2QZ7A

The crystal structure of a homologue of telluride resistance protein (terd), sco6318 from streptomyces coelicolor a3(2)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
172
Chain Sequence
GLKRVDVRLKWDPSPWDRPPHHLDIIATTYAADAPHGRPVYVVQFDKRSPDGTINMSRHSRTGQGFGFVEEMTFELDRLSPSIARVIVGVAIHQDNGHKTFDDVSNTGVVVAEGYRELLTDGFERVAGATAATVAEFTRNASGAWEFREAVRGFDSDPVLFATEMGSAPRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a homologue of telluride resistance protein (TerD), SCO6318 from Streptomyces coelicolor A3(2).
rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SCO6318
total genus 35
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02342 TerD TerD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.30 Mainly Beta Sandwich Lipoxygenase-1 sav2460 like domains 2qz7A01
2KXTA 2QNGA 3IBZA 2KXVA 2QZ7A
chains in the Genus database with same CATH superfamily
1ROVA 5EEOA 2LG7A 1CA1A 4NREA 2PPLA 2QNGA 1GYGA 2PVSA 1Y4KA 1RRHA 1LPBB 1OLPA 2SBLA 2FNQA 1IK3A 3BNBA 2WXUA 1LOXA 3FG1A 3FG4A 1ETHA 1F8NA 1QMDA 4QWTA 3V92A 1RP1A 2XFEA 2IUKA 1FGMA 3O8YA 2IUJA 2XHJA 2KXTA 1N8QA 1YGEA 1HPLA 3FG3A 1JNQA 3BNEA 3V99A 2OXEA 3PZWA 2LGEA 2XFDA 2XHHA 1FGOA 1FGTA 2LRGA 2KXVA 3BNDA 1LPAB 1N8SA 3IBZA 2WY6A 4QEYA 4WHAA 1BU8A 2QZ7A 1NO3A 2P0MA 1GPLA 1LNHA 1KHOA 1W52X 3V98A 3VF1A 3U6GA 2WXTA 3BNCA 3CWZB 1FGQA 1FGRA 1HU9A 1RRLA 4WFOA 1QM6A
chains in the Genus database with same CATH topology
2KXTA 2QNGA 3IBZA 2KXVA 2QZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXT A;  2QNG A;  3IBZ A;  2KXV A;  2QZ7 A; 
#chains in the Genus database with same CATH topology
 1ROV A;  5EEO A;  2LG7 A;  1CA1 A;  4NRE A;  2PPL A;  2QNG A;  1GYG A;  2PVS A;  1Y4K A;  1RRH A;  1LPB B;  1OLP A;  2SBL A;  2FNQ A;  1IK3 A;  3BNB A;  2WXU A;  1LOX A;  3FG1 A;  3FG4 A;  1ETH A;  1F8N A;  1QMD A;  4QWT A;  3V92 A;  1RP1 A;  2XFE A;  2IUK A;  1FGM A;  3O8Y A;  2IUJ A;  2XHJ A;  2KXT A;  1N8Q A;  1YGE A;  1HPL A;  3FG3 A;  1JNQ A;  3BNE A;  3V99 A;  2OXE A;  3PZW A;  2LGE A;  2XFD A;  2XHH A;  1FGO A;  1FGT A;  2LRG A;  2KXV A;  3BND A;  1LPA B;  1N8S A;  3IBZ A;  2WY6 A;  4QEY A;  4WHA A;  1BU8 A;  2QZ7 A;  1NO3 A;  2P0M A;  1GPL A;  1LNH A;  1KHO A;  1W52 X;  3V98 A;  3VF1 A;  3U6G A;  2WXT A;  3BNC A;  3CWZ B;  1FGQ A;  1FGR A;  1HU9 A;  1RRL A;  4WFO A;  1QM6 A; 
#chains in the Genus database with same CATH homology
 2KXT A;  2QNG A;  3IBZ A;  2KXV A;  2QZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...