2R00A

Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
335
structure length
306
Chain Sequence
QQFNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIELFRGADFPTQVRDAGGKDHVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELLVRDYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a redundant enzyme: a second isoform of aspartate beta-semialdehyde dehydrogenase in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 107
structure length 306
sequence length 335
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2r00A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2r00A01
4IJWA 2CDAA 4WASA 2PKQO 1WVGA 4NR0A 5JSFA 5IDWA 1WZIA 3S55A 3LC7O 1MA0A 3V2GA 4EUEA 3ZHZA 1HYHA 1KEUA 1GCUA 1DIBA 1PIWA 2RHRA 1PWZA 3H3JA 3WBBA 1H0KA 3FWZA 4GLLA 2X0NA 2EGGA 3K73O 1IY8A 3HB4X 3IQDB 2AG8A 1YVEI 2OXIA 4YJHA 1HDGO 3ZW9A 1U3TA 1QYWA 2FHSA 1LLDA 4Z6KA 3W8DA 1A9YA 1IOLA 1HETA 4BV9A 1U8XX 5EJ2A 1C0IA 2CNBA 3GPIA 1FJHA 4TQGA 1ZEMA 5KVVA 1PGJA 4BGEA 3GGOA 1XELA 1MV8A 4PLYA 3UAGA 2DBZA 1LEHA 1EE2A 4RPGA 1C0KA 1I3KA 3PJFA 3GNSA 5JY6A 4NBTA 4R1UA 3SJUA 4B4OA 4YRBA 4U5QA 4MIEA 3OEYA 4ID9A 1T2AA 4E33A 4MKXA 4IQGA 3DZIA 3NGLA 5I7FA 3FI9A 1UDAA 2JCYA 3PDUA 2I3AA 1J0XO 1GPJA 1MUUA 3ZWCA 3WNQA 4BMSA 4YPOA 3JQFA 2AQHA 4YJHB 1NVTA 4Y67A 4E2XA 4ESOA 1ZMOA 5BT9A 5T6BA 2VN8A 1J6UA 2JKVA 4NU6A 3Q0EA 3A06A 2X0JA 4RDIA 3OQ6A 3PYLA 4RF5A 1A4IA 3H5AA 3LVFO 1I10A 3F46A 5AXCA 4R3WA 3JYQA 4JROA 1WXDA 4PFJA 1VC2A 1YL6A 1E6UA 1QYVA 4BKPA 2Y0DA 3U5TA 2I6TA 5AYVA 1JQBA 2YV1A 2JAPA 1X7GA 4RPJA 4DC0A 2B4QA 4MIOA 4FB5A 1CWUA 1KY4A 4XGKA 1JA9A 1E3LA 1K89A 4UEOA 1GUYA 1HDCA 4TRNA 1LLQA 5LC1A 5IAAA 3QVXA 4WE3A 3OF2A 4WPGA 2C2YA 3I6QA 4BO9A 3SLGA 1KBZA 3WGHA 2Q45A 3H5NA 2JL1A 3QY9A 3PJGA 5CDTA 3SX2A 4L73A 1VM6A 2F00A 1LRJA 3EVTA 3SXPA 1YOVB 1TT7A 3T7CA 3K5PA 3PDJA 4ND4A 3C24A 4CV2A 4C7JA 2JFHA 3KBOA 1O0SA 4AL4A 2GGSA 3ZV5A 1LA2A 5EINA 3C7DB 4URFA 5IDYA 4CJXA 5A9RA 1PL8A 4BNHA 1R66A 5T57A 3ICCA 2HK9A 1E1MA 1R0KA 1QMGA 1Q7GA 3W6UA 4CLHA 5A05A 1X15A 2AG5A 4OM8A 5DCUA 4GWKA 3UCXA 5L4SA 3DONA 3LC1O 4CR8A 4BB5A 1SMKA 1BGVA 1Y81A 3UCEA 3ITDA 3U4DA 3TZQA 3K9QO 3GAFA 4WLEA 1Q7BA 4GI2A 2NQ8A 4J9UE 2HJRA 4MVJH 3KYDB 1P44A 4AJ2A 3CH6A 1QV7A 4FDAA 3UGKA 4DTIA 1GCOA 1GV0A 4Q3AA 4CM8B 4DL9A 5CG1A 4WLVA 4E5MA 5T8KC 2DBQA 3HADA 4KMSA 4YAEA 4JNKA 3UCFA 2Q1SA 3HDHA 3HDYA 5DBFA 3D3WB 4FOOA 1ZMTA 4ZN6A 2YFQA 4NMHA 1XWFA 1K3TA 3LT4A 2YQ4A 3K2EA 1DFGA 4IMPA 2PZKA 3W1VA 2ZKLA 4MDHA 3N7UA 1I0ZA 4RZIA 4E2ZA 4A5OA 1YL7A 1NNUA 1DC4A 3T4XA 1ZNQO 5L45A 1Y9AA 4M8SA 2NWQA 3JQAA 2OHXA 3MCVA 4RVSA 4Y6SA 3MTGA 2FY8A 3BIOA 1XQ1A 1KETA 3RD5A 1NYTA 3QWFA 1YWGO 1WP4A 3PIIA 1XIVA 5ADHA 1KIFA 3BA1A 3G1TA 4J7XA 4B7CA 2V6GA 3GEMA 1R16A 1VJTA 2QRJA 1LX6A 2TMGA 4J0EA 4U7WA 5G2OA 3S2FA 1JLLA 3C7AA 1H6BA 1D1SA 2G0TA 1PQPA 1GQQA 4L4SA 5ILOA 2Q2VA 4R9SA 4E4YA 2Y67A 1E5LA 3B1KA 4UAGA 4TMFA 2FSVA 4M1QA 2CVOA 5I7EA 4YT2A 4R1NA 4D3FA 2VUSA 2XAAA 3LSYA 3ZNQA 2WYVA 5CDYA 5DT9A 3L4SO 3PWZA 4J7UA 4WCDA 2P68A 4R1SA 5FWNA 2WM3A 1UZLA 3BMNA 4XJSA 2ZB4A 3DQPA 3ZNPA 1O94A 3RUCA 4W9NC 3PK0A 4YACA 3FNGA 1U5AA 2O3QA 3WB9A 1WDKA 1GU7A 1JAYA 4PVDA 2VRCD 1MXFA 2B5WA 3NTRA 3OJLA 3WDSA 1ONNA 4FFLA 2POQX 3ETDA 4J2HA 2GO1A 3K8ZA 1T24A 2BFPA 4Z0HO 4LN1A 5TJ9A 2CMDA 2ZB7A 2DC1A 1GEEA 3CEAA 3TWOA 3Q11A 4EEZA 2Q1UA 4CLEA 1YQGA 3WGQA 4XWYA 3CXRA 3P2YA 2EIHA 2O7SA 4I8XA 3Q2IA 4AJKA 4RLSA 5L95A 3JD1A 2B4TO 3RAJA 4CMAA 3U0BA 4KQXA 1LDBA 2GUGA 3PGJA 1LUAA 1EUCA 1O5IA 1A4UA 4M54A 4KTVE 1WW8A 4S1VA 1OAAA 2Z5LA 4BNMA 3H2ZA 5KWEA 1KVTA 4RF3A 3WLEA 1T4BA 1ISJA 1C0PA 2UAGA 4QO7A 3RUHA 3DAPA 3ZHBA 4YAGA 1R0SA 1H6DA 1ARZA 1NFQA 4MO2A 3MOIA 5L3ZA 3GMSA 4GAEA 1DJQA 1YE3A 4WJZA 1HT0A 1PGQA 3ZU4A 4TSKA 1DJNA 1XDWA 4P4LA 4K9DA 1QP8A 1XA0A 5HBRA 1GZ3A 1ZSNA 4GGPA 3I23A 4QFDA 4IQ8A 3U09A 4EI2A 1ADGA 3AWDA 3M6IA 4H16A 3S2IA 4U8GA 2QRKA 2CF6A 2C7GA 1EVJA 2OZPA 1I3LA 2EF1A 5KJ1A 4HADA 1DOHA 4RQUA 4ZRMA 3RU9A 2DTXA 3GFGA 2X9VA 2G82A 2O23A 4ZQGA 3ZWBA 8LDHA 1H6AA 3I9LA 3KM0A 2AEJA 3GMDA 4UVDA 1OI7A 1HE5A 1DC6A 2HSDA 3FBTA 1RKXA 4R51A 1P0CA 1N8KA 3OIDA 3JQ7A 5A1TA 2GLXA 2HMVA 3FRJA 1HLPA 3U4IA 4D0RA 3DOCA 1U9JA 4ALMA 2C0CA 3B1JA 2NU6A 1WMAA 5U1PA 4CLOB 2YYYA 1UR5A 5EN4A 4A7PA 3ZHXA 5L4NA 1YJ8A 4IINA 2Y1EA 3AY6A 1AXGA 4E2WA 3GDFA 4E5NA 4TZKA 1BXZA 2EXXA 2EKPA 4OSPA 3GNQA 1A71A 4E5YA 4NPCA 3EZYA 2W90A 4HFNA 1YQDA 3GOHA 2VWPA 3I9JA 4YR9A 1DFIA 1SB9A 4WNIA 1LDMA 3O38A 4XJTA 4YT5A 5AOVA 1N9GB 4F6CA 1T4DA 1Q2XA 5EERA 3TPCA 3VDRA 3FR8A 1R4MA 2Q50A 4CMBA 4CM5A 3C1AA 4OGWA 2Q99A 1B26A 3GG9A 3UKOA 4W6ZA 3ZHYA 3AM3A 5JLAA 1MX3A 5JO9A 3BMOA 5ER9A 1JWAB 2C07A 4DWVA 3ZN2A 5IG2A 2OBNA 1U7TA 2AQKA 3IJRA 5G0WA 3RWBA 4FGWA 3WIDA 4CQLB 4O6VA 3VPFA 4EBFA 3AM4A 1BDMA 4LMPA 3ST7A 5KIAA 2WE8A 3RKUA 1IZ0A 2DT5A 1V6AA 3WGOA 2WD8A 1J49A 1R15A 1DIHA 2VYND 2VWGA 5G0VA 5IZ4A 4J1SA 3VAZA 4E21A 1Y8RA 1HDRA 3A9WA 4JBGA 3VKUA 2CDBA 4ITUA 4OL9A 4XQGA 5IXYA 3GH3A 1IUKA 1HLDA 2O2YA 1UDCA 2CF5A 1PZEA 1GR0A 2C82A 4DREA 4W99A 5ER6A 2NLOA 2J3JA 3VPGA 2WSBA 4WLFA 4BNWA 2E49A 2ZJ1A 3BHJA 4BNXA 4CMEC 5HRUA 1EE9A 3T4EA 1F8FA 3NKLA 1LSJA 2EWMA 1E92A 5LCXA 1DIAA 1YOVA 2X1HA 1KC3A 3DOJA 1K5HA 4TRJA 5B12A 5ITWA 2W8ZA 3F9IA 1Y6JA 5B1YA 1D7OA 3GVPA 4MVJA 4E32A 1E7YA 1E3WA 1VLLA 2X9GA 3Q1LA 3HJAA 2ZJ0A 3TL2A 4HKTA 3WTBA 3B6ZA 2VOEA 2VYVD 5IZCC 4JJFA 3CPSA 3OQ1A 4WCFB 2JCXA 4MVJI 4N7RA 1UUFA 4JGBA 3TOZA 2DM6A 2VQ3A 5JS6A 2QZZA 3VZRA 3SVTA 4MKZA 3WBFA 1UP4A 2J5RA 3JQFC 1IHYA 3GGGA 3KXDA 1XQ6A 1I01A 3D4NA 3ORFA 3V2UA 4KQWA 1T1RA 3GFBA 1P45A 3WFIA 4NBWA 2R6JA 3IOYA 4BNLA 3INGA 3HWRA 4RF4A 3H5RA 3FNEA 2X0RA 5TLSA 1Z7EA 1PZFA 1ADCA 4IZIA 4U0JA 1PL7A 4W82A 3LF1A 2TMDA 2H9IA 1PR9A 3QJ5A 3ABIA 3LU1A 5IN4A 2C20A 3HZZA 2V6FA 3G49A 4MVJG 2NADA 1PGNA 1EEHA 4AFNA 2EP7A 4CMKA 4MINA 3OFSA 2GN8A 1I32A 3GNTA 3HN7A 4G81A 4CM4A 1E3WB 4AJPA 3AOEC 4PZCA 1C1DB 2OP0A 3U62A 4MJLA 1Q0HA 1N1GA 1ZK3A 4OIMA 3L77A 1LU9A 1XG5A 4PG8A 4OXKA 4R9RA 4Z0TA 4BGIA 1G0NA 3RFVA 1I2BA 3BZUA 5U9CA 4N5MA 3AU8A 4F45A 3KB6A 2QIOA 4GKBA 4CUZA 2B4RO 3BMCB 1CYDA 4H15A 1CQJA 2X58A 3VC7A 1QYCA 5L40A 3I9KA 5DBIA 4BNGA 1PJCA 1A27A 3CIFA 3ZW8A 1PGPA 3K96A 5HS6A 2P5UA 4IGFA 4CQMD 5KCZA 2YHIA 1O95A 4JBHA 5JXWA 4GLOA 5JAZA 4F46A 2ZYDA 5G4LA 4BOYA 2O48X 3QSGA 1ZKMA 1PQUA 4S3MA 4CM9A 2C7VA 1FDWA 2VHVA 4MP6A 3F47A 2NV6A 3GHYA 2WTBA 3DC2A 5BQFA 1H5QA 4BO8A 1PGOA 4FQ8A 3BAZA 1OBFO 3CMMA 2BI8A 3NJ8A 2IEBA 4EYEA 1ZH8A 1HDXA 2NACA 4A2CA 4O59O 3GY0A 1BXGB 3ZV4A 1M6HA 1GDHA 4CMCA 2QW8A 5FI5A 3VKVA 4XB1A 2EERA 3WMWA 2HCTA 1MFZA 4CMEA 1HE3A 1M76A 3TRIA 3I9NA 1N5DA 4JXKA 2OUIA 1WMBA 2BGMA 2CZCA 3DEYX 1FXSA 3WSVA 4UVIA 2QZ9A 1C14A 1TB4A 3F4BA 3QWBA 4ALJA 1TA4A 3RU7A 4LRTB 1B3RA 2Q3EA 3G3EA 2NU9A 2O7QA 3OA2A 3K2BA 4R16A 4E6PA 2JHGA 1LDGA 3VH1A 4BV8A 5C3MA 1CF2O 3I5MA 4IJUA 2JCVA 3R0IA 5CEEA 2BI7A 3NTOA 4O63O 4ZRNA 2IYPA 3GRKA 4JJGA 3H7AA 3DBRB 4CQLA 1FDVA 2GR9A 2HO5A 4PG4A 1DDOA 3QVTA 2EJVA 2PFGA 1P3DA 2FPGA 4LW8A 1I5RA 3LT1A 3ON5A 4Y98A 5CPFA 1H93A 4FS3A 4YJFB 5ENVA 3WLFA 1ADBA 4GX2A 2ZYAA 5FI3A 5JDCC 5TT0A 4RJTA 2FN7A 3HHPA 4RZHA 4D0SA 4W9NA 1F8GA 4PLWA 2B69A 2PK3A 3BHIA 5LDGA 4B3JA 1IE3A 1JVSA 1U3WA 3V8BA 4Z3KA 5ICSA 2BGLA 4DBZA 5F3RA 4OJNA 4INAA 3PP8A 3NV9A 3ZV6A 4NI5A 5J23A 3LK7A 3D7LA 3PJEA 1C1XB 1E5QA 4CM3A 2R00A 4DGSA 3R1IA 4NBUA 3O4RA 3TOXA 3DHYA 4EW6A 2P2SA 4PLVA 3M2TA 4QO8A 1ISGA 1T1SA 3C3XA 3EC7A 4CM7A 5BSHA 2Y1DA 5ILGA 1Z45A 4L76A 1Y8QA 2FR1A 3JQGA 1M2WA 1PU2A 1B7GO 5G4KA 4CMJA 1UXHA 1EBFA 3X2EA 4CM6A 1W4ZA 4GWGA 2PD6A 5K0ZA 1PX0A 3GT0A 2JD0A 3IMFA 4W7IA 3A14A 2HU2A 3EZLA 3JCZA 3C7CB 1B3BA 1QYXA 2CVQA 1H94A 1YBMA 3GG2A 1KEPA 4CMHA 1X0XA 1KEWA 4L75A 2D8AA 3GRPA 1FF9A 3OQBA 4OQZA 1ZBQA 1OZAA 4BNJA 2H5LA 5A9TA 1NQ5A 4I9NA 4J4HA 3ZWAA 5EQFA 2BRUA 5I8ZA 3V5NA 3AU9A 3VOSA 2HK7A 1MLDA 1GYRA 4GH5A 1PZHA 4J3FA 3LDHA 4B8WA 4IDCA 3VZQA 4WLOA 4R5HA 2ZTUA 4IDDA 4NHEA 5B37A 3WYEA 4R5MA 3FBGA 2E82A 5AXBA 4FSHA 3JQ8A 3Q6IA 4I5FA 4JP3A 1VL6A 1DRVA 4KOAA 2Y68A 3MZ0A 3ENKA 4GBJA 2BD0A 4IXTA 4ZD6A 5AVOA 1U5CA 5THQA 1S7CA 1B16A 5I9LA 5ITVA 4PG5A 2FWMX 1TXGA 5DF1A 3TZKA 3JV7A 3AUTA 4HFRA 3NDJA 4KDEA 4CL8A 3L6DA 4XGIA 4OAQA 1UAGA 4ZA2A 3WGZA 3F6YA 4D41A 1ENYA 1VE9A 3IP3A 3FWNA 3UOGA 4EJ0A 1IZ9A 1DFHA 6ADHA 1C0LA 1SAYA 1DBVO 3D3EA 1BG6A 4WEOA 2EW8A 4R54A 3PHLA 1IB6A 2EG9A 1DIGA 3WSWA 2GCGA 2NM0A 4QEDA 4H7PA 1UXGA 1Z74A 1JWBB 4LCJA 5GY7A 5EESA 4RPKA 4HWKA 3QWIA 1ZSYA 2PGDA 1RWBA 4EITA 3GEGA 4ROSA 1DAOA 4QTZA 2C2XA 3W4JA 3JYLA 1IPEA 5B4UA 4TKLA 2P4HX 5C7OO 1RM4A 2DKNA 4LVUA 2DUUA 1LDEA 5JW6A 2LDXA 1LRKA 3RROA 3PFFA 4NU5A 3FR7A 5F5LA 5TQVA 2BF7A 1O9BA 1FDUA 2CSUA 3C1TA 5A03A 1ZVMA 2PKRA 4Z9YA 3WTCA 3V1YA 1PS8A 5JC8A 2IE0A 2Q22A 4UUNA 1Z6ZA 3HNPA 1KS9A 2Y0EA 1QKIA 1HE4A 3H8VA 3JQ8B 3JQ9A 5BNIA 2PH3A 4MP3A 5HA5A 3DTYA 1XU9A 1DXYA 4M87A 1ZFNA 2QHXA 2HRZA 1CEQA 2PZMA 5G0UA 2IODA 4Q3NA 3R3JA 5TC4A 1W6UA 4L4RA 3DFZA 1A9ZA 1YH3A 4IJKA 2PR2A 1FDSA 4CMIA 1BXKA 3TZCA 2FPIA 3SC4A 2X23A 3FSRA 4D3DA 3DL2A 2GZ3A 4CR6A 3OJOA 2BHLA 4B4UA 3DZJA 2YDXA 4CMGA 1DC5A 1K0UA 1W0CA 3RSHA 3EMKA 1CIVA 1UDBA 4P38A 5KOIA 3CKYA 3U4CA 3JQ7B 3GZNB 3E8XA 3QE3A 5F1KA 3AFMA 1HTBA 3RBZA 2UUOA 1O89A 2CUKA 4C4OA 3N58A 2GZ1A 4XR4A 2EEZA 1EDOA 4AJ4A 1QORA 5A5EA 4OQYA 4DQUA 5ICMA 3IKVA 5A5FA 2VWHA 1YDEA 3DBHB 4J4TA 3OICA 3OSUA 3LLSA 1HKUA 2IEDA 5KJEA 1SC6A 1OOEA 2BGKA 3ZWVA 3V1UA 2JD2A 5JPIA 1LBEA 2ZCVA 1GY8A 1PJTA 3ZH2A 1ISMA 1I8TA 5JNLA 4DYVA 1SB8A 2EGHA 2Z95A 2I66A 1NVGA 4MVJM 2PTGA 1QRRA 1P9LA 2X5JO 1J4AA 2E4AA 4BKOA 3PQDA 3SLKA 5T8KA 2HKIA 5BNTA 4YAJA 4D3SA 1R37A 3CE6A 2VYVA 4QX6A 2BFAA 3HFGA 2DPHA 1E3IA 2VHZA 3MJSA 5JBIA 4F6LA 2PD3A 3CMCO 5L7YA 1PZGA 3E5MA 4Z0PA 1J5PA 4IM7A 1L1FA 4HP8A 2X8LA 4MVJD 2B83A 1EUZA 1I3NA 1YJQA 2J8ZA 4PLPA 5CP8A 2VUTA 4B8ZA 4GSKA 1CDOA 1HRDA 1SOVA 3TFOA 2I5PO 3WYCA 3LT2A 3OETA 3L07A 5JYAA 3D0OA 4GX5A 1GUZA 3MOGA 4OOEA 1XSEA 3UH1A 4XCVA 2NNLD 1HF3A 1GPDG 5IDXA 3Q3CA 4BNYA 3ZWXA 1Z82A 3R6DA 1JN0A 2Q1TA 1CRWG 3GF4A 5HWSA 3E82A 2RH8A 4BMNA 2D5CA 1DSSG 5DULA 3PYMA 1BSVA 4JJIA 3GVHA 1PJBA 3DDNA 4A0SA 3PZRA 4GQAA 3SC6A 1YQXA 4IUYA 4AJEA 3O9ZA 3H6KA 1JKIA 2Q4EA 1DLIA 2H63A 4QQRA 4Q3BA 4Y6RA 5H83A 2PWZA 3QW2A 3IL2A 1PJSA 4RO0A 3STHA 1U1IA 5JYFA 4GX1A 1TVEA 2UYYA 1LXCA 3SEFA 3L6OO 4GX0A 3EAGA 3HE3A 1EMDA 1RYDA 3ULKA 3QVSA 2ZQYA 4AVYA 4EZBA 3QWAA 2WJPA 1AN9A 1PL6A 1P74A 4NNJA 3IUSA 4DLBA 2RHCA 2JAHA 3NX4A 2C59A 4BNIA 4BO4A 4IPTA 4BO3A 5L51A 3W8EA 2O3JA 3UICA 3WICA 1YBAA 2GRAA 4BVAA 4XQ9A 5G0SA 3ZWOA 4AJ1A 2PA3A 3WNVA 5JFOA 4NJMA 1P1FA 4NIMA 2IRWA 2DAPA 5H82A 1DC3A 1B15A 1BW9A 3KEOA 4XX0A 3TQHA 2LDBA 3OIGA 3AI3A 4FC6A 3X2FA 3DR3A 5CDGA 3WX0A 5KVQA 1HE2A 2PD4A 3JTMA 4Q39A 4Z3DA 4M89A 3MJ4A 4YAIA 3PQFA 4XIJA 4OXNA 3KYCA 1T2FA 1VSUA 1EVIA 1RPNA 5DCYA 3G0OA 4II2A 1LQTA 3H65A 5IDQA 1KYQA 1PTJA 2V65A 4BNKA 4IGEA 3TJRA 1QYDA 4WCFC 1R4NB 2NVUB 3ONEA 1KY5A 1YBVA 2A9FA 5BNFA 1IL0A 4CUKA 5JCJA 4ZU3A 2OMEA 4L9RA 3DAGA 1Y9EA 4O5OA 2FSSA 3ZCXA 2GYYA 4KP7A 3BYZA 1X0VA 2ZTMA 3AI2A 3GZNA 3AJRA 4DC1A 3F4LA 1YXMA 2OL4A 2ZIZA 4PRLA 3EGOA 4ALLA 2DBRA 3T7EA 4NJMB 4IY1A 2RBEA 1F0YA 4AJLA 2QYSA 4YRDA 4MIYA 1MG0A 3JD0A 4AJHA 2A35A 3F1KA 3OECA 4EJMA 3D4OA 4OKIA 4PLTA 4B3IA 1JTVA 3HN2A 4TVOA 4UVHA 4XB2A 1S6YA 1OFGA 5JDCA 4IDFA 1VL8A 2OP1A 4IBOA 2JJYA 4M86A 2HQ1A 1GADO 1V8BA 3ROQA 4J7CA 3FCOA 4HV4A 1K2WA 4CV1A 3M1LA 3VH4A 2XXBA 1Y7TA 4JQCA 4BS9A 3IC5A 5A04A 2Y99A 4EUHA 1R12A 1HYEA 2C29D 1HEUA 3KEQA 3F5SA 5T67A 1E6EA 4BNVA 4RORA 4BIIA 1Q1NA 3QQPA 5KKCA 1XYGA 1LSUA 1XLTA 2V7PA 2NTJA 5L53A 2W98A 3ETEA 1I36A 1LJ8A 4MP8A 3C1OA 1SZJG 3WMXA 1Q0LA 1V9LA 1XR3A 1G6KA 1U4OA 3SJ7A 4PN3A 3HQ4O 1XHLA 2OO5A 5U4QA 1AHHA 3BMNB 4OYRA 2I99A 1ZJYA 2CDCA 3K31A 2XOXA 1IPFA 2BLLA 3MJEA 2ZTVA 2GERA 4W4TA 3AY3A 2AA3A 3U4HA 3UF0A 1XCBA 4L8VA 4NZ9A 3VTZA 5MGBA 1NVMB 3TF5A 2O4CA 4CPDA 2NVBA 3ZWPA 3EK2A 1KVSA 1NQAO 2YHUA 2X5KO 1TT5B 4XKJA 4XEHA 3GC6A 3I4FA 1SEVA 3I9MA 4F3YA 2Q2WA 4KWHA 4DIBA 5LDHA 3EDMA 4RDHA 4W7HA 5JE8A 4FOSA 3VH2A 4JBIA 4K26A 2VTDA 1NWCA 1NTOA 4CV3A 3ZV3A 5CDUA 1GD1O 1OMOA 2FR8A 2AQ8A 4ND5A 3OP4A 1EFLA 1V3VA 1ZW1A 3ONFA 2X7HA 1XU7A 3RJ5A 2Y1OA 4J6FA 1F17A 4Z9XA 5GZ3A 1QR6A 3L4BA 1P1HA 3ONDA 3GUYA 3S2EA 4D45A 3F5QA 3Q9UA 1C1XA 1T2EA 4QT0A 5GZ6A 5JCXA 2B5VA 3K92A 3RUFA 2QQ5A 5I9NA 3BMOB 3MWDB 4G5HA 4OKNA 4CL3A 5JYDA 5DNAA 2D4AA 1P1IA 4PLZA 3WWYA 2A94A 3PLRA 2HMUA 3NYWA 3TFQA 3W4IA 3FF4A 4ZQEA 4KUHA 2UVDA 2W4QA 3BTSA 1V0JA 4KWIA 4YVFA 3IUPA 4YCAA 1SO8A 4JCOA 3GQVA 3GVCA 4G2NA 3QA9A 1R0LA 4BHTA 3RI3A 1FDTA 5JMWA 4OMUA 2VHWA 2IXBA 4NK4A 4RQTA 1BW9B 1N2SA 4DLLA 4BO0A 4TVBA 2NQTA 4YQZA 3NT4A 2GD1O 3IDSA 3M2PA 3JQAD 2VWQA 4FN4A 3LF2A 4WCFA 3VVCA 3JYPA 5F5NA 5IXSA 5JDIC 2NTNA 4IDBA 4DVJA 2HDHA 5IF3A 2V6BA 4NJOA 3ZWNA 1MP0A 2B37A 4NDNE 4XQEA 3ASUA 4MVJF 3ANNA 3D4PA 1ZZEA 1VI2A 1R6DA 1BDBA 4UEKA 4C7KA 2VRBA 3DBHA 5DOVA 3GHHA 1DAPA 1KC1A 4WECA 1M75A 3WGTA 3H9UA 1DIRA 1AE1A 1HDOA 1HZJA 4UUMA 4UVEA 4GKVA 3BMQA 4ND2A 3IP1A 1ISIA 1DHTA 2WMDA 3NTQA 4YYZA 5KJFA 2C5EA 1DLJA 1ZK1A 1U2GA 1BRMA 3ZU2A 3TZHA 1DPGA 3PWSA 3FTPA 3P5SA 1YS4A 2ZQZA 4ZQHA 4DIFA 3RFXA 3RC7A 5T73A 4UREA 3EVNA 4YJFA 1PS9A 2DFDA 3AY7A 3P19A 2P9CA 2YZ7A 3KSUA 3P7MA 2UUPA 7ADHA 3ZU5A 2AEMA 1EUDA 2O50A 2D0IA 2PNFA 2DTEA 1BTOA 2W2LD 3ZNOA 3DZKA 4D46A 2P4QA 4J91A 4D42A 1GEGA 1HSOA 1L7DA 3E6AA 4UUOA 4HX5A 2C5AA 2VZ8A 3DHEA 4L74A 4RLHA 3WJ7A 1YO6A 1E7WA 2UDPA 4IXWA 4ZJUA 1FK8A 1T25A 1TEHA 2EW2A 3E5RA 3RUIA 4HY3A 4ILKA 4RVHA 2HUNA 4XGNA 4PIVA 1E3EA 4YAKA 4ZVVA 2HJSA 4LSMA 1N9GA 4J9VA 1LI4A 4J16A 3L0DA 1G1AA 2G76A 3W4KA 1HSZA 2IDZA 3WQSB 4EGFA 3RJ9A 5FFFA 5EIOA 5TRTA 2Y1CA 1PSDA 3GUCA 3PGXA 1I24A 2JHFA 1NP3A 4A73A 3VVBA 4CM9D 3MEQA 2ZYGA 1ML3A 1E6WA 1XGKA 4J1QA 1T2CA 1PEDA 4E13A 1LDYA 2VHYA 4DPLA 2OFPA 1LRLA 4CQMA 3GEDA 3DZFA 1VJ0A 2W2KB 4FJ0A 3H2SA 2YQ5A 3ZDFA 4AICA 1L7EA 2RAFA 2ET6A 3QHAA 4WUVA 5DBGA 2G5CA 3WGYA 1A7KA 2AQIA 4Q3DA 1TI7A 2FOIA 3OHSX 4B79A 3VZSA 4XA8A 2X6TA 3JD2A 1KERA 3L9WA 4TWRA 3QRWA 3DB2A 1XKQA 4XDZA 1EBUA 4I9UA 4FR5A 2EP5A 5TGDA 4LISA 2RCYA 5JAQA 3BTVA 2G17A 5JC1A 2I67A 2E6UX 2VOJA 2J5KA 4QECA 3WGIA 1YB4A 3DFUA 1CETA 3VDQA 1NPYA 1VKOA 4PVCA 3JQDA 4NG5A 4TKMA 4N18A 1KVRA 1ZUD1 1JKJA 4IIVA 4UULA 4FGSA 4U6QA 2XF8A 3KYCB 1EFKA 4O1MA 2DQ4A 4JP2A 1U7HA 2RIRA 3W8FA 2NSDA 4YQYA 4LVCA 4B7XA 3I9OA 5FYDA 1D1TA 4FJ1A 4PLHA 5C37A 1K6JA 1V35A 1DHRA 3VPXA 4NFHA 4FPXA 4XRGA 4YWJA 5TX7A 1OC4A 4XYMA 2F1KA 1HWYA 3WIEA 4BL5A 5A9SA 5B4VA 5TT1A 1BVUA 3ENNA 2GZ2A 5A02A 1BVRA 3ZWWA 4P4GA 4LSWA 3PHJA 4Q3EA 5ES3A 4BQRA 4YT4A 4AJIA 3P2OA 4UVGA 1JKFA 1K6IA 2EKQA 2I65A 2X9NA 1U8FO 1I3MA 1GQ2A 5TS3A 4GL4A 3BXXA 4R4JA 5G4KB 4CV0A 5EMHA 1H6CA 4WNCA 3G17A 4I08A 4HNGA 2UV8A 4DXHA 7MDHA 3FPCA 3ZI0A 1ADFA 1NX6A 2IXAA 4JIGA 5K6AA 4ONEA 1X7HA 3WGGA 1A7AA 2BMAA 1VPDA 4DPKA 3RUAA 2D3TA 5COAA 1KOLA 2H1SA 3F1LA 4CLXA 5KKAA 1ZK2A 4LGVA 1D4FA 4QXMA 3KV3O 1Q7CA 2W2LA 3KETA 4RCVA 4OH1A 4BKRA 2I3GA 1GZ4A 1CQIA 1RM0A 1ZCJA 1ZIDA 1Y5RA 4CODB 1WLYA 1V3UA 3L9XA 3NDRA 2GDZA 2V6MA 2A4KA 4AG3A 2O3TA 1N1EA 3ZGYA 5JMPA 1SBYA 2VYNA 1NFRA 4YA6A 2QX7A 1NR1A 4YTEA 1BXGA 1MG5A 1X1TA 2Q49A 1MC5A 5T5QA 1ZJZA 4FFMA 2WYWA 4K6CA 2BH9A 3RFTA 1W8DA 3RQSA 4YJDA 3HUDA 1B8VA 4WKGA 2HK8A 2RH4A 2HMWA 3B70A 5FF9A 4J43A 3FD8A 5A9SB 4R68A 3ZWYA 3GN2A 1ENPA 4AJJA 4DQXA 4ALIA 2Z1NA 4J1NA 3ETGA 2QRLA 3OEWA 1ISHA 1WDMA 4DA9A 3JSAA 2Y66A 2BFOA 3K6JA 1XEAA 3EW7A 3JQAB 4R1TA 4HNHA 3B20A 1WNTA 3PEFA 3WG9A 3U9LA 1NHWA 3NRCA 5TJHA 2WD7B 3DTTA 2DU8A 3JQBA 4WOKA 5CPBA 4BGUA 4PLCA 3C85A 1ULSA 1UP6A 2JFFA 3KOUA 3ZNNA 3I4CA 5KNLA 3AI1A 4ALKA 3COSA 1PQWA 1R4NA 2NVUA 3PHHA 3A28A 4Y9DA 2X0IA 4NBRA 1EQUA 3A1NA 5JY1A 4FIZA 2PZLA 1GFSA 4RVUA 4XQCA 4ALNA 2YV3A 5F1OA 3FTNA 3O8QA 3PQEA 5DOZA 4XR9A 3E03A 4MKRA 4CLRB 1NFFA 3RUEA 4QSMA 4PRKA 3JYNA 4D44A 4PLGA 3KZVA 1NBOA 4YJGB 3LLVA 5EL0A 2O2SA 4PZDA 1LQUA 1M6WA 2YUTA 2HAEA 4XDYA 3DMTC 3JQCA 1T2DA 1LNQA 5DP2A 3GK3A 3BTUA 4O0LA 2VZ0A 4FFOA 1UZMA 3RBXA 4DPMA 3KRTA 1IULA 1D8AA 4JK3A 4LMRA 5GMOA 3ASVA 4CM8A 1LSOA 1MXHA 4KTTE 2VNAA 3ZWMA 3UUWA 1QSGA 2YFHA 3E9NA 1GL3A 3O03A 3ZZNA 3H4VA 2E48A 4TRRA 4BO5A 1X1EA 2B35A 1TT5A 1NWHA 1QV6A 4PGFA 1YGYA 1SPXA 3DMYA 5THKA 1QLHA 4DQVA 5C7IO 4A27A 1ZSVA 1Y8QB 1O8CA 4MVJP 3JD3A 1LC3A 4YDRA 2I9PA 2NU8A 4BNZA 2EKLA 3PHIA 1EVZA 1OC2A 3WJAA 3KSDO 1VL0A 2NUAA 2PZJA 2CFCA 1AUPA 3MJVA 3EUWA 3PFWO 4FFNA 2P9EA 2OBYA 5A06A 2WE7A 4GMGA 3BHMA 2ZB8A 3A4VA 3NEPX 4BMVA 5A4DA 4WLNA 5IFLA 4RVFA 5DCWA 2HMTA 5L7WA 3OA0A 1WAMA 3H9JA 4K1LA 1P1RA 3IIEA 1BHSA 5KJCA 4GMFA 4CUJA 2Z1MA 1LLCA 1ZO8A 1LTHR 2DVMA 1CJCA 4E0BA 3ADOA 4R41A 3ROKA 4P8RA 1F06A 4MPDA 5JAIA 5F21A 3M1AA 4WGGA 1ZEJA 1F12A 3KLMX 1E7SA 1PJ3A 2VT3A 1P1KA 1E3JA 3N74A 1U3UA 2BFMA 2YY7A 9LDTA 1JVBA 4DYDA 3G79A 3Q2KA 3BTOA 1RM5A 1NM5A 3DBLA 4QFCA 4E5KA 5A3JA 4M55A 3KVOA 4JX8A 4U6SA 4IJVA 1ZK0A 1B8UA 4RPLA 4XRRA 4AJOA 4KUEA 4HXYA 2AMFA 2FR0A 1JU9A 2QG4A 4TRMA 5F1PA 3ANMA 5CEJA 1DO8A 2A92A 4BO1A 4D43A 4EDFA 5C7LO 1MFPA 1SCUA 2ZATA 4AJNA 4EJ6A 2DLDA 2GPTA 1YONA 3JQ6A 5CDSA 4ZICA 4XIYA 3RASA 4XYBA 4CM1A 2J3KA 1GYQA 3UHAA 2CD9A 1YDWA 2FP4A 5COBA 3MJCA 4KUGA 1DB3A 2YDYA 3UN1A 3DWFA 4CLDA 5KJ6A 1PJ2A 3D64A 4IDEA 3PPIA 3PHGA 4IS2A 3GZ4A 3DMTA 1C1DA 1I2ZA 3DOOA 3AM5A 5AXDA 5K9ZA 4BNFA 4FC7A 1LDNA 3AUSA 5FEUA 3JYOA 4RGBA 4CLOA 1C3VA 1X7DA 3EHEA 3TSCA 3WR5A 4H3VA 3NGXA 2GN6A 1AXEA 2YJZA 5ENDA 3I52A 4BUCA 4LK3A 1B8PA 3GDOA 4GSLA 2ILTA 5JCJD 1CERA 3NDIA 3JQGB 4NFSA 4DUPA 3L6EA 3ADPA 3U3XA 5M6DA 2YHIB 3KHUA 1GQYA 3NT2A 2WDZA 2X5OA 3RCBA 1YB1A 3WXBA 3HB5X 4WK6A 2D1YA 1R4MB 2Y1GA 1PS0A 3PWKA 3QIVA 5DZSA 1AGNA 2E37A 4CMIB 2JD1A 3O26A 1EZ4A 1LLUA 1P1JA 1UXIA 2WD7A 3IJPA 5KVCA 2YW9A 4RPHA 3RC1A 4OSOA 1NHGA 3IS3A 2WWRA 3D5QA 4XYLA 1E1LA 1ULUA 4Y6PA 2X22A 3GDGA 1GYPA 2J3HA 4ZGWA 1HZZA 2AEFA 2GSDA 3W6ZA 2Q1WA 4MOWA 1YKFA 3S8MA 1WDLA 3LQFA 4MVJE 3LYLA 3CINA 4GPD1 5L7TA 3V2HA 2VCYA 5DDIP 4PG6A 3TNLA 5H81A 1SOWA 1U2DA 2NTVA 3S2GA 1EK6A 3CTMA 4A03A 4Z9FA 2DBVO 1DRWA 1ONOA 2ZB3A 4B7UA 5TIIA 3HSKA 1PJQA 1QLJA 2VT2A 3WS7A 1M67A 2Y93A 3H9QA 3HDJA 4L4XA 5IZCA 3LT0A 4N5LA 1M66A 5HTOA 4FCCA 3DO5A 3E9MA 3HDQA 1JDJA 4J49A 2OGUA 4BO7A 2HMSA 5KVSA 3RVDA 3DBRA 3AUUA 3GGPA 4RVDA 4B4WA 3K30A 4NK5A 5T64A 1F14A 2FZEA 3FPLA 3NAQA 3PJDA 3DXFA 2W2KA 3RC2A 3E1KA 2PY6A 3GR6A 1Z7BA 5C5IA 5HS4A 2X86A 4PZEA 5IJZA 1NASA 2XXJA 1E7RA 2AXQA 3KSZO 3DZHA 1P33A 1U4SA 4ZHSA 3CZRA 4X54A 3GLQA 1GUFA 1RYEA 5A3VA 4I5DA 1ENOA 4GGOA 2PKQP 3WQRA 4E12A 1WWKA 1RM3A 3KTDA 4N5NA 2P5YA 2IYOA 3OJ0A 3RC9A 3FNFA 4EEXA 3DAFA 3I6IA 4IZHA 5IN5A 4PLFA 5GZ1A 3GVXA 1IHXA 2PH5A 3D5TA 4OXYA 5I7VA 3QV1A 4YBZA 1SEPA 1UP7A 3B1FA 2YV2A 3TDKA 3UVEA 4PG7A 1BWSA 2O3SA 3AK4A 2OOSA 2GNAA 3QP9A 3ICPA 3WWZA 2I76A 2D2IA 4BKQA 3OH8A 3UXYA 3QWHA 2FPPA 1VSVA 5J9GA 3ROPA 4BNTA 3WQQA 4Q9NA 4B4VA 3G1UA 1E7MA 2VNSA 3JQEA 3WYBA 1N7HA 4E30A 4ND3A 4R01A 5CFZA 2VUUA 5TF4A 4ZQBA 4ZQFA 2R2GA 8ADHA 4E31A 2H6EA 1HXHA 1YB5A 3KUXA 4NH4A 4XYGA 2VHXA 1GAEO 5I8WA 1I30A 2CY0A 3BMQB 4P4NA 4CR7A 1UXKA 5I9MA 3O8QB 3UW3A 4II3A 2HLPA 3PXXA 1H9BA 1SNYA 2GN9A 3GVIA 4IDGA 2ZCUA 4DLAA 4OOFA 2CVZA 4D7AA 5B4TA 1NR7A 2FZWA 4J4BA 3GA0A 3TL3A 3AOEA 3JQ9C 1MGOA 3VPHA 4DMMA 2XPCA 3FN4A 3TN7A 3CZMA 3D3WA 1YL5A 2VZ9A 1QG6A 2PV7A 9LDBA 1X14A 3PLNA 3OBBA 3AFNA 1I33A 4K6FA 4FJ2A 1U28A 2JFGA 3FHLA 1ID1A 2PGJA 4GVLA 1D3AA 3U49A 1O6ZA 2AHRA 3JD4A 4YJGA 1WPQA 3KO8A 1T26A 4E5PA 1KVQA 2J6IA 3NJ4A 1LC0A 4RF2A 3CUKA 1P31A 2Q46A 3FNHA 1UZNA 3DHNA 4IQ0A 4FD3A 3H9GA 3VH3A 5BSFA 2QYTA 3HG7A 3IAHA 1MB4A 4I1IA 3PTZA 1TLTA 4NBVA 2P9GA 3I3OA 3GPDG 2DFVA 1UH5A 4J90A 5CHEA 4DIOA 5L4LA 1A5ZA 1HL3A 3H3FA 1E3SA 4OHUA 3ITKA 1E0DA 4YT8A 1Z73A 4BO6A 1P0FA 1E1KA 4P22A 1ENZA 1NPDA 3RBVA 2G1UA 4YRAA 1VKNA 1GTMA 1HDZA 3AOGA 1X13A 3OJEA 1EVYA 2B36A 5EPOA 4BNNA 4E2YA 1WZEA 5CEFA 5BSEA 3I1JA 4PCVA 4IDAA 4L0QA 4J0FA 3OIFA 4N54A 3AUAA 1NAHA 4QUKA 3GN1A 3VTFA 2WEKA 1ZXBA 3ANLA 4DMLA 2J5QA 2VRCA 3KLPX 3DZGA 4WEQA 4BGVA 3KYDA 3VHRA 2GASA 3LC2O 3OMLA 3VPSA 3S1LA 2DPGA 2J3IA 3PI7A 3E48A 2IZ1A 1NAIA 3F3SA 4JN6B 4WOJA 2FRDA 3UFXA 5L9AA 1FMCA 1HYGA 1NQOA 3NUGA 4KDFA 1P77A 4M49A 4WLUA 1U3VA 1B0AA 4I9HA 4HBGA 5TNXA 2DTDA 3DBVO 4LRSB 5JYEA 4HUJA 4KZPA 4DRYA 3IKTA 1JW9B 1VRWA 1IYZA 1Z75A 1GZ6A 4FFPA 3RIHA 1ISFA 5DP1A 3RKRA 4CLRA 2PLAA 3QVWA 3MWEB 2X4GA 4OO3A 1BMDA 4FW8A 3PZBA 4A10A 1NQTA 1UJMA 4RV9A 4G65A 1AHIA 3PRJA 2BELA 1ZXLA 3ZU3A 4EUFA 5MDHA 4XZ3A 4I5EA 3E9QA 4BO2A 1DRUA 4RVGA 1ORRA 1QXSA 2GF2A 4A26A 3WOHA 2D59A 5BSGA 5AXAA 1E77A 3JQBC 3RUDA 5CAEA 3EYWA 3SBOA 5HM8A 4NFYA 2WYUA 3VZPA 2EV9A 1H2HA 4HFJA 2SCUA 4TROA 3KYBA 2IZZA 4RL6A 5COQA 4B3HA 4R3NA 5EQDA 3E18A 1B2LA 1G0OA 2DUWA 2R00C 1K6XA 3TZ6A 4YXFA 1V3TA 1RJWA 2BKAA 3INTA 3PVZA 2Q4BA 4J1TA 1E1NA 4NQZA 4FBGA 5JAMA 1PJLA 2Y1FA 3LZ6A 3WFJA 5JDIA 2AW5A 5BR7A 4IS3A 4D79A 4UUPA 1KVUA 1I2CA 1H2BA 3R3SA 5CG2A 1NXQA 4FFRA 4DBVO 4BNUA 4CQMB 2FMUA 3PYXA 6LDHA 3MTJA 5AQ1A 2NU7A 3OJFA 4I5GA 5I7SA 3I83A 2C54A 1KEVA 2D5AA 3V1TC 2B0JA 2EJWA 3L4BC 3Q9NA 2NVWA 2OORA 3MJTA 3OM9A 4XYEA 1EK5A 1MC4A 4ND1A 3DZBA 1N92A 2IZ0A 3INRA 4IMRA 3EY4A 4CM4B 4IIUA 5KTKA 3AW9A 3H9EO 3HFSA 1E7QA 1Y5MA 2O3UA 1UXJA 3ROMA 5G0TA 2EHDA 5DN9A 1YRLA 1EDZA 1NPTO 2ZK7A 1ONPA 1PWXA 1PR3A 5K6AC 2PGLA 3GAZA 1Q0QA 2Q2QA 3DBLB 1JAXA 2AE1A 1GV1A 2P91A 2HRBA 3QVOA 4Y8VA 1UAYA 4U0KA 3CSDA 1N7GA 4XD2A 4UEJA 1A72A 4HFMA 4YB8A 5JO0A 4K28A 2O3RA 4BB6A 4JLWA 4R69A 3PIDA 3C8MA 2O4UX 1DEHA 1VJ1A 1Y8RB 3QLJA 4LCEA 1W73A 1H9AA 2VTEA 4GVXA 4YEDA 3NT5A 2GN4A 1EQ2A 2ZTLA 1HDYA 3D1LA 1Y1PA 2Y05A 4E3ZA 4TZTA 2AE2A 2Y0CA 1LSSA 4J2OA 3BMCA 5TSDA 4BKUA 4Q3CA 4BQPA 1ZK4A 1PJ4A 1B14A
chains in the Genus database with same CATH superfamily
3L92A 1WIWA 2PKQO 3LUJA 5LQJA 4AWBA 3WFZA 2Z3WA 3S55A 4QVGA 3LC7O 3V2GA 1T4GA 2E4VA 4EUEA 4AS1A 1FOEB 1EJ6A 3LUKA 1KFJB 5LJLA 2QAGA 1N32B 1KU0A 1GCUA 5LD2C 3N70A 4XB6B 1V5FA 1IAVA 3NHJA 5DBHX 1KWKA 3H3JA 3WBBA 2D1QA 3FWZA 2ONYA 2QNIA 4LNHA 1H2ZA 5CIWA 1IY8A 1EZZA 2ACVA 3DT9A 3ZGOA 3UWPA 4WESB 3H83A 1LS1A 3VBEA 1XN1A 1YVEI 2F7SA 2W4IA 2OXIA 5KWJA 5JASA 5L3SA 1SD1A 3HB9A 1TU3A 1QYWA 3EVDA 1LLDA 1B73A 1VECA 3BPSA 1J0EA 1U1GA 2H9YA 3BRWD 3OJXA 4CIWA 1A9YA 1U8XX 1PSZA 4ENUA 4JUCA 4DSTA 3QUTA 3VBCA 5A4KA 3A10A 3GPIA 1AGYA 1SQ5A 2DPLA 3RSGA 1RYNA 2Z9CA 3HYSA 4MWTA 2PLFA 3BIXA 3TOSA 5KVVA 4BGEA 4ACAA 2A6PA 4D80A 1W5SA 5KYWA 1TF2A 2CXRA 5ESXA 3ZY2A 1G66A 1I3KA 1QVZA 3PJFA 4MWEA 4P36A 3GNSA 3VDNB 4B7AA 4IO0A 5CTAA 4X0EA 4EJ6A 2RGYA 4P84A 3UJAA 3OTOB 2Z5GA 1HBJA 1W0KA 4MCIA 4PX9A 2GT1A 1AD2A 3HBNA 5CCXA 4MKXA 1QHNA 4IQGA 3HFRA 4KWTA 4EJSC 3CLTD 2ICAA 1YCDA 1RKQA 2I4MA 4XWAA 2PSJA 3C7KA 2GK3A 4P81A 4DMHA 3PDUA 2M6LA 4C2BA 1CUWA 1NRXA 3JVUA 5LA6F 4B6OA 3ZWCA 2IPLA 3MAGA 4B81A 1UODA 4QLBA 1YFZA 5C1BA 1IHOA 3RM3A 2I29A 1T15A 3HBFA 1WF6A 3WBJA 4BVFA 4E2XA 1JJVA 5B36A 3X1KA 3FNIA 2VEOA 5T6BA 4BJ5A 1L9XA 1FYDA 2B92A 4U8HA 2JKVA 3GI1A 1J21A 1GPAA 3IE2A 3PUIA 4G89A 3SQDA 1N6IA 3F97A 4BKMA 4V1CI 2X0JA 1MNAA 1RRCA 1TD9A 1AVTA 5AI5A 3RS2A 2PUCA 3H5AA 1TM4E 2ISCA 1UT8A 4U3JB 4BTLA 1GRNA 3A4MA 1FLDA 2UU9B 5IC4A 4OI0A 5AKLA 4LZZA 4B1FA 4N39A 4V3CA 3CRW1 4GG1A 4B2PA 2JGKA 1VE5A 2XVAA 4KR6A 2QVCA 4LHWA 3U5TA 2FPIB 5DN6A 3JZMA 4ZI7A 1X7GA 4MIOA 2B4QA 4G01B 1QLWA 3SX4A 1EB9A 1NUPA 2ESRA 3NIBA 4KSCA 3MNFA 4TS1A 1NOJA 5LC1A 1DAKA 4EVSA 4BTEA 3ZQ4A 1XZPA 3UT0A 2H1LA 5FUYA 2PEYA 3IPLA 4XE5A 4E88A 4FLEA 3OTHA 5IHPA 1FS4A 1PHRA 4TZ6A 3DVSX 3H0KA 2TS1A 1EYZA 2R7NA 1OXSC 2NSHA 1GGJA 4IDQA 3TLXA 5CDTA 4F04A 1FL9A 2A59A 1CUIA 4JYPA 3VU9B 1TAQA 4QE3A 1KY2A 3R74A 2W48A 3RRYA 1OILA 3T7CA 4LRUA 2G7ZA 1TJ3A 5FPKA 4CV2A 4NYJQ 2R9VA 2FV8A 2PH1A 3N86A 3OTWA 5DNWA 3SS7X 1CE8B 2I4TA 3KBOA 1X1QA 2C58A 2R6ZA 4R83A 2E4UA 4CEJB 1CNFA 3IMEA 3PPWA 2QSJA 4QG3A 1EZ1A 2K7FA 4OLAA 2Q4OA 3EUEA 2AVDA 2YCBA 1E1QA 1R66A 1XTPA 2E18A 2GAOA 5T57A 3WNDA 1E5DA 4EZEA 3ICCA 1O97C 1R0KA 3DDZX 3W6UA 4Q3KA 2ZIXB 4CLHA 2WG1A 3UCXA 3ICVA 5DCUA 5L4SA 1BXRB 4X7BA 1EB8A 1CB7A 3E70C 1NBAA 1OROA 2RE8A 2AI3A 1FZTA 2XECA 2TRSB 1SMKA 3I1YA 1MJGM 4HQ0A 3R7LA 3MGKA 3GLUA 5SY6A 1MA3A 3K9QO 1NYLA 1Q7BA 4FGKA 2DR0A 1EFRD 4C76A 1VZ2A 3OG9A 4AG6A 3KQVA 4F4DA 3KYDB 4MUGA 1QIFA 4EK9A 2EJCA 1QV7A 3O8BA 2G5TA 3LXRA 2UYGA 4FDAA 2E4XA 4YASA 2WJWA 3VKWA 4DTIA 2WA1A 4RVNA 1GZDA 5KTRA 3RIYA 4EQ6A 2A0YA 3UT5B 3HADA 3M1YA 1RXYA 3B7PA 3HDHA 4F5YA 4EKIA 5DBFA 4W1RA 1DAMA 3L0CA 2Q0SA 4EM6A 2IHTA 1GG2A 1KA9H 5AI8A 3SHOA 4EY3A 3GLIA 2Z58A 3KZMA 5EUCA 3N3BC 4YLEA 4ZN6A 2YFQA 3EARA 2PIAA 5FH9A 4I3HA 2ZIEA 1DCFA 4K7JA 5IHXA 5ENZA 3K2EA 3BDAA 4G5XA 1IEXA 1IN6A 4KPUB 4NH0A 1JIUA 2BE7A 2ZKLA 3NG1A 3ORSA 1XEXA 2OAP1 1I0ZA 1WPGA 2YV4A 4WVLA 2C2WA 4OP2A 1YL7A 1NNUA 3IBCA 4JQZA 1DC4A 4G9EA 1NN3A 1TYZA 4RMIA 1J00A 1NN0A 3WB0A 4M8SA 4PGGA 2ZRJA 3UQZA 2OHXA 1KDVA 3F8TA 1UKEA 1U8CB 5MN6A 3H9CA 4Q15A 5IUJC 2FY8A 1Z26A 3EG5A 5KNBD 3BIOA 2WICA 1QK3A 3LOUA 5KC9A 2P1DA 3BBPA 5KEIA 1F38A 1ZWLA 2YS7A 1IUNA 1MVNA 1EVKA 1M8KA 3H2BA 3HA7A 2ZPAA 3M3HA 3MERA 4O2BA 3CNLA 4TVSA 5B6PA 3MUNA 3H8SA 3SMQA 5HM6A 5M2QA 3PIIA 3ZU6A 5E2IA 4B7CA 3G1TA 3ZJ5A 2YNMA 2QMQA 2V6GA 3SNHA 4TTIA 2G1JA 1R16A 2EWVA 4JLNA 2AF4C 4J0EA 4P3PA 2MT9A 5CBPB 1RZRD 1H6BA 4CEHB 2G0TA 1FRFS 5D8DA 5F78A 1R4ZA 2CEAA 3L6RA 3T61A 1NJFA 1T5LA 4JODA 2Q2VA 5D2CA 1TECE 2BFBA 3TTXA 3AJ9A 4IX1A 2JZCA 2GEVA 4UAGA 2JBHA 3IXMA 3O7WA 4DW8A 2ZBFA 3BJMA 4JSYA 2IKQA 3TRFA 3T1OA 4MGIR 2JIOA 3HYNA 4ARZA 4FFBA 2QN1A 3FOWA 3O4GA 1WX1A 2VUSA 4FBLA 4HDNB 4MR8B 3RG8A 2HV9A 3X1ZA 3E7FA 2WYVA 4D6XA 5CDYA 5DT9A 3L4SO 3QTTA 4WCDA 1YTUA 1XAJA 5EJGA 6AT1A 1ZJ4A 5JJCA 4ND7A 1G6Q1 4Z4EA 1MEOA 3F5DA 1K5DA 2ZI3A 4GI3A 4XJSA 3KZXA 1Z4KA 2BL4A 5CM9C 5A2GA 1THMA 2Y1LA 1O94A 4JFRA 3A6EA 5HYVA 4YX9A 1PRYA 1ODFA 5C5DA 3WA7A 1JV2B 2O3QA 3QPBA 3SZUA 3HDGA 4EHKA 4DZTA 2VRCD 1K3FA 1TQ6A 2ZE5A 3NTRA 1II0A 3DBIA 3OJLA 3WDSA 4FB4A 2BHSA 2BF4A 1KORA 5F33A 1SBCA 5AP9A 3I6YA 4AMBA 2Q5JA 3CNQS 1M6NA 1OTXA 4KMMA 3UK7A 1XP5A 1FP4B 3B7GA 4UTXA 3PC7A 3CEAA 1HNZB 4BAZA 4ODIA 4CLEA 6YASA 4LRYA 1YQGA 5CFPA 1MENA 3EPJA 1JJ7A 3CXRA 2EIHA 2O7SA 2AH5A 1VCIA 2FA9A 5L95A 2B4TO 3ZGLA 3V8EA 4Y2SA 3DQQA 4E03A 4ZVOA 5H1YA 3EYAA 4ZAYA 2PU5A 3EODA 2GUGA 3ET5A 3PGJA 2FWAA 1O5IA 1QH9A 1A4UA 4X1YB 4ARZB 2ASEA 3GEIA 4URZR 1THTA 2CLHB 4S1VA 1D03A 3HV0A 3Q9LA 3ZBUA 1Z18A 1IMJA 1HL7A 1XX6A 3G5MA 4BNMA 2WB2A 4RUKA 3VC3A 2PSEA 4Q93A 4M98A 1KAMA 4YMVA 3HKCA 4DG8A 2JZOA 2UAGA 4C7XA 4QODA 3NTUA 2M9MA 4M38A 3ZHBA 3DAPA 4YAGA 5I6DA 1NFQA 1QNFA 1VE1A 1XF9A 4IFEA 4MO2A 5L3ZA 3GMSA 7REQB 2XIJA 4WCVA 5BW5A 1J06A 2FJ0A 2VPXA 3QOYA 4A2PA 2JJMA 4AUKA 3U4GA 1VMKA 4I9FA 1Z5WA 3TTSA 1IAQA 1JFFB 2FH5B 1K4MA 4P4LA 4K9DA 1XA0A 3WLRA 5CFQA 3FMVA 4EVIA 1GZ3A 4XWWA 3OU7A 1HOTA 1MDBA 4IQ8A 2HA0A 2MSLA 1DADA 4AULA 2A1TR 3DQZA 2OGWA 4PZUA 4U8GA 4YONB 4C5AA 4NABA 1KYIA 1Q50A 2I7DA 4ZT6A 4MS3A 4DUGD 1Q91A 4LOJA 4EP1A 2IBTA 2VTBA 4RQUA 3EEYA 2MINA 3UPTA 1GM5A 2X9VA 1NNI1 4P4SB 4PQFA 4WKPA 4ZQGA 5CT9A 3B3QA 1OJ7A 1PT6A 2AEJA 2QX6A 3AQ4A 4UVDA 4HXGA 4IX9A 4F4HA 4NCAA 1R50A 1VYUA 3THYB 1YQWA 1GOTA 5AIBA 2ES4A 1VOTA 3P0RA 1W9MA 3NM6B 3HP4A 1UBKS 2H2AA 1I5EA 3QKIA 4LHYA 4MV5A 4BZPA 4RTQA 2HR1A 1IONA 3HU3A 1N8KA 2A7QA 1UBEA 1UPUA 4QT4A 1I7DA 2GLXA 1N0WA 4ER6A 3EA5A 1XZLA 3FBWA 3O7MA 2XMSA 1CUBA 1KK3A 4C3UA 3PGA1 1PFVA 2NU6A 3GJYA 4CLOB 1UR5A 1VCHA 5EJAA 1UMDB 4AKTA 5L4NA 2B8TA 3AY6A 1SUBA 3UO8B 4XVUA 4ARUA 4DKJA 2BKLA 3GDFA 4V2IA 5JSHA 2FPPB 5ALUA 5CB8A 2C84A 2EXXA 3SWWA 3GNQA 2EBHX 1C5KA 4MV6A 4NPCA 3EZYA 3ISTA 1RQRA 2W90A 4M4SA 2CUZA 3I9JA 5FBZA 4YR9A 4DDVA 3AW8A 3FCSB 3O38A 2J4CA 2JCBA 3ND8A 4YT5A 4BXOA 3CUWA 4OQPA 4F6CA 1N9GB 4TMTA 1BDJA 2XQGA 3KOYA 4KYTA 1P9NA 2QQFA 3TPCA 1I3CA 3C8UA 1PK7A 4C0QC 1AQJA 1XNRB 1CF9A 1X80A 1S2OA 1M6VA 1DXQA 3C1AA 3OZRA 3NO4A 4OGWA 4DBLE 4ENQA 4ARVA 3UKOA 4BZQA 1EVLA 4Q66C 1GPMA 4QBIA 1MX3A 4X1OA 5JO9A 3NNNA 5ER9A 2BY4A 4DWVA 2D2XA 2OBNA 1Y6ZA 4B83A 3AZOA 1ZONA 4Q1AA 2ZBRA 2Q4RA 4FGWA 3TLBA 4H1WA 4JI7B 4LMPA 4R40A 2AUTA 2ID4A 2WE8A 3GWZA 3RKUA 3A70A 1N57A 5FUXA 2CYCA 5FX2A 3A7DA 4DIMA 2CEKA 1KTVA 3KUKA 2CW5A 2PKWA 5G3ZA 4J1SA 4ZCMA 1HDRA 2LCFA 1X9GA 3OTGA 1VG9B 3QU4A 1FUEA 3FWPA 1IUKA 3GH3A 3OTQA 2Z2YA 4CKBB 3AV3A 3PICA 1PZEA 1P4JA 4LEIA 4Y6QA 5FDFA 1KQOA 5KC8A 3R9KA 1IBMB 5KSPA 2WJJA 4YRSA 3I3SR 2GPBA 2E49A 2ZJ1A 3DM9B 3IE0A 2A5JA 1HQCA 3DV9A 4CMEC 1K7SN 2C2BA 4ZVNA 3HO1A 1F8FA 1LSJA 4WXPA 1N2EA 2WHPB 2O8NA 2ZSJA 3MMSA 4AKHA 4CETA 5EIWA 1RP7A 1KC3A 3B6JA 4RKFA 1K5HA 5B12A 4G5SA 2EF0A 5B1YA 1Y6JA 5FV4A 2XQVA 4RSGA 5LKRA 1IWPB 3PUKA 3UXHA 2Q6KA 5FBQB 1HKHA 1VLLA 2XZLA 4FIDA 1LPPA 1JS1X 4RVOA 1UBJS 2AN9A 2C2ZA 2BEUB 2G5PA 1TEZA 3TL2A 2Q9AA 1FDIA 4HKTA 3JR7A 3B6ZA 3QFSA 4K03A 3WTBA 1H8ED 5FLYA 3O1JC 2CLCX 2QLLA 5IZCC 4JJFA 4EJSA 3O8LA 3RSCA 1R0XA 4FKBA 2GWHA 2YTZA 4YDHB 5GOZA 4IWNA 4EFKA 1ZQ9A 4MICA 4K9QA 4K9SA 5EYPB 4A6PA 5FWAA 1RYBA 1VLQA 3V32A 3CUUA 1SVNA 4PZ9A 2J5RA 5DHUA 1IHYA 3KXDA 4Y6OA 3DLTA 2MHCA 2P7HA 4I4CA 4KQWA 3I2JA 3LMKA 3CQ9A 2HYDA 1CY0A 4NBWA 4EHIA 4DMRA 3NHAA 3IOYA 2D6FA 3E9RA 3GT7A 1K8QA 3INGA 3VO8A 3H5RA 1A88A 4LVNA 5CURA 2X0RA 4AP6A 5TLSA 3AF6A 3JALA 1GPKA 3UM9A 1XZBA 4P93A 1P91A 1E18A 1Y5LA 4D1YA 3ACBA 2P40A 4U0JA 5HIKA 1NBMD 2IYLD 3EGXA 1EKXA 3FJ1A 1MIHA 3AI7A 4R98A 3OKPA 3B3AA 4H59A 1WABA 5KHOC 2BM8A 4UM8B 1MRNA 2JLQA 2GPJA 2CDNA 4AFNA 1W5FA 1AB5A 1WG8A 4R6WA 1XVTA 2VLIA 4BJ3A 1DEKA 4MINA 1IBRA 1V45E 4CM4A 4DARA 2NSLA 1JSLA 3E4CA 4KE9A 4WJKB 1NIJA 3A2KA 3THOA 4CTKA 3N6RA 3AHEA 4RETA 3PNMA 1SWVA 2OYCA 1CZOA 1A5AB 1C1DB 2OP0A 3LO5A 1W0KD 1N1GA 1L5HA 1ZK3A 4RIHA 1B0UA 2ACKA 1LU9A 2JLRA 5GIOE 2VQEB 4X20A 5CB4A 4OXKA 3V7FA 3DOIA 5BQXA 1NW4A 2OLJA 1YDGA 5K3CA 4BGIA 1I2BA 4W63A 3PFGA 4UEQA 3EBOA 4YRKA 5BWMA 4LXQA 5CB4F 3ZJTA 4EY4A 2O19A 4NE2A 3KB6A 4CUZA 5TMEA 3F8WA 3IVCA 3JASA 821PA 1CYDA 3P0FA 4H15A 1YUBA 3UJHA 1E2FA 2X58A 3GOQA 4Q18A 1V8DA 5K3EA 5JAPA 4M60A 3PE3A 3DE2X 1Q7TA 4M0DA 1O96A 2C8KA 1V5GA 2FUG6 4R8MA 4BNGA 2Z83A 2CLKB 2QQGA 2V7BA 2WJAA 1Z0ZA 1PGPA 4R8RA 3ZW8A 3HCDA 5DNUA 2P5UA 4RDXA 2D1SA 1OJLA 4BQOA 5KCZA 4MXDA 4RS3A 2HF2A 3ZE6A 3HVRA 3C3WA 1XEWX 2NPIA 1AIPA 3ME5A 4OBEA 3D8TA 2RHOA 4RW0A 5G4LA 3WADA 2O48X 4KFRA 3OQOA 1W36C 5ITZB 1OI4A 2XBLA 3PGVA 2C7VA 1SU6A 1NW3A 1Q1ZA 4LJ7A 3LL7A 3AYZB 1DVRA 2RAUA 3N9IA 4M0PA 3DC2A 4Y30A 1E9DA 1KP2A 4ZGGA 1RT9A 2DT8A 3QK7A 4BLUA 1DL5A 1YFJA 3FIJA 2IFTA 3NJ8A 4ASUD 2D5BA 2GX6A 1ZH8A 1FS6A 1OX4A 2FK8A 3H84A 4P98A 3IJ5A 4REMA 4GLBA 3N2GB 3RSOA 3VR4A 4MA0A 2XGOA 3AMVA 2YOGA 1C8BA 2ZAGA 3ZV4A 2ORIA 2ZJBA 4LHEA 4P2BA 4DLRA 4CMCA 5FI5A 3VKVA 2EERA 5DM0A 3QMPA 3WMWA 2B5OA 1HE3A 1M76A 3VI3B 1T8PA 1POWA 1NSYA 1ST2A 3QELB 3R9WA 1WMBA 4RMNA 4P92A 5AVUA 4FE7A 3EB9A 1Z5ZA 2IUSA 3WSVA 1FXSA 1V48A 3ORRA 1C14A 2PMKA 2FWRA 4YFVA 1TA4A 3RU7A 1S96A 4AQDA 4CKZA 2CC2A 5LL6P 3EDYA 1B3RA 1Q1GA 2BJVA 2NU9A 1L6RA 2O7QA 3A32A 3CNNA 3K2BA 3UY4A 2IOHA 1EWKA 4A8TA 3B82A 4JMPA 4E6PA 3RC8A 3TXYA 3M81A 1WF3A 3KVRA 3Q85A 2JCVA 3R0IA 1ISPA 5TQ2A 3AL0C 4U9IS 3WC4A 4YXWD 4O63O 2IYPA 5K2OA 4MX8A 1A2OA 1E2NA 4KEAA 2ZETA 3DBRB 2J0UA 1FDVA 4A6XA 1DDOA 3T9AA 3QVTA 4WFKA 2FPGA 5FWYB 4KWEA 4LW8A 1I5RA 2DWQA 1C9JA 1JH9A 3GXBA 3ON5A 3D2CA 4AM8A 5KNDA 2A9VA 4C2UA 3W6PA 1N8NA 1ADBA 5FI3A 2PZBA 5TT0A 4KLRA 5BNZA 3R7NA 4FILA 5KU7A 4QG7A 1ZH4A 2ODWA 3HLTA 1JZSA 1RZVA 4GEGA 4ZOLA 1H1TA 1O94C 1RAGA 4PLWA 2C77A 2PK3A 3BHIA 3ZE7A 3R7WA 3V8BA 1U3WA 3GLVA 4PPGA 1H4QA 4B6QA 2AZMA 3VMMA 4E11A 1SVSA 3WV5A 3KV1A 1R5BA 3TGLA 5C52B 5DEIA 1KJJA 4GE0A 3MT9A 4X61A 3BJEA 1JHRA 1NLMA 3PUVA 3GLFB 4D02A 1Z39A 3LI2A 4KX5A 2WD9A 2O5EA 5D5HA 4DGSA 1ZIOA 3R1IA 4NBUA 4F60A 2IPMA 4CKCB 5LQCA 4JI5B 4M7PA 4KREA 4CM7A 5BN3A 1ISGA 3C3XA 5LM3A 3FJOA 1IPHA 4ZI7F 2JHPA 2OHOA 3QM1A 4N7BA 3WGLA 3EPRA 4HNAB 1B7GO 1UMDA 1YZTA 2V5AA 1EBFA 1EINA 1S2MA 3GFFA 1EJ0A 4QDXA 4GC5A 1NUTA 4BVLA 5BQOA 2FSPA 3C74A 5K0ZA 1PX0A 2GJ4A 2XDWA 2YVKA 3DL4A 3K4PA 3FFBA 4HDSA 1NY5A 3JVEA 4S2UA 3TDNA 2PAFA 4G84A 1ZA2A 1V95A 1QYXA 4Q7KA 3DEHA 2CVQA 3OKAA 4HWSA 3JVVA 1T0JB 1SUWA 2HHJA 4L8FA 1LWNA 3VSEA 5JS7A 1X0XA 1YB7A 5HUQA 2D8AA 4A6EA 1FF9A 5A6SA 1JQKA 2IGBA 1J8DA 4OF4A 1ZBQA 4BX2A 2IHBA 2YN2A 2H5LA 3DD1A 5J59A 1ZLXA 1NQ5A 1MZPA 5EQFA 5I8ZA 1E9AA 1GQOA 3HWSA 3JZDA 2HK7A 3LXXA 3VR5A 4UFPA 3AUJB 4QJ5A 5HX7A 4BU1A 4IDCA 4LF7B 3AIIA 4WLOA 4WESA 3H1EA 4IDDA 4DJDC 4R5MA 2AX4A 2DERA 2ZJ2A 3FBGA 2QROA 2E82A 3PGKA 3DA8A 3JQ8A 4JP3A 1VL6A 4NU8X 1GRCA 1P7WA 2Y68A 3I8XA 3WAJA 1JDBC 4IXTA 5AVOA 4B44A 3ZOKA 1S7CA 2V8BA 4BN4A 2QYOA 3KS9A 1H3EA 4FDMA 3MBOA 2FWMX 4HS4A 1KDRA 1TXGA 4N3BA 3B6MA 5DF1A 5D3KA 4TLEA 3TZKA 5DHSA 5BQ3A 2F8MA 1YA6A 1AY0A 1LW6E 4YAFA 3DLBA 4WT7A 1RQXA 1TTQB 1ZGBA 2GCPA 2V0CA 2XDQA 3JV7A 3AUTA 2BC9A 1IRXA 2FSGA 2GESA 3NDJA 3QVJA 3AHHA 4CL8A 4GDFA 4WFQA 1KSGA 1MC1A 3T3MB 3CR7A 5K05A 2GUWA 2W37A 1UT6A 4Q1FA 4ZA2A 3SZOA 3F6YA 2IU4A 4INPA 3SDBA 1BJKA 1NBEA 4KXYA 4I66A 5CIYA 3WL3A 3WXMA 4W5NA 1JG6A 6ADHA 3D7KA 4JOSA 3E8SA 3D3EA 4INOA 2R5FA 1BG6A 4YMHA 5JMOA 4ZYVA 1LV7A 1T9GS 2OZLA 2V3CC 2CT8A 2C7PA 2PLNA 2EG9A 4FZRA 5K3BA 1DIGA 1PSWA 2NO0A 2QR2A 2R6GA 5C1PA 3OHPA 1QPGA 5B1DA 3TCKA 2IOYA 3B9QA 3N59A 3L0IB 4LYHA 3C1UA 5EESA 3UMGA 2PGAA 3D4IA 1KF0A 2H4YA 1NNEA 2IH4A 2NMVA 1C3EA 2LNDA 3GEGA 2RKBA 5LQDA 3UXMA 1U99A 5GJWC 3NU1A 2H2DA 4LVUA 1CS0B 2HRQA 2BJHA 1M2JA 3BL8A 2Q41A 4MS4A 3TMKA 2DGDA 4JT2A 4L1KA 1LRKA 5DXAA 3RTEA 3SYTA 4P34A 3L04A 2GO7A 5SYAA 1N4AA 1M2NA 3FR7A 3JTEA 4L5IA 3OQMA 2BF7A 3C3YA 3W3AH 2BUAA 4CGYA 1XAHA 1ZVMA 3FZYA 3IUYA 4HWGA 3V1YA 3H1BA 2IE0A 4U3JA 3CX4A 1GNPA 2ZI5A 2JJ8A 3KKOA 1Y5IA 3BE5A 4DG5A 1DAIA 1HE4A 2VBGA 4E1AA 3T6KA 5BNIA 2PH3A 2YR0A 3CWCA 4JELA 2QHXA 4OQNA 3HCOA 1K7EB 2P8JA 2W6IA 2WUFA 4UXHA 5G0UA 3SR3A 3CV3A 3E22A 4OHKA 1UBHS 1W6UA 2E7ZA 4EGAA 3MXOA 2Q2NA 3MYRA 3Q3HA 1BIFA 1VHWA 3D6FA 3NKFA 4FEEA 1XDZA 1AS0A 2P35A 3L8CA 3CVVA 4CMIA 3PQCA 4KU4A 3FOAA 2XA1A 1T10A 3W5JA 2PMWB 2X23A 3H75A 4NKRA 4D3DA 4JLSA 1JILA 1U90A 3KC2A 3HSSA 3G89A 4WNAB 4X7RA 2NYUA 3U4QB 1NTRA 3HGQA 2ROQA 1E9BA 3JAKB 5EJ9A 3OT4A 4HNRA 2GBLA 1N6RA 1M10A 2BTEA 2YOHA 3EMKA 1GCIA 1SBZA 2WYOA 2V6IA 3E3LA 1RRKA 2H29A 2E2WA 3M83A 4QAJA 4GZLA 1JXAA 2I0FA 2XWSA 1UBCA 2A0FA 3GZNB 4R8SA 3QE3A 5IKEA 5J58A 1HTBA 1C7EA 3GU3A 1E2EA 3LHKA 3WAKA 4JI0B 4IEFB 3MD0A 2I62A 721PA 4EY5A 4Z4FA 1AKYA 3N58A 2N9UA 3QFRA 4RTOA 2B34A 4CTMA 4XR4A 4UM9D 1EDOA 2YWDA 3GJ6A 4JUAA 2FMIA 5F1YA 4DNFA 3VKHA 3FDZA 2BKVA 1TPZA 1TTPB 3UWDA 4H1TA 1KQGA 3OEHA 1Z47A 4RULA 1KJQA 1YIOA 2WWVD 4JL8A 1YMUA 3GLRA 3YASA 1HLFA 1HKUA 5KJEA 2C5SA 2QN7A 4TMZA 1C81A 5ALIA 3BJIC 5H70A 1A7UA 2PWYA 3JU3A 1TK2A 5EUQB 3W5SA 1EJ2A 5EC8A 1L5ZA 1LBEA 5E6SB 2PGXA 3NXSA 1ZM2A 2XTJA 5J5CA 1ISMA 1E8MA 2MCFA 4JI6B 3EXIA 1UFQA 2EZTA 3BERA 4CNBA 3BF8A 4LIPD 5BVGA 1NMQA 1U31A 3OKFA 2OYSA 2I22A 4GS5A 2X0EA 3DUFA 4C08A 1NONA 1J97A 4MVJM 1NVGA 1VGQA 2MSDB 3U9TA 5AJUA 1V7CA 5TR9A 1P9LA 1KEZA 2CL7X 4XPIA 1IBKB 2FLKA 1OX4B 1NYQA 2ZAYA 2ZRMA 4PC6A 3K20A 4ZEMA 1ZNYA 5T8KA 2WSMA 4D3SA 1JFTA 3QG1A 1X1CA 1R37A 5D5QA 2VYVA 3K71B 2DPHA 3UG6A 5LLTA 2VHZA 3KZKA 3MJSA 3G8AA 4MW2A 2C1EA 5KDDA 3E5MA 2I2WA 3DFMA 5LMNB 2P2YA 4BQQA 1L1FA 4C6TB 4HP8A 4A2WA 2X8LA 3L6UA 2CZGA 4AN0A 4HVCA 4QJ3A 5JECA 1TFUA 4PLPA 1GILA 2Q2OA 4PN7A 4ZQCB 2VUTA 3SOPA 1E62A 1KI7A 2I5PO 3WYCA 1JG7A 2XWBF 3ETNA 4GX5A 1AO0A 1C80A 3AH8A 2WM9B 3LQ1A 2BUCA 1T9GR 1UC5B 1GQSA 2OAGA 4GYJA 4BFWA 4A36A 2ZYTX 2IHJA 1HF3A 5ESWA 1SG0A 2G1PA 4RJLA 1WQ4A 3ZWXA 1X86B 2WV7A 1CUGA 1DRJA 1UDXA 1V11B 3E82A 2YYSA 1VKJA 3GF4A 1G59A 4MVXA 4US0R 2VDOB 4P3KA 4PXYA 2OV3A 4BMNA 1FDRA 1RABA 3ROZA 5HZHA 5DULA 2XGGA 1BSVA 4JJIA 1USKA 3DDNA 4S04A 3L4KA 4MUIA 1SBIA 4IUBS 2YXPX 1TKAA 4S1OA 3QIAA 1MQ9A 3WHKA 3SC6A 3O31A 2WTAA 4MMYB 2KJQA 5BSRA 5JWOA 4QWWA 2BHNA 3K0FB 1Y1KE 4QQRA 4DNQA 4Y6RA 5EP3A 3SGLA 4C4AA 3T7RA 1V26A 3IL2A 3BZBA 1RXSA 2JK1A 6CHYA 1JG3A 3REFA 4EVRA 5JCZA 2DQYA 4GX0A 4NZYA 3EZNA 2KE5A 2OHFA 3D3KA 4KQEA 3UUGA 5DM70 3UAOA 4RA9A 1J2YA 3O82A 3F6BX 3QWAA 4WZAE 4AVYA 3KG2A 4PSCA 1Z4PX 2QT0A 3IUSA 3WMRA 3N8NA 2C59A 2RGAA 5A0TA 3N2NA 1RLIA 2QX9A 3UICA 2IEIA 1F3LA 1N1MA 1YBAA 2H2FA 3M1IA 4H6PA 1Z7WA 1XKTA 3CHYA 4AT1A 1E60A 1BYIA 1UDWA 5JFOA 4NIMA 2IRWA 2DH6A 2O8FB 2W6QA 1BW9A 1ZVVA 5EJ4A 4R81A 1Z0KA 3OEHD 4LNUA 2GBFA 2F2TA 4UTOA 4GBGA 3O5AA 1QS0B 3FVWA 4M9RA 1J90A 3D8BA 3SI7A 2IOFK 4Z3DA 3MJ4A 4Q4AA 1F2TB 3WK5A 4ZT5A 3QVGB 3KDAA 1GNQA 5E8JA 1T2FA 1AV6A 1VSUA 2YMLA 4X7PA 2JIMA 5BNWA 2J31A 3N0RA 5C5CA 1YZUA 4Y2VA 5IDQA 1PTJA 4FBMA 1WV1A 2V65A 3TVYA 4IGEA 2GHRA 4GLFA 1CY2A 3BRSA 4GZMA 4TXHA 2O5CA 1R4NB 4LXIA 2YC2C 1OI3A 2EL7A 3FMPB 1YBVA 2A9FA 4KE7A 1IL0A 3CO5A 5FWXB 2VQSA 4ZU3A 2CHFA 1FTQA 4QZVA 3VC2A 1A2BA 1DDGA 1WVIA 2XR1A 2FSSA 3ZCXA 4PHCA 1LI5A 2Q5EA 4KP7A 3NUQA 4DLNA 2W7TA 4IIDA 5LJIA 5SYMA 1GRRA 1YXMA 2OL4A 3MT7A 4H6VA 2RI0A 3NVMB 5CUQA 3T7EA 1BQ4A 3DPIA 4RA9B 4KQ6A 4NJMB 3PBKA 2R6AA 2RBEA 4OJQA 1ZUNB 2QYSA 4MIYA 3DUWA 4D2IA 2A35A 2NU7B 3D4OA 4O1HA 3KDPA 4PLTA 1UWKA 3F6SA 4TVOA 2EC5A 5GPBA 5HG0A 4A15A 3WMGA 3DOFA 2FKNA 4DV3B 4MR7A 4CZ2A 4AQ7A 4LDAA 3WGUA 1JIXA 3SJZA 2PS0A 3ZK9A 2ODBA 4P2GA 4J7CA 1CJBA 4D9FA 2IS2A 2SBTA 3PNLA 4GHWA 4JB0A 1ZGAA 4P08A 4QJBA 2OQVA 3QE2A 3ZX5A 4PAQA 4CV1A 2X2OA 3VH4A 2ZZNA 4R8VA 3BB1A 4IYRA 4JQCA 4BS9A 1YS1X 3R3YA 4B6JA 1IEVA 3GJRA 3TO5A 2LZ0A 1JTEA 5FJIA 4YC7A 5T67A 3E7PA 1XZIA 4BNVA 3OC6A 2RHGB 2XTMA 4IOJA 2JKZA 1TQDA 4CWAA 5KKCA 1QHYA 1XYGA 4OXQA 1WXQA 4DWWA 1H2AS 2W98A 1ABEA 2CNWD 2WQZA 4JEIA 5E6RA 4KXNA 2NPOA 1RAEA 2VHEA 4MQMA 3UPDA 3O94A 3WLHA 5HF9A 1LVUA 4R1MA 5E3JA 2O8CB 1NIPA 1XCPA 3K05A 4MRMB 2OO5A 1XROA 3HY6A 4P0QB 4JL6A 3AX6A 3PGMA 3ZEIA 1P7PA 5HRAA 1E2UA 4OYRA 2QS9A 1VYTA 1ZJYA 3EFHA 4OK6A 4D4HA 3W5AA 4L02A 4MROA 2V3WA 1W87A 2XJ9A 2IYUA 3HACA 3PEVA 1YHNA 4QTXA 1OYOA 4L8VA 3T3OA 1IBCA 3EWSA 3GRRA 1LVGA 1KVSA 1YR6A 1NQAO 2FF7A 4G1FA 2OQ2A 5IYZF 5ALVA 1ID8A 5I7AA 4XEHA 3UTDA 2ZWAA 4QRHA 1P39A 3I9MA 5EE1A 1MHTA 3L1KA 4KSYA 4G0YA 2W93A 1S3FA 5DSXA 3PXBA 2XKAA 5EJIA 3WQBA 5TDHA 1NE2A 1II8A 3K9BA 3CZAA 3ED5A 2JFQA 5JE8A 2WHYA 3FDXA 3OURA 1J2UA 2XQIA 2HLDA 1FQWA 4ND5A 2HLHA 1EFLA 1M3SA 1ZW1A 3THWB 4U7DA 1MX5A 2X7HA 3CZ4A 4NULA 3ER8A 3CLSD 4F3NA 1BFUA 2ZANA 2I7TA 2GM3A 3OZGA 3TLZA 1LQ2A 1BU5A 5D00A 1C9YA 2DMRA 5GZ3A 3NVAA 4NCKA 4JLBA 5A4MS 2EJUA 2XNDD 4I7EA 2VSFA 1P5FA 1NVFA 3F5QA 3FLBA 1C1XA 1T2EA 1PNOA 4QT0A 2PUEA 4GR4A 4TWAA 1JEQB 4UXIA 4MMXB 3RUFA 2QQ5A 1YB2A 1X2BA 3FFAA 2BEJA 1SD5A 4X6YA 2FYTA 1SUIA 3BXZA 3LFTA 4MVCA 5DNAA 4BBZA 2WPDD 1P1IA 1DCTA 2FFAA 4YQFA 2B8EA 1A69A 1ULHA 2H08A 2ISSD 1Z5PA 4HWTA 4P32A 4DCCA 1U2ZA 3FF4A 4ZQEA 5EKUA 3JRWA 4CFZA 1C9NA 1U2PA 1PZMA 1V0JA 1ESNA 1JYSA 3H1TA 3G68A 4MUEA 5KNBA 3IUPA 1EGVB 4YCAA 1SO8A 4BJ6A 5EIHA 1V25A 5LD2B 1GG8A 3AEKB 4U2FA 4BHTA 3FYDA 3AVUA 1IOVA 3FG9A 5FT9A 2CKDA 5DKFA 1PKEA 3SKYA 4D46A 1R6UA 4L0CA 2IXBA 4L2IA 3AUFA 4D26A 4V0ME 4RQTA 4YPVA 3DMFA 1KXJA 2O8VA 3P9KA 4EHFA 5K3OA 5DLEA 3NT4A 1M5TA 4FN4A 3M2PA 3JQAD 2VWQA 5AM2A 2VAWA 3VVCA 2R0QC 5IAOA 4WZBA 2BFFA 5CA1A 5KTNA 3H1GA 2QM3A 4MVYA 1XO1A 4UJ5A 2YL2A 1XJWA 5HFAA 5KQSA 1VSBA 2IP1A 4NBLA 5JZ9A 4NJOA 1VA4A 3ZWNA 3CPHA 4R1PA 3TI9A 1ZZEA 1VI2A 4MJ3A 1GZUA 2OZKA 221PA 3A3NA 4MQEA 1I7MB 5YASA 5AI4A 1AQYA 1GLNA 3GHHA 4WECA 3FCYA 2F3RA 1AE1A 1N6PA 4PZ0A 4RNCA 4UVEA 4GKVA 2REQA 2QB5A 5C8YF 2GZSA 3IP1A 4LDJA 5IUKC 5JZVA 1PTJC 3SQOA 2I7CA 3ZDZB 4TYNA 4LTNA 4YYZA 3VNBA 5KJFA 1DLJA 4JS0A 5BMVF 1OPRA 3J80A 1ZK1A 1SVMA 1RMYA 3KX2A 2IYVA 2KYRA 3RVQA 3ZU2A 5BYKA 2A88A 3PWSA 1IOZA 1T5OA 1YS4A 2ZQZA 3EGXB 4U39A 4ZQHA 4DADA 4F9TA 4DR3B 3EVNA 4YJFA 2O52A 3CH7A 1T1GA 2CXNA 3U3ZA 5KYTA 5I7HA 2ATXA 3I04A 3K2IA 1G2IA 1JXMA 3WIBA 2EKBA 2HJHA 2YZ7A 3KSUA 5K03A 1P4AA 2HPVA 2PGNA 2UUPA 3ZU5A 1EUDA 2O50A 2W2LD 3D0QA 5CK5A 3ZNOA 3CLRD 3DZKA 4J91A 3WWCA 1GEGA 2FR8C 2AOTB 4B6GA 5BP7A 2PWBA 2VRWA 5FULA 2D5LA 4HX5A 4MHOA 1L8XA 3QOFA 2HXGA 5E2AA 4I19A 1NVWQ 1IB0A 2VNIA 3BFVA 3G9UA 4IXWA 3TB6A 3IQWA 4IV0A 2HZBA 3P8ZA 4N0PA 2Z2XA 1KHTA 2JFOA 5B1IA 1ZNWA 1QFYA 3TR0A 3AL3A 4B31A 3KJZA 2DP4E 2V7TA 4XGNA 2HUNA 2P5SA 4KLAA 2WFAA 1RI1A 3C8HA 5HJ7A 4ZVVA 4LSMA 2GNPA 3GPBA 1U1CA 3PITA 4AX8A 2CCGA 5ABPA 2F6RA 4UEWA 4ZP1A 3OY2A 2H85A 5LQAA 1RADA 2GOYA 2PX4A 2BT4A 2R6R1 4M37A 1G1AA 1TZCA 4WD3A 4X93A 4ND8A 1FVFA 4F5WA 3RJ9A 2PXXA 3FUUA 5K45A 3PFHA 3HCAA 1U0JA 4K9KA 5TRTA 2Y1CA 3F78A 3PGXA 1A9XA 1I24A 3RRJA 5KPDA 1RLOA 4WKBA 2DPXA 1I7CB 2J0VA 1FJGB 4D8XA 2H4XA 3HV2A 3IOBA 2JGAA 3ZGZA 2CMGA 4GE3A 1E6WA 1VPTA 1XGKA 1PEDA 3N75A 3UWSA 3P26A 1S3SA 2OWEA 3UWKA 2VNHA 1ONSA 1LRLA 2ENUA 1UBFA 3UMMA 1QK5A 2XUHA 1A3CA 2ZP1A 3DZFA 3P1JA 4M22A 4RSHA 2W2KB 5B58C 2IDJA 2OA0A 3IQGX 5DYTA 3UHOA 2EW1A 3DXXA 3H2SA 3LWDA 2YQ5A 3SG0A 4QVKA 4D92A 1CLEA 2B1QA 3D54D 4UAVA 1L7EA 2RAFA 4AICA 1KI1A 3C4JA 3ZIAD 3QHAA 4BX8A 3Q8WA 2DXIA 2G5CA 3TCXB 2G67A 4QTYA 2IPNA 4TSRA 4B79A 2FOIA 2P4SA 4OBWA 4QU8A 1S2NA 4P6VF 2MJLA 2R48A 2H2WA 1JU4A 3X1YA 4KRFA 3UKJA 4XA8A 2IV2X 2X6TA 3CKLA 5CFOA 3VYUB 1DNPA 3H2GA 3JAKA 3DB2A 1FTNA 2DKFA 1KI6B 4GKAA 1H2YA 2ZAIA 4KODA 2BCGY 4TN1A