2QYZA

Crystal structure of the uncharacterized protein ctc02137 from clostridium tetani e88
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
NREVKFRAWDKELNMMVYTKEQTGHIEYNTNPADTINIILNQDDYGYVFMQYTGLKDKNEKEIYEGDIIKKSNRSSNLYEIIYQDSIACFRCKVIKGDIKSFPCLNIGTVRNCEVIGNIYENPELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the uncharacterized protein CTC02137 from Clostridium tetani E88.
rcsb
source organism Clostridium tetani e88
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.290 Mainly Beta Roll SH3 type barrels. YopX-like domains 2qyzA02
3.30.1490.160 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ctc02137 like domains 2qyzA01
2QYZA 2OX7A 2P84A
chains in the Genus database with same CATH superfamily
1OU9A 1OX9A 3L2RA 4X1VA 2MAMA 2PQWA 1FKAH 4FBTA 4B3TH 2DD4A 2AKLA 3M0SA 3CCEA 3JCMf 3GIMA 1PSEA 4EEYA 1D1CA 1M2VA 1TTHB 1VQLT 4FM9A 2FO0A 5JVLA 4J6XA 3DF7A 4ZTJA 1BYMA 1YWPA 3JCMe 4IUTA 3NHNA 4ECTA 3HTRA 2JS2A 3HKZA 1YBYA 2LJ3A 1SF9A 2K2MA 1V1CA 1Y1VA 5GAMe 3SWNA 3MCAB 5LOVF 5KG0A 1QWFA 2RI3A 3M56A 4NXNH 1XDNA 4JI2H 1JX4A 1D0XA 1Y96B 4LH7A 4M78C 3CMET 3OA6A 3TEEA 2F2XA 3CMAA 1ARKA 3CMAT 2HGSA 2DXCA 3H3VH 1ZUUA 1ZHSA 1OZ2A 3H0HA 5GAN3 2EPDA 4ME7A 1GSOA 2XKOC 3UFXB 2LJ1A 2EQJA 5IYBG 5GAN6 4J9GA 5L23A 1N9RA 3RB4A 4E7ZA 2EYWA 2Y0SE 2O4XB 2EQMA 1Z2PX 2RK1A 2DPIA 4JV5H 3R5FA 1N34H 1HNXH 2V8JA 4TVRA 4BY1G 4RG2A 1PX2A 3L2UA 2UU9H 4XQ3A 4OVAA 5ECAA 4J9EA 1GBRA 1H92A 2HL3A 3CCET 4AQYH 1KJWA 1I81A 3A8GB 1JXOA 3A1PA 4X64H 5J2UF 2I8CA 4A3DG 4DR7H 1FWZA 1ZHIA 4FYWB 1K9MR 1T3SA 4QWDA 4EBCA 1QVFP 1S0NA 4DR6H 3HFOA 1Q82R 5KG7A 3G6YA 3N5BB 2GQVA 2JMAA 2HAXA 3VRYA 3EGDA 1QVGP 2C28A 4RTVA 2ROLA 2RD1A 1EYZA 3V6JA 5FD5A 5HV6A 1PSFA 3CBOA 1M3CA 5L9XA 2DETA 2Y90A 1G3WA 1I94H 3C95A 2A08A 4M77C 1K1SA 1MHNA 2QQSA 2KR3A 3CD6T 2JS0A 4QIWA 4I7HA 5I2MA 2OWOA 4J9IA 1VQ7A 1IREB 4EEQA 2DBKA 4DV0H 2VKNA 1VQ9Q 4HCZA 4DL2A 4M77G 1JRIA 3VU3C 3OQ5A 2QQ9A 3M55A 3TSWA 2W6QA 1VQ5T 3M4IA 1J3TA 2XMFA 2FP4B 3CPWP 1UECA 3I56Q 4RAZA 2R7NA 1UG1A 4RUAA 5KFDA 5J39A 4M77A 2R58A 5KYYA 2DERA 4O4HF 1WHGA 1D0YA 5LMUH 2MCTA 2K57A 4ZGDB 4YAKB 4NS5A 2RK2A 4A3IG 3BJYA 1UC8A 5DGAA 1M8MA 4AG1C 2CW7A 1QWEA 1WXTA 3PIPA 2EFIA 4C0DB 4XU1A 1VQKT 2WDTA 4JZ3A 2QA4T 2LMJA 4FSSA 1VQ5Q 2YS6A 4UCOA 5GJVB 2HNIA 4RB1A 1S0OA 1SRMA 4C5CA 4M78F 2VR1A 1PD0A 1TXQA 1OWTA 5FW9A 1MUZA 3Q1JA 5DQHA 1XQHA 2W9BB 5D8DA 2B63G 4F4YA 3LLRA 2NU9B 1WNLA 3T1YH 2D8JA 4A4GA 4DBHA 4J0MA 5KKNB 2LZ6B 2D9TA 4QKUA 1YJWT 1JEGA 1N56A 4IR1A 4K0KH 1YIJQ 1JIHA 2FVUA 1G83A 2FLPA 4C0ZA 4BWSC 3VYHB 4X9DA 3JCMQ 3H4DA 3OSVA 2K5LA 1FJGH 3NTIA 3JRXA 3V6KA 2EGCA 2RQTA 1E4GT 2E6ZA 3CC4T 2YZMA 3JRWA 3N41B 4DR1H 5KFAA 2VUGA 2BQRA 2ASDA 5A2QE 1LPLA 3JRZA 1TWCA 1UUEA 3JSLA 2DXTA 3PMTA 3C4SA 1R9TA 5DM7R 3OSPA 1HNWH 3HB9A 3DLLA 1MZBA 1IBKH 3S3NA 1RLPC 1UGVA 5LJ3j 1YJNT 2DE0X 4RCCA 4MV8A 5KFSA 2YRVA 4R55A 1VQ8T 2DEUA 3MP1A 2QDLA 2KRMA 1ACMB 2V8KA 2K6DA 1VQ5A 4BY7G 4EMKC 4BBSG 4CI0C 2RB6A 4NXMH 3FKIA 4I4TF 2K3XA 4JJCA 1G5VA 3PMIA 4OF1A 4MA5A 2CKKA 3X28B 1JU5C 1V9PA 3GTMA 1SEMA 3JB9G 4OP0A 1JO8A 1I3QA 3TVTA 1RAFB 3OYLA 3G6ET 3QFFA 4YR0A 4IUQA 3M59A 4QVZA 4HT9A 4O3NA 2WYOA 4M75G 1R0CB 4LDWA 3RIZA 2V4RA 4M7DG 4ANJA 4M7DB 5C6SA 4PJOE 4FS2A 1FMVA 3S3OA 2MF2A 2QGGA 2MYSA 3QYHB 4N0AA 2HQXA 5EWEA 1SFOA 4O4LF 4GC7A 2FEIA 2DRKA 3GTKA 4F4WA 4QVDA 2YU9A 2A28A 4M78D 4X9CA 2I80A 4DR4H 3IN5A 4Y28E 1JBMA 4M7AC 3EG3A 4XTVA 2NUTA 4JDSA 1N27A 3EH1A 1QKXA 3UA7A 1WHKA 4MV4A 1E4EB 1EFNA 4LMYA 4BB7A 1GGOA 3FMAA 2ZM6H 4KH0B 4EGQA 3C94A 3J80W 2CZGA 2RGVA 2C22A 1ZQ1A 5CVIA 2CUBA 1ABQA 1N36H 2XIGA 1I1JA 2HDAA 2FPIB 4ZN3A 3RMQA 1W93A 1UC9A 3WNZA 1OZ3A 2AHJB 4M4ZA 1KBLA 2LQNA 1RJRA 4C92G 1TUDA 5LJ3e 2FKLA 2VWFA 2GCXA 3A8LB 4M77D 3SI8A 3EHQA 2GLTA 2F4VH 1YJ9A 2DL5A 5C4XG 6AT1B 2RMOA 2GTJA 4ECVA 2GFAA 2YLCA 2W7PA 3ASKA 4CC3A 3Q8PB 3M0QA 4C8QE 2YT6A 4LH6A 3SB2A 2C2DA 2A7YA 1MNEA 5LJ5j 4M7DC 3U9SA 4DL6A 1RK5A 2R7KA 2R5MA 3MEWA 2M02A 2QG9B 1MNDA 1SHGA 3V8LA 2R8GA 3FB9A 4JPBW 5GANd 3U23A 2K3BA 1NE8A 2DL8A 4PJNA 3OYKA 3VS5A 1BIAA 2FB7A 3CC7Q 3EGUA 1U5SA 5BR8H 4K11A 3M9MB 1YWOA 2WSFE 1DJ7B 2YWWA 4XU2A 5CR2A 2R7MA 4OMNA 4ZGEB 2JMCA 2GFUA 1UB4A 3OYMA 3TIIA 4N4GA 2OTJA 5CCAA 5GAOl 1UFFA 1SYXB 5HBRB 2J6UA 1S72T 1XOVA 3VYGA 3GTGA 2E5QA 1W2BS 4UCVA 2QK0A 1VQ4Q 4PJMA 1YHQT 4HKEA 2VOBA 4EIKA 3GTQA 1KQ1A 4DL5A 2CP2A 4HR7A 3K3VA 4X62H 3CCSA 5GAOm 2EJFA 1O75A 3M57A 2R7LA 2CT4A 1B7TA 2IP4A 4R7RA 1EZZB 5GMKi 1YI2A 1I6UA 1ZQ7A 2D0QB 3CMAQ 4A4KA 3RIRA 1KJ8A 4M75C 1ZUKA 4KRTA 2KYMA 4Y8VB 1WZOA 2K3YA 4ED1A 1RAAB 1AN7A 2EGAA 4N4HA 4MV1A 3MEAA 5A0LA 1R0BG 3OUUA 3RB6A 4B3MH 3T5LA 2LCCA 4M75E 1EZ1A 3H40A 1YHQQ 1LOJA 4ZOLF 5C1OA 3M0UA 1KK7A 3X24B 4IIMA 1BI2A 2W9BA 2MOXA 3LP8A 4QWCA 5LJ5e 4DL7A 2QYZA 5LJ5g 3CCVA 2VV5A 4CRIA 3HP9A 2UXDH 5KFRA 4LDXA 4EFEA 3PO2G 2PZ1A 2GGRA 5C0MA 3LH5A 5I11A 4E7LA 4PNOA 2FE3A 2YRWA 1N33H 2X3WD 4AG2C 1TWBA 2Z0WA 2EYXA 2DK3A 5DY9A 3X26B 1VQ4A 3RAQA 4IR9A 4BI8B 4LNPA 2RHUA 2G3RA 2JM8A 2L3SA 3CCLT 3CCSQ 5IYDG 3GV5B 5KT2A 3QIIA 4QW8A 5GAN8 5D1OA 2AT1B 3BA8A 3MR5A 5KYUB 4TQRA 4LF6H 1SCUB 1OV3A 1ZBXA 3N43B 3CXCP 1PHTA 3F70A 4A4EA 5GAN4 4LUDA 4MV9A 3G71T 3QHSA 1KC7A 3T5KA 1AZGB 2J6TA 4M9UA 1SRLA 1K1ZA 2HQEA 2DIGA 3H6ZA 3CPWA 3A5ZB 1NEBA 3VS1A 2FPDA 1B34B 2DXBA 4MTDA 2RGRA 3MPUB 1WYXA 4QQDA 3BW1A 1XJWB 2UVVA 4G3IA 1K8AU 3I56T 2E4HA 4DA4A 4EMHA 3OMCA 3G8CA 5EG2A 1TU0B 3RF2A 2IVWA 1HXDA 1Y07A 4L6V5 3GLXA 1X2KA 2DTHA 4RTWA 1JQQA 1YJNA 3L4JA 5K2MA 3ZBDA 1HK9A 1M0TA 3LWBA 1N9SA 4EDUA 4HCCA 5CKFA 3VS2A 2L3RA 3K3PA 5KFVA 4EBDA 1XNRH 3H8ZA 2DZ9A 4RZRA 2CQYA 2OI3A 2DZCA 2GQIA 2MWOA 4FYVB 4DBQA 1PRLC 2DPJA 1ZSZA 2W71A 3Q8QB 2BQUA 2DKGA 1NJIU 4LSAA 4A93G 2DL3A 3MJFA 4C0DC 3FRNA 4O2BF 1BI3A 2RI2A 3CCQQ 5KFLA 2K4YA 4M75A 1K76A 2FB9A 3J81W 3CCRA 4DOWA 2Y4XA 1GSAA 3AHUA 1E4EA 2NUPA 3M0RA 3TU4K 1RI9A 2LT1A 5J3BA 3E2UA 4BY6B 4B3RH 1IXDA 3MFIA 2E12A 3GIQA 5HK0A 3U9TA 5DLQE 5LL6b 1WSCA 3QBYA 5GAMh 4M77E 1TOVA 2YS7A 4J9QA 2JA6A 2C0TA 4F4XA 3RKWA 5CAIA 3L2PA 1AT1B 3NGPA 4JRKA 2CUDA 2WE6A 4DV6H 1YJNQ 4MZTA 5C1PA 4YY3H 1A0NB 2R8KA 3HFNA 5LJ3f 3N8DA 1A9XA 2BKDN 2YDLA 4XTUA 3CCJT 3N40P 4JUZA 2EJ9A 1M0WA 4YR2A 1YCYA 5L1JA 4CC2A 4JV2A 4C8QA 2X4YA 4PLLA 2J7IA 3PGGA 2DM1A 1AWJA 4C92B 2NU6B 4OMPA 4KH1B 3EHRA 1VQNA 5H80A 3OHBA 5KCOA 1M7JA 2AK5A 1K0XA 1KHCA 5LMNH 2CP0A 4BDYA 1KD1R 2QASA 1YN8A 4LDUA 2XK0A 4Z88A 1ZX6A 1RJQA 2UXCH 1A0IA 1VUBA 4XU0A 1X01A 3UWNA 1U1SA 2ECZA 1K0SA 3EH2A 5DGBA 2VASA 4ED7A 4JI3H 2JW4A 3G1JA 1Q7YU 2V1QA 3MWEA 3HOVG 2FJZA 5KFKA 2CSIA 2V5AA 2CZ0B 5DQGA 4FYYB 3BFMA 1PKSA 3VS0A 5LJ5f 1IHWA 1M6VA 3E19A 2XU8A 2P0PA 4OMMA 3OW2S 4ECZA 2XI9A 2WACA 3I12A 4RTZA 1SHFA 1OPKA 1U06A 2DTOA 1RABB 5CKHA 4YTLA 4EBEA 3EFSA 5D6YA 3FC3A 3MR3A 2XCAA 2AIRB 3SDZA 1T94A 5C3EG 4BE2A 1N8RR 5IYZF 3VUBA 2K5FA 3PVLA 2J6KA 5HY6A 4BD3A 4QWAA 4EMGA 2YRDA 3PR4A 2HZYA 1JLLB 3GOXA 2DVJA 1Y71A 4Y91A 1QP2A 4RTXA 1B07A 5EOYA 1LVKA 4PJOC 3CCMT 2R8HA 2FPPB 1EUCB 5AYFA 1X6GA 2M0YA 3VUZA 4ECYA 2V8IA 3UDCA 1IO6A 4ECRA 3CCUA 1KFZA 3HKSA 2H3EB 2R5AA 2BTTA 3PNWC 1JDEA 4HVWA 2RQWA 1QCOA 4BBRG 4ETSA 2KXDA 1VQMA 1B34A 2XDDA 2R82A 4CC6A 2YXYA 2YCHA 3TQ7P 3HXLA 5IYCG 4FIBA 1DGSA 3EPIA 4CC4B 4J9PA 4LDYA 3OYNA 4XZ3B 3CVZA 4BUGA 4A3CG 2PVGB 3CCJA 2O31A 2JA7G 1VQ8A 4RNOA 3QKJA 1D0ZA 1M5Q1 5F9LA 2E5KA 1YI2Q 4PJJA 3PTAA 1E7OA 3Q8RB 3KHRA 4J9LA 3I55A 2GPWA 1K1QA 1ZUYA 4LFBH 4QQGA 1RUWA 1BCMA 1O9SA 2COYA 1UE9A 2P0AA 3E5NA 1I7LA 1Y0MA 2JEGA 1C30A 4UCRA 1N8RC 2IA6A 1DV1A 2R8JA 3OS1A 1I4K1 3HRUA 1NG2A 2F2WA 2M51A 5KH6A 1BBZA 1JDBB 2D1XA 2OLSA 3Q2OA 5KE2A 1FMKA 2NYSA 4NLGA 1I7NA 1D3BB 5CK9A 3GV7B 3TCJA 4D6WA 4CC7A 1Y7XA 2G6FX 2BQ3A 3CCEQ 4NL3A 3MP8A 2HBPA 3O8VA 3JAMW 1W70A 1QVGA 4C8QC 2EKHA 1SEIA 1KC8C 4I50F 3P8BB 1XTDA 1TG0A 1WHHA 4QIWE 4OX9H 2RQVA 3KHHA 3PVQA 4TV9F 4MAMA 3RGZA 5EWFA 1YNZA 2OJ2A 1R77A 2QDYB 3HHTB 1M90R 3MO8A 2XDPA 3CCJQ 2DTIA 4EGJA 4RTTA 2DJZA 5FU7B 2OTLA 1Y1VG 3A8HB 3KXYT 3OUZA 1K83A 2YL2A 3L2ZA 3I55Q 3MWMA 1VQ9T 3HRSA 1NYFA 2W7OA 2PMZA 1KC8U 4LDVA 3V6HA 3OYJA 1EHIA 2GBQA 3THKA 3JV3A 3CC4A 2JA6G 2CT3A 2ABLA 3RNJA 3QJ6A 1M3BA 3QDFA 4JYAH 2DJQA 4BY6C 5GAN7 1HD3A 4O2AF 2F5TX 1WHLA 4ZNXA 4C8QB 2L0AA 2R85A 1K9MC 1UGSB 4E7KA 3GIKA 1TWFA 4UCSA 3KAKA 4C92A 2CH4W 4M75F 4JI1H 3RBDA 2JM9A 4FM4B 1HNZH 2DVEA 3NTKA 5IXFA 2KK4A 3CCMQ 2RQRA 5GMKl 4ZI7F 1U8RA 3LGLA 2QEXA 1IGQA 3HOYG 3OYHA 2CP7A 4V2SA 1YITT 3OYFA 3HOWG 2QA4A 5FRNA 2JNGA 2JJ9A 5KFBA 4RUGA 1VQKA 2HQHA 3JB9D 2OTLQ 4R0KA 2M05A 3CCQA 4RAYA 4YP3A 4ECUA 3MKDA 2EYZA 4XTZA 3CCRQ 1BGWA 4JI6H 2JEIA 3JCMg 2DL4A 2EYQA 3BQ2A 3CMEQ 2F5KA 5FU7C 5HK3A 3EG2A 3KXTA 2FK2A 1FVIA 1T36A 1QQJA 4JJDA 3I56A 2AGPA 3TSZA 1GRIA 2R7ZA 5KG5A 1D1AA 2O88A 5FLXW 1Z2NX 2HD0A 2CZ1B 3CPFA 4DL3A 1K8AC 1BB9A 2FRYA 3EG9A 4Z89A 4C0GA 5LA6F 4DEYA 2QK4A 4DV5H 5FD6A 1AWXA 1KSWA 3CCMA 4J6YA 2W9AA 4HYKA 2YSQA 1AWOA 3M9NB 3UF4A 4Z02A 1GCQC 3L2VA 4HT8A 4ECQA 3V4SA 4LF4H 4RG8A 3KALA 3BABA 2NU7B 4F7UG 2W0ZA 5GAOn 2DZDA 3JCMV 2P4RA 3JCMb 3QZ9B 2VGMA 4FL6A 1UTIA 2X4XA 2X3XD 4VUBA 5I47A 1D3BA 4JZ4A 4LSXA 2SEMA 4C92C 4ECWA 1DIKA 2YHTA 1WFWA 3NTHA 1X9NA 4IRDA 3GBQA 1VIEA 2KYBA 1WCMA 2WAQA 2LX9A 2F1LA 4IRKA 3VS6A 4C0FA 2V59A 4BACA 1M4ZA 3M54A 3FLGA 5GMKm 4MTEA 4YAJB 1GFDA 1GFCA 2KBTA 1T0HA 1Q7YC 2VB6A 2W6MA 1FXXA 3PW5A 4AFZC 1TWGA 4P5NA 3OB9A 1WPYA 1PCXA 3WVDB 4U6PA 3M0TA 1XNQH 2J6FA 2K9GA 1H641 2E1HA 2ZAEA 1AWWA 2HBWA 3OYYA 4C2MA 2RJEA 2FRWA 3M58A 3F8NA 2CYZB 4FS1A 2RNAA 4F16A 3QJYA 1E6HA 2LNVA 2KSSA 4A54A 1S1NA 4FT2A 2RJCA 3CCST 1K73R 5J26A 3CC2A 4A3GG 2P0QA 1K4US 4MV3A 1SSFA 1ZLMA 5LJ3g 1RAHB 3P8DA 2KNBB 1S72A 3RTXA 4LF5H 3HOZG 3GTLA 4A3BG 1M2OA 5GAOq 3T5HA 4II1A 2ATCB 1VQLA 3BE3A 4B9WA 2W6ZA 5IXBA 1Q81U 2FYKA 1M1KU 1B33N 3SD4A 5CQYA 2ZDQA 3G4ST 4BE0A 1BKBA 1SKUB 5DG7A 2UUCH 1X75C 2VGNA 4RKUE 2J06A 4AT1B 3FJ5A 1Q86R 1EX4A 3VS3A 1IOVA 3QZ7A 1MMAA 1WJRA 1TS9A 1M90C 1VOMA 3JCMX 4PJLA 3PIOA 1PC0A 1YJ9T 2NUZA 4HVVA 4IUPA 4A3MG 1WCMG 3RV3A 5IT9E 3OY9A 2FMAA 5FPRA 5KFIA 4QW2A 4A2AA 4C5GA 1VBHA 1LCKA 4M7DF 5FLXE 4B3SH 4HXJA 2QQRA 5GAMg 3JB9H 1I07A 3CCQT 5CA1F 1MV0B 2PVPA 3D7SB 1GBQA 1JJ2P 3CQZA 2NLUA 1QMCA 4UFZA 1B3QA 3URGA 1E4FT 3SEMA 5KFWA 1G2BA 3KHLA 3K5IA 4QW9A 4OMOA 4X65H 3GIJA 1WHJA 2MCNA 3CCLQ 1YJ9Q 3RERA 4A3KG 4F7UA 4QWBA 1OPLA 2EVRA 1ZSZC 2CZ7B 4N0AC 3OBWA 5IN1A 4HCKA 1UJ0A 2P0KA 1M1GA 2O01E 2VUBA 4C5BA 2R6FA 3M4GA 4PJOA 2PU9B 2E3IA 1QW1A 4N4IA 1VYVA 4AFSC 3TIGA 3GQCA 1KQSA 4CC5A 5KFNA 2JOYA 1D09B 3UATA 1I5LA 4DL4A 1GCQA 4C5HA 5IWAH 3OBYA 1X27A 2O2OA 4C8QF 3HOUG 3G6XA 5JQWA 3NFCA 5J2TF 5KFHA 1V51A 3MEUA 2R92G 4OB1B 1VQ6Q 2LCSA 2MPXC 2PUOB 1I5OB 5D6XA 5GONF 4MA0A 1RL2A 1U3OA 4JUVA 1NLOC 5IAYA 4A63B 4DV7H 2W8KA 1QKWA 4XTWA 4C5IA 1YITA 2V58A 5GAOp 4E7IA 3QWXX 3CCLA 1WGSA 5GAMj 1K8AR 1VQ9A 5A2QW 2RI5A 5GANj 2UUBH 2RF4A 5C5JA 2ZPGB 3Q8SB 4O6JA 3MJXA 3RDVA 4BE1A 3R5HA 2LTOA 1QVGS 1N6AA 1RADB 2KMTA 1K73U 4IURA 3QUIA 1E6GA 1VA7A 3OMGA 3QXEB 3ORQA 1KJJA 2BUDA 1TH7A 2XIDA 4DLKA 1BU1A 2BE7D 1C1AA 2LJ0A 4OGEA 2YRXA 4XX0B 2E3HA 3ETHA 2YUNA 3I9QA 1M2VB 3AYHB 4IHJF 1OEBA 5D1PA 1BK2A 2AGQA 4LD6A 4M7DD 1VQ6A 5KFPA 4RTUA 2F2VA 1AD5A 4L1KA 4UC4A 5KYXB 1KHIA 5EZYF 2I87A 5JH7F 3SWNB 1NPRA 2VXEA 2DNUA 1Q81C 1M1KC 1ULZA 2XCPA 1KQSP 4PFPA 5FLMG 3G4SA 4IIOA 3RAXA 1NM7A 2FZCB 2JTMA 5JUMA 4A3FG 5KFGA 5FRMA 2WTFA 4DEXA 1KIKA 2OAUA 1IHVA 4JRIA 1VBGA 2OH2A 1W6XA 1AUVA 3H20A 1RACB 2JA5A 1N5ZA 2F69A 2YZGA 4O3QA 4HNTA 5CQXA 1MV3A 1M9SA 3CCVT 3VJPA 2KE9A 2YW2A 2R57A 2R7ZG 3MP6A 1IBMH 1X43A 1YFNA 3OSNA 1L2ZA 2KT1A 3KFVA 4M7AD 2UVUA 1Y57A 1UEBA 1VQ7T 4ED6A 4IRCA 4M7AB 4ED2A 3RV4A 3L1AA 2DIQA 2R93G 2ZPBB 3C0FB 2E10A 3ZL7C 4TV8F 4F14A 4J9CA 1QVPA 4JLGA 3Q1KA 2UUAH 2RM4A 2XD0A 2J6OA 1NZ9A 2CDTA 4J5YA 3PFSA 3MWDA 4DR5H 2FPGB 3OS5A 3EGDB 2XCLA 4OMQA 1ZSZB 3G6EQ 1K9AA 1CS0A 3OYAA 2CGHA 1UDLA 3V8JA 2O03A 4C92F 1NBEB 1PD1A 5AT1B 3UA6A 5KFFA 3T9NA 1Y1WG 2I0NA 3I4NG 1AUXA 2RPNA 4PLIA 4M75B 2D8HA 1VQ7Q 3CXCA 3RJ0A 3VPCA 2D6FA 2UXBH 1HSQA 1VAJA 1GL5A 4LFAH 2DIKA 2NUPB 1Y1WA 2OTJT 2FPFA 3RKYA 5KYWB 4KBMB 3EAEA 3MR6A 2VUMA 4HQ6A 2JXBA 2YYAA 5BPFA 3PR5B 4NOYA 2FPEA 3CCUT 1BIBA 4LD9K 1LNXA 4Q45A 2AKKA 5FWCA 3L4KA 3V7SA 2C0IA 1ZSGA 2IIMA 5KE3A 4M78A 2NUTB 4AYBA 1S03G 4MDWA 3VPBA 1Q82C 4Q43A 4LF9H 3SWNC 2VPSA 3S6WA 5KT3A 4DV3H 2ASLA 4Q8FA 1W96A 3CC2Q 3LYIA 2UVWA 5JVDF 1GXIE 2E5LH 3KTMA 3QYGB 2RHYA 2KSWA 1IBLH 5EWGA 3G6EA 2DLNA 2V26A 5IH2A 4KT0E 3CBPA 3PO3G 1B04A 5LL6S 4KGVB 5I2SA 3CPWS 5KT4A 5KT6A 2YLBA 3GIBA 2W9CA 3RGXA 4D8DA 1VQNQ 4F50A 2HSEB 1M1FA 2DX1A 2XDBA 5GMKj 3LWHA 2EAYA 4FYXB 2HJWA 2PBZA 4APMA 2PN1A 1M30A 2FK1A 4FU0A 5KFUA 3BA9A 3JCMW 3H0IA 5KFTA 4JI0H 4RMOA 4OB0B 3TREA 2DAQA 3SFMA 4YB8B 1T3LA 4HNUA 2DBMA 5GAN2 1ZA1B 1UGQB 5LJ3h 3QG1A 5CAEB 4Q44A 2HMAA 3JCMJ 3A8MB 2CP6A 2IG0A 4KGZB 2JT4A 1QVFS 3GLKA 5KFCA 4GKKH 2JTEA 3BDUA 3LWIA 2LCLA 3QDRB 2DILA 4LUEA 1WIEA 4ELYC 1N32H 3LGFA 4PFZA 4X34A 4Y92A 3OYBA 4M78E 1WI7A 3EG0A 5CO7A 5IHNA 3OYDA 3OW2A 3BQ1A 3PN1A 2FG0A 1SG5A 4ED0A 2LT4A 1KQ2A 3J7AK 4LF8H 1X69A 1X6BA 4LFCH 3OTOH 2VVKA 3V7RA 5IHIA 5A0DA 4RCBA 4C92E 5KX5F 4RZQA 1M3AA 2KRNA 2W6OA 4RTYA 1Q86C 5T14A 3RKXA 3G7ZA 4JI4H 2DO3A 4WD3A 4M7DA 1KEEA 1RJPA 1CKBA 2CREA 3I5SA 4ESRA 5KYXA 3JSNA 2A36A 2RJFA 1QCNA 3EFRA 3CCUQ 2CS7A 1I50A 4RB3C 2DEQA 2EYYA 2C2EA 2L2PA 1YP5A 2BR0A 1OX8A 2E41A 3CXCS 4JS4A 3OSSC 3ZFJA 2V9WA 3UQ8A 1VKZA 2PTKA 1JB0E 2I2LA 2WSEE 1C0MA 4O3PA 1WHMA 1Z9ZA 4M7EA 1KJQA 1BNCA 4EYHB 2YUOA 3GTOA 1S97A 3HOXG 2EWNA 5KYWA 2KEAA 4J9DA 3GILA 3L2WA 3CD6Q 1H8KA 4M7DE 1FMWA 3G6VA 3R6NA 2SRCA 4WBNF 4DBRA 1RI0A 5KYUA 3ORRA 3GIPA 1UGRB 3RESA 1Y96A 3RBBB 4ECXA 4M7AA 4QJFA 2XICA 4RNNA 1YITQ 4OGCA 3ZEHA 3J7AF 1ZHQA 3C0CA 3GIDA 4JJNK 4Z8AA 1F1BB 4KUDK 1V29B 2ALZA 2OTLT 2J9GA 4PWQA 3FDSA 1MMNA 5GAOr 2W8LA 2O4XA 1LJOA 1WX6A 1XNIA 2VYTA 2W57A 3VS4A 1JXMA 4DQ2A 2HVQA 3MFHA 1WJSA 2LVMA 1ZBJA 4QVCA 2L3PA 2M16A 2X9HA 3CC7A 5IP7G 2EQUA 4IWXA 2LQKA 4OMFB 2VPQA 3JB9J 3HKZE 4IZOA 2LRQA 5L8RE 4MZMA 5KFOA 2ENMA 2QTXA 3X20B 4X66H 4JJBA 1PK8A 2FLNA 1AVZC 2H8HA 5KG4A 2KGTA 1Z9QA 2K2VA 3E9GA 3CEYA 2BE9B 5KFJA 1IGUA 4ECSA 2C2RA 2RDIA 4UCTA 2ED0A 4LE9A 3OYEA 4WCIA 3G4SQ 2XHCA 2LC4A 4M78B 3OS2A 4FCYA 2BZYA 2E65A 4EPCA 4RB0A 3PW7A 4E4TA 1AZEA 1B6SA 5FJ8G 5D7UA 5GJWB 1YI2T 3CC4Q 3I5RA 3KUFA 1KQSS 4ZQIA 2LNHB 1HJDA 5CA0F 2GF7A 5KYNA 5M9OA 1PKTA 5DLOA 5KYYB 4R56A 2ZCFB 4E7SA 1ZETA 1OOTA 2C0OA 1PM3A 1CE8A 4MDXA 3V4ZA 3ER0A 1G3TA 3H4BA 1S0MA 4QQ6A 2PVOB 2L89A 1WH2A 3VMMA 2W9CB 3M0PA 3RFCA 4A3JG 1RAGB 4AYBE 4J9SA 4EG0A 2A0FB 2M1HA 2ZPIB 3H0FA 2B63A 2BZXA 2DF6A 4O4IF 4MV7A 4BDZA 1Q81R 1M1KR 2QEXQ 1UHFA 4UCUA 4PFOA 2K79A 3WO0A 1H3ZA 2MIOA 1TUCA 1UNNC 3RUPA 1Q82U 3BQ0A 4E7JA 5FU6C 4L59A 5KCHA 4I55F 4DBFA 3BY7A 4RNMA 3PE0A 2IBKA 2MMPA 3REBB 2B8AA 4KULA 4JLIA 3MEVA 3MR2A 5IT9W 3UPUA 3PT9A 3RB3A 1YIJA 1RYSA 2P84A 4ATOA 1IRXA 2QI2A 2QXFA 3DB3A 2KVQG 2PNIA 1GO3E 4JI7H 2RF0A 2COWA 2CP3A 1NEGA 5GMKe 2VXFA 1IOWA 4E2FB 1RAIB 5IP9G 2RJDA 2EQKA 2EIFA 3M53A 1VQOT 8AT1B 2AU0A 4DR2H 1VQ6T 2X0SA 5KT5A 3PW2A 5CKEA 2IMWP 1JJ2A 1J5EH 2VA2A 3ME9A 2X4JA 1W1FA 3GV8B 4XAXB 2NVYA 1WXUA 1V76A 2VQFH 4ORZA 2P4TA 5KFZA 4DV1H 5CIUA 4JRPA 2CKZB 3VV0A 1WLPB 4C92D 1OU8A 2FZKB 2W10A 2ZGWA 2KXCA 3FIFA 5L1IA 4WTOB 3N44B 4NL2A 1VQNT 4DUZH 4ZN1A 4J7FA 1TSFA 1BXRA 2VC8A 2ZPHB 4MMLA 5EDWA 1NJIC 1DV2A 1T0JA 4IUVA 5CB4F 2MK5A 3CC7T 2HVSA 2FK3A 3N6XA 2KDSA 2KQWA 1KG1A 1WQ7A 5BPHA 2JA5G 1PG5B 2RQUA 2QQBA 2JUFA 3ULRB 2RH2A 2K7AA 4EYIB 1EIFA 1FX7A 1KD1U 4ZGJB 5KFEA 2DL7A 1AEYA 3NPFA 2Y0SA 3O5ZA 5FROA 1WA7A 5LJ5d 3HL8A 4ZTFA 4J9MA 1S9FA 2ROTA 3FJPA 3GF5A 3BDLA 2PMZE 2YUQA 4J9KA 2E70A 2ZDHA 3EG1A 2R93A 2A37A 4J9RA 5KFXA 2QEXT 5F9NA 2ESWA 2X4WA 5LYJF 3K5HA 4PDBA 4JS5A 3M4YA 4C8QD 2Q2TA 2JA8G 1S72Q 4B6MA 1TAEA 2JZ2A 3MHXA 2FHDA 1YJWQ 4GC6A 4C5AA 1QCFA 3H0GG 4ME6A 2X51A 2WSCE 3LH0A 4TUYF 2PUKB 2ZDGA 3CCRT 1G8XA 3G71Q 5L1KA 4DUYH 1UJYA 2J05A 3V7CA 1W2BA 2XC9A 1K73C 3HPWA 3R23A 1QVFA 4PL6A 4WF2A 2DPPB 4F7UE 3LX7A 3CBMA 5KG1A 2JVVA 1P92A 1VYTA 2KI7A 3LMLA 2JN0A 3EYYA 4GLKA 2E2IA 2O9SA 4ELZC 2XGQA 4E47A 1CKAA 3JCMd 5FPOA 4YQWA 4EMKA 2KT8A 4YBZB 3J81E 4GKJH 4GLMA 2E64A 3META 5DQIA 3RR6A 4IAJA 4FSXA 3AT1B 4XK8E 1OQKA 2OTJQ 3EPGA 5C8YF 5L1LA 4M78G 4GY5A 2C00A 4J83A 4RB2C 2RDJA 3FDRA 2ZPFB 3INZA 1PNJA 1BI0A 5FWBA 2HSPA 3LW5E 5DLGA 4FBUA 4XTYA 5KFQA 3CD6A 4L5GA 1UGPB 3HSBA 5KG2A 7AT1B 3M9QA 3FEOA 1H3HA 2RHXA 4BI3A 3DKMA 5GMKh 4Q8EA 4DV4H 2JA7A 5GANh 2WB1A 1GSHA 2DYIA 4F7UB 2EW3A 3JB9I 4FT4A 2K5IA 3H9NA 2AQ4A 2R84A 3NGDA 4AFUC 2ZPEB 1D1BA 2ASJA 2Q2UA 2HVRA 2H3JA 4PJOD 2E2HA 2MI6A 5IHKA 4PJOB 4OMLA 1VQ4T 4KHPH 3N42B 3A98A 4DR3H 1YHQA 2L3QA 1YIJT 1RYRA 1X6OA 1WDXA 3I35A 4OB3B 1VQMT 1NPPA 2JEFA 3X25B 4HVUA 3GPLA 3SHWA 4B9XA 3CCVQ 4AMCA 1VS0A 3GTJA 1VQMQ 3EGXA 4PJOF 2WAQE 4AFQC 2CSQA 1BJTA 2WB1E 2AGOA 1P8LA 1TWAA 4A3LG 2HL5C 4JI8H 3M5AA 4HCBA 2EQIA 2L5QA 2RA2A 1NLPC 3PVXA 5CKDA 5C44G 4J6WA 2VUMG 1MGQA 5D1OB 3OYIA 1AHJB 1SPKA 4JV0A 3SE7A 1VIFA 1VQ8Q 3A8OB 4YJ3F 2EKOA 1GLVA 3T5JA 2LDMA 3UT1A 3TQ1A 1M90U 4PKCC 2HEQA 2CH4A 3QO3A 1GYFA 4Q5WA 1IB8A 9ATCB 2LQ8A 2KRSA 1QLYA 2DYBA 4E7HA 2W6NA 3JCMP 1NYGA 3JAME 2D0NA 5BMVF 1Y14B 4ED3A 2Y4YA 1VYUA 3CMEA 5GANg 3J80E 5LXTF 4IKFA 4J9FA 1KC8R 1JJ2S 3WO1A 2RN8A 1CQIB 2AZVA 3NMZC 2QGFB 1X2QA 4F7UF 2KROA 4M7AF 3BG5A 4J9OA 4A53A 2O9VA 1WJQA 2DRMA 2J6SA 1MMDA 4BXXG 4J7IA 1WQWA 2ED1A 2RHIA 1UHCA 3JCMh 2C35B 2YRCA 3OW2P 3GNFB 1Z2OX 4MMKA 3HRTA 5HKCA 2FZGB 4LN2A 5LJ5h 2HKNA 2PVDB 4U7CA 1TUGB 1MMGA 2XG8D 3EFOB 2DXUA 1JKJB 3KHGA 3KAJA 3OYGA 4ED8A 4TQSA 4EMKB 4M77F 4Q0YA 2NUAB 2R87A 2M9UA 2HKQB 1FYNA 5CKBA 1TA8A 3WVEB 2ATLA 5I22A 3L2QA 2R92A 2VQDA 4MZPA 4OB2B 2DA9A 1OI1A 2XD4A 2XGPA 4DV2H 2CP5A 3OYCA 4R8UA 1G3SA 2AZSA 1C3OA 5LP6F 4LXCA 2HHHH 4O3RA 4XYMB 1W2BP 3DLMA 1AOJA 1BI1A 4YHHH 3VRZA 4C5EA 2ZJTA 4FW2A 4ZHQF 4QT7A 4A4HA 3V8KA 5DG9A 3FKIG 1W4SA 3QPHA 2L8DA 1OULA 4PJOG 3RMSA 3WXMB 2ZZDA 1QP3A 3VKIA 3GP8A 3QZ5B 5KFMA 3E9FA 1VQPQ 2SCUB 3H0GA 2QA4Q 1CQJB 2NVXA 2DD5A 1PWTA 4IUUA 1EUDB 3QSUA 1VQKQ 3HBLA 1IZ6A 3JSCA 2NWMA 5GAMf 3TQTA 4YR3A 1S10A 4QWEA 5KG3A 3PW0A 5GAMd 2NU8B 4DOVA 2VQEH 1RK6A 1I8FA 3JB9F 3EGXB 2EJGA 3H41A 2YUPA 1S68A 3RB0A 3R6OA 1R8OB 1PRMC 2X35A 2JEJA 5EC7A 5KFYA 4O3OA 4HA8A 1G3YA 3PW4A 2LP5A 5GANe 5HCKA 4J9HA 1VQPT 2W6PA 3GTPA 5A0GA 2YZNA 5D6WA 1N48A 1KD1C 4F4ZA 3EG9B 4GBQA 4M7AG 1V4YA 3JZIA 8ATCB 5GAN5 2COZA 3S3MA 4XTXA 4M7AE 1OYXA 3VPDA 3T1HH 1ABOA 1Q95G 3IQLA 1WR2A 3GNGA 2V1RA 2EGEA 2MWPA 4O3SA 1BCOA 3VS7A 5LJ3d 2CZ6B 4KUIA 1M8VA 2FL7A 4FU6A 2M0OA 2GPSA 1VQPA 1I0CA 2BZ8A 5I21A 3R5XA 4M77B 4PK4A 4RU9A 3IG0A 4BI4A 4F17A 1SSHA 1YJWA 1JXLA 3I4MG 2RHZA 4JI5H 4EFBA 2GTOA 2KAFA 4HNVA 2DWCA 3G71A 1WXBA 4LF7H 1K9MU 4IWYA 4C8QG 2BIVA 3E1SA 4E6RA 1B6RA 3L42A 3QWYA 5FU6B 2LQWA 3DB4A 4FW1A 4O5VA 2KY9A 3TINA 2OAWA 5GANf 1NJIR 2CW8A 4JV1A 3ETJA 3P8HA 5DG8A 1RLQC 1U1TA 4M75D 1VQOA 2DFUA 3C12A 2R86A 4A2BA 2DLPA 2HCKA 3RBEA 4XYLB 5KG6A 1CSKA 1RAEB 4F04B 1KJ9A 1Q86U 4D8KA 2QTVA 3RUXA 4MV6A 3M9OB 2DMOA 4KGXB 1Q7YR 2A3LA 1TWHA 2RO0A 2V4QA 3JCMc 2VA3A 3REAB 3GIIA 1GCPA 1T3NA 2JTFA 5DLFA 1M27C 2IPOB 2QQAA 4J9BA 4J9NA 2E6NA 1ZA2B 4RUCA 4R8UB 3OS0A 3CC2T 2OX7A 3KBGA 1VQLQ 1HR0H 2FLLA 1C6VX 2UVRA 4JRQA 4YJ2F 3QZ8A 3PZPA 4A4FA 1N8RU 1XMQH 2LX7A 2W70A 3BAAA 1YCSB 3I55T 4XU3A 5KT7A 2GNCA 2R8IA 3CQTA 2C06A 4J8OA 4GLXA 1VQOQ 2EBPA 2B86A 3EFOA 4A3EG 2QAZA 1XMOH 1KJIA 1HYOA 3OHAA
chains in the Genus database with same CATH topology
2QYZA 2OX7A 2P84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYZ A;  2OX7 A;  2P84 A; 
#chains in the Genus database with same CATH topology
 1OU9 A;  1OX9 A;  3L2R A;  4X1V A;  2MAM A;  2PQW A;  1FKA H;  4FBT A;  4B3T H;  2DD4 A;  2AKL A;  3M0S A;  3CCE A;  3JCM f;  3GIM A;  1PSE A;  4EEY A;  1D1C A;  1M2V A;  1TTH B;  1VQL T;  4FM9 A;  2FO0 A;  5JVL A;  4J6X A;  3DF7 A;  4ZTJ A;  1BYM A;  1YWP A;  3JCM e;  4IUT A;  3NHN A;  4ECT A;  3HTR A;  2JS2 A;  3HKZ A;  1YBY A;  2LJ3 A;  1SF9 A;  2K2M A;  1V1C A;  1Y1V A;  5GAM e;  3SWN A;  3MCA B;  5LOV F;  5KG0 A;  1QWF A;  2RI3 A;  3M56 A;  4NXN H;  1XDN A;  4JI2 H;  1JX4 A;  1D0X A;  1Y96 B;  4LH7 A;  4M78 C;  3CME T;  3OA6 A;  3TEE A;  2F2X A;  3CMA A;  1ARK A;  3CMA T;  2HGS A;  2DXC A;  3H3V H;  1ZUU A;  1ZHS A;  1OZ2 A;  3H0H A;  5GAN 3;  2EPD A;  4ME7 A;  1GSO A;  2XKO C;  3UFX B;  2LJ1 A;  2EQJ A;  5IYB G;  5GAN 6;  4J9G A;  5L23 A;  1N9R A;  3RB4 A;  4E7Z A;  2EYW A;  2Y0S E;  2O4X B;  2EQM A;  1Z2P X;  2RK1 A;  2DPI A;  4JV5 H;  3R5F A;  1N34 H;  1HNX H;  2V8J A;  4TVR A;  4BY1 G;  4RG2 A;  1PX2 A;  3L2U A;  2UU9 H;  4XQ3 A;  4OVA A;  5ECA A;  4J9E A;  1GBR A;  1H92 A;  2HL3 A;  3CCE T;  4AQY H;  1KJW A;  1I81 A;  3A8G B;  1JXO A;  3A1P A;  4X64 H;  5J2U F;  2I8C A;  4A3D G;  4DR7 H;  1FWZ A;  1ZHI A;  4FYW B;  1K9M R;  1T3S A;  4QWD A;  4EBC A;  1QVF P;  1S0N A;  4DR6 H;  3HFO A;  1Q82 R;  5KG7 A;  3G6Y A;  3N5B B;  2GQV A;  2JMA A;  2HAX A;  3VRY A;  3EGD A;  1QVG P;  2C28 A;  4RTV A;  2ROL A;  2RD1 A;  1EYZ A;  3V6J A;  5FD5 A;  5HV6 A;  1PSF A;  3CBO A;  1M3C A;  5L9X A;  2DET A;  2Y90 A;  1G3W A;  1I94 H;  3C95 A;  2A08 A;  4M77 C;  1K1S A;  1MHN A;  2QQS A;  2KR3 A;  3CD6 T;  2JS0 A;  4QIW A;  4I7H A;  5I2M A;  2OWO A;  4J9I A;  1VQ7 A;  1IRE B;  4EEQ A;  2DBK A;  4DV0 H;  2VKN A;  1VQ9 Q;  4HCZ A;  4DL2 A;  4M77 G;  1JRI A;  3VU3 C;  3OQ5 A;  2QQ9 A;  3M55 A;  3TSW A;  2W6Q A;  1VQ5 T;  3M4I A;  1J3T A;  2XMF A;  2FP4 B;  3CPW P;  1UEC A;  3I56 Q;  4RAZ A;  2R7N A;  1UG1 A;  4RUA A;  5KFD A;  5J39 A;  4M77 A;  2R58 A;  5KYY A;  2DER A;  4O4H F;  1WHG A;  1D0Y A;  5LMU H;  2MCT A;  2K57 A;  4ZGD B;  4YAK B;  4NS5 A;  2RK2 A;  4A3I G;  3BJY A;  1UC8 A;  5DGA A;  1M8M A;  4AG1 C;  2CW7 A;  1QWE A;  1WXT A;  3PIP A;  2EFI A;  4C0D B;  4XU1 A;  1VQK T;  2WDT A;  4JZ3 A;  2QA4 T;  2LMJ A;  4FSS A;  1VQ5 Q;  2YS6 A;  4UCO A;  5GJV B;  2HNI A;  4RB1 A;  1S0O A;  1SRM A;  4C5C A;  4M78 F;  2VR1 A;  1PD0 A;  1TXQ A;  1OWT A;  5FW9 A;  1MUZ A;  3Q1J A;  5DQH A;  1XQH A;  2W9B B;  5D8D A;  2B63 G;  4F4Y A;  3LLR A;  2NU9 B;  1WNL A;  3T1Y H;  2D8J A;  4A4G A;  4DBH A;  4J0M A;  5KKN B;  2LZ6 B;  2D9T A;  4QKU A;  1YJW T;  1JEG A;  1N56 A;  4IR1 A;  4K0K H;  1YIJ Q;  1JIH A;  2FVU A;  1G83 A;  2FLP A;  4C0Z A;  4BWS C;  3VYH B;  4X9D A;  3JCM Q;  3H4D A;  3OSV A;  2K5L A;  1FJG H;  3NTI A;  3JRX A;  3V6K A;  2EGC A;  2RQT A;  1E4G T;  2E6Z A;  3CC4 T;  2YZM A;  3JRW A;  3N41 B;  4DR1 H;  5KFA A;  2VUG A;  2BQR A;  2ASD A;  5A2Q E;  1LPL A;  3JRZ A;  1TWC A;  1UUE A;  3JSL A;  2DXT A;  3PMT A;  3C4S A;  1R9T A;  5DM7 R;  3OSP A;  1HNW H;  3HB9 A;  3DLL A;  1MZB A;  1IBK H;  3S3N A;  1RLP C;  1UGV A;  5LJ3 j;  1YJN T;  2DE0 X;  4RCC A;  4MV8 A;  5KFS A;  2YRV A;  4R55 A;  1VQ8 T;  2DEU A;  3MP1 A;  2QDL A;  2KRM A;  1ACM B;  2V8K A;  2K6D A;  1VQ5 A;  4BY7 G;  4EMK C;  4BBS G;  4CI0 C;  2RB6 A;  4NXM H;  3FKI A;  4I4T F;  2K3X A;  4JJC A;  1G5V A;  3PMI A;  4OF1 A;  4MA5 A;  2CKK A;  3X28 B;  1JU5 C;  1V9P A;  3GTM A;  1SEM A;  3JB9 G;  4OP0 A;  1JO8 A;  1I3Q A;  3TVT A;  1RAF B;  3OYL A;  3G6E T;  3QFF A;  4YR0 A;  4IUQ A;  3M59 A;  4QVZ A;  4HT9 A;  4O3N A;  2WYO A;  4M75 G;  1R0C B;  4LDW A;  3RIZ A;  2V4R A;  4M7D G;  4ANJ A;  4M7D B;  5C6S A;  4PJO E;  4FS2 A;  1FMV A;  3S3O A;  2MF2 A;  2QGG A;  2MYS A;  3QYH B;  4N0A A;  2HQX A;  5EWE A;  1SFO A;  4O4L F;  4GC7 A;  2FEI A;  2DRK A;  3GTK A;  4F4W A;  4QVD A;  2YU9 A;  2A28 A;  4M78 D;  4X9C A;  2I80 A;  4DR4 H;  3IN5 A;  4Y28 E;  1JBM A;  4M7A C;  3EG3 A;  4XTV A;  2NUT A;  4JDS A;  1N27 A;  3EH1 A;  1QKX A;  3UA7 A;  1WHK A;  4MV4 A;  1E4E B;  1EFN A;  4LMY A;  4BB7 A;  1GGO A;  3FMA A;  2ZM6 H;  4KH0 B;  4EGQ A;  3C94 A;  3J80 W;  2CZG A;  2RGV A;  2C22 A;  1ZQ1 A;  5CVI A;  2CUB A;  1ABQ A;  1N36 H;  2XIG A;  1I1J A;  2HDA A;  2FPI B;  4ZN3 A;  3RMQ A;  1W93 A;  1UC9 A;  3WNZ A;  1OZ3 A;  2AHJ B;  4M4Z A;  1KBL A;  2LQN A;  1RJR A;  4C92 G;  1TUD A;  5LJ3 e;  2FKL A;  2VWF A;  2GCX A;  3A8L B;  4M77 D;  3SI8 A;  3EHQ A;  2GLT A;  2F4V H;  1YJ9 A;  2DL5 A;  5C4X G;  6AT1 B;  2RMO A;  2GTJ A;  4ECV A;  2GFA A;  2YLC A;  2W7P A;  3ASK A;  4CC3 A;  3Q8P B;  3M0Q A;  4C8Q E;  2YT6 A;  4LH6 A;  3SB2 A;  2C2D A;  2A7Y A;  1MNE A;  5LJ5 j;  4M7D C;  3U9S A;  4DL6 A;  1RK5 A;  2R7K A;  2R5M A;  3MEW A;  2M02 A;  2QG9 B;  1MND A;  1SHG A;  3V8L A;  2R8G A;  3FB9 A;  4JPB W;  5GAN d;  3U23 A;  2K3B A;  1NE8 A;  2DL8 A;  4PJN A;  3OYK A;  3VS5 A;  1BIA A;  2FB7 A;  3CC7 Q;  3EGU A;  1U5S A;  5BR8 H;  4K11 A;  3M9M B;  1YWO A;  2WSF E;  1DJ7 B;  2YWW A;  4XU2 A;  5CR2 A;  2R7M A;  4OMN A;  4ZGE B;  2JMC A;  2GFU A;  1UB4 A;  3OYM A;  3TII A;  4N4G A;  2OTJ A;  5CCA A;  5GAO l;  1UFF A;  1SYX B;  5HBR B;  2J6U A;  1S72 T;  1XOV A;  3VYG A;  3GTG A;  2E5Q A;  1W2B S;  4UCV A;  2QK0 A;  1VQ4 Q;  4PJM A;  1YHQ T;  4HKE A;  2VOB A;  4EIK A;  3GTQ A;  1KQ1 A;  4DL5 A;  2CP2 A;  4HR7 A;  3K3V A;  4X62 H;  3CCS A;  5GAO m;  2EJF A;  1O75 A;  3M57 A;  2R7L A;  2CT4 A;  1B7T A;  2IP4 A;  4R7R A;  1EZZ B;  5GMK i;  1YI2 A;  1I6U A;  1ZQ7 A;  2D0Q B;  3CMA Q;  4A4K A;  3RIR A;  1KJ8 A;  4M75 C;  1ZUK A;  4KRT A;  2KYM A;  4Y8V B;  1WZO A;  2K3Y A;  4ED1 A;  1RAA B;  1AN7 A;  2EGA A;  4N4H A;  4MV1 A;  3MEA A;  5A0L A;  1R0B G;  3OUU A;  3RB6 A;  4B3M H;  3T5L A;  2LCC A;  4M75 E;  1EZ1 A;  3H40 A;  1YHQ Q;  1LOJ A;  4ZOL F;  5C1O A;  3M0U A;  1KK7 A;  3X24 B;  4IIM A;  1BI2 A;  2W9B A;  2MOX A;  3LP8 A;  4QWC A;  5LJ5 e;  4DL7 A;  2QYZ A;  5LJ5 g;  3CCV A;  2VV5 A;  4CRI A;  3HP9 A;  2UXD H;  5KFR A;  4LDX A;  4EFE A;  3PO2 G;  2PZ1 A;  2GGR A;  5C0M A;  3LH5 A;  5I11 A;  4E7L A;  4PNO A;  2FE3 A;  2YRW A;  1N33 H;  2X3W D;  4AG2 C;  1TWB A;  2Z0W A;  2EYX A;  2DK3 A;  5DY9 A;  3X26 B;  1VQ4 A;  3RAQ A;  4IR9 A;  4BI8 B;  4LNP A;  2RHU A;  2G3R A;  2JM8 A;  2L3S A;  3CCL T;  3CCS Q;  5IYD G;  3GV5 B;  5KT2 A;  3QII A;  4QW8 A;  5GAN 8;  5D1O A;  2AT1 B;  3BA8 A;  3MR5 A;  5KYU B;  4TQR A;  4LF6 H;  1SCU B;  1OV3 A;  1ZBX A;  3N43 B;  3CXC P;  1PHT A;  3F70 A;  4A4E A;  5GAN 4;  4LUD A;  4MV9 A;  3G71 T;  3QHS A;  1KC7 A;  3T5K A;  1AZG B;  2J6T A;  4M9U A;  1SRL A;  1K1Z A;  2HQE A;  2DIG A;  3H6Z A;  3CPW A;  3A5Z B;  1NEB A;  3VS1 A;  2FPD A;  1B34 B;  2DXB A;  4MTD A;  2RGR A;  3MPU B;  1WYX A;  4QQD A;  3BW1 A;  1XJW B;  2UVV A;  4G3I A;  1K8A U;  3I56 T;  2E4H A;  4DA4 A;  4EMH A;  3OMC A;  3G8C A;  5EG2 A;  1TU0 B;  3RF2 A;  2IVW A;  1HXD A;  1Y07 A;  4L6V 5;  3GLX A;  1X2K A;  2DTH A;  4RTW A;  1JQQ A;  1YJN A;  3L4J A;  5K2M A;  3ZBD A;  1HK9 A;  1M0T A;  3LWB A;  1N9S A;  4EDU A;  4HCC A;  5CKF A;  3VS2 A;  2L3R A;  3K3P A;  5KFV A;  4EBD A;  1XNR H;  3H8Z A;  2DZ9 A;  4RZR A;  2CQY A;  2OI3 A;  2DZC A;  2GQI A;  2MWO A;  4FYV B;  4DBQ A;  1PRL C;  2DPJ A;  1ZSZ A;  2W71 A;  3Q8Q B;  2BQU A;  2DKG A;  1NJI U;  4LSA A;  4A93 G;  2DL3 A;  3MJF A;  4C0D C;  3FRN A;  4O2B F;  1BI3 A;  2RI2 A;  3CCQ Q;  5KFL A;  2K4Y A;  4M75 A;  1K76 A;  2FB9 A;  3J81 W;  3CCR A;  4DOW A;  2Y4X A;  1GSA A;  3AHU A;  1E4E A;  2NUP A;  3M0R A;  3TU4 K;  1RI9 A;  2LT1 A;  5J3B A;  3E2U A;  4BY6 B;  4B3R H;  1IXD A;  3MFI A;  2E12 A;  3GIQ A;  5HK0 A;  3U9T A;  5DLQ E;  5LL6 b;  1WSC A;  3QBY A;  5GAM h;  4M77 E;  1TOV A;  2YS7 A;  4J9Q A;  2JA6 A;  2C0T A;  4F4X A;  3RKW A;  5CAI A;  3L2P A;  1AT1 B;  3NGP A;  4JRK A;  2CUD A;  2WE6 A;  4DV6 H;  1YJN Q;  4MZT A;  5C1P A;  4YY3 H;  1A0N B;  2R8K A;  3HFN A;  5LJ3 f;  3N8D A;  1A9X A;  2BKD N;  2YDL A;  4XTU A;  3CCJ T;  3N40 P;  4JUZ A;  2EJ9 A;  1M0W A;  4YR2 A;  1YCY A;  5L1J A;  4CC2 A;  4JV2 A;  4C8Q A;  2X4Y A;  4PLL A;  2J7I A;  3PGG A;  2DM1 A;  1AWJ A;  4C92 B;  2NU6 B;  4OMP A;  4KH1 B;  3EHR A;  1VQN A;  5H80 A;  3OHB A;  5KCO A;  1M7J A;  2AK5 A;  1K0X A;  1KHC A;  5LMN H;  2CP0 A;  4BDY A;  1KD1 R;  2QAS A;  1YN8 A;  4LDU A;  2XK0 A;  4Z88 A;  1ZX6 A;  1RJQ A;  2UXC H;  1A0I A;  1VUB A;  4XU0 A;  1X01 A;  3UWN A;  1U1S A;  2ECZ A;  1K0S A;  3EH2 A;  5DGB A;  2VAS A;  4ED7 A;  4JI3 H;  2JW4 A;  3G1J A;  1Q7Y U;  2V1Q A;  3MWE A;  3HOV G;  2FJZ A;  5KFK A;  2CSI A;  2V5A A;  2CZ0 B;  5DQG A;  4FYY B;  3BFM A;  1PKS A;  3VS0 A;  5LJ5 f;  1IHW A;  1M6V A;  3E19 A;  2XU8 A;  2P0P A;  4OMM A;  3OW2 S;  4ECZ A;  2XI9 A;  2WAC A;  3I12 A;  4RTZ A;  1SHF A;  1OPK A;  1U06 A;  2DTO A;  1RAB B;  5CKH A;  4YTL A;  4EBE A;  3EFS A;  5D6Y A;  3FC3 A;  3MR3 A;  2XCA A;  2AIR B;  3SDZ A;  1T94 A;  5C3E G;  4BE2 A;  1N8R R;  5IYZ F;  3VUB A;  2K5F A;  3PVL A;  2J6K A;  5HY6 A;  4BD3 A;  4QWA A;  4EMG A;  2YRD A;  3PR4 A;  2HZY A;  1JLL B;  3GOX A;  2DVJ A;  1Y71 A;  4Y91 A;  1QP2 A;  4RTX A;  1B07 A;  5EOY A;  1LVK A;  4PJO C;  3CCM T;  2R8H A;  2FPP B;  1EUC B;  5AYF A;  1X6G A;  2M0Y A;  3VUZ A;  4ECY A;  2V8I A;  3UDC A;  1IO6 A;  4ECR A;  3CCU A;  1KFZ A;  3HKS A;  2H3E B;  2R5A A;  2BTT A;  3PNW C;  1JDE A;  4HVW A;  2RQW A;  1QCO A;  4BBR G;  4ETS A;  2KXD A;  1VQM A;  1B34 A;  2XDD A;  2R82 A;  4CC6 A;  2YXY A;  2YCH A;  3TQ7 P;  3HXL A;  5IYC G;  4FIB A;  1DGS A;  3EPI A;  4CC4 B;  4J9P A;  4LDY A;  3OYN A;  4XZ3 B;  3CVZ A;  4BUG A;  4A3C G;  2PVG B;  3CCJ A;  2O31 A;  2JA7 G;  1VQ8 A;  4RNO A;  3QKJ A;  1D0Z A;  1M5Q 1;  5F9L A;  2E5K A;  1YI2 Q;  4PJJ A;  3PTA A;  1E7O A;  3Q8R B;  3KHR A;  4J9L A;  3I55 A;  2GPW A;  1K1Q A;  1ZUY A;  4LFB H;  4QQG A;  1RUW A;  1BCM A;  1O9S A;  2COY A;  1UE9 A;  2P0A A;  3E5N A;  1I7L A;  1Y0M A;  2JEG A;  1C30 A;  4UCR A;  1N8R C;  2IA6 A;  1DV1 A;  2R8J A;  3OS1 A;  1I4K 1;  3HRU A;  1NG2 A;  2F2W A;  2M51 A;  5KH6 A;  1BBZ A;  1JDB B;  2D1X A;  2OLS A;  3Q2O A;  5KE2 A;  1FMK A;  2NYS A;  4NLG A;  1I7N A;  1D3B B;  5CK9 A;  3GV7 B;  3TCJ A;  4D6W A;  4CC7 A;  1Y7X A;  2G6F X;  2BQ3 A;  3CCE Q;  4NL3 A;  3MP8 A;  2HBP A;  3O8V A;  3JAM W;  1W70 A;  1QVG A;  4C8Q C;  2EKH A;  1SEI A;  1KC8 C;  4I50 F;  3P8B B;  1XTD A;  1TG0 A;  1WHH A;  4QIW E;  4OX9 H;  2RQV A;  3KHH A;  3PVQ A;  4TV9 F;  4MAM A;  3RGZ A;  5EWF A;  1YNZ A;  2OJ2 A;  1R77 A;  2QDY B;  3HHT B;  1M90 R;  3MO8 A;  2XDP A;  3CCJ Q;  2DTI A;  4EGJ A;  4RTT A;  2DJZ A;  5FU7 B;  2OTL A;  1Y1V G;  3A8H B;  3KXY T;  3OUZ A;  1K83 A;  2YL2 A;  3L2Z A;  3I55 Q;  3MWM A;  1VQ9 T;  3HRS A;  1NYF A;  2W7O A;  2PMZ A;  1KC8 U;  4LDV A;  3V6H A;  3OYJ A;  1EHI A;  2GBQ A;  3THK A;  3JV3 A;  3CC4 A;  2JA6 G;  2CT3 A;  2ABL A;  3RNJ A;  3QJ6 A;  1M3B A;  3QDF A;  4JYA H;  2DJQ A;  4BY6 C;  5GAN 7;  1HD3 A;  4O2A F;  2F5T X;  1WHL A;  4ZNX A;  4C8Q B;  2L0A A;  2R85 A;  1K9M C;  1UGS B;  4E7K A;  3GIK A;  1TWF A;  4UCS A;  3KAK A;  4C92 A;  2CH4 W;  4M75 F;  4JI1 H;  3RBD A;  2JM9 A;  4FM4 B;  1HNZ H;  2DVE A;  3NTK A;  5IXF A;  2KK4 A;  3CCM Q;  2RQR A;  5GMK l;  4ZI7 F;  1U8R A;  3LGL A;  2QEX A;  1IGQ A;  3HOY G;  3OYH A;  2CP7 A;  4V2S A;  1YIT T;  3OYF A;  3HOW G;  2QA4 A;  5FRN A;  2JNG A;  2JJ9 A;  5KFB A;  4RUG A;  1VQK A;  2HQH A;  3JB9 D;  2OTL Q;  4R0K A;  2M05 A;  3CCQ A;  4RAY A;  4YP3 A;  4ECU A;  3MKD A;  2EYZ A;  4XTZ A;  3CCR Q;  1BGW A;  4JI6 H;  2JEI A;  3JCM g;  2DL4 A;  2EYQ A;  3BQ2 A;  3CME Q;  2F5K A;  5FU7 C;  5HK3 A;  3EG2 A;  3KXT A;  2FK2 A;  1FVI A;  1T36 A;  1QQJ A;  4JJD A;  3I56 A;  2AGP A;  3TSZ A;  1GRI A;  2R7Z A;  5KG5 A;  1D1A A;  2O88 A;  5FLX W;  1Z2N X;  2HD0 A;  2CZ1 B;  3CPF A;  4DL3 A;  1K8A C;  1BB9 A;  2FRY A;  3EG9 A;  4Z89 A;  4C0G A;  5LA6 F;  4DEY A;  2QK4 A;  4DV5 H;  5FD6 A;  1AWX A;  1KSW A;  3CCM A;  4J6Y A;  2W9A A;  4HYK A;  2YSQ A;  1AWO A;  3M9N B;  3UF4 A;  4Z02 A;  1GCQ C;  3L2V A;  4HT8 A;  4ECQ A;  3V4S A;  4LF4 H;  4RG8 A;  3KAL A;  3BAB A;  2NU7 B;  4F7U G;  2W0Z A;  5GAO n;  2DZD A;  3JCM V;  2P4R A;  3JCM b;  3QZ9 B;  2VGM A;  4FL6 A;  1UTI A;  2X4X A;  2X3X D;  4VUB A;  5I47 A;  1D3B A;  4JZ4 A;  4LSX A;  2SEM A;  4C92 C;  4ECW A;  1DIK A;  2YHT A;  1WFW A;  3NTH A;  1X9N A;  4IRD A;  3GBQ A;  1VIE A;  2KYB A;  1WCM A;  2WAQ A;  2LX9 A;  2F1L A;  4IRK A;  3VS6 A;  4C0F A;  2V59 A;  4BAC A;  1M4Z A;  3M54 A;  3FLG A;  5GMK m;  4MTE A;  4YAJ B;  1GFD A;  1GFC A;  2KBT A;  1T0H A;  1Q7Y C;  2VB6 A;  2W6M A;  1FXX A;  3PW5 A;  4AFZ C;  1TWG A;  4P5N A;  3OB9 A;  1WPY A;  1PCX A;  3WVD B;  4U6P A;  3M0T A;  1XNQ H;  2J6F A;  2K9G A;  1H64 1;  2E1H A;  2ZAE A;  1AWW A;  2HBW A;  3OYY A;  4C2M A;  2RJE A;  2FRW A;  3M58 A;  3F8N A;  2CYZ B;  4FS1 A;  2RNA A;  4F16 A;  3QJY A;  1E6H A;  2LNV A;  2KSS A;  4A54 A;  1S1N A;  4FT2 A;  2RJC A;  3CCS T;  1K73 R;  5J26 A;  3CC2 A;  4A3G G;  2P0Q A;  1K4U S;  4MV3 A;  1SSF A;  1ZLM A;  5LJ3 g;  1RAH B;  3P8D A;  2KNB B;  1S72 A;  3RTX A;  4LF5 H;  3HOZ G;  3GTL A;  4A3B G;  1M2O A;  5GAO q;  3T5H A;  4II1 A;  2ATC B;  1VQL A;  3BE3 A;  4B9W A;  2W6Z A;  5IXB A;  1Q81 U;  2FYK A;  1M1K U;  1B33 N;  3SD4 A;  5CQY A;  2ZDQ A;  3G4S T;  4BE0 A;  1BKB A;  1SKU B;  5DG7 A;  2UUC H;  1X75 C;  2VGN A;  4RKU E;  2J06 A;  4AT1 B;  3FJ5 A;  1Q86 R;  1EX4 A;  3VS3 A;  1IOV A;  3QZ7 A;  1MMA A;  1WJR A;  1TS9 A;  1M90 C;  1VOM A;  3JCM X;  4PJL A;  3PIO A;  1PC0 A;  1YJ9 T;  2NUZ A;  4HVV A;  4IUP A;  4A3M G;  1WCM G;  3RV3 A;  5IT9 E;  3OY9 A;  2FMA A;  5FPR A;  5KFI A;  4QW2 A;  4A2A A;  4C5G A;  1VBH A;  1LCK A;  4M7D F;  5FLX E;  4B3S H;  4HXJ A;  2QQR A;  5GAM g;  3JB9 H;  1I07 A;  3CCQ T;  5CA1 F;  1MV0 B;  2PVP A;  3D7S B;  1GBQ A;  1JJ2 P;  3CQZ A;  2NLU A;  1QMC A;  4UFZ A;  1B3Q A;  3URG A;  1E4F T;  3SEM A;  5KFW A;  1G2B A;  3KHL A;  3K5I A;  4QW9 A;  4OMO A;  4X65 H;  3GIJ A;  1WHJ A;  2MCN A;  3CCL Q;  1YJ9 Q;  3RER A;  4A3K G;  4F7U A;  4QWB A;  1OPL A;  2EVR A;  1ZSZ C;  2CZ7 B;  4N0A C;  3OBW A;  5IN1 A;  4HCK A;  1UJ0 A;  2P0K A;  1M1G A;  2O01 E;  2VUB A;  4C5B A;  2R6F A;  3M4G A;  4PJO A;  2PU9 B;  2E3I A;  1QW1 A;  4N4I A;  1VYV A;  4AFS C;  3TIG A;  3GQC A;  1KQS A;  4CC5 A;  5KFN A;  2JOY A;  1D09 B;  3UAT A;  1I5L A;  4DL4 A;  1GCQ A;  4C5H A;  5IWA H;  3OBY A;  1X27 A;  2O2O A;  4C8Q F;  3HOU G;  3G6X A;  5JQW A;  3NFC A;  5J2T F;  5KFH A;  1V51 A;  3MEU A;  2R92 G;  4OB1 B;  1VQ6 Q;  2LCS A;  2MPX C;  2PUO B;  1I5O B;  5D6X A;  5GON F;  4MA0 A;  1RL2 A;  1U3O A;  4JUV A;  1NLO C;  5IAY A;  4A63 B;  4DV7 H;  2W8K A;  1QKW A;  4XTW A;  4C5I A;  1YIT A;  2V58 A;  5GAO p;  4E7I A;  3QWX X;  3CCL A;  1WGS A;  5GAM j;  1K8A R;  1VQ9 A;  5A2Q W;  2RI5 A;  5GAN j;  2UUB H;  2RF4 A;  5C5J A;  2ZPG B;  3Q8S B;  4O6J A;  3MJX A;  3RDV A;  4BE1 A;  3R5H A;  2LTO A;  1QVG S;  1N6A A;  1RAD B;  2KMT A;  1K73 U;  4IUR A;  3QUI A;  1E6G A;  1VA7 A;  3OMG A;  3QXE B;  3ORQ A;  1KJJ A;  2BUD A;  1TH7 A;  2XID A;  4DLK A;  1BU1 A;  2BE7 D;  1C1A A;  2LJ0 A;  4OGE A;  2YRX A;  4XX0 B;  2E3H A;  3ETH A;  2YUN A;  3I9Q A;  1M2V B;  3AYH B;  4IHJ F;  1OEB A;  5D1P A;  1BK2 A;  2AGQ A;  4LD6 A;  4M7D D;  1VQ6 A;  5KFP A;  4RTU A;  2F2V A;  1AD5 A;  4L1K A;  4UC4 A;  5KYX B;  1KHI A;  5EZY F;  2I87 A;  5JH7 F;  3SWN B;  1NPR A;  2VXE A;  2DNU A;  1Q81 C;  1M1K C;  1ULZ A;  2XCP A;  1KQS P;  4PFP A;  5FLM G;  3G4S A;  4IIO A;  3RAX A;  1NM7 A;  2FZC B;  2JTM A;  5JUM A;  4A3F G;  5KFG A;  5FRM A;  2WTF A;  4DEX A;  1KIK A;  2OAU A;  1IHV A;  4JRI A;  1VBG A;  2OH2 A;  1W6X A;  1AUV A;  3H20 A;  1RAC B;  2JA5 A;  1N5Z A;  2F69 A;  2YZG A;  4O3Q A;  4HNT A;  5CQX A;  1MV3 A;  1M9S A;  3CCV T;  3VJP A;  2KE9 A;  2YW2 A;  2R57 A;  2R7Z G;  3MP6 A;  1IBM H;  1X43 A;  1YFN A;  3OSN A;  1L2Z A;  2KT1 A;  3KFV A;  4M7A D;  2UVU A;  1Y57 A;  1UEB A;  1VQ7 T;  4ED6 A;  4IRC A;  4M7A B;  4ED2 A;  3RV4 A;  3L1A A;  2DIQ A;  2R93 G;  2ZPB B;  3C0F B;  2E10 A;  3ZL7 C;  4TV8 F;  4F14 A;  4J9C A;  1QVP A;  4JLG A;  3Q1K A;  2UUA H;  2RM4 A;  2XD0 A;  2J6O A;  1NZ9 A;  2CDT A;  4J5Y A;  3PFS A;  3MWD A;  4DR5 H;  2FPG B;  3OS5 A;  3EGD B;  2XCL A;  4OMQ A;  1ZSZ B;  3G6E Q;  1K9A A;  1CS0 A;  3OYA A;  2CGH A;  1UDL A;  3V8J A;  2O03 A;  4C92 F;  1NBE B;  1PD1 A;  5AT1 B;  3UA6 A;  5KFF A;  3T9N A;  1Y1W G;  2I0N A;  3I4N G;  1AUX A;  2RPN A;  4PLI A;  4M75 B;  2D8H A;  1VQ7 Q;  3CXC A;  3RJ0 A;  3VPC A;  2D6F A;  2UXB H;  1HSQ A;  1VAJ A;  1GL5 A;  4LFA H;  2DIK A;  2NUP B;  1Y1W A;  2OTJ T;  2FPF A;  3RKY A;  5KYW B;  4KBM B;  3EAE A;  3MR6 A;  2VUM A;  4HQ6 A;  2JXB A;  2YYA A;  5BPF A;  3PR5 B;  4NOY A;  2FPE A;  3CCU T;  1BIB A;  4LD9 K;  1LNX A;  4Q45 A;  2AKK A;  5FWC A;  3L4K A;  3V7S A;  2C0I A;  1ZSG A;  2IIM A;  5KE3 A;  4M78 A;  2NUT B;  4AYB A;  1S03 G;  4MDW A;  3VPB A;  1Q82 C;  4Q43 A;  4LF9 H;  3SWN C;  2VPS A;  3S6W A;  5KT3 A;  4DV3 H;  2ASL A;  4Q8F A;  1W96 A;  3CC2 Q;  3LYI A;  2UVW A;  5JVD F;  1GXI E;  2E5L H;  3KTM A;  3QYG B;  2RHY A;  2KSW A;  1IBL H;  5EWG A;  3G6E A;  2DLN A;  2V26 A;  5IH2 A;  4KT0 E;  3CBP A;  3PO3 G;  1B04 A;  5LL6 S;  4KGV B;  5I2S A;  3CPW S;  5KT4 A;  5KT6 A;  2YLB A;  3GIB A;  2W9C A;  3RGX A;  4D8D A;  1VQN Q;  4F50 A;  2HSE B;  1M1F A;  2DX1 A;  2XDB A;  5GMK j;  3LWH A;  2EAY A;  4FYX B;  2HJW A;  2PBZ A;  4APM A;  2PN1 A;  1M30 A;  2FK1 A;  4FU0 A;  5KFU A;  3BA9 A;  3JCM W;  3H0I A;  5KFT A;  4JI0 H;  4RMO A;  4OB0 B;  3TRE A;  2DAQ A;  3SFM A;  4YB8 B;  1T3L A;  4HNU A;  2DBM A;  5GAN 2;  1ZA1 B;  1UGQ B;  5LJ3 h;  3QG1 A;  5CAE B;  4Q44 A;  2HMA A;  3JCM J;  3A8M B;  2CP6 A;  2IG0 A;  4KGZ B;  2JT4 A;  1QVF S;  3GLK A;  5KFC A;  4GKK H;  2JTE A;  3BDU A;  3LWI A;  2LCL A;  3QDR B;  2DIL A;  4LUE A;  1WIE A;  4ELY C;  1N32 H;  3LGF A;  4PFZ A;  4X34 A;  4Y92 A;  3OYB A;  4M78 E;  1WI7 A;  3EG0 A;  5CO7 A;  5IHN A;  3OYD A;  3OW2 A;  3BQ1 A;  3PN1 A;  2FG0 A;  1SG5 A;  4ED0 A;  2LT4 A;  1KQ2 A;  3J7A K;  4LF8 H;  1X69 A;  1X6B A;  4LFC H;  3OTO H;  2VVK A;  3V7R A;  5IHI A;  5A0D A;  4RCB A;  4C92 E;  5KX5 F;  4RZQ A;  1M3A A;  2KRN A;  2W6O A;  4RTY A;  1Q86 C;  5T14 A;  3RKX A;  3G7Z A;  4JI4 H;  2DO3 A;  4WD3 A;  4M7D A;  1KEE A;  1RJP A;  1CKB A;  2CRE A;  3I5S A;  4ESR A;  5KYX A;  3JSN A;  2A36 A;  2RJF A;  1QCN A;  3EFR A;  3CCU Q;  2CS7 A;  1I50 A;  4RB3 C;  2DEQ A;  2EYY A;  2C2E A;  2L2P A;  1YP5 A;  2BR0 A;  1OX8 A;  2E41 A;  3CXC S;  4JS4 A;  3OSS C;  3ZFJ A;  2V9W A;  3UQ8 A;  1VKZ A;  2PTK A;  1JB0 E;  2I2L A;  2WSE E;  1C0M A;  4O3P A;  1WHM A;  1Z9Z A;  4M7E A;  1KJQ A;  1BNC A;  4EYH B;  2YUO A;  3GTO A;  1S97 A;  3HOX G;  2EWN A;  5KYW A;  2KEA A;  4J9D A;  3GIL A;  3L2W A;  3CD6 Q;  1H8K A;  4M7D E;  1FMW A;  3G6V A;  3R6N A;  2SRC A;  4WBN F;  4DBR A;  1RI0 A;  5KYU A;  3ORR A;  3GIP A;  1UGR B;  3RES A;  1Y96 A;  3RBB B;  4ECX A;  4M7A A;  4QJF A;  2XIC A;  4RNN A;  1YIT Q;  4OGC A;  3ZEH A;  3J7A F;  1ZHQ A;  3C0C A;  3GID A;  4JJN K;  4Z8A A;  1F1B B;  4KUD K;  1V29 B;  2ALZ A;  2OTL T;  2J9G A;  4PWQ A;  3FDS A;  1MMN A;  5GAO r;  2W8L A;  2O4X A;  1LJO A;  1WX6 A;  1XNI A;  2VYT A;  2W57 A;  3VS4 A;  1JXM A;  4DQ2 A;  2HVQ A;  3MFH A;  1WJS A;  2LVM A;  1ZBJ A;  4QVC A;  2L3P A;  2M16 A;  2X9H A;  3CC7 A;  5IP7 G;  2EQU A;  4IWX A;  2LQK A;  4OMF B;  2VPQ A;  3JB9 J;  3HKZ E;  4IZO A;  2LRQ A;  5L8R E;  4MZM A;  5KFO A;  2ENM A;  2QTX A;  3X20 B;  4X66 H;  4JJB A;  1PK8 A;  2FLN A;  1AVZ C;  2H8H A;  5KG4 A;  2KGT A;  1Z9Q A;  2K2V A;  3E9G A;  3CEY A;  2BE9 B;  5KFJ A;  1IGU A;  4ECS A;  2C2R A;  2RDI A;  4UCT A;  2ED0 A;  4LE9 A;  3OYE A;  4WCI A;  3G4S Q;  2XHC A;  2LC4 A;  4M78 B;  3OS2 A;  4FCY A;  2BZY A;  2E65 A;  4EPC A;  4RB0 A;  3PW7 A;  4E4T A;  1AZE A;  1B6S A;  5FJ8 G;  5D7U A;  5GJW B;  1YI2 T;  3CC4 Q;  3I5R A;  3KUF A;  1KQS S;  4ZQI A;  2LNH B;  1HJD A;  5CA0 F;  2GF7 A;  5KYN A;  5M9O A;  1PKT A;  5DLO A;  5KYY B;  4R56 A;  2ZCF B;  4E7S A;  1ZET A;  1OOT A;  2C0O A;  1PM3 A;  1CE8 A;  4MDX A;  3V4Z A;  3ER0 A;  1G3T A;  3H4B A;  1S0M A;  4QQ6 A;  2PVO B;  2L89 A;  1WH2 A;  3VMM A;  2W9C B;  3M0P A;  3RFC A;  4A3J G;  1RAG B;  4AYB E;  4J9S A;  4EG0 A;  2A0F B;  2M1H A;  2ZPI B;  3H0F A;  2B63 A;  2BZX A;  2DF6 A;  4O4I F;  4MV7 A;  4BDZ A;  1Q81 R;  1M1K R;  2QEX Q;  1UHF A;  4UCU A;  4PFO A;  2K79 A;  3WO0 A;  1H3Z A;  2MIO A;  1TUC A;  1UNN C;  3RUP A;  1Q82 U;  3BQ0 A;  4E7J A;  5FU6 C;  4L59 A;  5KCH A;  4I55 F;  4DBF A;  3BY7 A;  4RNM A;  3PE0 A;  2IBK A;  2MMP A;  3REB B;  2B8A A;  4KUL A;  4JLI A;  3MEV A;  3MR2 A;  5IT9 W;  3UPU A;  3PT9 A;  3RB3 A;  1YIJ A;  1RYS A;  2P84 A;  4ATO A;  1IRX A;  2QI2 A;  2QXF A;  3DB3 A;  2KVQ G;  2PNI A;  1GO3 E;  4JI7 H;  2RF0 A;  2COW A;  2CP3 A;  1NEG A;  5GMK e;  2VXF A;  1IOW A;  4E2F B;  1RAI B;  5IP9 G;  2RJD A;  2EQK A;  2EIF A;  3M53 A;  1VQO T;  8AT1 B;  2AU0 A;  4DR2 H;  1VQ6 T;  2X0S A;  5KT5 A;  3PW2 A;  5CKE A;  2IMW P;  1JJ2 A;  1J5E H;  2VA2 A;  3ME9 A;  2X4J A;  1W1F A;  3GV8 B;  4XAX B;  2NVY A;  1WXU A;  1V76 A;  2VQF H;  4ORZ A;  2P4T A;  5KFZ A;  4DV1 H;  5CIU A;  4JRP A;  2CKZ B;  3VV0 A;  1WLP B;  4C92 D;  1OU8 A;  2FZK B;  2W10 A;  2ZGW A;  2KXC A;  3FIF A;  5L1I A;  4WTO B;  3N44 B;  4NL2 A;  1VQN T;  4DUZ H;  4ZN1 A;  4J7F A;  1TSF A;  1BXR A;  2VC8 A;  2ZPH B;  4MML A;  5EDW A;  1NJI C;  1DV2 A;  1T0J A;  4IUV A;  5CB4 F;  2MK5 A;  3CC7 T;  2HVS A;  2FK3 A;  3N6X A;  2KDS A;  2KQW A;  1KG1 A;  1WQ7 A;  5BPH A;  2JA5 G;  1PG5 B;  2RQU A;  2QQB A;  2JUF A;  3ULR B;  2RH2 A;  2K7A A;  4EYI B;  1EIF A;  1FX7 A;  1KD1 U;  4ZGJ B;  5KFE A;  2DL7 A;  1AEY A;  3NPF A;  2Y0S A;  3O5Z A;  5FRO A;  1WA7 A;  5LJ5 d;  3HL8 A;  4ZTF A;  4J9M A;  1S9F A;  2ROT A;  3FJP A;  3GF5 A;  3BDL A;  2PMZ E;  2YUQ A;  4J9K A;  2E70 A;  2ZDH A;  3EG1 A;  2R93 A;  2A37 A;  4J9R A;  5KFX A;  2QEX T;  5F9N A;  2ESW A;  2X4W A;  5LYJ F;  3K5H A;  4PDB A;  4JS5 A;  3M4Y A;  4C8Q D;  2Q2T A;  2JA8 G;  1S72 Q;  4B6M A;  1TAE A;  2JZ2 A;  3MHX A;  2FHD A;  1YJW Q;  4GC6 A;  4C5A A;  1QCF A;  3H0G G;  4ME6 A;  2X51 A;  2WSC E;  3LH0 A;  4TUY F;  2PUK B;  2ZDG A;  3CCR T;  1G8X A;  3G71 Q;  5L1K A;  4DUY H;  1UJY A;  2J05 A;  3V7C A;  1W2B A;  2XC9 A;  1K73 C;  3HPW A;  3R23 A;  1QVF A;  4PL6 A;  4WF2 A;  2DPP B;  4F7U E;  3LX7 A;  3CBM A;  5KG1 A;  2JVV A;  1P92 A;  1VYT A;  2KI7 A;  3LML A;  2JN0 A;  3EYY A;  4GLK A;  2E2I A;  2O9S A;  4ELZ C;  2XGQ A;  4E47 A;  1CKA A;  3JCM d;  5FPO A;  4YQW A;  4EMK A;  2KT8 A;  4YBZ B;  3J81 E;  4GKJ H;  4GLM A;  2E64 A;  3MET A;  5DQI A;  3RR6 A;  4IAJ A;  4FSX A;  3AT1 B;  4XK8 E;  1OQK A;  2OTJ Q;  3EPG A;  5C8Y F;  5L1L A;  4M78 G;  4GY5 A;  2C00 A;  4J83 A;  4RB2 C;  2RDJ A;  3FDR A;  2ZPF B;  3INZ A;  1PNJ A;  1BI0 A;  5FWB A;  2HSP A;  3LW5 E;  5DLG A;  4FBU A;  4XTY A;  5KFQ A;  3CD6 A;  4L5G A;  1UGP B;  3HSB A;  5KG2 A;  7AT1 B;  3M9Q A;  3FEO A;  1H3H A;  2RHX A;  4BI3 A;  3DKM A;  5GMK h;  4Q8E A;  4DV4 H;  2JA7 A;  5GAN h;  2WB1 A;  1GSH A;  2DYI A;  4F7U B;  2EW3 A;  3JB9 I;  4FT4 A;  2K5I A;  3H9N A;  2AQ4 A;  2R84 A;  3NGD A;  4AFU C;  2ZPE B;  1D1B A;  2ASJ A;  2Q2U A;  2HVR A;  2H3J A;  4PJO D;  2E2H A;  2MI6 A;  5IHK A;  4PJO B;  4OML A;  1VQ4 T;  4KHP H;  3N42 B;  3A98 A;  4DR3 H;  1YHQ A;  2L3Q A;  1YIJ T;  1RYR A;  1X6O A;  1WDX A;  3I35 A;  4OB3 B;  1VQM T;  1NPP A;  2JEF A;  3X25 B;  4HVU A;  3GPL A;  3SHW A;  4B9X A;  3CCV Q;  4AMC A;  1VS0 A;  3GTJ A;  1VQM Q;  3EGX A;  4PJO F;  2WAQ E;  4AFQ C;  2CSQ A;  1BJT A;  2WB1 E;  2AGO A;  1P8L A;  1TWA A;  4A3L G;  2HL5 C;  4JI8 H;  3M5A A;  4HCB A;  2EQI A;  2L5Q A;  2RA2 A;  1NLP C;  3PVX A;  5CKD A;  5C44 G;  4J6W A;  2VUM G;  1MGQ A;  5D1O B;  3OYI A;  1AHJ B;  1SPK A;  4JV0 A;  3SE7 A;  1VIF A;  1VQ8 Q;  3A8O B;  4YJ3 F;  2EKO A;  1GLV A;  3T5J A;  2LDM A;  3UT1 A;  3TQ1 A;  1M90 U;  4PKC C;  2HEQ A;  2CH4 A;  3QO3 A;  1GYF A;  4Q5W A;  1IB8 A;  9ATC B;  2LQ8 A;  2KRS A;  1QLY A;  2DYB A;  4E7H A;  2W6N A;  3JCM P;  1NYG A;  3JAM E;  2D0N A;  5BMV F;  1Y14 B;  4ED3 A;  2Y4Y A;  1VYU A;  3CME A;  5GAN g;  3J80 E;  5LXT F;  4IKF A;  4J9F A;  1KC8 R;  1JJ2 S;  3WO1 A;  2RN8 A;  1CQI B;  2AZV A;  3NMZ C;  2QGF B;  1X2Q A;  4F7U F;  2KRO A;  4M7A F;  3BG5 A;  4J9O A;  4A53 A;  2O9V A;  1WJQ A;  2DRM A;  2J6S A;  1MMD A;  4BXX G;  4J7I A;  1WQW A;  2ED1 A;  2RHI A;  1UHC A;  3JCM h;  2C35 B;  2YRC A;  3OW2 P;  3GNF B;  1Z2O X;  4MMK A;  3HRT A;  5HKC A;  2FZG B;  4LN2 A;  5LJ5 h;  2HKN A;  2PVD B;  4U7C A;  1TUG B;  1MMG A;  2XG8 D;  3EFO B;  2DXU A;  1JKJ B;  3KHG A;  3KAJ A;  3OYG A;  4ED8 A;  4TQS A;  4EMK B;  4M77 F;  4Q0Y A;  2NUA B;  2R87 A;  2M9U A;  2HKQ B;  1FYN A;  5CKB A;  1TA8 A;  3WVE B;  2ATL A;  5I22 A;  3L2Q A;  2R92 A;  2VQD A;  4MZP A;  4OB2 B;  2DA9 A;  1OI1 A;  2XD4 A;  2XGP A;  4DV2 H;  2CP5 A;  3OYC A;  4R8U A;  1G3S A;  2AZS A;  1C3O A;  5LP6 F;  4LXC A;  2HHH H;  4O3R A;  4XYM B;  1W2B P;  3DLM A;  1AOJ A;  1BI1 A;  4YHH H;  3VRZ A;  4C5E A;  2ZJT A;  4FW2 A;  4ZHQ F;  4QT7 A;  4A4H A;  3V8K A;  5DG9 A;  3FKI G;  1W4S A;  3QPH A;  2L8D A;  1OUL A;  4PJO G;  3RMS A;  3WXM B;  2ZZD A;  1QP3 A;  3VKI A;  3GP8 A;  3QZ5 B;  5KFM A;  3E9F A;  1VQP Q;  2SCU B;  3H0G A;  2QA4 Q;  1CQJ B;  2NVX A;  2DD5 A;  1PWT A;  4IUU A;  1EUD B;  3QSU A;  1VQK Q;  3HBL A;  1IZ6 A;  3JSC A;  2NWM A;  5GAM f;  3TQT A;  4YR3 A;  1S10 A;  4QWE A;  5KG3 A;  3PW0 A;  5GAM d;  2NU8 B;  4DOV A;  2VQE H;  1RK6 A;  1I8F A;  3JB9 F;  3EGX B;  2EJG A;  3H41 A;  2YUP A;  1S68 A;  3RB0 A;  3R6O A;  1R8O B;  1PRM C;  2X35 A;  2JEJ A;  5EC7 A;  5KFY A;  4O3O A;  4HA8 A;  1G3Y A;  3PW4 A;  2LP5 A;  5GAN e;  5HCK A;  4J9H A;  1VQP T;  2W6P A;  3GTP A;  5A0G A;  2YZN A;  5D6W A;  1N48 A;  1KD1 C;  4F4Z A;  3EG9 B;  4GBQ A;  4M7A G;  1V4Y A;  3JZI A;  8ATC B;  5GAN 5;  2COZ A;  3S3M A;  4XTX A;  4M7A E;  1OYX A;  3VPD A;  3T1H H;  1ABO A;  1Q95 G;  3IQL A;  1WR2 A;  3GNG A;  2V1R A;  2EGE A;  2MWP A;  4O3S A;  1BCO A;  3VS7 A;  5LJ3 d;  2CZ6 B;  4KUI A;  1M8V A;  2FL7 A;  4FU6 A;  2M0O A;  2GPS A;  1VQP A;  1I0C A;  2BZ8 A;  5I21 A;  3R5X A;  4M77 B;  4PK4 A;  4RU9 A;  3IG0 A;  4BI4 A;  4F17 A;  1SSH A;  1YJW A;  1JXL A;  3I4M G;  2RHZ A;  4JI5 H;  4EFB A;  2GTO A;  2KAF A;  4HNV A;  2DWC A;  3G71 A;  1WXB A;  4LF7 H;  1K9M U;  4IWY A;  4C8Q G;  2BIV A;  3E1S A;  4E6R A;  1B6R A;  3L42 A;  3QWY A;  5FU6 B;  2LQW A;  3DB4 A;  4FW1 A;  4O5V A;  2KY9 A;  3TIN A;  2OAW A;  5GAN f;  1NJI R;  2CW8 A;  4JV1 A;  3ETJ A;  3P8H A;  5DG8 A;  1RLQ C;  1U1T A;  4M75 D;  1VQO A;  2DFU A;  3C12 A;  2R86 A;  4A2B A;  2DLP A;  2HCK A;  3RBE A;  4XYL B;  5KG6 A;  1CSK A;  1RAE B;  4F04 B;  1KJ9 A;  1Q86 U;  4D8K A;  2QTV A;  3RUX A;  4MV6 A;  3M9O B;  2DMO A;  4KGX B;  1Q7Y R;  2A3L A;  1TWH A;  2RO0 A;  2V4Q A;  3JCM c;  2VA3 A;  3REA B;  3GII A;  1GCP A;  1T3N A;  2JTF A;  5DLF A;  1M27 C;  2IPO B;  2QQA A;  4J9B A;  4J9N A;  2E6N A;  1ZA2 B;  4RUC A;  4R8U B;  3OS0 A;  3CC2 T;  2OX7 A;  3KBG A;  1VQL Q;  1HR0 H;  2FLL A;  1C6V X;  2UVR A;  4JRQ A;  4YJ2 F;  3QZ8 A;  3PZP A;  4A4F A;  1N8R U;  1XMQ H;  2LX7 A;  2W70 A;  3BAA A;  1YCS B;  3I55 T;  4XU3 A;  5KT7 A;  2GNC A;  2R8I A;  3CQT A;  2C06 A;  4J8O A;  4GLX A;  1VQO Q;  2EBP A;  2B86 A;  3EFO A;  4A3E G;  2QAZ A;  1XMO H;  1KJI A;  1HYO A;  3OHA A; 
#chains in the Genus database with same CATH homology
 2QYZ A;  2OX7 A;  2P84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...