2QZGA

Crystal structure of unknown function protein mmp1188
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
b'AKKLSPADKLKNISSMLEEIVEDTTVPRNIRAAADNAKNALHNEEQELIVRSATAIQYLDDISEDPNMPIHTRTQIWGIVSELETIKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved uncharacterized archaeal protein
publication title Crystal structure of MMP1188, unknown function protein.
rcsb
source organism Methanococcus maripaludis s2
molecule tags Structural genomics, unknown function
total genus 31
structure length 88
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03685 UPF0147 Uncharacterised protein family (UPF0147)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.50 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Ta0600-like 2qzgA01
2BL8A 1TDPA 2QZGA 2BL7A 2FU2A 2QSBA
chains in the Genus database with same CATH superfamily
4Z7GA 3P23A 4PL4A 4HFVA 2ZW3A 3LJ0A 4I1TA 1SJ8A 4U6RA 3L0IA 4AS3A 3B55A 4GXTA 3UITA 2CAZB 2RLDA 2L1LB 2XTQA 3FNBA 2A2CA 2RIOA 1U5KA 2JAEA 3SDJA 1TDPA 5HGIA 2JB3A 2JBWA 3FBVA 2A2DA 3I9V1 2YFBA 3DA3A 3AJFA 4NV5A 4YZCA 1JQOA 2P22B 3Q8DA 3F4MA 2BL8A 2IP6A 4Q9VA 2XMXA 1W3SA 4G75A 4OAUC 2GSCA 4DWLA 5LNK1 3LJ1A 4YZ9A 4YZDA 2K19A 2BL7A 2ETDA 3KP9A 2FEFA 2V1CC 2YFAA 4OAVB 4NV2A 3LJ2A 2QSBA 2MJFB 2JB2A 4HEA1 3IAS1 2ZRRA 2F6MB 4PL5A 4JCVE 4O1OA 2JB1A 4G76A 2FU2A 4Z7HA 4AS2A 4O1PA 4PL3A 3FVVA 3IAM1 2KKMA 1YO7A 2QGMA 2F66B 2XTRA 3DA4A 3DO9A 2E8GA 3VA9A 2RADA 2QZGA 2HGKA 2FUG1 2V6EA 3JSBA
chains in the Genus database with same CATH topology
2BL8A 1TDPA 2QZGA 2BL7A 2FU2A 2QSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL8 A;  1TDP A;  2QZG A;  2BL7 A;  2FU2 A;  2QSB A; 
#chains in the Genus database with same CATH topology
 4Z7G A;  3P23 A;  4PL4 A;  4HFV A;  2ZW3 A;  3LJ0 A;  4I1T A;  1SJ8 A;  4U6R A;  3L0I A;  4AS3 A;  3B55 A;  4GXT A;  3UIT A;  2CAZ B;  2RLD A;  2L1L B;  2XTQ A;  3FNB A;  2A2C A;  2RIO A;  1U5K A;  2JAE A;  3SDJ A;  1TDP A;  5HGI A;  2JB3 A;  2JBW A;  3FBV A;  2A2D A;  3I9V 1;  2YFB A;  3DA3 A;  3AJF A;  4NV5 A;  4YZC A;  1JQO A;  2P22 B;  3Q8D A;  3F4M A;  2BL8 A;  2IP6 A;  4Q9V A;  2XMX A;  1W3S A;  4G75 A;  4OAU C;  2GSC A;  4DWL A;  5LNK 1;  3LJ1 A;  4YZ9 A;  4YZD A;  2K19 A;  2BL7 A;  2ETD A;  3KP9 A;  2FEF A;  2V1C C;  2YFA A;  4OAV B;  4NV2 A;  3LJ2 A;  2QSB A;  2MJF B;  2JB2 A;  4HEA 1;  3IAS 1;  2ZRR A;  2F6M B;  4PL5 A;  4JCV E;  4O1O A;  2JB1 A;  4G76 A;  2FU2 A;  4Z7H A;  4AS2 A;  4O1P A;  4PL3 A;  3FVV A;  3IAM 1;  2KKM A;  1YO7 A;  2QGM A;  2F66 B;  2XTR A;  3DA4 A;  3DO9 A;  2E8G A;  3VA9 A;  2RAD A;  2QZG A;  2HGK A;  2FUG 1;  2V6E A;  3JSB A; 
#chains in the Genus database with same CATH homology
 2BL8 A;  1TDP A;  2QZG A;  2BL7 A;  2FU2 A;  2QSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...