA 1BXRA 3CCSQ 1AZGB 3CCUQ 2P4RA 1M5Q1 2UUCH 2RJDA 2XIDA 4M77G 4C8QB 4KGVB 4JV1A 3PT9A 1M90U 1AWJA 4ED3A 1C30A 2VQDA 3QKJA 1K9MC 1Q7YR 2YLBA 2JTMA 2NUAB 5KFQA 1M1KU 3PIPA 1VQPQ 1NLOC 4FYWB 1X2QA 2V1QA 3GV8B 2HVQA 3N5BB 1EUDB 1Q86R 2J6OA 4TUYF 4RTZA 5CKBA 1ABOA 3RV4A 3EGDA 4EFEA 4Q8FA 5LMUH 2YUNA 1AWOA 4PWQA 1ZSZB 3PR5B 2PTKA 4DV0H 5KYXB 3CXCA 5KH6A 2E64A 5CKHA 2UVUA 2VGMA 1AWWA 1W2BS 1Q81R 1RK5A 1RAFB 7AT1B 1HK9A 2IVWA 4OP0A 3JCMh 5L9XA 4E7HA 1WHGA 2LRQA 3WNZA 2KK4A 4HKEA 1ZHQA 1VQMT 2KI7A 4ZGEB 4JJCA 4J9LA 2ESWA 5GANg 2CKZB 1QLYA 1H641 4MZMA 3CC2Q 1FJGH 5CO7A 2LT4A 4F7UF 3OYMA 3QFFA 1OOTA 5KFNA 4ELZC 5DQHA 2VKNA 2XMFA 1IOWA 3RNJA 1A0NB 4M4ZA 5KFAA 2RQRA 2KSWA 2KQWA 2K5IA 2GLTA 3JSNA 2ATCB 3CPWP 1BKBA 1T36A 3T1YH 4GBQA 4PLIA 2R82A 2OH2A 3R6OA 1K8AR 3HRSA 1TWBA 3BY7A 4ZGJB 3QXEB 1G2BA 1GSOA 3TQ1A 4PDBA 2QQBA 5IYZF 3L42A 3BQ0A 3V8JA 1YIJA 1I50A 1NYGA 2KEAA 1NE8A 4QWBA 1QWEA 4A3EG 4J9GA 3IQLA 1RADB 4HVUA 2L3RA 5LXTF 5C4XG 5FW9A 2DK3A 1YI2A 2R7NA 4WCIA 1VAJA 4M7DB 3HRTA 5I11A 4PJOD 4QIWE 1VQ5T 3VS0A 4HQ6A 5KFZA 3E9FA 2E1HA 4JS4A 2ROTA 1C6VX 1EUCB 2RK1A 3OBWA 4DR3H 4RTXA 4E47A 4FYVB 2CW7A 5KT2A 4RTTA 2OAUA 4Y91A 4E2FB 3T1HH 1VYUA 3N6XA 3TIGA 1AN7A 1VBGA 4YB8B 1T0HA 2KYBA 3CBPA 4DQ2A 4DR2H 4QWEA 3VS7A 2DD4A 4M78A 1IO6A 2E10A 1VYTA 1VQ4T 2DVJA 1E4EB 4IWXA 4HVVA 2KNBB 1NZ9A 5EWGA 1MGQA 4QW8A 4M7AD 1W70A 3TSZA 1VUBA 4HNVA 5KFXA 1AUVA 1LCKA 2GQIA 5I47A 3H0GA 1WXBA 3T5KA 1YJNQ 4UFZA 2E5LH 2DL7A 2R8GA 3ZFJA 3MWEA 4NL2A 1QW1A 3QBYA 3S6WA 5GAN8 2R8JA 2VUMA 3E19A 3L4JA 2F2WA 3UT1A 2R8IA 4RUGA 2WAQA 3TCJA 2KR3A 2DAQA 4IUPA 4RB3C 3OSPA 2FL7A 3A5ZB 1PD0A 2FPIB 3OYLA 1FMWA 1X6OA 3G71Q 2J06A 1EZZB 2FK3A 3LW5E 2LP5A 1EFNA 2XD0A 1T3LA 2I87A 3BA9A 2VQFH 4QT7A 1FVIA 1XNRH 1S72T 3HOVG 2W7OA 3VRYA 3M0RA 2RNAA 2WSEE 2YU9A 1WJRA 3HKZA 2DYIA 1XNQH 4LDUA 1RJQA 4C5GA 3M0QA 4MV9A 1TUCA 4FS2A 2DPIA 3C0FB 1SRLA 3J81E 1GFCA 4I7HA 3DB3A 5GAMd 3GIJA 5GANf 1GRIA 3V4ZA 1G3YA 4A3BG 2Q2TA 1B34B 2DJQA 4C92B 2PUKB 2CZ7B 4OB3B 3I4NG 4OGCA 2AHJB 2E3IA 2MOXA 3VS1A 3I56T 4RAYA 3QYGB 2VB6A 2JEIA 1WQWA 3QZ5B 3M53A 1YP5A 4VUBA 3TU4K 4J9NA 2RHXA 2V4QA 4O3RA 2VPQA 3CC7A 4XU1A 4O3QA 1VIEA 1ZQ1A 3OYEA 1N32H 2VXEA 5GAN6 4C92F 4BD3A 3C0CA 4GY5A 1OWTA 2GTJA 3OSNA 3IN5A 1VQ6A 4GKKH 3T5JA 3UA6A 4AG2C 4AMCA 2EQMA 2CKKA 3SE7A 4CC6A 1VQMQ 1I1JA 3EFOB 4LXCA 1ZBXA 1X01A 4KHPH 1BB9A 2PMZA 3M4YA 2CS7A 1X2KA 2HQHA 1X43A 1ZA2B 8AT1B 3FJPA 2P4TA 1ZETA 5BMVF 2C0OA 4OMFB 2LCCA 4GC6A 2ZPIB 4ECVA 4Q44A 4PKCC 3CCMA 2MWPA 3CCET 1KEEA 2J05A 4LNPA 2RO0A 5GAN3 3M9OB 1KJJA 3EPGA 4JZ4A 1WFWA 4M77D 2E5QA 3RR6A 5GANj 3V6JA 5KFPA 2FG0A 2QAZA 5KFVA 1PK8A 4O2BF 4EBCA 1CKAA 1SSHA 4J9OA 1VQOT 4U6PA 3N40P 3QJYA 4II1A 1N48A 2YSQA 1KC7A 5IYDG 5GJWB 2O4XA 3EGUA 4DOVA 2NU6B 1VQ5Q 4M75C 4M78E 1Y96B 1N9SA 4XAXB 1YJ9T 4C5CA 1Q82U 3V8KA 2L2PA 1JJ2P 2JS2A 4A4FA 4HYKA 1VQLT 4QW9A 3LX7A 3ORRA 3L2UA 5IN1A 2VQEH 4RAZA 1NEGA 1N8RC 1C1AA 2LJ0A 1I81A 5FROA 4F17A 5HBRB 1VQ4Q 2DPPB 1S68A 2RMOA 3SI8A 1D09B 3QJ6A 1G5VA 3I55T 2CZ6B 3PVXA 2WAQE 1JDEA 3FB9A 4RUAA 2UVWA 3PO2G 1K9AA 2RQVA 1DV1A 1Y1VA 3OQ5A 3VU3C 3OBYA 4QJFA 1D1CA 2QGGA 4CC4B 1Y7XA 4M77C 5GAMg 4RNMA 2GPSA 3GTMA 2IIMA 2UUAH 2B63G 2DRMA 4MV4A 2M05A 2KYMA 2DYBA 3JB9D 3SB2A 4FSSA 2SRCA 1KIKA 3HKZE 4JI4H 5LL6b 1KJ9A 2JVVA 4A3IG 2E65A 4IRCA 4A3CG 2YZMA 4D6WA 1UGSB 1NJIC 1KFZA 4BXXG 3I4MG 2HKQB 1YHQA 1S72Q 4OF1A 2YUOA 3Q2OA 4LFCH 2YUQA 4HA8A 4DR6H 4RZQA 2B8AA 1YITA 3RFCA 4DBQA 5KFKA 2DM1A 2HMAA 3JCMV 5GAOl 1QVFP 3G8CA 4ME7A 1B6SA 1W2BA 4MZTA 1E7OA 1I4K1 3MP6A 2HSEB 4J5YA 2NUTB 2QEXQ 1J3TA 3LP8A 3OY9A 4JV0A 1GBQA 3V7SA 2NYSA 4ZOLF 1W4SA 4JI1H 2FK1A 4YJ3F 4M9UA 1TWAA 3BQ2A 4C0GA 4EPCA 3AT1B 1VQ7A 3KHLA 4EBDA 2VA3A 4CC5A 2ZCFB 4ED2A 4J6YA 3I56Q 4BDZA 2JNGA 4C8QA 1PHTA 5KFHA 1S0NA 5C1PA 1IREB 3PMTA 4DR1H 1EHIA 5IXBA 1ZUUA 4JI2H 4DL7A 2PMZE 2R85A 3U9TA 3CCLA 4RG8A 3FJ5A 1W96A 3DLMA 2PVGB 5LMNH 5KT6A 5KT4A 5IWAH 1MNDA 1WHJA 2W71A 2KDSA 1KJ8A 2KXDA 2JMCA 4DEXA 1Z9QA 5EC7A 5GAN2 1M1GA 1OV3A 2DZDA 1PSEA 1S0OA 3QYHB 5D6XA 3QZ8A 3G6YA 1ZX6A 3CCVT 3GV7B 1OU8A 3HTRA 4F7UA 5KYXA 5HK3A 1K73C 1QVFS 4DV2H 4DV4H 3M0SA 3FIFA 4XZ3B 1M3BA 3HBLA 2P0PA 2R87A 2R7ZG 1TUDA 3MEUA 1UECA 4JI3H 5DQIA 3K5HA 3CCEQ 4C2MA 2MPXC 4LDYA 4FM9A 3EG9B 3OYCA 9ATCB 1GCQC 1P92A 2R8HA 2KRMA 2E6ZA 2I2LA 4RTWA 5EG2A 2CW8A 3CMAT 4QWDA 4QVZA 1Y57A 2FPFA 3CCJQ 3PW0A 1MHNA 1MUZA 4A4KA 3CCVA 3CPWA 2FKLA 1VQOQ 3TIIA 2EYXA 2YRXA 1D0ZA 1Y14B 2KT1A 1JX4A 3ZL7C 3JCMc 1KD1C 3MWDA 1FMVA 1YWOA 5GAMf 5KG1A 3EFRA 2O01E 1RL2A 1YJ9Q 1K1SA 5DG7A 2C2DA 1VQ8A 2B86A 1VQLQ 2G6FX 2VPSA 3GIPA 4HT8A 1KBLA 4LH7A 4HT9A 1WJQA 1U1SA 4XYLB 2HBWA 4PJOG 4M7DA 2BQ3A 3SDZA 4J9MA 3H0GG 5ECAA 2EVRA 3CCSA 4ECSA 2R93G 2MAMA 5CKFA 4R8UA 2CSQA 3CCUA 3I55Q 4MV3A 1XMOH 2R8KA 3MEWA 4IR9A 3H0IA 1N27A 1WLPB 3OTOH 3RB3A 4JPBW 4I55F 5GMKl 1JB0E 2KE9A 2UXCH 5IHIA 2W7PA 2E5KA 1FYNA 5HK0A 1VQPA 1YFNA 4IUUA 4ZHQF 5KKNB 4PJLA 3PW4A 1IHWA 3WVDB 3GPLA 1KC8R 4MTEA 1IRXA 1E4EA 3PN1A 4M7AG 4DL2A 4BE2A 3GLKA 1SHGA 5A2QW 3H9NA 3CC2T 3DF7A 4BE0A 5I2MA 3QO3A 4LUDA 5HY6A 4O3OA 2RQTA 2HAXA 1N56A 2NUPB 4M75B 3MJXA 2C0TA 3L4KA 1K0XA 1Y71A 1NM7A 5IHNA 4EGQA 2FZGB 5GAMj 4ZTJA 5JQWA 1M9SA 3H3VH 2K2VA 4N0AC 1UGQB 2LQKA 3FRNA 5FWCA 2PU9B 5H80A 3VPBA 1QKXA 4E7KA 5BPFA 1KSWA 4OMMA 2X9HA 2KXCA 1D0XA 4IWYA 5BPHA 3CC2A 1KQ1A 3LH5A 5JVDF 1G8XA 2ZPFB 4UCSA 2EQIA 2F2VA 1S10A 2JA8G 1Q7YC 2LNVA 1TA8A 4C8QE 2CZ0B 2FEIA 3G6ET 2JTFA 2XCAA 1JRIA 2EQUA 3GBQA 4N4IA 2RQUA 5GANd 4AQYH 4J6XA 1O75A 2I0NA 1UE9A 1Q86C 2M0OA 2AGOA 4LE9A 4NS5A 2VR1A 4OMNA 1QP2A 2X4WA 4O3NA 3FEOA 2XHCA 2RHYA 4KRTA 2FLPA 1Q95G 2WB1A 2CT3A 3OMCA 3MP8A 3JV3A 5KCOA 1Q82R 4JRPA 4QIWA 1G3SA 4MAMA 1I7NA 1Q81C 5LL6S 3OW2P 3UQ8A 1N6AA 1M4ZA 2NUZA 2IBKA 4F7UE 1B34A 4F04B 5KG2A 2CYZB 3BABA 2KBTA 5C0MA 4MMKA 4EMGA 4C92A 5GAMh 4XU0A 3INZA 3QZ9B 1IHVA 1T3SA 1AWXA 1XOVA 1SKUB 2FB9A 4A3KG 1YJNT 4M77F 4ED7A 2CUDA 4FT2A 3EG3A 4L6V5 2K79A 3H20A 1XQHA 2I8CA 3E5NA 4GLKA 1RABB 5GMKj 3OYHA 4A93G 2OTJT 2COZA 4P5NA 4RCBA 1UUEA 2CQYA 4EMKC 3NTKA 2JA5G 4C5EA 1QP3A 1TTHB 4L59A 2D1XA 1K8AC 2W9CB 1VYVA 2AT1B 2LTOA 2HL5C 4YQWA 1ULZA 1GXIE 2BZ8A 3QSUA 3KXYT 4RB1A 3RBEA 4JJNK 3M54A 2W6MA 1TS9A 3EFOA 2E12A 2KY9A 4EIKA 1UC8A 2ZDQA 2L8DA 1YJNA 3CMAQ 2LCLA 1ZHIA 5LA6F 4RB2C 2ZPHB 2W6PA 3M9NB 4R55A 3UA7A 2R57A 3DLLA 1I94H 4DR4H 1WHMA 2IPOB 3MR6A 2BE9B 1VA7A 4AFZC 1IGUA 4JZ3A 3OS0A 4PJNA 4J83A 2W70A 1UJYA 1DJ7B 2YRWA 2MK5A 2R92A 1FX7A 4BY6C 4CC3A 3OW2S 1Z2NX 1N5ZA 4EBEA 2NVXA 2COWA 1TUGB 3C94A 4M7DE 1XMQH 4A3DG 1AOJA 3G71A 4IUQA 4I4TF 1WHHA 2P0AA 3NGPA 2DETA 3QUIA 1QCOA 2X4JA 5IAYA 4E7IA 3RKXA 2PNIA 4EMHA 2VUBA 5GAOn 2W8LA 1PCXA 2I80A 3VUBA 1X6BA 4JRIA 1KQSP 3PZPA 1CKBA 2YLCA 2SEMA 4LF5H 4WBNF 1Y96A 1U3OA 1JJ2A 4J9BA 4F7UB 2W9BB 2W9AA 2LDMA 3BQ1A 4TV9F 2HHHH 4A3JG 2EAYA 2SCUB 3Q8RB 2M02A 5CAEB 2UVRA 2FPDA 3CQZA 3RV3A 1M2OA 3Q1JA 2XDPA 2V58A 5KYYB 4UCVA 2FLLA 5LJ5g 2L3QA 4DV3H 1UJ0A 3I5SA 1BI3A 3P8DA 3VS3A 2CP0A 3CVZA 2DLNA 4CC2A 2E6NA 3O5ZA 4YR3A 4AFSC 3BDUA 2XIGA 1TXQA 3MCAB 3PVLA 4O4LF 2Z0WA 3C95A 5EZYF 2A28A 2VYTA 2RDIA 2FPEA 4QQGA 5KFSA 1JDBB 1UNNC 5KFDA 4LN2A 2LCSA 3X28B 1VQMA 3JB9G 1UTIA 3TQTA 4BDYA 3A98A 3KHRA 2W0ZA 1KQSS 4M78D 2MCTA 3ASKA 4EDUA 2A36A 2WB1E 2YZNA 5KFIA 3HP9A 5FLMG 4J7IA 3G6EQ 3RKYA 5KX5F 2Y4YA 4HXJA 3H4DA 1SFOA 2JXBA 5GJVB 4R8UB 4LF7H 3WXMB 1M3CA 1KG1A 5KE3A 1J5EH 4C92E 3LGLA 3KTMA 2QXFA 2NUTA 2J6UA 2EYYA 1HR0H 2K3YA 1V4YA 4DL4A 2YW2A 3QG1A 3G4ST 2EYWA 1ZHSA 5A2QE 2R7MA 2BQRA 4UCUA 2C0IA 1NEBA 3VS4A 4K11A 1VQ5A 1GLVA 3HFNA 2Y90A 5CVIA 1RI9A 4B3SH 2EGCA 3VPDA 1HNZH 3U23A 2JTEA 1BU1A 4OB2B 3PR4A 2JW4A 3OSVA 2PVOB 2WDTA 4XX0B 3M4GA 1I3QA 1WXTA 1QWFA 1OULA 4PJMA 2PQWA 3L1AA 2NVYA 3VS2A 2OTJQ 2D8JA 3NGDA 2HVSA 2FRWA 1I7LA 5CR2A 3RJ0A 4LUEA 2AZSA 1VQ4A 1UGRB 4DOWA 2QTXA 2GPWA 3ETHA 3JB9I 2HCKA 4Z89A 4MV1A 5D1OB 4IIOA 2EWNA 4QWCA 3JB9H 1M7JA 3FKIA 4J9IA 3N8DA 4X9DA 2JA7G 4PJOC 4J9PA 2JJ9A 4DV1H 4DBHA 4O3PA 3G6XA 3HFOA 2CP7A 1BIAA 4DBRA 2DTOA 1PNJA 4ATOA 5KFLA 1U8RA 1B04A 2LX9A 5KYWB 1S0MA 3EG9A 4C5IA 4J9QA 4BACA 2LQNA 2EGAA 4B6MA 2YRDA 4A4GA 5LJ5f 2VOBA 3PW5A 2QEXT 3CC4T 4EYHB 4ED6A 3CEYA 1M2VA 2DD5A 2R5AA 2JEGA 2FVUA 3HL8A 5KFRA 3LH0A 2JA6A 1OPKA 4M7AC 1JQQA 3K3PA 1S72A 4J8OA 4BY1G 3PIOA 4KH1B 4CI0C 2DL3A 3R5FA 4J9EA 4XTXA 3TEEA 4TV8F 4Q8EA 5KFMA 2HQXA 4XU3A 1WIEA 1O9SA 4EMKB 4J0MA 5A0DA 3VPCA 3EAEA 5DGBA 4O4HF 2W6NA 2DE0X 2QEXA 3QWXX 2XGPA 1Z2OX 4RTUA 2D0QB 4C5BA 1MMGA 1GFDA 2EYQA 2RJCA 4ECRA 1D1AA 4HCZA 5KFYA 4ESRA 3RESA 2BIVA 4PK4A 1PG5B 4DV5H 3VS6A 1Y1WA 1WPYA 2A08A 3I56A 4YY3H 4LFBH 3UWNA 4PL6A 1L2ZA 4LH6A 1IBLH 5IT9W 2FE3A 2EFIA 3THKA 4RU9A 2CUBA 1PRMC 3LWIA 2GFUA 4BY6B 1CE8A 1PKTA 2FMAA 4ECTA 1RAEB 3GTKA 2X4XA 5DLFA 1I6UA 3OUUA 3A8GB 1I8FA 3EH1A 4LD9K 1MV0B 3RUXA 1D3BB 4MA5A 4YJ2F 3P8BB 3CMET 4UCRA 4IZOA 5KFJA 3JAMW 2NU8B 4R56A 2DFUA 1DGSA 4B3RH 2LMJA 3KHHA 3CCJT 2FPGB 4EGJA 4E7ZA 2PZ1A 2DRKA 2VVKA 4FCYA 1WCMG 5FRMA 2NUPA 1GSHA 1T94A 1VBHA 1UG1A 4M75A 3RIRA 2XICA 4LD6A 3GNGA 1BIBA 3M0TA 2ABLA 5I22A 2JEFA 2V8KA 3CQTA 1GCPA 2LC4A 5LYJF 5LP6F 3CCEA 3QDRB 2JM8A 1MMAA 2RM4A 4FYYB 5LJ5e 4O5VA 2J9GA 1B7TA 1WQ7A 1ZQ7A 1M90R 3E2UA 2GCXA 2QDYB 1A0IA 4HVWA 4JS5A 4GC7A 3V6KA 4G3IA 1M1KR 1VQOA 3G4SQ 4BI3A 1SCUB 5KG4A 4ECYA 1OI1A 3N43B 2C22A 2IG0A 2H3JA 2OI3A 4NXMH 2MIOA 3AYHB 1MZBA 1B07A 3PGGA 3OA6A 1A9XA 3ME9A 5GANh 1YJ9A 3OYDA 3U9SA 5F9LA 1OX8A 2O03A 1VQLA 3OW2A 4DL6A 2UVVA 3OHBA 1JXLA 1OYXA 1QVGS 1LNXA 1TH7A 2EW3A 2QDLA 4R0KA 2KRNA 1B33N 4PNOA 4RZRA 3I12A 1M8VA 3L2ZA 1GBRA 3L2WA 2M1HA 2K6DA 4BBSG 2NLUA 3I55A 2C2RA 5C3EG 1X9NA 2F2XA 2NU9B 4EFBA 1RK6A 2P84A 3CCRT 4NL3A 3SD4A 2MMPA 1AZEA 5FU6C 4DA4A 2ASJA 2BE7D 3H8ZA 4F16A 4FU0A 4DUZH 3GV5B 2FB7A 2R92G 1X27A 2QQ9A 4FW2A 3TSWA 4C8QD 2W9CA 2EGEA 4OB0B 4X1VA 2Y4XA 1M27C 2R7KA 2FZCB 2GNCA 2V26A 5FPOA 3CC4Q 4IHJF 2FHDA 5IH2A 3KBGA 1S9FA 1AHJB 5GAN4 1QCNA 2LX7A 3H6ZA 4BWSC 1E6HA 1TOVA 2A3LA 3ZEHA 3HXLA 2FK2A 2K2MA 1MMNA 3JB9J 4E7LA 1TAEA 1XDNA 3RIZA 2DTHA 2DXCA 4XK8E 3JCMJ 3UFXB 3VMMA 4ZN3A 2EBPA 4XQ3A 2KMTA 2P0KA 4UCOA 4J6WA 4HR7A 1IXDA 1TSFA 2DTIA 1SSFA 2DXUA 2UUBH 3CC7Q 2PN1A 4ZGDB 5GAN7 4C0DC 4EG0A 1Q86U 2X3WD 4N4GA 2X35A 1SYXB 3BG5A 1KC8C 4PJOB 2OWOA 5D7UA 4Q45A 3PW7A 4DV6H 2DILA 3M0UA 5LJ3e 1GO3E 4PJJA 5KFUA 1V9PA 2HNIA 5CKDA 4DV7H 3E9GA 2AGQA 3PO3G 2W9BA 1Q81U 1VIFA 4PFPA 4LSXA 1UB4A 4LF6H 3GOXA 1NG2A 1GCQA 4Y28E 4UC4A 4C8QC 2RH2A 2UXDH 4FT4A 1AD5A 2LNHB 3A8HB 4M75E 1KQ2A 3Q8SB 4PJOF 3TREA 5D6WA 5KYYA 3CMEQ 1RAHB 4XTWA 4M7AB 2QASA 3R5XA 3MO8A 1E4GT 2E2IA 2A0FB 5LOVF 4ZQIA 2YUPA 1M2VB 2KRSA 2EIFA 2V1RA 3MFIA 2DZ9A 4M7DD 4YBZB 4EEYA 1ZBJA 1ZSZC 3L2RA 1K8AU 2CZGA 5DQGA 4LF9H 2A37A 4A53A 3RB6A 3MKDA 2DBKA 1MMDA 2XDBA 2YCHA 3KHGA 5C8YF 4QVCA 3V4SA 4M7AF 2NWMA 1M3AA 3ETJA 5DM7R 2E2HA 1RYRA 1IZ6A 3EH2A 5DLQE 2QA4T 1Q82C 5GAOr 3CMAA 4M78G 1P8LA 2O2OA 5IYCG 3JCMb 3X24B 2RA2A 1JU5C 1OZ3A 4JDSA 3GTJA 4X65H 4X9CA 2CDTA 2M9UA 5CK9A 2ASLA 5CA0F 2RN8A 4OX9H 5J2UF 5CB4F 1IBMH 5IT9E 2RGRA 2K5LA 3VYGA 3QWYA 2DEUA 1EYZA 3CPFA 1Z2PX 4JLGA 1VQKT 5FPRA 5KFFA 1K9MU 3BAAA 2YZGA 4FL6A 2OTLT 4MMLA 4TVRA 4ETSA 5FRNA 2VUMG 4PFOA 2HJWA 1PM3A 2UXBH 3EHQA 1F1BB 3JAME 2OLSA 4O2AF 2RJFA 3M9QA 2E70A 1GSAA 2J6SA 3BW1A 4BI8B 4QWAA 1QVPA 3RMSA 1DV2A 2JEJA 2M16A 2CZ1B 2DL5A 1ZUKA 4IURA 2QGFB 4WTOB 4N0AA 2YHTA 2RHUA 3MJFA 2JUFA 3CCRQ 4BBRG 4M7EA 3JCMX 1N33H 4QKUA 5KFCA 3HHTB 5EWFA 1N34H 3J7AK 4ZNXA 3GTLA 1HJDA 1QKWA 2DIKA 2CSIA 2DBMA 4Y8VB 5EWEA 3NPFA 2WTFA 5D1OA 4ECZA 2YRVA 2EKOA 2ALZA 2XI9A 3JCMQ 2ED0A 5LJ5d 1E6GA 2W8KA 4D8KA 5CA1F 4C92D 1GL5A 3GIBA 1VOMA 4JI0H 2DIGA 2KSSA 5J26A 4ECQA 2RJEA 4MTDA 1UDLA 4JRQA 4U7CA 4IRDA 4MDWA 3R23A 4LMYA 5FLXW 5CCAA 5KYWA 1VQ9T 4O3SA 2COYA 4M77B 4A54A 3EGXB 4UCTA 1R9TA 5GAOm 3QZ7A 4HNTA 2DKGA 3KAKA 1SG5A 3N44B 3V8LA 2XGQA 4NOYA 1RJRA 5GMKi 3GIQA 1D1BA 2JN0A 3G6EA 3GNFB 1UEBA 3HRUA 1W93A 2IP4A 2W57A 1N36H 5L1IA 4WD3A 3WO0A 2DO3A 5JVLA 1EZ1A 3VS5A 1TWGA 4OMQA 2DX1A 1H3HA 2YRCA 2RHZA 2HVRA 3PMIA 3HPWA 4EMKA 3M0PA 2BQUA 1YNZA 2RF0A 5D1PA 3A8LB 2NU7B 3GP8A 5J2TF 2LQWA 3SFMA 1RAAB 1KHCA 3Q8PB 1SPKA 5T14A 1IB8A 3M55A 4DUYH 5HKCA 3K3VA 4A3GG 4J9SA 1BBZA 4HCCA 3HOZG 3I35A 1I5OB 1WNLA 2RPNA 3OUZA 3CCQT 4ME6A 2C28A 2O9SA 3HOXG 2CP6A 5K2MA 1K4US 3EG1A 3GLXA 3OYIA 5KG6A 5GAOq 5CIUA 4FBTA 3ER0A 1Y07A 4HNUA 2OTJA 3RBDA 5D8DA 1UHCA 5BR8H 1UGVA 1V1CA 2DXBA 3RKWA 3SWNC 1D3BA 2AKLA 3BFMA 4BUGA 1YBYA 2DNUA 4C0DB 4JRKA 2K3BA 2XDDA 2B63A 2BUDA 2ECZA 2QQRA 2DIQA 4KULA 4X64H 4MDXA 3JCMP 2QA4Q 3TQ7P 3GIIA 3VUZA 2V8JA 5GMKh 4RTYA 2IMWP 2G3RA 1SHFA 3OSSC 1HNXH 4BI4A 1YN8A 4APMA 4QW2A 2WE6A 3LLRA 3GIDA 4GLXA 1PC0A 1OEBA 1UGPB 1M6VA 1Y1VG 3JB9F 1BJTA 5L1KA 1VQKQ 4LDWA 2VA2A 2OTLQ 2EJGA 2QK0A 2RK2A 4JUVA 4A4HA 3E1SA 5JUMA 3JRZA 5C44G 3GQCA 2WSCE 1SEMA 2K5FA 1CQJB 5LJ3d 4MV8A 1B6RA 3JCMe 5KFWA 1TU0B 1XTDA 4FBUA 4ORZA 4DL5A 4C0FA 2K9GA 1SEIA 1KJWA 4C8QF 1VQNQ 2DPJA 2VV5A 5GONF 2YDLA 2DF6A 2J6KA 3RBBB 1QMCA 1XJWB 3FC3A 3V7CA 2JM9A 3ORQA 2H8HA 2C00A 4OMPA 5KFEA 3BA8A 3D7SB 1EX4A 1RUWA 1ZLMA 3UF4A 4CRIA 3H41A 1RLPC 4RTVA 4Y92A 2FPPB 5KT7A 5L23A 2VWFA 5KG7A 2VC8A 4ECWA 3I5RA 3MR3A 3MP1A 1YIJT 4OMLA 5GMKm 4HCKA 2CT4A 3X20B 3GTGA 2HDAA 5CQYA 5KE2A 4MV6A 4F4WA 2A7YA 3EG2A 3T9NA 1HSQA 3LMLA 1YI2T 2MCNA 3M5AA 5DLGA 2EYZA 2JT4A 5FU7C 3FMAA 4F4YA 3PE0A 2RGVA 4KGZB 1YJWQ 3A8MB 4ZN1A 5F9NA 4F50A 4ED0A 2R7ZA 2DZCA 1QVFA 3M4IA 1JXOA 1BI1A 4C8QG 1S1NA 1I5LA 1R77A 4FS1A 1NYFA 1VQ9Q 3G1JA 2HGSA 3OYFA 3CD6Q 3WO1A 4J9KA 3GILA 1NPPA 3MEVA 2HD0A 1GYFA 3I9QA 4EEQA 4XTUA 3FLGA 2WYOA 2ZZDA 4RG2A 2GFAA 3PFSA 1WHKA 2HBPA 1X75C 2XCLA 4DR5H 1NBEB 1R0BG 1R8OB 3PNWC 4ZI7F 4LFAH 3VYHB 1SF9A 1H8KA 1AVZC 3NHNA 3OYKA 4E4TA 1HNWH 1NLPC 4F7UG 3EYYA 1K1QA 3S3NA 2XC9A 5AYFA 3VJPA 4IR1A 1UC9A 4J9DA 1K9MR 6AT1B 1N8RU 3TINA 5KFBA 5DLOA 4IIMA 2O9VA 5D6YA 4M7DF 4NXNH 4J9RA 5I21A 5L1JA 2DVEA 3R6NA 1X69A 3REAB 3G4SA 1TWFA 2EJ9A 1TWHA 3CBMA 2ZAEA 3QDFA 2M0YA 4PJOA 3M9MB 2DWCA 5J39A 3CPWS 4M78C 5C5JA 2R93A 4AYBA 3CCQQ 1WR2A 5L8RE 3J80E 3J7AF 5CQXA 2AK5A 1HXDA 4F4ZA 2PUOB 5DG9A 4JI6H 2FZKB 5FD6A 4JI7H 1C3OA 1C0MA 4YHHH 5FLXE 3RMQA 3RERA 4YR2A 4DR7H 2WACA 3JRXA 4MA0A 1S97A 4Q43A 5LJ3g 1T3NA 3RTXA 1WA7A 4M7AA 5KYUA 2V5AA 1NJIU 2HZYA 1ARKA 1D0YA 4KGXB 4RKUE 3RGZA 1M90C 1JLLB 2F4VH 4OB1B 3KUFA 2MF2A 1K83A 4M7DG 4O4IF 2L3PA 2RF4A 2VGNA 4AFQC 4DEYA 1M1KC 3OYAA 2Y0SA 2YT6A 1PD1A 2KT8A 3NMZC 1E4FT 4A4EA 3PVQA 3N42B 3URGA 1N9RA 4V2SA 2ZPGB 5KFOA 3CC4A 5DY9A 3CC7T 1WX6A 4D8DA 2QG9B 1VQ6T 3OYBA 2DERA 5CAIA 1WYXA 5I2SA 3JZIA 2ASDA 4JJDA 2P0QA 1RJPA 1V29B 1HD3A 1FWZA 2HQEA 3K5IA 3RUPA 2J6FA 1IGQA 2HKNA 3V7RA 2JZ2A 3JRWA 3MPUB 4QQ6A 4M75D 3RAQA 1ZA1B 4FYXB 1WGSA 2RI2A 1X6GA 4B3TH 2BZXA 3SWNB 5KT5A 2J7IA 3CCMT 4MV7A 4QQDA 3BDLA 2FO0A 2XG8D 4J7FA 5C1OA 3RF2A 1PRLC 1KC8U 4X66H 4KUDK 2F69A 4X34A 1IBKH 4RUCA 3SEMA 4XTZA 5LJ5j 2OAWA 3MWMA 3F8NA 2YL2A 1SRMA 2DXTA 2PVPA 3RB0A 1XNIA 1R0CB 1BI0A 1YIJQ 2CP5A 4Z88A 1K73U 2CP3A 1TG0A 4JV2A 2IA6A 1QVGP 4J9HA 4AG1C 4J9FA 2FYKA 4KUIA 4DBFA 1YI2Q 2GGRA 1K76A 2K7AA 4F4XA 3KFVA 2RI5A 1QCFA 2MI6A 3NFCA 2W10A 3KAJA 1LOJA 2JA5A 1CS0A 2KGTA 3LWBA 3CMEA 2R6FA 3GIMA 1NPRA 4ECXA 2W6OA 4XYMB 3UATA 1RAGB 3KXTA 1WHLA 1I07A 4AT1B 1JXMA 3CCJA 3H0HA 3S3OA 3HSBA 1I0CA 8ATCB 1M1FA 4WF2A 3REBB 3F70A 2OJ2A 3DB4A 1H3ZA 2X4YA 4C92G 5J3BA 4N4HA 1KD1U 4IUTA 4BB7A 2OX7A 3TVTA 4K0KH 3EGDB 1HYOA 5LJ5h 3EFSA 3JCMW 5JH7F 5GANe 5DGAA 3C4SA 3JCMd 3UPUA 4M77A 1UHFA 2VXFA 3CXCP 4PJOE 2ZDGA 5LJ3f 2Q2UA 3EGXA 4A3MG 2ZPBB 1QQJA 4GLMA 2EKHA 5IXFA 4AYBE 2QQSA 3Q1KA 3HOWG 2V4RA 3S3MA 1PKSA 2L0AA 2JS0A 5FU7B 1IOVA 3IG0A 3VV0A 4TQRA 1JKJB 1GGOA 4A3LG 2LQ8A 1YHQT 2E3HA 2V8IA 3PTAA 2R58A 4M7AE 2CP2A 1W1FA 4YR0A 1YITT 2F5TX 4Z02A 1WSCA 3OMGA 5CKEA 2L89A 1PX2A 5EOYA 2GF7A 1AUXA 1WJSA 2LJ3A 4TQSA 1YCSB 2Y0SE 1OZ2A 1BNCA 2JOYA 1G3WA 2QQAA 1TWCA 1YWPA 1KJIA 2ZDHA 2KROA 5FJ8G 1JJ2S 4IAJA 3CCRA 1PWTA 4Z8AA 1VQ7T 3CXCS 1WI7A 2AZVA 2DMOA 1WH2A 2XK0A 1FKAH 4DLKA 4OGEA 2YXYA 3CBOA 3EG0A 4FM4B 1K0SA 3H40A 3Q8QB 5LJ3j 1BK2A 5AT1B 4A63B 4ANJA 1EIFA 4IRKA 1Q7YU 3KALA 1H92A 4FW1A 2CGHA 3CCLT 1LVKA 2CH4W 4M78B 2VUGA 4RNNA 1V76A 5IP7G 2E4HA 3JSLA 1VQ6Q 4RNOA 1KJQA 2W6QA 1MV3A 4NLGA 2KVQG 1KQSA 1RYSA 1S03G 4ED8A 3OS2A 3A8OB 3MR2A 3JSCA 1Y0MA 2GQVA 3N41B 2XU8A 5KT3A 2RI3A 4CC7A 1U1TA 1JEGA 5KG0A 5DG8A 2R86A 2EQKA 4O6JA 4EYIB 3CCMQ 2MWOA 4M78F 2K57A 4JI8H 3OYGA 1N8RR 2PBZA 2YS7A 5KG5A 4XU2A 4FU6A 3HB9A 2R84A 5HV6A 4YP3A 3MR5A 1OQKA 2RB6A 5KYUB 3META 5LJ3h 1ZSZA 1BCMA 3GIKA 4B9XA 3L2PA 1WDXA 1BI2A 2X3XD 5L1LA 4JV5H 2QYZA 3GF5A 5KCHA 4XTVA 4DL3A 4BY7G 1U06A 2AGPA 4KT0E 3JCMg 1K1ZA 5KYNA 4YAJB 4ECUA 1VS0A 2DL8A 2ZPEB 4FSXA 2RD1A 1CQIB 2R7LA 4B3MH 1LPLA 2UU9H 5GAN5 4LF4H 4PFZA 2E41A 1T0JA 1ZUYA 4JJBA 4OVAA 4JI5H 3DKMA 5GAOp 1VQ8T 3NTHA 2DJZA 3O8VA 1AT1B 1KHIA 1U5SA 3C12A 1NJIR 3SHWA 4HCBA 3MHXA 2V9WA 4I50F 1B3QA 3X25B 3HOYG 4BE1A 2JA7A 2ED1A 2D0NA 4M77E 1M30A 3HOUG 1RACB 4YTLA 3CCST 5C6SA 2CH4A 3OHAA 4J9CA 3CCUT 1UFFA 2QTVA 4LSAA 2EQJA 2ZM6H 1LJOA 2KAFA 3UDCA 3L2QA 2EJFA 1VQPT 1DIKA 4YAKB 3T5LA 4RCCA 2QA4A 1W6XA 4Q5WA 2GTOA 2QK4A 3RB4A 2LT1A 4OMOA 1M0WA 1G83A 4JYAH 1VQNT 3FKIG 5A0GA 2V59A 1MNEA 1ABQA 2JMAA 3NTIA 4B9WA 4M7DC 2BKDN 3QIIA 2FP4B 4PLLA 1VQKA 3M56A 1YHQQ 2O31A 2VASA 2OTLA 4QVDA 4ZTFA 2D6FA 1ACMB 4L5GA 2WSFE 3LYIA 1YITQ 3X26B 4XTYA 2L5QA 3RAXA 1JO8A 1OX9A 2AIRB 2MYSA 4C5HA 1WXUA 1Z9ZA 3OYJA 3M57A 1AEYA 3H4BA 2X51A 1VKZA 2W6ZA 5IYBG 3L2VA 1YCYA 3MEAA 1VQNA 2XKOC 2AKKA 4GKJH 2XD4A 2FRYA 2ATLA 4LF8H 4IKFA 5M9OA 2JA6G 1K73R 4KBMB 5A0LA 3PW2A 2C2EA 4F14A 2D8HA 1YJWT 2HEQA 4FIBA 5KG3A 3OB9A 1M8MA 2LJ1A 2O4XB 2R5MA 3J80W 3GTQA 2BR0A 3BE3A 3WVEB 1VQ7Q 4LDVA 2ENMA 3H0FA 2K4YA 1ZSGA 1PSFA 2K3XA 3QHSA 2RDJA 2DA9A 1G3TA 2DL4A 3AHUA 2HSPA 3CD6T 2C06A 3R5HA 4M75F 3V6HA 2YYAA 4JUZA 5EDWA 3CCLQ 2ZJTA 3GTOA 1WCMA 2J6TA 3RDVA 3G6VA 4AFUC 1YJWA 4ED1A 5GAMe 4C0ZA 1KD1R 3JCMf 1V51A 3OS5A 3RGXA 1Y1WG 2BZYA 2H3EB 3GTPA 3ULRB 1RLQC 1JBMA 3M58A 2AU0A 5KFTA 2EPDA 5FU6B 4LDXA 3HKSA 2L3SA 1BGWA 2DLPA 1VQ9A 4E7SA 2YS6A 3CD6A 3ZBDA 2AQ4A 1OPLA 5IHKA
chains in the Genus database with same CATH topology
2P84A 2OX7A 2QYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P84 A;  2OX7 A;  2QYZ A; 
#chains in the Genus database with same CATH topology
 4C5A A;  3FDS A;  3J81 W;  2RHI A;  4RB0 A;  3LWH A;  3P8H A;  2XCP A;  4ELY C;  4A3F G;  2FJZ A;  3OS1 A;  2ZGW A;  1BCO A;  4KH0 B;  4E6R A;  1BYM A;  4R7R A;  4A2B A;  5FWB A;  4M75 G;  4C92 C;  1RAI B;  2F5K A;  2GBQ A;  3VKI A;  3CCV Q;  2O88 A;  5HCK A;  3BJY A;  3SWN A;  3LGF A;  2M51 A;  3VRZ A;  3G7Z A;  4E7J A;  3M59 A;  1FMK A;  1FXX A;  2LVM A;  4L1K A;  1WZO A;  2YWW A;  5IP9 G;  4A2A A;  3EPI A;  2F1L A;  4X62 H;  2CRE A;  2LZ6 B;  1JIH A;  5FD5 A;  3MFH A;  3OYY A;  3G71 T;  1W2B P;  2RQW A;  2C35 B;  4IUV A;  2X0S A;  2ROL A;  3A1P A;  1KK7 A;  3T5H A;  3EHR A;  2BTT A;  1VQ8 Q;  3FDR A;  4JLI A;  1QVG A;  3CCQ A;  4Q0Y A;  4MZP A;  2DEQ A;  2QI2 A;  1M0T A;  3QPH A;  2PVD B;  5KFG A;  2D9T A;  5GMK e;  1OU9 A;  3OYN A;  4RMO A;  1CSK A;  1RI0 A;  2HL3 A;  2FLN A;  1BXR A;  3CCS Q;  1AZG B;  3CCU Q;  2P4R A;  1M5Q 1;  2UUC H;  2RJD A;  2XID A;  4M77 G;  4C8Q B;  4KGV B;  4JV1 A;  3PT9 A;  1M90 U;  1AWJ A;  4ED3 A;  1C30 A;  2VQD A;  3QKJ A;  1K9M C;  1Q7Y R;  2YLB A;  2JTM A;  2NUA B;  5KFQ A;  1M1K U;  3PIP A;  1VQP Q;  1NLO C;  4FYW B;  1X2Q A;  2V1Q A;  3GV8 B;  2HVQ A;  3N5B B;  1EUD B;  1Q86 R;  2J6O A;  4TUY F;  4RTZ A;  5CKB A;  1ABO A;  3RV4 A;  3EGD A;  4EFE A;  4Q8F A;  5LMU H;  2YUN A;  1AWO A;  4PWQ A;  1ZSZ B;  3PR5 B;  2PTK A;  4DV0 H;  5KYX B;  3CXC A;  5KH6 A;  2E64 A;  5CKH A;  2UVU A;  2VGM A;  1AWW A;  1W2B S;  1Q81 R;  1RK5 A;  1RAF B;  7AT1 B;  1HK9 A;  2IVW A;  4OP0 A;  3JCM h;  5L9X A;  4E7H A;  1WHG A;  2LRQ A;  3WNZ A;  2KK4 A;  4HKE A;  1ZHQ A;  1VQM T;  2KI7 A;  4ZGE B;  4JJC A;  4J9L A;  2ESW A;  5GAN g;  2CKZ B;  1QLY A;  1H64 1;  4MZM A;  3CC2 Q;  1FJG H;  5CO7 A;  2LT4 A;  4F7U F;  3OYM A;  3QFF A;  1OOT A;  5KFN A;  4ELZ C;  5DQH A;  2VKN A;  2XMF A;  1IOW A;  3RNJ A;  1A0N B;  4M4Z A;  5KFA A;  2RQR A;  2KSW A;  2KQW A;  2K5I A;  2GLT A;  3JSN A;  2ATC B;  3CPW P;  1BKB A;  1T36 A;  3T1Y H;  4GBQ A;  4PLI A;  2R82 A;  2OH2 A;  3R6O A;  1K8A R;  3HRS A;  1TWB A;  3BY7 A;  4ZGJ B;  3QXE B;  1G2B A;  1GSO A;  3TQ1 A;  4PDB A;  2QQB A;  5IYZ F;  3L42 A;  3BQ0 A;  3V8J A;  1YIJ A;  1I50 A;  1NYG A;  2KEA A;  1NE8 A;  4QWB A;  1QWE A;  4A3E G;  4J9G A;  3IQL A;  1RAD B;  4HVU A;  2L3R A;  5LXT F;  5C4X G;  5FW9 A;  2DK3 A;  1YI2 A;  2R7N A;  4WCI A;  1VAJ A;  4M7D B;  3HRT A;  5I11 A;  4PJO D;  4QIW E;  1VQ5 T;  3VS0 A;  4HQ6 A;  5KFZ A;  3E9F A;  2E1H A;  4JS4 A;  2ROT A;  1C6V X;  1EUC B;  2RK1 A;  3OBW A;  4DR3 H;  4RTX A;  4E47 A;  4FYV B;  2CW7 A;  5KT2 A;  4RTT A;  2OAU A;  4Y91 A;  4E2F B;  3T1H H;  1VYU A;  3N6X A;  3TIG A;  1AN7 A;  1VBG A;  4YB8 B;  1T0H A;  2KYB A;  3CBP A;  4DQ2 A;  4DR2 H;  4QWE A;  3VS7 A;  2DD4 A;  4M78 A;  1IO6 A;  2E10 A;  1VYT A;  1VQ4 T;  2DVJ A;  1E4E B;  4IWX A;  4HVV A;  2KNB B;  1NZ9 A;  5EWG A;  1MGQ A;  4QW8 A;  4M7A D;  1W70 A;  3TSZ A;  1VUB A;  4HNV A;  5KFX A;  1AUV A;  1LCK A;  2GQI A;  5I47 A;  3H0G A;  1WXB A;  3T5K A;  1YJN Q;  4UFZ A;  2E5L H;  2DL7 A;  2R8G A;  3ZFJ A;  3MWE A;  4NL2 A;  1QW1 A;  3QBY A;  3S6W A;  5GAN 8;  2R8J A;  2VUM A;  3E19 A;  3L4J A;  2F2W A;  3UT1 A;  2R8I A;  4RUG A;  2WAQ A;  3TCJ A;  2KR3 A;  2DAQ A;  4IUP A;  4RB3 C;  3OSP A;  2FL7 A;  3A5Z B;  1PD0 A;  2FPI B;  3OYL A;  1FMW A;  1X6O A;  3G71 Q;  2J06 A;  1EZZ B;  2FK3 A;  3LW5 E;  2LP5 A;  1EFN A;  2XD0 A;  1T3L A;  2I87 A;  3BA9 A;  2VQF H;  4QT7 A;  1FVI A;  1XNR H;  1S72 T;  3HOV G;  2W7O A;  3VRY A;  3M0R A;  2RNA A;  2WSE E;  2YU9 A;  1WJR A;  3HKZ A;  2DYI A;  1XNQ H;  4LDU A;  1RJQ A;  4C5G A;  3M0Q A;  4MV9 A;  1TUC A;  4FS2 A;  2DPI A;  3C0F B;  1SRL A;  3J81 E;  1GFC A;  4I7H A;  3DB3 A;  5GAM d;  3GIJ A;  5GAN f;  1GRI A;  3V4Z A;  1G3Y A;  4A3B G;  2Q2T A;  1B34 B;  2DJQ A;  4C92 B;  2PUK B;  2CZ7 B;  4OB3 B;  3I4N G;  4OGC A;  2AHJ B;  2E3I A;  2MOX A;  3VS1 A;  3I56 T;  4RAY A;  3QYG B;  2VB6 A;  2JEI A;  1WQW A;  3QZ5 B;  3M53 A;  1YP5 A;  4VUB A;  3TU4 K;  4J9N A;  2RHX A;  2V4Q A;  4O3R A;  2VPQ A;  3CC7 A;  4XU1 A;  4O3Q A;  1VIE A;  1ZQ1 A;  3OYE A;  1N32 H;  2VXE A;  5GAN 6;  4C92 F;  4BD3 A;  3C0C A;  4GY5 A;  1OWT A;  2GTJ A;  3OSN A;  3IN5 A;  1VQ6 A;  4GKK H;  3T5J A;  3UA6 A;  4AG2 C;  4AMC A;  2EQM A;  2CKK A;  3SE7 A;  4CC6 A;  1VQM Q;  1I1J A;  3EFO B;  4LXC A;  1ZBX A;  1X01 A;  4KHP H;  1BB9 A;  2PMZ A;  3M4Y A;  2CS7 A;  1X2K A;  2HQH A;  1X43 A;  1ZA2 B;  8AT1 B;  3FJP A;  2P4T A;  1ZET A;  5BMV F;  2C0O A;  4OMF B;  2LCC A;  4GC6 A;  2ZPI B;  4ECV A;  4Q44 A;  4PKC C;  3CCM A;  2MWP A;  3CCE T;  1KEE A;  2J05 A;  4LNP A;  2RO0 A;  5GAN 3;  3M9O B;  1KJJ A;  3EPG A;  4JZ4 A;  1WFW A;  4M77 D;  2E5Q A;  3RR6 A;  5GAN j;  3V6J A;  5KFP A;  2FG0 A;  2QAZ A;  5KFV A;  1PK8 A;  4O2B F;  4EBC A;  1CKA A;  1SSH A;  4J9O A;  1VQO T;  4U6P A;  3N40 P;  3QJY A;  4II1 A;  1N48 A;  2YSQ A;  1KC7 A;  5IYD G;  5GJW B;  2O4X A;  3EGU A;  4DOV A;  2NU6 B;  1VQ5 Q;  4M75 C;  4M78 E;  1Y96 B;  1N9S A;  4XAX B;  1YJ9 T;  4C5C A;  1Q82 U;  3V8K A;  2L2P A;  1JJ2 P;  2JS2 A;  4A4F A;  4HYK A;  1VQL T;  4QW9 A;  3LX7 A;  3ORR A;  3L2U A;  5IN1 A;  2VQE H;  4RAZ A;  1NEG A;  1N8R C;  1C1A A;  2LJ0 A;  1I81 A;  5FRO A;  4F17 A;  5HBR B;  1VQ4 Q;  2DPP B;  1S68 A;  2RMO A;  3SI8 A;  1D09 B;  3QJ6 A;  1G5V A;  3I55 T;  2CZ6 B;  3PVX A;  2WAQ E;  1JDE A;  3FB9 A;  4RUA A;  2UVW A;  3PO2 G;  1K9A A;  2RQV A;  1DV1 A;  1Y1V A;  3OQ5 A;  3VU3 C;  3OBY A;  4QJF A;  1D1C A;  2QGG A;  4CC4 B;  1Y7X A;  4M77 C;  5GAM g;  4RNM A;  2GPS A;  3GTM A;  2IIM A;  2UUA H;  2B63 G;  2DRM A;  4MV4 A;  2M05 A;  2KYM A;  2DYB A;  3JB9 D;  3SB2 A;  4FSS A;  2SRC A;  1KIK A;  3HKZ E;  4JI4 H;  5LL6 b;  1KJ9 A;  2JVV A;  4A3I G;  2E65 A;  4IRC A;  4A3C G;  2YZM A;  4D6W A;  1UGS B;  1NJI C;  1KFZ A;  4BXX G;  3I4M G;  2HKQ B;  1YHQ A;  1S72 Q;  4OF1 A;  2YUO A;  3Q2O A;  4LFC H;  2YUQ A;  4HA8 A;  4DR6 H;  4RZQ A;  2B8A A;  1YIT A;  3RFC A;  4DBQ A;  5KFK A;  2DM1 A;  2HMA A;  3JCM V;  5GAO l;  1QVF P;  3G8C A;  4ME7 A;  1B6S A;  1W2B A;  4MZT A;  1E7O A;  1I4K 1;  3MP6 A;  2HSE B;  4J5Y A;  2NUT B;  2QEX Q;  1J3T A;  3LP8 A;  3OY9 A;  4JV0 A;  1GBQ A;  3V7S A;  2NYS A;  4ZOL F;  1W4S A;  4JI1 H;  2FK1 A;  4YJ3 F;  4M9U A;  1TWA A;  3BQ2 A;  4C0G A;  4EPC A;  3AT1 B;  1VQ7 A;  3KHL A;  4EBD A;  2VA3 A;  4CC5 A;  2ZCF B;  4ED2 A;  4J6Y A;  3I56 Q;  4BDZ A;  2JNG A;  4C8Q A;  1PHT A;  5KFH A;  1S0N A;  5C1P A;  1IRE B;  3PMT A;  4DR1 H;  1EHI A;  5IXB A;  1ZUU A;  4JI2 H;  4DL7 A;  2PMZ E;  2R85 A;  3U9T A;  3CCL A;  4RG8 A;  3FJ5 A;  1W96 A;  3DLM A;  2PVG B;  5LMN H;  5KT6 A;  5KT4 A;  5IWA H;  1MND A;  1WHJ A;  2W71 A;  2KDS A;  1KJ8 A;  2KXD A;  2JMC A;  4DEX A;  1Z9Q A;  5EC7 A;  5GAN 2;  1M1G A;  1OV3 A;  2DZD A;  1PSE A;  1S0O A;  3QYH B;  5D6X A;  3QZ8 A;  3G6Y A;  1ZX6 A;  3CCV T;  3GV7 B;  1OU8 A;  3HTR A;  4F7U A;  5KYX A;  5HK3 A;  1K73 C;  1QVF S;  4DV2 H;  4DV4 H;  3M0S A;  3FIF A;  4XZ3 B;  1M3B A;  3HBL A;  2P0P A;  2R87 A;  2R7Z G;  1TUD A;  3MEU A;  1UEC A;  4JI3 H;  5DQI A;  3K5H A;  3CCE Q;  4C2M A;  2MPX C;  4LDY A;  4FM9 A;  3EG9 B;  3OYC A;  9ATC B;  1GCQ C;  1P92 A;  2R8H A;  2KRM A;  2E6Z A;  2I2L A;  4RTW A;  5EG2 A;  2CW8 A;  3CMA T;  4QWD A;  4QVZ A;  1Y57 A;  2FPF A;  3CCJ Q;  3PW0 A;  1MHN A;  1MUZ A;  4A4K A;  3CCV A;  3CPW A;  2FKL A;  1VQO Q;  3TII A;  2EYX A;  2YRX A;  1D0Z A;  1Y14 B;  2KT1 A;  1JX4 A;  3ZL7 C;  3JCM c;  1KD1 C;  3MWD A;  1FMV A;  1YWO A;  5GAM f;  5KG1 A;  3EFR A;  2O01 E;  1RL2 A;  1YJ9 Q;  1K1S A;  5DG7 A;  2C2D A;  1VQ8 A;  2B86 A;  1VQL Q;  2G6F X;  2VPS A;  3GIP A;  4HT8 A;  1KBL A;  4LH7 A;  4HT9 A;  1WJQ A;  1U1S A;  4XYL B;  2HBW A;  4PJO G;  4M7D A;  2BQ3 A;  3SDZ A;  4J9M A;  3H0G G;  5ECA A;  2EVR A;  3CCS A;  4ECS A;  2R93 G;  2MAM A;  5CKF A;  4R8U A;  2CSQ A;  3CCU A;  3I55 Q;  4MV3 A;  1XMO H;  2R8K A;  3MEW A;  4IR9 A;  3H0I A;  1N27 A;  1WLP B;  3OTO H;  3RB3 A;  4JPB W;  4I55 F;  5GMK l;  1JB0 E;  2KE9 A;  2UXC H;  5IHI A;  2W7P A;  2E5K A;  1FYN A;  5HK0 A;  1VQP A;  1YFN A;  4IUU A;  4ZHQ F;  5KKN B;  4PJL A;  3PW4 A;  1IHW A;  3WVD B;  3GPL A;  1KC8 R;  4MTE A;  1IRX A;  1E4E A;  3PN1 A;  4M7A G;  4DL2 A;  4BE2 A;  3GLK A;  1SHG A;  5A2Q W;  3H9N A;  3CC2 T;  3DF7 A;  4BE0 A;  5I2M A;  3QO3 A;  4LUD A;  5HY6 A;  4O3O A;  2RQT A;  2HAX A;  1N56 A;  2NUP B;  4M75 B;  3MJX A;  2C0T A;  3L4K A;  1K0X A;  1Y71 A;  1NM7 A;  5IHN A;  4EGQ A;  2FZG B;  5GAM j;  4ZTJ A;  5JQW A;  1M9S A;  3H3V H;  2K2V A;  4N0A C;  1UGQ B;  2LQK A;  3FRN A;  5FWC A;  2PU9 B;  5H80 A;  3VPB A;  1QKX A;  4E7K A;  5BPF A;  1KSW A;  4OMM A;  2X9H A;  2KXC A;  1D0X A;  4IWY A;  5BPH A;  3CC2 A;  1KQ1 A;  3LH5 A;  5JVD F;  1G8X A;  2ZPF B;  4UCS A;  2EQI A;  2F2V A;  1S10 A;  2JA8 G;  1Q7Y C;  2LNV A;  1TA8 A;  4C8Q E;  2CZ0 B;  2FEI A;  3G6E T;  2JTF A;  2XCA A;  1JRI A;  2EQU A;  3GBQ A;  4N4I A;  2RQU A;  5GAN d;  4AQY H;  4J6X A;  1O75 A;  2I0N A;  1UE9 A;  1Q86 C;  2M0O A;  2AGO A;  4LE9 A;  4NS5 A;  2VR1 A;  4OMN A;  1QP2 A;  2X4W A;  4O3N A;  3FEO A;  2XHC A;  2RHY A;  4KRT A;  2FLP A;  1Q95 G;  2WB1 A;  2CT3 A;  3OMC A;  3MP8 A;  3JV3 A;  5KCO A;  1Q82 R;  4JRP A;  4QIW A;  1G3S A;  4MAM A;  1I7N A;  1Q81 C;  5LL6 S;  3OW2 P;  3UQ8 A;  1N6A A;  1M4Z A;  2NUZ A;  2IBK A;  4F7U E;  1B34 A;  4F04 B;  5KG2 A;  2CYZ B;  3BAB A;  2KBT A;  5C0M A;  4MMK A;  4EMG A;  4C92 A;  5GAM h;  4XU0 A;  3INZ A;  3QZ9 B;  1IHV A;  1T3S A;  1AWX A;  1XOV A;  1SKU B;  2FB9 A;  4A3K G;  1YJN T;  4M77 F;  4ED7 A;  2CUD A;  4FT2 A;  3EG3 A;  4L6V 5;  2K79 A;  3H20 A;  1XQH A;  2I8C A;  3E5N A;  4GLK A;  1RAB B;  5GMK j;  3OYH A;  4A93 G;  2OTJ T;  2COZ A;  4P5N A;  4RCB A;  1UUE A;  2CQY A;  4EMK C;  3NTK A;  2JA5 G;  4C5E A;  1QP3 A;  1TTH B;  4L59 A;  2D1X A;  1K8A C;  2W9C B;  1VYV A;  2AT1 B;  2LTO A;  2HL5 C;  4YQW A;  1ULZ A;  1GXI E;  2BZ8 A;  3QSU A;  3KXY T;  4RB1 A;  3RBE A;  4JJN K;  3M54 A;  2W6M A;  1TS9 A;  3EFO A;  2E12 A;  2KY9 A;  4EIK A;  1UC8 A;  2ZDQ A;  2L8D A;  1YJN A;  3CMA Q;  2LCL A;  1ZHI A;  5LA6 F;  4RB2 C;  2ZPH B;  2W6P A;  3M9N B;  4R55 A;  3UA7 A;  2R57 A;  3DLL A;  1I94 H;  4DR4 H;  1WHM A;  2IPO B;  3MR6 A;  2BE9 B;  1VA7 A;  4AFZ C;  1IGU A;  4JZ3 A;  3OS0 A;  4PJN A;  4J83 A;  2W70 A;  1UJY A;  1DJ7 B;  2YRW A;  2MK5 A;  2R92 A;  1FX7 A;  4BY6 C;  4CC3 A;  3OW2 S;  1Z2N X;  1N5Z A;  4EBE A;  2NVX A;  2COW A;  1TUG B;  3C94 A;  4M7D E;  1XMQ H;  4A3D G;  1AOJ A;  3G71 A;  4IUQ A;  4I4T F;  1WHH A;  2P0A A;  3NGP A;  2DET A;  3QUI A;  1QCO A;  2X4J A;  5IAY A;  4E7I A;  3RKX A;  2PNI A;  4EMH A;  2VUB A;  5GAO n;  2W8L A;  1PCX A;  2I80 A;  3VUB A;  1X6B A;  4JRI A;  1KQS P;  3PZP A;  1CKB A;  2YLC A;  2SEM A;  4LF5 H;  4WBN F;  1Y96 A;  1U3O A;  1JJ2 A;  4J9B A;  4F7U B;  2W9B B;  2W9A A;  2LDM A;  3BQ1 A;  4TV9 F;  2HHH H;  4A3J G;  2EAY A;  2SCU B;  3Q8R B;  2M02 A;  5CAE B;  2UVR A;  2FPD A;  3CQZ A;  3RV3 A;  1M2O A;  3Q1J A;  2XDP A;  2V58 A;  5KYY B;  4UCV A;  2FLL A;  5LJ5 g;  2L3Q A;  4DV3 H;  1UJ0 A;  3I5S A;  1BI3 A;  3P8D A;  3VS3 A;  2CP0 A;  3CVZ A;  2DLN A;  4CC2 A;  2E6N A;  3O5Z A;  4YR3 A;  4AFS C;  3BDU A;  2XIG A;  1TXQ A;  3MCA B;  3PVL A;  4O4L F;  2Z0W A;  3C95 A;  5EZY F;  2A28 A;  2VYT A;  2RDI A;  2FPE A;  4QQG A;  5KFS A;  1JDB B;  1UNN C;  5KFD A;  4LN2 A;  2LCS A;  3X28 B;  1VQM A;  3JB9 G;  1UTI A;  3TQT A;  4BDY A;  3A98 A;  3KHR A;  2W0Z A;  1KQS S;  4M78 D;  2MCT A;  3ASK A;  4EDU A;  2A36 A;  2WB1 E;  2YZN A;  5KFI A;  3HP9 A;  5FLM G;  4J7I A;  3G6E Q;  3RKY A;  5KX5 F;  2Y4Y A;  4HXJ A;  3H4D A;  1SFO A;  2JXB A;  5GJV B;  4R8U B;  4LF7 H;  3WXM B;  1M3C A;  1KG1 A;  5KE3 A;  1J5E H;  4C92 E;  3LGL A;  3KTM A;  2QXF A;  2NUT A;  2J6U A;  2EYY A;  1HR0 H;  2K3Y A;  1V4Y A;  4DL4 A;  2YW2 A;  3QG1 A;  3G4S T;  2EYW A;  1ZHS A;  5A2Q E;  2R7M A;  2BQR A;  4UCU A;  2C0I A;  1NEB A;  3VS4 A;  4K11 A;  1VQ5 A;  1GLV A;  3HFN A;  2Y90 A;  5CVI A;  1RI9 A;  4B3S H;  2EGC A;  3VPD A;  1HNZ H;  3U23 A;  2JTE A;  1BU1 A;  4OB2 B;  3PR4 A;  2JW4 A;  3OSV A;  2PVO B;  2WDT A;  4XX0 B;  3M4G A;  1I3Q A;  1WXT A;  1QWF A;  1OUL A;  4PJM A;  2PQW A;  3L1A A;  2NVY A;  3VS2 A;  2OTJ Q;  2D8J A;  3NGD A;  2HVS A;  2FRW A;  1I7L A;  5CR2 A;  3RJ0 A;  4LUE A;  2AZS A;  1VQ4 A;  1UGR B;  4DOW A;  2QTX A;  2GPW A;  3ETH A;  3JB9 I;  2HCK A;  4Z89 A;  4MV1 A;  5D1O B;  4IIO A;  2EWN A;  4QWC A;  3JB9 H;  1M7J A;  3FKI A;  4J9I A;  3N8D A;  4X9D A;  2JA7 G;  4PJO C;  4J9P A;  2JJ9 A;  4DV1 H;  4DBH A;  4O3P A;  3G6X A;  3HFO A;  2CP7 A;  1BIA A;  4DBR A;  2DTO A;  1PNJ A;  4ATO A;  5KFL A;  1U8R A;  1B04 A;  2LX9 A;  5KYW B;  1S0M A;  3EG9 A;  4C5I A;  4J9Q A;  4BAC A;  2LQN A;  2EGA A;  4B6M A;  2YRD A;  4A4G A;  5LJ5 f;  2VOB A;  3PW5 A;  2QEX T;  3CC4 T;  4EYH B;  4ED6 A;  3CEY A;  1M2V A;  2DD5 A;  2R5A A;  2JEG A;  2FVU A;  3HL8 A;  5KFR A;  3LH0 A;  2JA6 A;  1OPK A;  4M7A C;  1JQQ A;  3K3P A;  1S72 A;  4J8O A;  4BY1 G;  3PIO A;  4KH1 B;  4CI0 C;  2DL3 A;  3R5F A;  4J9E A;  4XTX A;  3TEE A;  4TV8 F;  4Q8E A;  5KFM A;  2HQX A;  4XU3 A;  1WIE A;  1O9S A;  4EMK B;  4J0M A;  5A0D A;  3VPC A;  3EAE A;  5DGB A;  4O4H F;  2W6N A;  2DE0 X;  2QEX A;  3QWX X;  2XGP A;  1Z2O X;  4RTU A;  2D0Q B;  4C5B A;  1MMG A;  1GFD A;  2EYQ A;  2RJC A;  4ECR A;  1D1A A;  4HCZ A;  5KFY A;  4ESR A;  3RES A;  2BIV A;  4PK4 A;  1PG5 B;  4DV5 H;  3VS6 A;  1Y1W A;  1WPY A;  2A08 A;  3I56 A;  4YY3 H;  4LFB H;  3UWN A;  4PL6 A;  1L2Z A;  4LH6 A;  1IBL H;  5IT9 W;  2FE3 A;  2EFI A;  3THK A;  4RU9 A;  2CUB A;  1PRM C;  3LWI A;  2GFU A;  4BY6 B;  1CE8 A;  1PKT A;  2FMA A;  4ECT A;  1RAE B;  3GTK A;  2X4X A;  5DLF A;  1I6U A;  3OUU A;  3A8G B;  1I8F A;  3EH1 A;  4LD9 K;  1MV0 B;  3RUX A;  1D3B B;  4MA5 A;  4YJ2 F;  3P8B B;  3CME T;  4UCR A;  4IZO A;  5KFJ A;  3JAM W;  2NU8 B;  4R56 A;  2DFU A;  1DGS A;  4B3R H;  2LMJ A;  3KHH A;  3CCJ T;  2FPG B;  4EGJ A;  4E7Z A;  2PZ1 A;  2DRK A;  2VVK A;  4FCY A;  1WCM G;  5FRM A;  2NUP A;  1GSH A;  1T94 A;  1VBH A;  1UG1 A;  4M75 A;  3RIR A;  2XIC A;  4LD6 A;  3GNG A;  1BIB A;  3M0T A;  2ABL A;  5I22 A;  2JEF A;  2V8K A;  3CQT A;  1GCP A;  2LC4 A;  5LYJ F;  5LP6 F;  3CCE A;  3QDR B;  2JM8 A;  1MMA A;  2RM4 A;  4FYY B;  5LJ5 e;  4O5V A;  2J9G A;  1B7T A;  1WQ7 A;  1ZQ7 A;  1M90 R;  3E2U A;  2GCX A;  2QDY B;  1A0I A;  4HVW A;  4JS5 A;  4GC7 A;  3V6K A;  4G3I A;  1M1K R;  1VQO A;  3G4S Q;  4BI3 A;  1SCU B;  5KG4 A;  4ECY A;  1OI1 A;  3N43 B;  2C22 A;  2IG0 A;  2H3J A;  2OI3 A;  4NXM H;  2MIO A;  3AYH B;  1MZB A;  1B07 A;  3PGG A;  3OA6 A;  1A9X A;  3ME9 A;  5GAN h;  1YJ9 A;  3OYD A;  3U9S A;  5F9L A;  1OX8 A;  2O03 A;  1VQL A;  3OW2 A;  4DL6 A;  2UVV A;  3OHB A;  1JXL A;  1OYX A;  1QVG S;  1LNX A;  1TH7 A;  2EW3 A;  2QDL A;  4R0K A;  2KRN A;  1B33 N;  4PNO A;  4RZR A;  3I12 A;  1M8V A;  3L2Z A;  1GBR A;  3L2W A;  2M1H A;  2K6D A;  4BBS G;  2NLU A;  3I55 A;  2C2R A;  5C3E G;  1X9N A;  2F2X A;  2NU9 B;  4EFB A;  1RK6 A;  2P84 A;  3CCR T;  4NL3 A;  3SD4 A;  2MMP A;  1AZE A;  5FU6 C;  4DA4 A;  2ASJ A;  2BE7 D;  3H8Z A;  4F16 A;  4FU0 A;  4DUZ H;  3GV5 B;  2FB7 A;  2R92 G;  1X27 A;  2QQ9 A;  4FW2 A;  3TSW A;  4C8Q D;  2W9C A;  2EGE A;  4OB0 B;  4X1V A;  2Y4X A;  1M27 C;  2R7K A;  2FZC B;  2GNC A;  2V26 A;  5FPO A;  3CC4 Q;  4IHJ F;  2FHD A;  5IH2 A;  3KBG A;  1S9F A;  1AHJ B;  5GAN 4;  1QCN A;  2LX7 A;  3H6Z A;  4BWS C;  1E6H A;  1TOV A;  2A3L A;  3ZEH A;  3HXL A;  2FK2 A;  2K2M A;  1MMN A;  3JB9 J;  4E7L A;  1TAE A;  1XDN A;  3RIZ A;  2DTH A;  2DXC A;  4XK8 E;  3JCM J;  3UFX B;  3VMM A;  4ZN3 A;  2EBP A;  4XQ3 A;  2KMT A;  2P0K A;  4UCO A;  4J6W A;  4HR7 A;  1IXD A;  1TSF A;  2DTI A;  1SSF A;  2DXU A;  2UUB H;  3CC7 Q;  2PN1 A;  4ZGD B;  5GAN 7;  4C0D C;  4EG0 A;  1Q86 U;  2X3W D;  4N4G A;  2X35 A;  1SYX B;  3BG5 A;  1KC8 C;  4PJO B;  2OWO A;  5D7U A;  4Q45 A;  3PW7 A;  4DV6 H;  2DIL A;  3M0U A;  5LJ3 e;  1GO3 E;  4PJJ A;  5KFU A;  1V9P A;  2HNI A;  5CKD A;  4DV7 H;  3E9G A;  2AGQ A;  3PO3 G;  2W9B A;  1Q81 U;  1VIF A;  4PFP A;  4LSX A;  1UB4 A;  4LF6 H;  3GOX A;  1NG2 A;  1GCQ A;  4Y28 E;  4UC4 A;  4C8Q C;  2RH2 A;  2UXD H;  4FT4 A;  1AD5 A;  2LNH B;  3A8H B;  4M75 E;  1KQ2 A;  3Q8S B;  4PJO F;  3TRE A;  5D6W A;  5KYY A;  3CME Q;  1RAH B;  4XTW A;  4M7A B;  2QAS A;  3R5X A;  3MO8 A;  1E4G T;  2E2I A;  2A0F B;  5LOV F;  4ZQI A;  2YUP A;  1M2V B;  2KRS A;  2EIF A;  2V1R A;  3MFI A;  2DZ9 A;  4M7D D;  4YBZ B;  4EEY A;  1ZBJ A;  1ZSZ C;  3L2R A;  1K8A U;  2CZG A;  5DQG A;  4LF9 H;  2A37 A;  4A53 A;  3RB6 A;  3MKD A;  2DBK A;  1MMD A;  2XDB A;  2YCH A;  3KHG A;  5C8Y F;  4QVC A;  3V4S A;  4M7A F;  2NWM A;  1M3A A;  3ETJ A;  5DM7 R;  2E2H A;  1RYR A;  1IZ6 A;  3EH2 A;  5DLQ E;  2QA4 T;  1Q82 C;  5GAO r;  3CMA A;  4M78 G;  1P8L A;  2O2O A;  5IYC G;  3JCM b;  3X24 B;  2RA2 A;  1JU5 C;  1OZ3 A;  4JDS A;  3GTJ A;  4X65 H;  4X9C A;  2CDT A;  2M9U A;  5CK9 A;  2ASL A;  5CA0 F;  2RN8 A;  4OX9 H;  5J2U F;  5CB4 F;  1IBM H;  5IT9 E;  2RGR A;  2K5L A;  3VYG A;  3QWY A;  2DEU A;  1EYZ A;  3CPF A;  1Z2P X;  4JLG A;  1VQK T;  5FPR A;  5KFF A;  1K9M U;  3BAA A;  2YZG A;  4FL6 A;  2OTL T;  4MML A;  4TVR A;  4ETS A;  5FRN A;  2VUM G;  4PFO A;  2HJW A;  1PM3 A;  2UXB H;  3EHQ A;  1F1B B;  3JAM E;  2OLS A;  4O2A F;  2RJF A;  3M9Q A;  2E70 A;  1GSA A;  2J6S A;  3BW1 A;  4BI8 B;  4QWA A;  1QVP A;  3RMS A;  1DV2 A;  2JEJ A;  2M16 A;  2CZ1 B;  2DL5 A;  1ZUK A;  4IUR A;  2QGF B;  4WTO B;  4N0A A;  2YHT A;  2RHU A;  3MJF A;  2JUF A;  3CCR Q;  4BBR G;  4M7E A;  3JCM X;  1N33 H;  4QKU A;  5KFC A;  3HHT B;  5EWF A;  1N34 H;  3J7A K;  4ZNX A;  3GTL A;  1HJD A;  1QKW A;  2DIK A;  2CSI A;  2DBM A;  4Y8V B;  5EWE A;  3NPF A;  2WTF A;  5D1O A;  4ECZ A;  2YRV A;  2EKO A;  2ALZ A;  2XI9 A;  3JCM Q;  2ED0 A;  5LJ5 d;  1E6G A;  2W8K A;  4D8K A;  5CA1 F;  4C92 D;  1GL5 A;  3GIB A;  1VOM A;  4JI0 H;  2DIG A;  2KSS A;  5J26 A;  4ECQ A;  2RJE A;  4MTD A;  1UDL A;  4JRQ A;  4U7C A;  4IRD A;  4MDW A;  3R23 A;  4LMY A;  5FLX W;  5CCA A;  5KYW A;  1VQ9 T;  4O3S A;  2COY A;  4M77 B;  4A54 A;  3EGX B;  4UCT A;  1R9T A;  5GAO m;  3QZ7 A;  4HNT A;  2DKG A;  3KAK A;  1SG5 A;  3N44 B;  3V8L A;  2XGQ A;  4NOY A;  1RJR A;  5GMK i;  3GIQ A;  1D1B A;  2JN0 A;  3G6E A;  3GNF B;  1UEB A;  3HRU A;  1W93 A;  2IP4 A;  2W57 A;  1N36 H;  5L1I A;  4WD3 A;  3WO0 A;  2DO3 A;  5JVL A;  1EZ1 A;  3VS5 A;  1TWG A;  4OMQ A;  2DX1 A;  1H3H A;  2YRC A;  2RHZ A;  2HVR A;  3PMI A;  3HPW A;  4EMK A;  3M0P A;  2BQU A;  1YNZ A;  2RF0 A;  5D1P A;  3A8L B;  2NU7 B;  3GP8 A;  5J2T F;  2LQW A;  3SFM A;  1RAA B;  1KHC A;  3Q8P B;  1SPK A;  5T14 A;  1IB8 A;  3M55 A;  4DUY H;  5HKC A;  3K3V A;  4A3G G;  4J9S A;  1BBZ A;  4HCC A;  3HOZ G;  3I35 A;  1I5O B;  1WNL A;  2RPN A;  3OUZ A;  3CCQ T;  4ME6 A;  2C28 A;  2O9S A;  3HOX G;  2CP6 A;  5K2M A;  1K4U S;  3EG1 A;  3GLX A;  3OYI A;  5KG6 A;  5GAO q;  5CIU A;  4FBT A;  3ER0 A;  1Y07 A;  4HNU A;  2OTJ A;  3RBD A;  5D8D A;  1UHC A;  5BR8 H;  1UGV A;  1V1C A;  2DXB A;  3RKW A;  3SWN C;  1D3B A;  2AKL A;  3BFM A;  4BUG A;  1YBY A;  2DNU A;  4C0D B;  4JRK A;  2K3B A;  2XDD A;  2B63 A;  2BUD A;  2ECZ A;  2QQR A;  2DIQ A;  4KUL A;  4X64 H;  4MDX A;  3JCM P;  2QA4 Q;  3TQ7 P;  3GII A;  3VUZ A;  2V8J A;  5GMK h;  4RTY A;  2IMW P;  2G3R A;  1SHF A;  3OSS C;  1HNX H;  4BI4 A;  1YN8 A;  4APM A;  4QW2 A;  2WE6 A;  3LLR A;  3GID A;  4GLX A;  1PC0 A;  1OEB A;  1UGP B;  1M6V A;  1Y1V G;  3JB9 F;  1BJT A;  5L1K A;  1VQK Q;  4LDW A;  2VA2 A;  2OTL Q;  2EJG A;  2QK0 A;  2RK2 A;  4JUV A;  4A4H A;  3E1S A;  5JUM A;  3JRZ A;  5C44 G;  3GQC A;  2WSC E;  1SEM A;  2K5F A;  1CQJ B;  5LJ3 d;  4MV8 A;  1B6R A;  3JCM e;  5KFW A;  1TU0 B;  1XTD A;  4FBU A;  4ORZ A;  4DL5 A;  4C0F A;  2K9G A;  1SEI A;  1KJW A;  4C8Q F;  1VQN Q;  2DPJ A;  2VV5 A;  5GON F;  2YDL A;  2DF6 A;  2J6K A;  3RBB B;  1QMC A;  1XJW B;  3FC3 A;  3V7C A;  2JM9 A;  3ORQ A;  2H8H A;  2C00 A;  4OMP A;  5KFE A;  3BA8 A;  3D7S B;  1EX4 A;  1RUW A;  1ZLM A;  3UF4 A;  4CRI A;  3H41 A;  1RLP C;  4RTV A;  4Y92 A;  2FPP B;  5KT7 A;  5L23 A;  2VWF A;  5KG7 A;  2VC8 A;  4ECW A;  3I5R A;  3MR3 A;  3MP1 A;  1YIJ T;  4OML A;  5GMK m;  4HCK A;  2CT4 A;  3X20 B;  3GTG A;  2HDA A;  5CQY A;  5KE2 A;  4MV6 A;  4F4W A;  2A7Y A;  3EG2 A;  3T9N A;  1HSQ A;  3LML A;  1YI2 T;  2MCN A;  3M5A A;  5DLG A;  2EYZ A;  2JT4 A;  5FU7 C;  3FMA A;  4F4Y A;  3PE0 A;  2RGV A;  4KGZ B;  1YJW Q;  3A8M B;  4ZN1 A;  5F9N A;  4F50 A;  4ED0 A;  2R7Z A;  2DZC A;  1QVF A;  3M4I A;  1JXO A;  1BI1 A;  4C8Q G;  1S1N A;  1I5L A;  1R77 A;  4FS1 A;  1NYF A;  1VQ9 Q;  3G1J A;  2HGS A;  3OYF A;  3CD6 Q;  3WO1 A;  4J9K A;  3GIL A;  1NPP A;  3MEV A;  2HD0 A;  1GYF A;  3I9Q A;  4EEQ A;  4XTU A;  3FLG A;  2WYO A;  2ZZD A;  4RG2 A;  2GFA A;  3PFS A;  1WHK A;  2HBP A;  1X75 C;  2XCL A;  4DR5 H;  1NBE B;  1R0B G;  1R8O B;  3PNW C;  4ZI7 F;  4LFA H;  3VYH B;  1SF9 A;  1H8K A;  1AVZ C;  3NHN A;  3OYK A;  4E4T A;  1HNW H;  1NLP C;  4F7U G;  3EYY A;  1K1Q A;  3S3N A;  2XC9 A;  5AYF A;  3VJP A;  4IR1 A;  1UC9 A;  4J9D A;  1K9M R;  6AT1 B;  1N8R U;  3TIN A;  5KFB A;  5DLO A;  4IIM A;  2O9V A;  5D6Y A;  4M7D F;  4NXN H;  4J9R A;  5I21 A;  5L1J A;  2DVE A;  3R6N A;  1X69 A;  3REA B;  3G4S A;  1TWF A;  2EJ9 A;  1TWH A;  3CBM A;  2ZAE A;  3QDF A;  2M0Y A;  4PJO A;  3M9M B;  2DWC A;  5J39 A;  3CPW S;  4M78 C;  5C5J A;  2R93 A;  4AYB A;  3CCQ Q;  1WR2 A;  5L8R E;  3J80 E;  3J7A F;  5CQX A;  2AK5 A;  1HXD A;  4F4Z A;  2PUO B;  5DG9 A;  4JI6 H;  2FZK B;  5FD6 A;  4JI7 H;  1C3O A;  1C0M A;  4YHH H;  5FLX E;  3RMQ A;  3RER A;  4YR2 A;  4DR7 H;  2WAC A;  3JRX A;  4MA0 A;  1S97 A;  4Q43 A;  5LJ3 g;  1T3N A;  3RTX A;  1WA7 A;  4M7A A;  5KYU A;  2V5A A;  1NJI U;  2HZY A;  1ARK A;  1D0Y A;  4KGX B;  4RKU E;  3RGZ A;  1M90 C;  1JLL B;  2F4V H;  4OB1 B;  3KUF A;  2MF2 A;  1K83 A;  4M7D G;  4O4I F;  2L3P A;  2RF4 A;  2VGN A;  4AFQ C;  4DEY A;  1M1K C;  3OYA A;  2Y0S A;  2YT6 A;  1PD1 A;  2KT8 A;  3NMZ C;  1E4F T;  4A4E A;  3PVQ A;  3N42 B;  3URG A;  1N9R A;  4V2S A;  2ZPG B;  5KFO A;  3CC4 A;  5DY9 A;  3CC7 T;  1WX6 A;  4D8D A;  2QG9 B;  1VQ6 T;  3OYB A;  2DER A;  5CAI A;  1WYX A;  5I2S A;  3JZI A;  2ASD A;  4JJD A;  2P0Q A;  1RJP A;  1V29 B;  1HD3 A;  1FWZ A;  2HQE A;  3K5I A;  3RUP A;  2J6F A;  1IGQ A;  2HKN A;  3V7R A;  2JZ2 A;  3JRW A;  3MPU B;  4QQ6 A;  4M75 D;  3RAQ A;  1ZA1 B;  4FYX B;  1WGS A;  2RI2 A;  1X6G A;  4B3T H;  2BZX A;  3SWN B;  5KT5 A;  2J7I A;  3CCM T;  4MV7 A;  4QQD A;  3BDL A;  2FO0 A;  2XG8 D;  4J7F A;  5C1O A;  3RF2 A;  1PRL C;  1KC8 U;  4X66 H;  4KUD K;  2F69 A;  4X34 A;  1IBK H;  4RUC A;  3SEM A;  4XTZ A;  5LJ5 j;  2OAW A;  3MWM A;  3F8N A;  2YL2 A;  1SRM A;  2DXT A;  2PVP A;  3RB0 A;  1XNI A;  1R0C B;  1BI0 A;  1YIJ Q;  2CP5 A;  4Z88 A;  1K73 U;  2CP3 A;  1TG0 A;  4JV2 A;  2IA6 A;  1QVG P;  4J9H A;  4AG1 C;  4J9F A;  2FYK A;  4KUI A;  4DBF A;  1YI2 Q;  2GGR A;  1K76 A;  2K7A A;  4F4X A;  3KFV A;  2RI5 A;  1QCF A;  2MI6 A;  3NFC A;  2W10 A;  3KAJ A;  1LOJ A;  2JA5 A;  1CS0 A;  2KGT A;  3LWB A;  3CME A;  2R6F A;  3GIM A;  1NPR A;  4ECX A;  2W6O A;  4XYM B;  3UAT A;  1RAG B;  3KXT A;  1WHL A;  1I07 A;  4AT1 B;  1JXM A;  3CCJ A;  3H0H A;  3S3O A;  3HSB A;  1I0C A;  8ATC B;  1M1F A;  4WF2 A;  3REB B;  3F70 A;  2OJ2 A;  3DB4 A;  1H3Z A;  2X4Y A;  4C92 G;  5J3B A;  4N4H A;  1KD1 U;  4IUT A;  4BB7 A;  2OX7 A;  3TVT A;  4K0K H;  3EGD B;  1HYO A;  5LJ5 h;  3EFS A;  3JCM W;  5JH7 F;  5GAN e;  5DGA A;  3C4S A;  3JCM d;  3UPU A;  4M77 A;  1UHF A;  2VXF A;  3CXC P;  4PJO E;  2ZDG A;  5LJ3 f;  2Q2U A;  3EGX A;  4A3M G;  2ZPB B;  1QQJ A;  4GLM A;  2EKH A;  5IXF A;  4AYB E;  2QQS A;  3Q1K A;  3HOW G;  2V4R A;  3S3M A;  1PKS A;  2L0A A;  2JS0 A;  5FU7 B;  1IOV A;  3IG0 A;  3VV0 A;  4TQR A;  1JKJ B;  1GGO A;  4A3L G;  2LQ8 A;  1YHQ T;  2E3H A;  2V8I A;  3PTA A;  2R58 A;  4M7A E;  2CP2 A;  1W1F A;  4YR0 A;  1YIT T;  2F5T X;  4Z02 A;  1WSC A;  3OMG A;  5CKE A;  2L89 A;  1PX2 A;  5EOY A;  2GF7 A;  1AUX A;  1WJS A;  2LJ3 A;  4TQS A;  1YCS B;  2Y0S E;  1OZ2 A;  1BNC A;  2JOY A;  1G3W A;  2QQA A;  1TWC A;  1YWP A;  1KJI A;  2ZDH A;  2KRO A;  5FJ8 G;  1JJ2 S;  4IAJ A;  3CCR A;  1PWT A;  4Z8A A;  1VQ7 T;  3CXC S;  1WI7 A;  2AZV A;  2DMO A;  1WH2 A;  2XK0 A;  1FKA H;  4DLK A;  4OGE A;  2YXY A;  3CBO A;  3EG0 A;  4FM4 B;  1K0S A;  3H40 A;  3Q8Q B;  5LJ3 j;  1BK2 A;  5AT1 B;  4A63 B;  4ANJ A;  1EIF A;  4IRK A;  1Q7Y U;  3KAL A;  1H92 A;  4FW1 A;  2CGH A;  3CCL T;  1LVK A;  2CH4 W;  4M78 B;  2VUG A;  4RNN A;  1V76 A;  5IP7 G;  2E4H A;  3JSL A;  1VQ6 Q;  4RNO A;  1KJQ A;  2W6Q A;  1MV3 A;  4NLG A;  2KVQ G;  1KQS A;  1RYS A;  1S03 G;  4ED8 A;  3OS2 A;  3A8O B;  3MR2 A;  3JSC A;  1Y0M A;  2GQV A;  3N41 B;  2XU8 A;  5KT3 A;  2RI3 A;  4CC7 A;  1U1T A;  1JEG A;  5KG0 A;  5DG8 A;  2R86 A;  2EQK A;  4O6J A;  4EYI B;  3CCM Q;  2MWO A;  4M78 F;  2K57 A;  4JI8 H;  3OYG A;  1N8R R;  2PBZ A;  2YS7 A;  5KG5 A;  4XU2 A;  4FU6 A;  3HB9 A;  2R84 A;  5HV6 A;  4YP3 A;  3MR5 A;  1OQK A;  2RB6 A;  5KYU B;  3MET A;  5LJ3 h;  1ZSZ A;  1BCM A;  3GIK A;  4B9X A;  3L2P A;  1WDX A;  1BI2 A;  2X3X D;  5L1L A;  4JV5 H;  2QYZ A;  3GF5 A;  5KCH A;  4XTV A;  4DL3 A;  4BY7 G;  1U06 A;  2AGP A;  4KT0 E;  3JCM g;  1K1Z A;  5KYN A;  4YAJ B;  4ECU A;  1VS0 A;  2DL8 A;  2ZPE B;  4FSX A;  2RD1 A;  1CQI B;  2R7L A;  4B3M H;  1LPL A;  2UU9 H;  5GAN 5;  4LF4 H;  4PFZ A;  2E41 A;  1T0J A;  1ZUY A;  4JJB A;  4OVA A;  4JI5 H;  3DKM A;  5GAO p;  1VQ8 T;  3NTH A;  2DJZ A;  3O8V A;  1AT1 B;  1KHI A;  1U5S A;  3C12 A;  1NJI R;  3SHW A;  4HCB A;  3MHX A;  2V9W A;  4I50 F;  1B3Q A;  3X25 B;  3HOY G;  4BE1 A;  2JA7 A;  2ED1 A;  2D0N A;  4M77 E;  1M30 A;  3HOU G;  1RAC B;  4YTL A;  3CCS T;  5C6S A;  2CH4 A;  3OHA A;  4J9C A;  3CCU T;  1UFF A;  2QTV A;  4LSA A;  2EQJ A;  2ZM6 H;  1LJO A;  2KAF A;  3UDC A;  3L2Q A;  2EJF A;  1VQP T;  1DIK A;  4YAK B;  3T5L A;  4RCC A;  2QA4 A;  1W6X A;  4Q5W A;  2GTO A;  2QK4 A;  3RB4 A;  2LT1 A;  4OMO A;  1M0W A;  1G83 A;  4JYA H;  1VQN T;  3FKI G;  5A0G A;  2V59 A;  1MNE A;  1ABQ A;  2JMA A;  3NTI A;  4B9W A;  4M7D C;  2BKD N;  3QII A;  2FP4 B;  4PLL A;  1VQK A;  3M56 A;  1YHQ Q;  2O31 A;  2VAS A;  2OTL A;  4QVD A;  4ZTF A;  2D6F A;  1ACM B;  4L5G A;  2WSF E;  3LYI A;  1YIT Q;  3X26 B;  4XTY A;  2L5Q A;  3RAX A;  1JO8 A;  1OX9 A;  2AIR B;  2MYS A;  4C5H A;  1WXU A;  1Z9Z A;  3OYJ A;  3M57 A;  1AEY A;  3H4B A;  2X51 A;  1VKZ A;  2W6Z A;  5IYB G;  3L2V A;  1YCY A;  3MEA A;  1VQN A;  2XKO C;  2AKK A;  4GKJ H;  2XD4 A;  2FRY A;  2ATL A;  4LF8 H;  4IKF A;  5M9O A;  2JA6 G;  1K73 R;  4KBM B;  5A0L A;  3PW2 A;  2C2E A;  4F14 A;  2D8H A;  1YJW T;  2HEQ A;  4FIB A;  5KG3 A;  3OB9 A;  1M8M A;  2LJ1 A;  2O4X B;  2R5M A;  3J80 W;  3GTQ A;  2BR0 A;  3BE3 A;  3WVE B;  1VQ7 Q;  4LDV A;  2ENM A;  3H0F A;  2K4Y A;  1ZSG A;  1PSF A;  2K3X A;  3QHS A;  2RDJ A;  2DA9 A;  1G3T A;  2DL4 A;  3AHU A;  2HSP A;  3CD6 T;  2C06 A;  3R5H A;  4M75 F;  3V6H A;  2YYA A;  4JUZ A;  5EDW A;  3CCL Q;  2ZJT A;  3GTO A;  1WCM A;  2J6T A;  3RDV A;  3G6V A;  4AFU C;  1YJW A;  4ED1 A;  5GAM e;  4C0Z A;  1KD1 R;  3JCM f;  1V51 A;  3OS5 A;  3RGX A;  1Y1W G;  2BZY A;  2H3E B;  3GTP A;  3ULR B;  1RLQ C;  1JBM A;  3M58 A;  2AU0 A;  5KFT A;  2EPD A;  5FU6 B;  4LDX A;  3HKS A;  2L3S A;  1BGW A;  2DLP A;  1VQ9 A;  4E7S A;  2YS6 A;  3CD6 A;  3ZBD A;  2AQ4 A;  1OPL A;  5IHK A; 
#chains in the Genus database with same CATH homology
 2P84 A;  2OX7 A;  2QYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...