2R00C

Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
336
structure length
335
Chain Sequence
SQQFNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNIIANPNSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYPAETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIELFRGADFPTQVRDAGGKDHVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELLVRDYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a redundant enzyme: a second isoform of aspartate beta-semialdehyde dehydrogenase in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 120
structure length 335
sequence length 336
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
C PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2r00C02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2r00C01
4CMJA 4B4WA 4DIFA 5ES3A 4XJSA 3DTYA 1HDOA 1C0KA 3NTOA 2IXAA 3A28A 3C3XA 5JDIC 3DBLA 2LDXA 4CQLA 1PZFA 3WWYA 2NTVA 4FFOA 3H6KA 4ND4A 4A2CA 4LCJA 1ENOA 3D5TA 1PGNA 3K30A 3BHJA 1IUKA 3JQAD 4Y6PA 4JX8A 5HM8A 2P4QA 1GYPA 3QJ5A 1KOLA 2Y1DA 1I10A 2Q99A 3SJUA 3GEDA 4IQ8A 2CFCA 1I3KA 3D3WA 4A0SA 2PZJA 2EV9A 4IM7A 3M2PA 3NDRA 4M89A 4PIVA 1WAMA 3PXXA 2O23A 1S7CA 1YL5A 4E4YA 4JBIA 3GEGA 4R69A 2ZATA 2CVQA 3IKVA 1I3NA 1Z82A 1R4MB 1IHXA 1UP7A 3B1KA 5TIIA 3RUIA 4OM8A 2NU6A 4WCFA 3PDJA 4OAQA 5BNFA 1NPTO 3CSDA 4A5OA 1VKNA 1UZLA 1Z75A 4O5OA 3UFXA 4UVEA 2YHIA 3M2TA 1CERA 4NU5A 4I5EA 1YL6A 1MX3A 2VRCA 4R01A 4PCVA 5L45A 3I9LA 2JHGA 3LC1O 4Q39A 2EJWA 2F00A 3CUKA 4CM9D 1W0CA 1PWXA 3L6OO 2FSSA 4NU6A 4B7UA 4HXYA 5IDQA 1E1KA 4ITUA 3NGLA 1HYGA 2HMTA 3JQFC 4Z9XA 1OOEA 4GWKA 2AW5A 3UF0A 4D3SA 1PGPA 4IINA 3FTNA 4E31A 4HFRA 3IDSA 4WEOA 4GX1A 3QIVA 2XF8A 1DLJA 4NFSA 3STHA 1A7AA 2DBVO 4JXKA 3AI3A 5H83A 1D1TA 2UAGA 4D45A 1EDOA 1K89A 1LX6A 4AJHA 4EDFA 2HRZA 5C5IA 2QYSA 5I8WA 2PZMA 3V8BA 3CMMA 5JPIA 1Y9EA 5C7OO 1C3VA 1NQ5A 3RUCA 1WW8A 1Z74A 1T4DA 1NP3A 3W4JA 1J6UA 3TSCA 1GADO 5L4SA 4DRYA 3GZNA 5HS4A 4WGGA 2EEZA 1IPEA 3DZKA 2PR2A 3LLSA 1HEUA 1NQTA 2CNBA 5TRTA 3S8MA 5CDUA 4WK6A 1BDMA 3F6YA 1VLLA 4PLWA 1V8BA 3W8EA 3RKRA 2NADA 3GRKA 3HB4X 3SLKA 3NTRA 5CEFA 3WYCA 3GNTA 3DAFA 3JCZA 5MDHA 1YWGO 1NPDA 4MIOA 5A06A 3UAGA 3M1AA 1ZNQO 4U8GA 4FSHA 4CM1A 1RJWA 3S2GA 2JJYA 5L4LA 3GFGA 1VL6A 1R4NA 3OIFA 4RGBA 5ILOA 4HKTA 4YAKA 4P8RA 4LSWA 2DUUA 2WYUA 1GZ6A 3KETA 3Q3CA 1C1DA 1U7TA 3KXDA 1H94A 3NT4A 2FN7A 1GV1A 2O3JA 2Y1EA 3H2ZA 5COBA 1HRDA 4OXKA 1RWBA 4UUMA 3UKOA 4BB5A 4Y6SA 3NV9A 2X23A 4IY1A 4CMHA 1P1RA 4YT8A 4FN4A 3EMKA 3HWRA 4BNZA 2J5KA 3EAGA 1E3EA 4U0JA 5FI3A 2A9FA 4I9UA 1ZMOA 3WGYA 3S55A 4MINA 3R3JA 1HYEA 4ALJA 3O03A 3M6IA 1YJQA 5CG1A 5JXWA 1MUUA 1QYXA 4W99A 5IZCC 1SCUA 2XXBA 2Y0CA 2PK3A 1N8KA 5FI5A 4MP6A 2PTGA 4BNFA 3RC2A 3RSHA 1E6EA 3LT0A 1IE3A 3VZPA 1HZZA 4YJDA 3AFMA 1PR9A 3JQGA 3PJFA 1FMCA 4BNTA 2D3TA 2HDHA 1NVGA 3FI9A 4CLXA 5G0WA 3RUHA 5KKCA 3RBZA 3KHUA 2OHXA 3VC7A 2FOIA 3DTTA 1LDBA 3K5PA 1EK6A 4IZIA 3ZWMA 4FFNA 1QORA 4WOKA 2VYVD 3WFIA 1C1DB 1KEPA 1SPXA 4PG5A 1GL3A 2P5YA 4ZJUA 4GKVA 4FIZA 1XEAA 5JDCC 5G0SA 3VTFA 5AXBA 4OOEA 3E9NA 4EJ6A 4GX5A 4F6CA 1QKIA 1E3WB 3RIHA 3R1IA 5A9TA 3ZWPA 5I9NA 2IXBA 3Q2KA 5KWEA 3TOZA 1Q2XA 4NH4A 4PGFA 2ZCVA 4R9SA 1KEUA 3EUWA 4FJ0A 1RM3A 3QWBA 3VHRA 3TJRA 1T24A 2EGHA 4URFA 3DFUA 3QVTA 4L76A 3AY3A 4HV4A 4E5MA 4Q3AA 3V2UA 4GAEA 3FBTA 4AVYA 2JHFA 4UREA 4MIEA 3DBRB 4ZQFA 2O2YA 5HS6A 1KS9A 4MVJE 4U0KA 2JD0A 3MJSA 2CUKA 3G17A 2OORA 3PWZA 2WEKA 4RF2A 3EDMA 1QP8A 4ND3A 3EC7A 1A4IA 3ETGA 4XQEA 3BMNA 4J43A 1YL7A 2V65A 1NVTA 3DEYX 4CQMD 5CFZA 2PKRA 4NJMA 3DC2A 5AQ1A 4CL8A 3SC6A 1IULA 1UR5A 1GQYA 2IZ0A 3B1FA 1GEGA 3WLEA 2GERA 3R3SA 1QMGA 3WMXA 4FJ1A 3F3SA 4NI5A 2FHSA 4DC0A 2Y0DA 4OSPA 3H9GA 3GY0A 2Q50A 2X22A 3QV1A 4YAIA 2RH4A 4DPKA 3KLMX 2Y0EA 4W6ZA 2E4AA 4N5LA 2PA3A 4BGIA 1P1HA 4MO2A 3WSWA 2EP5A 3SX2A 3ABIA 3ZW8A 1T2DA 4PLFA 1P1FA 5AXCA 4EI2A 1ULSA 4QFCA 1XU9A 3V1TC 4BO0A 2R6JA 2R2GA 2BFPA 2JD2A 3RQSA 4KWHA 1P77A 2W90A 1BXGB 4YAEA 4O63O 2IZZA 2UYYA 4MOWA 4J6FA 2J8ZA 1PWZA 3A9WA 5DDIP 3A4VA 4ALIA 2HU2A 1IOLA 1NTOA 1WZIA 2DBRA 5ADHA 4FOOA 4MVJG 3N74A 4NJOA 3ZNQA 1GPJA 4E32A 1Z7BA 1WZEA 1GYQA 3OBBA 4NJMB 1WVGA 4WPGA 4CV1A 5CDYA 3DHEA 3OJ0A 1DAPA 3IJPA 1WNTA 1LRKA 1P33A 2YHIB 3UCEA 4EJMA 4EZBA 2IODA 9LDTA 5ENVA 2AE1A 2C5AA 3VZSA 3RWBA 4CV2A 1DRVA 3HNPA 4MVJP 3AM4A 1F0YA 4OSOA 4LK3A 3TFOA 4G2NA 2ILTA 4ALKA 1T1SA 3E9MA 4HWKA 3U62A 2H63A 3ZU2A 4CMGA 4PVDA 1PIWA 2Y1OA 3HDQA 3HSKA 7ADHA 4DUPA 2HAEA 1E7SA 2YZ7A 3DZGA 4K1LA 3H9JA 4YT2A 3RI3A 2Q45A 3WIEA 4KUGA 3WTCA 2PZLA 5TJHA 2DM6A 3LF1A 5BSFA 5L7YA 1P31A 3FPLA 2P9CA 3LDHA 3LF2A 1L7EA 5GZ6A 3U9LA 5A5EA 1B16A 4S3MA 1YBVA 1N1EA 5A5FA 3BTOA 5BNIA 1KEWA 5I9LA 4EUFA 5H82A 1GYRA 1BRMA 1EZ4A 1NX6A 3ZZNA 1NFRA 2ZYDA 3OF2A 3ORFA 3CZMA 5CDGA 1C0LA 3SLGA 1VJTA 2ZYGA 4UAGA 4BGEA 2HMWA 4NDNE 4WEQA 4PRKA 1NWHA 1YDWA 3TL3A 1NFFA 2AG8A 5IJZA 3UVEA 2D2IA 3RROA 1EUZA 4XR4A 4E33A 5KOIA 4WASA 3ZI0A 4UUPA 3BMCB 1KC1A 4BNVA 1V0JA 3L07A 1ZEJA 1X15A 1VKOA 2NSDA 3EW7A 1RM5A 2VWQA 4I5GA 3Q1LA 1MFPA 3IOYA 4IJVA 1HLDA 2WSBA 4D3FA 3EZYA 2DTXA 4CMAA 3QRWA 1XIVA 2B5VA 2O4UX 5BSEA 1NM5A 3T7EA 1U3TA 4BNXA 3K9QO 1M2WA 3JQ7B 2NU7A 4FS3A 2Q1SA 3TN7A 3JYOA 1NAHA 4RF3A 4E2YA 3JQCA 5L53A 2IRWA 2QRKA 3OMLA 1ZBQA 2HUNA 5I7SA 3H9UA 4FR5A 2X0RA 2JCXA 1W73A 1U3VA 4RQUA 3MTJA 1ZSNA 1L7DA 4OIMA 5I7FA 3I9JA 1DSSG 3DZIA 4N5NA 1I36A 4XB1A 2EKPA 4EITA 2GO1A 3GVXA 3X2FA 3ROKA 1DHRA 4M49A 3WG9A 3L0DA 1CETA 2GN4A 4KDFA 4R5HA 3V2GA 4FD3A 5I9MA 3TZ6A 3ZHYA 4IBOA 4J3FA 5JCJD 2B4TO 2V6FA 4CM8B 1E1LA 7MDHA 2EWMA 1KYQA 3D3EA 1LSSA 1W4ZA 4IJUA 2D0IA 2G17A 2GN8A 2BHLA 2VQ3A 3DZHA 4H3VA 2DTDA 4BNWA 1NNUA 3ANLA 3CZRA 2VOEA 3FN4A 3P2OA 1BXGA 4YJHB 3CMCO 2QQ5A 3ICPA 5JDCA 3E82A 5KKAA 4CMEA 3VVBA 1R0LA 3IC5A 3ZV3A 3HN7A 1T26A 1EQ2A 1CYDA 1SOVA 4OGWA 1FJHA 3H2SA 2EXXA 4PLHA 4BO6A 5KTKA 2J3KA 1EE2A 3PI7A 1B8VA 1W6UA 1E7QA 2DU8A 1UDCA 4DIBA 4UUOA 4XR9A 2NQTA 4YWJA 3FF4A 4DWVA 4L9RA 5JY1A 4J1SA 1U8XX 1RM4A 3EHEA 3GHYA 3W6ZA 2I6TA 1LC3A 1OI7A 1KC3A 4DPLA 1MLDA 1PJ2A 1XR3A 4J2HA 1E5QA 3LSYA 1GV0A 1U2DA 4K28A 4NZ9A 1B26A 4A27A 3PVZA 4L4SA 2X0NA 4R54A 4PZCA 5F1PA 4DBVO 3COSA 3FSRA 4BNGA 1M6WA 3LT1A 1VJ1A 4OL9A 3DQPA 1CWUA 3WOHA 1GR0A 2EIHA 3F46A 4PLVA 1BSVA 3I5MA 4NK5A 3GNSA 2DFVA 3RVDA 5TGDA 5JBIA 5JC8A 1R4MA 4W9NC 1J5PA 4M1QA 5DN9A 1ONPA 1BTOA 3SJ7A 3U3XA 4BO2A 2DAPA 2H5LA 3TZQA 3E1KA 1QYWA 1YQDA 4OMUA 5GMOA 1QYVA 3JQ6A 4IXTA 4W7HA 2YV3A 4MIYA 4R68A 4I1IA 2OL4A 3PPIA 4IDAA 3PJEA 1ZH8A 1I5RA 3VZRA 1K6JA 4DLBA 3ZWVA 1BXZA 3BA1A 3LLVA 1KVUA 3HQ4O 2BH9A 3PRJA 1PZGA 4JP3A 4CQLB 1WMAA 3H4VA 4FCCA 4J1QA 2CF5A 2GZ1A 4Q3DA 1HF3A 3RU7A 4TVOA 3UN1A 3DOJA 1PQUA 4XZ3A 2UV8A 3CINA 3IP3A 3L77A 1D7OA 3UW3A 4JROA 1UJMA 4UVGA 1EMDA 4N7RA 1LSUA 4L73A 4ALMA 2Y93A 4HUJA 3EVTA 4CM4B 3VZQA 3PJGA 3GVPA 4GMFA 1XCBA 1P1JA 4JJIA 4CR7A 4DQUA 2O4CA 2WD7A 4R4JA 4TSKA 4CUKA 2Y1GA 1BWSA 4LGVA 4R5MA 3GF4A 1DBVO 3I9KA 3ROMA 3RUFA 4D0SA 1NVMB 4RV9A 1GCUA 2Z1NA 3HG7A 4D44A 2Q4BA 2QHXA 4GMGA 2VOJA 2VUTA 4WLUA 3S1LA 5G4KB 2EERA 5KVVA 4FFMA 3HZZA 4GLLA 4RO0A 1SB8A 1ISMA 1OC4A 3KYBA 3CE6A 2GGSA 4JP2A 1B15A 3MJCA 4EEZA 5T57A 3KVOA 3R0IA 2I3GA 3I4CA 4E30A 3ZHZA 4NBRA 1HE4A 1ZO8A 4P4NA 3OIGA 5DBFA 2BGMA 5DBGA 3TQHA 1MA0A 4S1VA 6ADHA 3G79A 5G0VA 4CL3A 5IDXA 4DPMA 1IB6A 3B20A 1T2CA 1UXJA 4UEKA 3RFTA 5HRUA 4LISA 4AJLA 2GDZA 5COQA 1R4NB 1XU7A 3DMTA 1R66A 2FPPA 2YV2A 2Y05A 3I83A 1RPNA 4II2A 3FPCA 3DHNA 2EJVA 2W2LD 3U4CA 3KV3O 3WJ7A 1E7YA 1CQJA 1X7HA 2AQIA 4W9NA 3F9IA 4J2OA 1QXSA 4XRRA 4XYBA 4AJOA 2OGUA 3GMSA 2VHXA 4ND1A 4WLVA 2AEJA 3TF5A 1NXQA 1P1IA 4IGFA 1E77A 1E3LA 3PWSA 3JQ8B 3DOCA 3OFSA 4HNGA 3PGXA 4HX5A 3C85A 2DC1A 4XYMA 2DKNA 3RBVA 2NM0A 3ETEA 4A26A 4HFMA 1YQXA 1PL6A 1N1GA 3FNGA 3PJDA 5A9SB 4L75A 3U09A 4IMPA 1ZXLA 3PYXA 3WX0A 2WWRA 1H2BA 2R00C 5F1KA 3ZWXA 3L4BC 3HE3A 1YJ8A 3VH4A 4WLEA 3RBXA 1JVBA 3AOEC 3TRIA 2ZQZA 2I67A 4YA6A 1V3VA 3DZBA 3RUDA 3LZ6A 3FTPA 1V9LA 2I5PO 3BMOB 3DBHA 3VPXA 5JFOA 5BR7A 4Y67A 3I52A 5G4LA 4YJGB 4BS9A 1HE3A 3AK4A 2C7VA 5EINA 3OSUA 3GC6A 2VYND 1FDVA 4EEXA 3Q9UA 3HFSA 2ZTLA 4E0BA 4FOSA 2WDZA 4BL5A 4IS3A 1O94A 3QWAA 1NYTA 1ZK2A 2FZEA 3GVHA 2XAAA 4B3JA 1U3WA 4WCFB 1I2ZA 5CAEA 2BI7A 2Z5LA 5IF3A 5L9AA 2ZK7A 4LRSB 5C7IO 3ANNA 2H9IA 3GH3A 3KTDA 1ARZA 1WDKA 4CUZA 1YB5A 3KLPX 4CQMA 5KNLA 3JQBC 3K6JA 3UH1A 4AICA 2OFPA 2HRBA 3S2IA 4A03A 1E6WA 1O8CA 1U4SA 4BKPA 4F46A 2GR9A 4YYZA 1HDGO 1T2EA 5TJ9A 5L95A 5B1YA 4J0EA 2C59A 1YBAA 5EJ2A 3DMYA 1GQ2A 1T2AA 1T1RA 1ENZA 4QXMA 2Y99A 2Q4EA 3OQ1A 4YR9A 3FD8A 1BG6A 4CLRA 1PEDA 4IMRA 3OHSX 1PS9A 4GGPA 4BNNA 1DFGA 4IDDA 1Q0HA 5JCXA 1Y8QB 3DZJA 1LRJA 1XDWA 3F5QA 5A3JA 2OOSA 2C2YA 2PGDA 3ZV4A 3WS7A 4P22A 3ST7A 4TQGA 1HDYA 3VPHA 5EPOA 3DHYA 5A02A 1R37A 4R1UA 2VHVA 1I3LA 1QSGA 3N58A 3AY6A 1PQWA 4HADA 2YHUA 2E48A 1ZUD1 1FDWA 1R16A 2ET6A 1UZMA 1F06A 4DA9A 1EVYA 1ZK0A 3DZFA 4ESOA 4NBWA 4UUNA 1YB4A 3NYWA 5B4TA 5IN5A 1Y8RB 4WOJA 2PFGA 2X9GA 2VYVA 3D7LA 2O3TA 1VRWA 3ZNNA 3WGZA 3IJRA 2PNFA 1IZ9A 2WE8A 4FGSA 1MV8A 3KYDB 5A9RA 1K2WA 3PDUA 4NK4A 2W2KB 2WTBA 4RJTA 1KY4A 4YQYA 3QWIA 4J7XA 3DOOA 3RFXA 3H5RA 3U49A 3E6AA 1MGOA 5T67A 3ASVA 3JYPA 1R0KA 1AGNA 5FEUA 1E3SA 3TZHA 4H7PA 3QVXA 5DOVA 2ZTVA 4E2WA 1U4OA 1PJSA 3QWHA 4D43A 1LEHA 3OETA 4RVUA 3E8XA 1O89A 1C0IA 3AY7A 1I24A 1BMDA 1HYHA 3F4LA 2W8ZA 2Q1TA 3AUAA 3FNFA 1QRRA 4OQZA 4P4GA 1DRWA 3PIDA 4FGWA 1YDEA 4QT0A 2IYPA 3VDRA 3HHPA 5THQA 4YCAA 1AXEA 4EUHA 2DTEA 4DGSA 3T4XA 5JW6A 3I9OA 1C1XA 1SOWA 4P38A 1B8PA 1J4AA 2EHDA 3H3JA 2A92A 4ALNA 3TFQA 5EMHA 3P2YA 3GAZA 1DC5A 2QIOA 1EVJA 4FQ8A 3WICA 2B36A 3JYNA 3L9XA 3KEOA 1N7GA 5IAAA 1VC2A 3BMQA 4Y8VA 2GLXA 3QQPA 3TZCA 4D0RA 2Q1UA 5DZSA 4J9VA 1K6XA 1NASA 3GGOA 1LTHR 2YFHA 1NR7A 5L51A 1KETA 4UVHA 4P4LA 3PHJA 1R15A 3D4NA 3PLRA 1QLJA 1IL0A 2G76A 4E2ZA 4J4TA 1IHYA 1ZJZA 2BMAA 3PWKA 4DMMA 5JYEA 2B4QA 4L4RA 3ZCXA 4BQRA 1GU7A 1LQUA 4ZRMA 3DAGA 3ANMA 2D1YA 5TT1A 1RM0A 3LU1A 4B8WA 3INGA 1D1SA 4MVJM 2WE7A 3JQAA 4RZHA 1X13A 2J3IA 3PZBA 1Y7TA 2C5EA 4XJTA 3WGGA 3GA0A 4J1NA 1H2HA 4U6SA 1J0XO 2Z95A 4QQRA 1OC2A 1QG6A 5JMPA 2AQ8A 1BXKA 2GPTA 2EG9A 3VH1A 4I9NA 2VHYA 5LDGA 5EESA 4WNCA 1M75A 2UDPA 4NMHA 4AL4A 3I9NA 2I76A 3KSUA 4J16A 5I8ZA 2C7GA 1P3DA 2A35A 4FC7A 1YH3A 1Z6ZA 4GWGA 4YBZA 5DF1A 3S2EA 1BVRA 1I2CA 4N54A 1CJCA 1CF2O 1D8AA 3EY4A 4KOAA 1KVSA 1CIVA 3ZWAA 4XGIA 2NNLD 4IDCA 2CVOA 2FY8A 1JU9A 4XB2A 4RDIA 1HDXA 3GUCA 5JO9A 1N92A 1Q0QA 3Q11A 2VRCD 4BHTA 2W98A 5MGBA 3NJ8A 4XEHA 4YXFA 4BKOA 4E5KA 2GASA 4B7CA 3OJFA 4RF5A 4ZA2A 2NUAA 2EW2A 1ZKMA 2UVDA 1E1NA 3MTGA 4BKQA 4CUJA 4DTIA 4J90A 3FWZA 1DO8A 4BKRA 1ADCA 2NWQA 3GG2A 3ZN2A 4W4TA 1TA4A 4ZN6A 2QRJA 2R00A 4B7XA 3MWEB 5CEEA 4AJPA 1V35A 3PLNA 3MJVA 3WWZA 3OJEA 5BSHA 4KTTE 3SBOA 4C4OA 3FR7A 5KJCA 1WDLA 2I65A 4GX2A 5TC4A 1IPFA 5JDIA 2Q2WA 3O26A 2ZJ0A 4I5DA 1ISGA 1GUYA 2PGJA 3X2EA 1U8FO 3LYLA 4IDFA 1N9GA 1TB4A 1A4UA 4LVCA 4OXYA 4PLTA 3WNQA 2EGGA 1BVUA 4DVJA 1UDAA 5K6AC 4RQTA 2P4HX 5KJEA 5HA5A 4YRBA 5JAMA 4FW8A 4XCVA 5F5NA 1GUZA 4WE3A 1JAYA 2DBQA 3AJRA 3FBGA 1P1KA 2PD6A 4YRAA 1LLUA 1YKFA 1E6UA 3KO8A 3U0BA 4C7JA 1QV6A 3JQFA 4II3A 3H65A 1SEVA 4XYEA 1PX0A 5H81A 2GZ3A 4NFYA 5JYAA 1A27A 1HWYA 3RCBA 3QW2A 2VT2A 1I30A 1SO8A 4HBGA 1ID1A 1EBFA 3GG9A 4WLOA 4IJWA 2BKAA 1DFIA 3JD0A 2EF1A 4OOFA 1DJNA 5FWNA 5IG2A 3PZRA 2W2LA 3DB2A 3GOHA 2WD8A 4CPDA 2JFHA 1C0PA 1PJTA 2YY7A 4XDYA 4INAA 3WMWA 2HSDA 3VDQA 1XA0A 1Q1NA 2RAFA 3W4IA 4EUEA 2BFAA 1G0NA 4XGNA 5CDTA 4DYDA 4L74A 4PG4A 4NNJA 1L1FA 3ZWOA 1JWAB 3BXXA 5B4UA 2NTNA 3NT5A 3H3FA 1LUAA 3GNQA 1X1EA 1HE2A 2F1KA 4TMFA 3U4IA 2AHRA 1M6HA 4A73A 4CLDA 1Q0LA 5CG2A 3ASUA 2BELA 2SCUA 2EKQA 5JC1A 2B69A 1Y5RA 2OP1A 3FRJA 3U5TA 2D8AA 3L6EA 3MCVA 2AQKA 1DB3A 3F5SA 4WUVA 1H5QA 2V6GA 1O95A 1K0UA 1JWBB 1CQIA 1FXSA 1PGJA 2VT3A 1XHLA 3H9QA 1SBYA 1ZEMA 3RKUA 4PG6A 1OAAA 1A5ZA 3KB6A 4RF4A 3GLQA 3S2FA 2ZB7A 4MVJI 2H6EA 1H6BA 2GZ2A 3C24A 5F3RA 4QO8A 1EQUA 1FDSA 4MVJH 2WYWA 4AJ4A 4DYVA 1LI4A 1YOVA 2J5RA 2WMDA 1VL0A 4LCEA 5T6BA 4F3YA 2Q46A 4R51A 1VSVA 2VCYA 1EEHA 1OFGA 1D4FA 3LC2O 3BMOA 1A72A 2O3QA 1Z73A 3IP1A 2HMUA 2Q49A 2OMEA 1SZJG 1D3AA 1LSOA 4YTEA 2J3JA 3IAHA 4DQXA 3IL2A 1NQAO 3JQEA 1TT5A 4R9RA 4BGVA 5EQFA 4IIVA 4QECA 3E5RA 4CMIB 1DPGA 2NVUB 2PY6A 5T73A 3DL2A 4CODB 4RCVA 1DIGA 1PQPA 1O0SA 4D41A 3JQ9C 3AUTA 3UCFA 1SC6A 1LJ8A 4TKLA 3CPSA 4G65A 3ZWNA 4FC6A 4RL6A 1ZSVA 2DVMA 5KJ1A 4XD2A 4PZDA 4YT5A 3AOEA 1DRUA 1ADFA 3BTVA 3KYCB 4IUYA 5EERA 3L4BA 1Y1PA 3MOGA 1DIRA 5IZCA 1R12A 4TZKA 1DLIA 1KY5A 3TPCA 1HSZA 1OMOA 2ZKLA 1DXYA 1YBMA 1G6KA 4H16A 2NU8A 4BB6A 4YPOA 3GUYA 4UEOA 1BW9B 2VN8A 3WQSB 3WQRA 4CLEA 2DQ4A 4FB5A 3VKVA 4Z3KA 3GDFA 2ZB8A 1ZIDA 5TLSA 1GFSA 4BMNA 2D59A 4Y98A 1W8DA 2VUUA 3OECA 3MZ0A 3RC1A 2EP7A 1F14A 1U5CA 4BO7A 3VTZA 5J23A 4ZRNA 4TRJA 3O8QA 2PV7A 1G0OA 1MXFA 3ZV6A 1U2GA 5A4DA 3AU9A 4CM5A 5T8KA 4IIUA 4AJIA 4OKIA 2BGLA 3AM5A 1U1IA 3KSZO 4EGFA 2RBEA 1YQGA 2XOXA 1PJ4A 3PHLA 3U4HA 3JQ9A 5CP8A 1UXIA 3A1NA 2PD3A 1QV7A 3AUUA 8LDHA 3B70A 2B35A 2GNAA 1UDBA 2X5JO 1U7HA 2JCYA 3PFFA 4NBVA 1N5DA 4O1MA 3C1AA 3VPFA 3P5SA 4R41A 4BOYA 1P9LA 4DL9A 5KCZA 1R6DA 3GN2A 4IJKA 3K73O 4E5NA 3OQ6A 4YT4A 4E5PA 1Y8QA 1E3JA 4IGEA 4BO9A 3D4PA 4DQVA 3JSAA 3GT0A 4DC1A 3B6ZA 1X1TA 3L6DA 2CD9A 3OJOA 5KVCA 4MPDA 4RVGA 4YJFB 1E1MA 2NVUA 4B4OA 2C0CA 4IS2A 4L0QA 5KJ6A 3EVNA 1J49A 1ADGA 1ISFA 5JY6A 1HT0A 3AUSA 3K2BA 1MG5A 4JNKA 4CMIA 4GKBA 1Z45A 4KTVE 3Q2IA 4Q3EA 4F45A 4D7AA 2Q2VA 1X0VA 1FDTA 1ISIA 1VM6A 5DULA 2GUGA 3WYEA 3D5QA 3HDYA 3KM0A 4DIOA 2VZ9A 5CHEA 3WJAA 1TEHA 4TRRA 5DP1A 1LSJA 3IIEA 2POQX 5L3ZA 4LMPA 5J9GA 2IYOA 3BYZA 2P9EA 4FDAA 1BHSA 2HK9A 4XX0A 4B79A 3JTMA 3WXBA 2JAHA 4U7WA 4ROSA 5IZ4A 3VPSA 1HSOA 3Q6IA 3VVCA 5AXAA 2B5WA 2B0JA 5TSDA 1YOVB 1LDNA 1RKXA 3C1OA 5T5QA 4CLHA 4OQYA 2RH8A 4GLOA 4GSKA 1M76A 2FZWA 3UCXA 3MJTA 4IQGA 3WLFA 4GI2A 4CR8A 3QA9A 4RPHA 4GL4A 3C7CB 3F1KA 1H6CA 2HLPA 3HDHA 4Y9DA 1U5AA 2VHWA 4DLAA 1P0CA 2FR8A 4BO4A 4JGBA 3RC9A 1YXMA 1XYGA 5IN4A 3JD3A 3DO5A 3CH6A 1I0ZA 3F4BA 2FR1A 4CR6A 1S6YA 2WJPA 2G5CA 5IXYA 4ZICA 4AJJA 1TLTA 4KUHA 3TL2A 1GDHA 3QP9A 1ONNA 3MJ4A 3OJLA 1ADBA 3GN1A 3TOXA 1HLPA 4Z0PA 2AEMA 5GY7A 2HK8A 4ALLA 1ONOA 2AA3A 4BNJA 3IUPA 1JDJA 4IXWA 1Y9AA 3ROQA 3JD2A 3OICA 5ENDA 3ZWBA 2LDBA 1DC6A 3GRPA 1M66A 4E13A 4UVDA 1EBUA 3VH3A 3G3EA 3ENKA 1B14A 1TI7A 1RYEA 1Q7CA 2EW8A 3JD1A 3JYLA 4RZIA 4K9DA 1C1XB 4Z9YA 4AJ2A 5TNXA 2GF2A 2P2SA 1ZK1A 3G0OA 3I1JA 1DHTA 4HFJA 4J49A 5DT9A 5TF4A 4CM7A 1YS4A 4JLWA 5F5LA 4NIMA 4ND5A 3NEPX 3UHAA 3LC7O 1DEHA 2ZJ1A 1AE1A 3UICA 4UEJA 4BQPA 4ND2A 1LQTA 3PK0A 2X4GA 2GN9A 3WBFA 5L7WA 4BGUA 1Z7EA 2RIRA 4LN1A 3BZUA 4YJFA 2X9NA 4PG7A 4EJ0A 3GQVA 2VTDA 2YQ4A 4TWRA 2RCYA 2AG5A 3PYMA 3D0OA 2P5UA 4MDHA 2D5AA 4YVFA 1ZK4A 2Z1MA 1MG0A 1JVSA 4RVDA 4D42A 4U5QA 4DBZA 2ZIZA 3WDSA 3DAPA 4CMKA 4RVSA 2QW8A 1X7DA 5LC1A 3VKUA 3F47A 2NTJA 3AI2A 4WCDA 1DAOA 5JE8A 4B4UA 1YO6A 3E48A 2FP4A 2NQ8A 2DUWA 3AWDA 4ZGWA 2BRUA 4CLOA 1I2BA 4Q9NA 1HDCA 1JKIA 3GGPA 4DMLA 4AJEA 4TRMA 2Y1FA 5ITVA 1SB9A 1N9GB 3N7UA 4CLOB 2QG4A 4L8VA 1PR3A 4PLPA 4Z0HO 2O48X 4WNIA 3E18A 1QR6A 3GAFA 4IDBA 1LLQA 4RPGA 3W8DA 1LLCA 2ZTUA 2O3SA 3CXRA 3G1TA 5JSFA 2C29D 1U28A 4CJXA 2A94A 1WWKA 5HWSA 5M6DA 2AE2A 3O8QB 5JO0A 4BKUA 4BNHA 3TZKA 1XQ1A 3ON5A 3ZHXA 4TRNA 2VWGA 5K6AA 2E6UX 2DPHA 2O3RA 2ZCUA 4LSMA 1K5HA 2X9VA 4J9UE 4R1NA 4J7CA 1DC4A 3V2HA 2YUTA 3FNHA 2VNAA 4XWYA 2YJZA 2ZB3A 1JQBA 5EQDA 4GPD1 2BLLA 4JIGA 1VPDA 4JBHA 1JN0A 2JKVA 4OJNA 3GPDG 3ONFA 1ULUA 3OA2A 4M87A 4Z3DA 3U4DA 5TS3A 2J3HA 2D5CA 3TNLA 5IXSA 2E49A 5G2OA 1H0KA 5F21A 2O7SA 3G49A 4M8SA 1KVTA 2VWHA 4WECA 3RU9A 2B4RO 2VRBA 2Q1WA 2QZZA 3C7AA 5BSGA 3WGOA 4QSMA 5DP2A 4KQWA 4MVJF 4GH5A 4Q3BA 1XSEA 5DCUA 4HNHA 3PQEA 3GDGA 4OHUA 3O38A 1EE9A 5BNTA 2FWMX 4Y6RA 4O6VA 2P68A 1PJBA 3ZH2A 5DBIA 3FNEA 3K96A 4ID9A 4GVXA 1PU2A 1ZJYA 3BHMA 1CEQA 1QLHA 4QO7A 1FDUA 1TVEA 2IEDA 1ISHA 2Y68A 1LC0A 3LVFO 3QVSA 1FF9A 4NPCA 3OP4A 1PJLA 5FF9A 4E21A 2JL1A 1HL3A 1PGOA 2CY0A 2PLAA 1DIBA 1VE9A 4TVBA 3DMTC 4R3WA 1EFKA 1B2LA 4XA8A 4XDZA 4JBGA 1I01A 3BHIA 1UZNA 2PKQO 4TROA 4A7PA 3ZU4A 4E3ZA 3WGHA 2C54A 1DFHA 3I6QA 1P74A 3QLJA 1EVIA 3BMQB 1EUDA 3C8MA 1V3UA 3FCOA 3HN2A 4XQGA 1A7KA 4O59O 1HDRA 1TT7A 4OH1A 3MOIA 2FR0A 4X54A 4CM3A 3H8VA 5T64A 4BNYA 1DJQA 1X7GA 4MP8A 2X5KO 1A9YA 3ENNA 4NBTA 3ZWWA 4AJ1A 1Y81A 2TMDA 4BNMA 5CPFA 4BMVA 1VSUA 3PHHA 4BIIA 1U3UA 2NVBA 4W82A 2B83A 1F17A 4K6CA 4YRDA 4AG3A 1K3TA 5LDHA 3JQAB 1SAYA 5A03A 2OO5A 3BMNB 5KVQA 3Q0EA 1JTVA 1UAYA 3QWFA 3LQFA 2Q3EA 2VNSA 4BO5A 4MJLA 2OBNA 1VI2A 2QZ9A 3T7CA 4KUEA 3DFZA 2Y66A 1AHIA 4C7KA 1HDZA 2D4AA 3DBRA 5DNAA 4QEDA 5JYDA 3UGKA 2YV1A 4BNKA 2BGKA 3NX4A 1TXGA 1E0DA 2V6BA 4DLLA 3CEAA 1SEPA 4OO3A 4BVAA 4RORA 8ADHA 2JD1A 2ZYAA 2CDAA 3CKYA 3JQDA 5TQVA 5L4NA 5ER6A 5F1OA 1ZSYA 2BD0A 1K6IA 4B8ZA 1GQQA 2VYNA 3IS3A 4LVUA 1ZW1A 3GVIA 5G4KA 4IDGA 4TZTA 4ZU3A 5HBRA 3UOGA 4OKNA 3KSDO 1Y8RA 4K6FA 5COAA 4M86A 1QYDA 3P19A 4RDHA 1GEEA 3GFBA 4G81A 1LLDA 4ZQBA 3QY9A 3JD4A 1SNYA 3ZHBA 1PJCA 1LDMA 2DBZA 2GCGA 2HK7A 3OEYA 1JLLA 1GPDG 3NT2A 2WD7B 3OQBA 3DXFA 2BFOA 3ZWYA 4BMSA 1HZJA 1YB1A 4HP8A 3V5NA 2XXJA 4GBJA 2OBYA 4QTZA 1MP0A 2C82A 2PD4A 4KWIA 2HJRA 1T2FA 3E5MA 1LRLA 1PSDA 3OH8A 5AXDA 5U4QA 1E7MA 3PHIA 1PL7A 2W2KA 2X58A 1V6AA 3IQDB 2Q2QA 1LNQA 1KEVA 4J4BA 1H6AA 1MC4A 3ZV5A 2VZ8A 4CMCA 3RJ5A 4B4VA 2ZB4A 5KVSA 2CMDA 5LCXA 2AXQA 1OBFO 2DT5A 2B37A 5JLAA 3K8ZA 5FYDA 1GY8A 4BO8A 2C2XA 4WCFC 3V1UA 1NAIA 4BV8A 1ZFNA 2H1SA 2OZPA 2I3AA 4QUKA 3NDIA 4JQCA 4BV9A 1AUPA 5L7TA 1UXGA 1YRLA 2PH5A 4CQMB 1EK5A 4R3NA 2G0TA 3R6DA 4J4HA 3ITKA 5ITWA 2I66A 3SEFA 1M67A 5IFLA 1GUFA 4MKRA 3ZW9A 1RYDA 4ONEA 5JAQA 3HJAA 2VUSA 4HY3A 1JW9B 3RFVA 5T8KC 1NQOA 3KYCA 3WTBA 5ICMA 9LDBA 1H6DA 2E37A 5HTOA 3V1YA 3DBVO 4H15A 5K0ZA 5U9CA 3BIOA 2I99A 2VTEA 4YEDA 4FPXA 1LDGA 3WQQA 4KP7A 4ZVVA 4DREA 4B3IA 3H5AA 4LMRA 2ZQYA 2OP0A 3D1LA 3K92A 1PJQA 3ZU5A 4YAGA 1GCOA 2JFFA 1VJ0A 2HO5A 1ZMTA 4JJGA 3NUGA 1KIFA 3HUDA 3H9EO 3C1TA 3NDJA 4CMBA 1JA9A 1X14A 1C14A 3IUSA 5KJFA 3W4KA 2OUIA 1XLTA 5A04A 4ZD6A 1F12A 5A05A 2J6IA 3GZNB 4W7IA 2ZTMA 3RC7A 3ONDA 5DCWA 4PZEA 3BTUA 1NFQA 3LK7A 2X5OA 4LW8A 2O50A 2WYVA 4PN3A 1E92A 2G1UA 1O6ZA 3QVOA 1GZ4A 3AI1A 3KRTA 5DOZA 5JAIA 1YE3A 5CDSA 1AN9A 2IE0A 3W6UA 5G0UA 1BDBA 3PEFA 4I08A 3BTSA 4FFLA 5AYVA 4QX6A 3UUWA 1KBZA 3NGXA 4E2XA 2HJSA 4YDRA 1NHGA 2E82A 2YQ5A 3WNVA 2UUOA 1LA2A 1NPYA 3HB5X 3ONEA 4OXNA 3FR8A 5CPBA 2YDXA 3JQBA 4PLZA 4PLCA 4NBUA 5C37A 4GSLA 4YJGA 2HCTA 1H9BA 4R1SA 1JAXA 3D4OA 5BT9A 4PFJA 3ZWCA 3ITDA 1KERA 1WLYA 2Y67A 3ICCA 1P44A 2V6MA 2TMGA 4PVCA 4BUCA 1XWFA 3BAZA 1A9ZA 2GSDA 3OEWA 4RVHA 1HXHA 4YQZA 3D64A 1PZHA 2JAPA 4TKMA 2FMUA 3NTQA 1HKUA 3FHLA 1HETA 2IEBA 1UP6A 3L9WA 5JS6A 2I9PA 1XQ6A 1Q7GA 4LRTB 1NR1A 4WLNA 4WJZA 2CF6A 4N5MA 5ICSA 2GN6A 4XYGA 4MVJD 3QE3A 1AXGA 3ZNPA 1T25A 2GYYA 3JQ8A 2X8LA 1MB4A 2O2SA 3D3WB 3PQFA 4AJKA 4FFPA 5L40A 1ZZEA 1OZAA 1EDZA 3GR6A 4BO1A 5DCYA 1LBEA 1G1AA 4U6QA 1DOHA 4BNUA 2FSVA 1T4BA 1I33A 5C7LO 2A4KA 3AM3A 1EFLA 3DBLB 1P45A 2W4QA 3H5NA 4FFRA 5ER9A 2HMVA 5B4VA 5BQFA 2AMFA 3WGQA 1E3WA 4XIJA 2DLDA 2X1HA 4E6PA 1IZ0A 4J91A 3KBOA 2C20A 1E7WA 3PHGA 4EYEA 4E12A 1JKJA 1X0XA 3HFGA 3PP8A 4R16A 2UUPA 4OYRA 3MJEA 3O9ZA 3VOSA 1P0FA 2C07A 4KDEA 4PLGA 5U1PA 4BNLA 1N7HA 4G5HA 1HTBA 2JFGA 1YVEI 3GVCA 1E3IA 5G0TA 4CV0A 1H9AA 1UP4A 1V3TA 1ZK3A 4O0LA 4XQCA 1LDYA 2EKLA 3I9MA 4B3HA 5JNLA 3QSGA 4R1TA 3PFWO 1YGYA 3KEQA 3TDKA 1F8FA 3LT4A 3K31A 3PIIA 4NR0A 3ULKA 1B7GO 4L4XA 3JYQA 2DFDA 2HQ1A 1XGKA 4JJFA 1GTMA 4HFNA 3ROPA 3RUAA 5GZ3A 4UVIA 3NJ4A 2X6TA 3MEQA 3CTMA 1DIAA 4PLYA 5JCJA 4PRLA 3IKTA 4QFDA 1R0SA 4RLHA 1ENPA 4RLSA 1E5LA 4BNIA 3ETDA 2X86A 3DWFA 4Z0TA 1BW9A 4IZHA 2Y1CA 2O3UA 5THKA 4D46A 4FJ2A 2CSUA 3ZNOA 5B37A 1O9BA 2RHRA 3JV7A 4RPKA 1H93A 1UUFA 3O4RA 1N2SA 4J1TA 2NU9A 4CM4A 2JCVA 2NLOA 5JYFA 4F6LA 2NV6A 1WPQA 5CEJA 3OM9A 2PKQP 4GVLA 1DC3A 4NFHA 1B3RA 4I5FA 4ILKA 4JCOA 4ZQGA 4GGOA 4Q3CA 4Z9FA 3B1JA 1GZ3A 5AOVA 3ADOA 5AVOA 4MKXA 3WB9A 2GD1O 1XG5A 4WKGA 6LDHA 1B3BA 3DDNA 3PGJA 2BF7A 4NHEA 4KQXA 2CDCA 4ZQHA 5JAZA 3EGOA 4CLRB 2P9GA 1GAEO 4GX0A 4M55A 2VHZA 3A14A 1JKFA 1PZEA 2HMSA 4MKZA 4IPTA 2X0JA 2Q22A 1TT5B 1XELA 1UXHA 1B8UA 1ENYA 2X7HA 3FWNA 2VWPA 3HDJA 4UULA 1CRWG 2FPIA 4I9HA 4D3DA 4K26A 2IDZA 1ZVMA 5C3MA 3WGIA 1I32A 4CM9A 5I7EA 4AFNA 4MVJA 4E5YA 1E7RA 1O5IA 4EBFA 5EIOA 3GPIA 3H7AA 4IQ0A 1ML3A 3SC4A 5B12A 4J0FA 3NAQA 4YJHA 3INRA 4MP3A 3ZGYA 5A3VA 1ZXBA 3M1LA 3QHAA 3RD5A 2G82A 1PTJA 1I3MA 4I8XA 2V7PA 3WSVA 1UH5A 3VH2A 4XGKA 3GMDA 2FRDA 4CMEC 1NWCA 1I8TA 1PGQA 3WR5A 3ADPA 3DBHB 3EK2A 3OIDA 2CVZA 1EVZA 3HADA 3L4SO 2AQHA 5IDWA 5TX7A 3T4EA 3I23A 3AW9A 3VAZA 4FBGA 4ZQEA 1MFZA 4PG8A 2P91A 2WM3A 3UXYA 1LU9A 1DDOA 4Z6KA 4JK3A 3ZU3A 4CM6A 2YW9A 4WLFA 4RPJA 2BI8A 3SVTA 3W8FA 3GDOA 4YB8A 5A9SA 3RJ9A 5GZ1A 1GD1O 1Y6JA 3LT2A 3DONA 5ILGA 3KUXA 1WXDA 2OXIA 4M54A 1UAGA 3KOUA 4XYLA 4RVFA 5TT0A 3EYWA 2PGLA 4RPLA 5IDYA 5I7VA 3C7DB 4IDEA 3AU8A 3GHHA 1SMKA 4DXHA 2FPGA 2YDYA 4CM8A 1XKQA 3GK3A 1Q7BA 2X0IA 3K2EA 3QVWA 4XIYA 3TWOA 3AFNA 3W1VA 1HE5A 2NVWA 3I6IA 3VPGA 4EW6A 1ZCJA 3MWDB 3WBBA 1Y5MA 1CDOA 2YYYA 3GEMA 3NRCA 1MXHA 2NACA 1YONA 3EZLA 1PS8A 4CV3A 5JMWA 3AOGA 1LXCA 2QX7A 5K9ZA 5EL0A 4XKJA 3G1UA 3GZ4A 2YFQA 1PJ3A 3A06A 4NG5A 1FK8A 3ZDFA 1PS0A 2J5QA 3CIFA 1ORRA 1IYZA 1MC5A 3PQDA 3Q9NA 2O7QA 4BO3A 4ZHSA 1PL8A 3PYLA 3JQGB 1AHHA 3KZVA 2PZKA 3JQ7A 3F1LA 1BGVA 3RASA 4AJNA 4JN6B 5FFFA 1F8GA 2GRAA 4A10A 2HKIA 1IY8A 2QYTA 2RHCA 3KYDA 3PTZA 4NQZA 1DIHA 3I4FA 3WGTA 1KVRA 2IZ1A 1NHWA 3WYBA 4GQAA 4XRGA 3P7MA 1KVQA 3INTA 1WMBA 3NKLA 2QRLA 2VZ0A 2PWZA 3SXPA 1B0AA 4YAJA 3WIDA 2DPGA 2XPCA 3RAJA 4KZPA 5A1TA 3BMCA 3WFJA 3DR3A 1UXKA 1WP4A 2PH3A 5EN4A 3E9QA 4N18A 2AEFA 4KMSA 1QYCA 3E03A 4J7UA 5KIAA 1U9JA 4YACA 4Q3NA 3I3OA 1LDEA 3IMFA 3RUEA 2BFMA 1NBOA 1EUCA 3GGGA 1WDMA 1A71A 1ISJA 3OA0A 2CZCA 4XQ9A 4D79A 2CDBA 1VL8A
chains in the Genus database with same CATH superfamily
1L7AA 1ZNWA 3TLMA 1VHWA 3NOVA 4W5QA 3A6DA 3HUUA 4XJSA 3DTYA 2B21A 1QJ4A 1S0UA 3HU2A 3JALA 3RS7A 5EE0A 4QARA 1OA0A 3OF5A 3A28A 2TMYA 4YK7A 1DEOA 2LDXA 1EDDA 5M29A 5K05A 2NTVA 1U1CA 4HATA 3A32A 1RWMA 4F6RB 4CVNA 4H7JA 1IUKA 1QO0A 4HH1A 5BVHA 5CH8A 2P4QA 5HM8A 1E98A 5EZSA 2Y1DA 1I10A 4C6RA 2WZDA 3O2SB 5DNWA 2N1BA 2BVNA 2W6PA 3BWEA 5DHFA 3TPZA 4C43A 2D2VA 4OL0A 2EV9A 1R64A 3NPAA 1P2FA 4BBZA 4F3TA 3Q4GA 2JCGA 1NONA 2O2IA 1WAMA 3EQ2A 1MRNA 2XNKA 3F7OA 3FB1A 1YL5A 2V3WA 4L5JA 4JI3B 1VBFA 3MCUA 2ILVA 2ZATA 5HNKA 1PNQA 3PDIB 5HOEA 4R7ZA 3F96A 4CT0A 3FVTA 2NYAA 3N07A 4EG4A 4K3UA 4HUQA 5EJ4A 4DN6A 3GGDA 6Q21A 1VSBA 2BBOA 2CWWA 4Y2HA 5BNFA 1GGKA 2XI4A 3CSDA 2ZT8A 1E58A 1VKNA 4UPVA 1QWSA 1WB5A 2G70A 3LY7A 4JLNA 4YJ2B 5DK6A 5FPQA 1BCSB 2HA5A 1OFTA 2YHIA 1ISSA 4P5DA 2BFWA 2YJ3A 1CERA 3GT7A 4J94A 4C01A 5LMNB 1P8JA 2FPRA 2QLNA 1QOQB 3UC5A 3CEJA 7ABPA 3LC1O 1PJZA 1RBMA 3T1YB 4V1CA 5IVHA 4O4HB 1RRPA 2F00A 3M81A 4HTAA 4LC1A 4MWBA 2JZNA 3CUKA 4V0MA 3W05A 5BWCA 2R0QC 4G0UA 1PWXA 4KXWA 1JHZA 4B7UA 2P7IA 4ITUA 5FA6A 1KZHA 1GNVA 1HYGA 3G2MA 1QIKA 3JQFC 4DCMA 3UF0A 3BB1A 4QGSA 3NASA 3VXKA 3P96A 1L5FA 4IINA 3FTNA 2QYHA 4NKRA 5BMVF 1LH0A 1X80A 2D06A 2J6BA 4L4ZA 2DPLA 1RPZA 3UJ8A 1EK1A 4WEOA 3TLAA 2IXDA 4OBWA 3ZCQA 2XF8A 3CJQA 1E1RD 1A7AA 4IRXA 2BFFB 2YV5A 2DBVO 3WAGA 2C95A 1A7JA 5H83A 1Z4NA 4CI9A 1KYTA 1LX6A 4JQOA 5I8WA 1CR4A 1BCRA 2JJ2D 4RFSB 2DXIA 1YV9A 1J8DA 4X60A 3OOYA 4ZO6A 3AVWA 1T4DA 2KI5A 1JBKA 3TGPA 3C16C 4G5RA 3W4JA 1FFYA 4ENWA 1GADO 1OFIA 2V5VA 2XIJA 3DUWA 3GZNA 4PANA 5HS4A 3H83A 5INTA 3UMJA 2JGMA 1DG3A 4X7MA 2SBTA 4X44A 3THOA 3R8XA 2XUDA 3S8MA 13PKA 5CDUA 3DDZX 3TG2A 1M2OA 2B2XA 2P3SA 3FFWA 4PLWA 3GYGA 2XDAA 1NP7A 3ESBA 2GBLA 2XE8A 3GRKA 3RKRA 3NTRA 2JI6A 4HWRA 2XCUA 3QFTA 3DAFA 1OX6A 3M6AA 3O8LA 1YWGO 1NPDA 3ZJYA 4OAOA 2D00A 2ZJ8A 3UAGA 2OCIA 3C6YA 2HLHA 3QPCA 4JWTA 4IHJF 4R2XA 3LUPA 2JJYA 2QR5A 2BKUA 3VJLA 4F92B 2P6PA 3BWBA 5ILOA 2OCKA 3FJOA 3TNFA 1SIUA 4P8RA 2OHJA 3GZJA 2WILA 3OMWA 4IIGA 3K70B 2WYUA 1YS9A 3UWKA 2GXAA 2FK7A 2ZRJA 3Q3CA 1D09A 3UAXA 4BEBA 1W59A 2E4XA 3FYSA 2N47A 1EFDN 4B81A 3C3WA 2Z30A 1U7TA 3FXAA 3U1VA 1CKEA 1XNRB 4LK2A 5C7YA 2FN7A 1GV1A 1T5HX 2O3JA 1JHQA 2B8JA 2Y1EA 3KBBA 1MPTA 1BNCA 3BFVA 4DCJA 4UUMA 2OM2A 2JH8A 3PNSA 4D82A 1JJFA 1P1RA 3GCZA 3K8QA 4HVAA 1J25A 3SZRA 4FN4A 1CFZA 2Z4SA 1CUGA 3EAGA 2FWIA 3AFIA 1Q7EA 3HLKA 4I9UA 2IXEA 3M5WA 4LWQA 1HYEA 4AW9A 3Q7RA 5DHRA 4B46A 1JHYA 2JLAA 4ALJA 1UJNA 2C04A 3A6KA 3M6IA 2R1TB 1MUUA 4QYXA 1WQ4A 2JBAA 4YAOA 2YMLA 1RCTE 4E94A 5I8PA 2HCRA 4ON9A 1QYXA 5CTJA 2DFPA 1MIHA 2Y0CA 4U2DA 1G7TA 4BE4A 5UKDA 1N8KA 3V4PB 3FMVA 3KLBA 5KZMB 2OFFA 3VKHA 3RC2A 1QH0A 2E5WA 2JIQA 1PJRA 2P65A 3HR4A 3MC1A 5EP2A 1A8HA 1ZH2A 5DYTA 3JQGA 2X0EA 5E7QA 4BU1A 2D3TA 2HDHA 2I7XA 3PNPA 4CF5A 3RUHA 5KKCA 3RBZA 3VC7A 2OHXA 2FOIA 1NW9B 2PKEA 5J4YA 4JC8A 1I4WA 4PYKA 3ZWMA 1SKMA 2J5BA 3FE2A 2J9FA 3RF6A 4YUZA 1ZVJA 3KT6A 4M8LA 5DM2A 6YASA 2XF2A 4LXUA 1TLFA 2QRVB 5F98A 4JT2A 3KC2A 4R71A 4QRDA 3ZE6A 3F97A 3CUSA 3FUTA 1ZITA 3DM9B 3QQ5A 1E8NA 2RDMA 4W5OA 4KWEA 3PUKA 4GX5A 1NKVA 2AMJA 2HPAA 1FS6A 4FDLA 3T0GA 1GTG1 5D6NA 3Q2KA 4FKZA 3TOZA 1IG0A 1Q2XA 3REQA 2VBIA 3S99A 2P3QA 4FN5A 2YXLA 2R8OA 1DU4A 4L4UA 5AHOA 4CFSA 4R9SA 5KOHB 3Q9LA 4QNRA 1RM3A 4QUEA 2H3HA 2C78A 3LBYA 5T4EA 3QWBA 5TPZD 3UGQA 4MRMB 3TJRA 5DNVA 1OX5A 3DFUA 3LXRA 3QVTA 4FYIA 4KXXA 4HDMB 4W63A 3GJRA 3LAWA 2ZM5A 4ZHQF 1XDGA 1OILA 2IF2A 3V2UA 2WTAA 3FYUC 4PHGA 3FBTA 2BM1A 1OCEA 3S2ZA 2EZ4A 2JHFA 2XCTB 4UREA 4ZAZA 5ALZA 2ODWA 3DBRB 2QN8A 3MCWA 4D3ZA 2O2YA 3LHFA 3EC1A 1KS9A 1JG1A 3EUEA 5CB4B 3ONVA 1KYWA 4K05A 4TWZA 2JD0A 2XMQA 1IY2A 4M4SA 3W7VA 1QKJA 1WY5A 2DHDA 4CTKA 1AUQA 4DMFA 2WA1A 1LTQA 3BDVA 3CN9A 4RIEA 2PS1A 1A4IA 4GLFA 3ETGA 4XQEA 1S1MA 1CBUA 1NLZA 3EIHA 3KZNA 4J43A 5E9AA 4G86A 3NBFA 4I8IA 1DV2A 3B6IA 3FWYA 1QU2A 1AGYA 2PKRA 3O8OA 1YQQA 5EJAA 1UR5A 1XKLA 3CLSD 3PKJA 2DH6A 1NTRA 4RENA 3VGJA 4HYYA 1TRKA 1JPJA 2Q5LA 4QJIA 3ZVMA 3RK4A 2K6GA 5CA1A 4DJ5X 4IIDA 3HBJA 5B58C 1WOYA 1KI4A 3ET4A 5AM4A 1P2TA 3GY0A 4F5EA 2WTXA 3OE1A 4J0HA 1PQYA 2DWCA 3A3NA 4NAVA 2FSHA 4HRYA 4DPKA 3KLMX 4YAIA 1N0HA 2Y0EA 5BVGA 3MA0A 3CRZA 4BDTA 1U5BB 4UC0A 3SX2A 1SBNE 2ZUSA 4ILEA 4MJ7A 3U7HB 4QPCA 4F2HA 1CNMA 1FFAA 3ZGLA 1B00A 2BFPA 2R2GA 1DXQA 1ECPA 2QTVB 5EKSA 4O63O 3FWPA 2W2OA 4J6FA 5AW9A 1PWZA 2JFOA 1N9KA 2EFJA 3BRSA 4RV4A 3MIIA 1Z22A 2YWXA 2FAXA 2LCIA 2Q3JA 3KWLA 3V3KA 1AD2A 1ORHA 2K4MA 4M1ZA 3SK0A 4MUYA 3K9NA 4D9HA 3H86A 1N0UA 2DBRA 5DVZA 4FOOA 2QLMA 1UXOA 1Q6ZA 1UOQA 3V7UA 4V0LA 3ZNQA 4KG7A 4HNTA 2QAJA 1NMEA 2YS6A 3HCWA 3DZ3B 3SSOA 4JLSA 1M0SA 3E70C 3ZTWA 1ZCBA 1GYQA 3OBBA 4DNFA 2E3JA 5A4KA 3FIUA 3OJ0A 1SOAA 1DC8A 3KR0A 3OCCA 5KDOA 5LMUB 3TAXA 1FP6A 1LRKA 4CI0B 1S5PA 3BQMB 3VR3A 4FVTA 1VECA 1J97A 2XTZA 4XVRA 2IODA 4EZBA 3OLZA 5ENVA 3RTBA 4BRUA 2J0EA 3NP9A 1BJKA 4CV2A 4MVJP 1C0EA 4P53A 1WMFA 3FCEA 1RR6A 4G2NA 4JP5A 2HA2A 3K9BA 1VFNA 5C8YA 3U62A 2ADOA 2CLDX 2F1RA 3HDQA 3WB2A 3MILA 3HSKA 4KC0A 5JSKA 1MW8X 4QDXA 1K5PA 3AR8A 4I6EA 2QZJA 4R9VA 4FLMA 3DZGA 4K1LA 4P92A 3LNTA 5AKGA 3RI3A 3TTXA 4YT2A 2EG5A 2QJFA 2R8ZA 3VC3A 4RM2A 5ESWA 3KD3A 2CXHA 2R44A 1Z4JA 2BEKA 5CT5A 3WLOA 2XTJA 5CXSA 5BSFA 3T8YA 1J22A 2Q6TA 5REQB 3PUHA 4KFSA 1G291 1P31A 2FW1A 2YHSA 5DYYA 3ZTYA 1T0BA 3U4QB 3GLHE 3D8TA 4Q1EA 2I4NA 3FSGA 1WHTB 3ZLBA 4EM6A 4L8FA 4C2BA 1L7EA 1WKBA 3JS5A 5GZ6A 2EEPA 1BZYA 1KI6A 1B16A 3GUVA 4JLUA 5B5SA 1N1EA 4FOPA 1JWLA 3HH8A 2W43A 3P9XA 4R05A 1FX0A 1HLFA 3BTOA 5BNIA 1B76A 3EY9A 2WK1A 4OQQA 3TQSA 5H82A 1DG9A 1KXZA 1U7UA 1CJBA 4HDSA 1NX6A 4WX2B 1EUCB 4DLPA 1DT5A 2ZBPA 2ZYDA 2PMBA 2VNIA 1Q50A 1X42A 3CZMA 3KWMA 5CDGA 5K0FA 3SLGA 2WTMA 2ATVA 2CXPA 3IODA 4ZEWA 1ESCA 2XDWA 5M3BA 2FPNA 3VOBA 4B71A 4P84A 3KUDA 5JROA 2AJTA 5IJZA 3A7DA 1JJ7A 3RS0A 1RQPA 2I7VA 2EBHX 1XQXA 2P30A 4PQFA 1YI8A 5EAIA 2R5NA 1LZKA 3ZI0A 2PBLA 5JARA 4UTZA 4EHIA 1V0JA 3L07A 3O83A 4GKAA 1VKOA 2NSDA 2REXB 2WR8A 4BQOA 1QVRA 1RM5A 3EW7A 3NIGB 5GM1A 5B55A 2PLRA 4TLLB 3ZY5A 3W5VA 1RRCA 1NJ8A 3ER6A 1JKXA 5REQA 2NGRA 3GA7A 2AUNA 3K4QA 3P9NA 3LIIA 4UNIA 4CMAA 3LW7A 4X8MA 4YCMA 3KZXA 1RYYA 1OH8A 1Z8HA 2BSXA 1US8A 5HFAA 5K2MA 2Y76A 3T7EA 1EVLA 4BNXA 2YHBA 1E96A 4MRSA 4C0LA 5DGCA 3TV1A 1R9GA 3WV4A 3EUFA 1Z17A 3F6EX 5KWVA 5C8VA 3DG9A 5ELMA 1F5SA 2W2TA 3JYOA 1VA5A 4H7FA 4RF3A 3T94A 2PA0A 1JHMA 3NIWA 1Q77A 2FFQA 5HSGA 2XWJI 2Z2JA 4J0GA 4RH1A 3VDNB 4M0CA 4OXXA 3ZQJA 4IFTA 4C4AA 3X1ZA 3U3JA 2WRZA 1GM5A 5FL7A 4IOJA 1E1YA 2WU1A 5CGZA 4LKOA 1RNLA 3MTJA 1ZSNA 4G5OA 1SK8A 5FCDA 5I7FA 3I9JA 3DO8A 1UJCA 1RKUA 4QU0A 1HX7A 3LD9A 1V5GA 1MN6A 2WMYA 1U0EA 1QCCA 3DEAA 3X2FA 1P0QA 1KDRA 4F04A 3ZCSA 2RMKA 3VV3A 3IKMB 4TTQA 5LQJA 1M72A 3RLFA 1RE0A 1H4TA 3Q98A 4J3FA 1VYTA 5BQ5A 2B4TO 4B9EA 1QFMA 3QFFA 3NIFB 4IVPA 5BO5A 4C0KA 3G9QA 4KITB 2EWMA 4ZPJA 1I1HA 4MO9A 2QT9A 1KYQA 1E66A 2RIPA 4A6PA 4RZSA 4YRRA 3RGWS 3FYUB 2G17A 2GN8A 2WNIA 4URHA 3RG2A 5A6SA 3DLAA 1NNUA 4JLDA 3ANLA 5EHQA 2VOEA 4FEAA 3QNWA 3EG9B 2ACEA 1VMDA 3G8BA 3GRZA 4KJZA 2QTVA 5FFNA 2IS6A 1JZTA 3ICPA 3LECA 1W47A 3E82A 5GONA 4EAAA 3P0RA 4HDRA 1CZKA 2V55B 4QU8A 3NORA 1ZCZA 4HDNA 2H18A 4DEXA 1W46A 1UJ6A 2HHJA 3LCCA 4MGIR 4D97A 1NBWB 1A9XA 4WUTA 4WHMA 1EE2A 2FOLA 2DU8A 1C7IA 2AL7A 2YWCA 5JHHB 2WICA 2O54A 5JCOA 2NQTA 3GFQA 1AZWA 1K9SA 4J1SA 1A4XA 2GI4A 3IQWA 4C0SA 5EJGA 1AS0A 1U4NA 5CA1B 2QP9X 1LC3A 5IF9A 3WGMA 1WUJS 2VDNB 1FMTA 2HBQA 3O9MA 2PVCA 4FDTA 2B1IA 1FS4A 1S4QA 3A3YA 3QUQA 4TSFD 4L4SA 3TIVA 2X0NA 4R54A 5F1PA 4DBVO 3COSA 3FSRA 3K0FB 4MPRA 1W88A 4OL9A 1BE0A 1TA9A 3AHIA 1EVKA 3F46A 4QM7A 3RHTA 3U7GA 3O8BA 5AFSA 3GNSA 2DFVA 4QXQA 5JBIA 4LE0A 4UE3S 3SDBA 3VSBA 5AUPB 4U7GA 5EIWA 1Z56C 5ADUS 4OQLA 1J5PA 3AJ9A 4CKWA 4H2DA 4JHXA 1EFRA 4JJ8A 1FYXA 3SDSA 1H2AS 3SJ7A 3U3XA 5CYGA 3OQJA 3P9ZA 1RS0A 5JNTA 4KSBA 1YQDA 1TQ2A 4OMUA 4D3XA 4TN1A 1QYVA 3JQ6A 4W7HA 1D5WA 4H60A 4MIYA 1YB6A 1YIDA 3H4TA 3W5CA 4S2EA 3PWTA 1M6EX 1Y4SA 3CF2A 5KPDA 2WT8A 4R2MA 2BGUA 5G02A 1BXZA 1SBIA 3BGSA 4DLBA 2QQ0A 5KOHA 3LLVA 4K46A 4BMOB 1KVUA 1N2CB 1W1IA 3HQ4O 3BIJA 3CPHA 4F8YA 1SURA 1GKIA 4CQLB 3NW9A 4Q16A 1A9QA 2UZIR 1NW6A 4JUDX 1S8FA 3MRSA 2CF5A 5CNMA 1NIJA 1QK4A 1Q1BA 5DNDA 3PC6A 3WHPA 3BX1A 3UN1A 1RSZA 5FAXA 1JZQA 2OC9A 4ETMA 3CINA 2Y92A 3IP3A 1NMZA 1D7OA 3FPAA 1JR3A 2H29A 4KLNA 1FVHA 1FXUA 4LOJA 3U61B 3V1NA 3FCYA 4JROA 3IDQA 2AFIE 5CITA 5CVDA 3OOEA 1L5NA 4F91B 3UFBA 3ZKWB 2PO7A 4CHGA 1XCBA 4G9GA 1P1JA 4JJIA 2IS1A 1JHPA 5B30A 4OHFA 4FYHA 3UXEA 1SN7A 5EHIA 1BWSA 3GF4A 4R5MA 1C41A 3ROMA 4D4HA 4D0SA 1AHPA 2RI0A 1J9EA 1NVMB 1X1RA 1Z8FA 4H31A 2IJGX 1NZDA 3I2HA 1T2UA 3PUXA 4QOFA 3LDAA 4RJJA 4ZREA 5FA8A 4PN7A 1A95A 4WIAA 1O95D 3LL4A 3VNQA 4D44A 1YMUA 4HAYA 2Q4BA 4I3HA 3BIWA 4OA5A 2QHXA 4GMGA 2VOJA 2VUTA 3AZPA 4G8JA 3S1LA 1ZRHA 4UE6A 4RIGA 1R8SA 4Q00A 3KOWA 1Y82A 4RO0A 4XIIA 2ZPAA 1MB9A 1OC4A 3D6NB 3KYBA 2GGSA 4JP2A 1XZPA 2G36A 1QDEA 3CNHA 3I30X 3UWSA 3AFHA 3VM6A 1AQNA 1L4GA 4NPAA 1WZCA 2JJ8A 1GPBA 4NBRA 1HE4A 2A1TR 4GRIA 2R8EA 5CU7A 5DBGA 5T6MA 2OEPA 1EWVA 1MA0A 3NALA 4KO3S 4S1VA 3TQHA 4A2QA 2V7BA 4K9OA 2QOEA 4CL3A 3C3PA 2MSLA 3H16A 4DPMA 2ZZMA 3NHJA 4NLLA 2GEUA 4L7QA 4LNUA 4RZQA 4ER6A 1MRSA 2P62A 3IPYA 5AW7A 5BWMA 3T7TA 1GU1A 3H19A 2PXHA 1AA9A 2C7BA 5DKFA 3KZKA 2VFAA 3KVVA 3OKPA 1LY1A 4EY4A 1BRTA 4LJAA 3IBCA 2CEKA 3IX7A 2FFBA 4GDMA 4AIRA 1R66A 1D2NA 2M1ZA 2P2NA 2Y05A 4HGZA 4H7KA 1GTVA 4LE2A 3FPCA 1KE2A 4EG3A 4OCZA 1SRRA 2CYCA 4KQMA 2P1ZA 2W2LD 3BJZA 3E2MA 3U4CA 4IV5A 4X84A 3WJ7A 3HB9A 1CQJA 3L93A 3OQNA 2VCHA 5EEGA 1IY0A 4JB2A 1VYHA 3NYQA 2FZ4A 4JUBA 1QXSA 4FYJA 5GM2A 4XSVA 1I94B 1HQDA 2BCJQ 3GMSA 4B2IA 5C8ZA 4O4JB 2WKWA 4GI7A 4JJAA 1NXQA 4RHYA 4LUCA 4R8MA 3QEMA 2NG1A 3TTUA 1OLXB 3QFHA 3KQSA 2FB9A 3DOCA 4HNGA 4GBMA 2FLVA 4EENA 3M1YA 2BDTA 1SHLA 4P82A 2YY6A 1AS2A 4A26A 3HRIA 1RFGE 1CTQA 2P6OA 4HFMA 5JH7B 3MF4A 3TECE 1TW2A 3FNGA 4J2TA 4P81A 3L6BA 4YJ3A 3U09A 2BFFA 4H6PA 4QPNA 1ZXLA 3ORHA 4Q4AB 1F9AA 3VC2A 4G9EA 2Y2VA 4PXSA 4WZBA 1MX1A 2AOXA 2C00A 3SGLA 4QYMA 1KJZA 1RI2A 2P27A 2R7LA 3AYXB 1SQ0A 4G85A 1PFWA 1YJ8A 4S1NA 3VH4A 4LOLA 5E7JA 3GPLA 1L4HA 2PL3A 2I67A 5ALYA 1U0JA 3TCKA 2AHOA 2R6AA 1H0RA 1TZBA 1GFZA 2BZGA 2ZPUA 4M83A 4X95A 3TQFA 2QLTA 4IILA 1XDDA 2N3ZA 2ZVPX 3AK4A 4GPEA 2QDKA 5FKJA 2C7VA 5EINA 3ICOA 1KQNA 2VYND 1FDVA 2GEDA 3K0EA 3O95A 3WYFA 3HFSA 4EEXA 2ZTLA 1EP9A 2BY4A 4MICA 3BRCA 1Z4IA 3RO7A 1X9HA 4IS3A 3UAYA 1BDJA 2FWJA 3QWAA 1KYXA 1NYTA 5AW8A 1F9EA 1KJJA 4D9BA 1O6CA 3KQQA 1YE5A 3THXA 3GT3A 2NYVA 1NXXA 3HBNA 3K5HA 1HOXA 2Z5LA 3W0LB 5LU9A 1C8LA 1E1CA 2ZK7A 2QN2A 2UXCB 2XTNA 5HVNA 1FFWA 1JPUA 3EEBA 2WJIA 4I14A 2KMLA 3GBSA 3P9RA 4ZI7B 4JEMA 5DASA 2OM6A 3BD6A 1SQFA 2OFPA 2ZTSA 2NSYA 1E6WA 5IUNC 1EWYA 4XUDA 1UDRA 1U3GA 4G0QA 3FSGD 4BKPA 4N47A 1DAEA 5AVYA 2GILA 3DZ2B 5L95A 2MDTA 4NYJR 3TR6A 4BX8A 4EY3A 5FBVB 1YBAA 2WU4A 4ARZB 4D8UA 4TQ9A 5HRCA 4QXMA 2ZUTA 2Y99A 3MT9A 4NMWA 3COVA 5KWJA 2MOKA 3DTNA 5HZMA 1VCMA 4MV5A 2VF4X 3ESRA 2P9QA 3P26A 2CFIA 2XDQA 4Y18A 4AY2A 1FTWA 1LRJA 1TM2A 2C2YA 2PGDA 5CYOA 5D87A 1FW6A 1I9GA 3PICA 5CLLA 3H8SA 4WFIA 421PA 2Z09A 1I0IA 1XDBA 3ST7A 4EUSA 1QDLB 2XCOA 3VYWA 3PNQA 3RHFA 3ROTA 2BFDA 3N2YA 4A36A 1Z35A 3CZCA 4MQUA 4QODA 1AN0A 2RGAA 3CX6A 3AY6A 3SMQA 1O96B 3R5JA 4WI1A 4HADA 3TUJC 4U4AA 2P1DA 1R5JA 2VQFB 3LK6A 1N3YA 4ZDIA 1XRMA 1ZUD1 2JKYA 1XK7A 2WBLC 1YU6A 3LBHA 1F06A 2OQRA 3X1KA 1ZK0A 2F1HA 2ECPA 3N6VA 4P31A 4ESOA 4RD2A 1AXRA 3D1VA 2WVHA 2Z8ZA 3JRXA 3EA5A 4KB5A 4Z4EA 3OX3A 4NBWA 4TM7A 3RYFA 5B4TA 4QTYA 1F6WA 1Y8RB 4TYYA 2PFGA 4HJXA 1R4AA 4YNBA 1XVTA 1ZP6A 121PA 1LBSA 2HHLA 5IEBA 5I01A 2ZIFA 2BMWA 4ZVNA 2XKBA 5E3HA 5BPFA 3FPKA 4I55B 2WE8A 1OYOA 4HPWA 1M5TA 2VHCA 1FRNA 2D0PB 5KYNA 5ULLA 2DR3A 4YS6A 2PPLA 3AR2A 2DPMA 4NK4A 2ZUDA 3PUIA 3ND8A 5BN4B 4ZANA 1LPPA 3PQ2A 4YQYA 1ID8A 2OQVA 3DOOA 1UBJS 2BGTA 1XB2A 4I46A 4MJXA 3S8YA 1F4LA 3B48A 3U49A 3E6AA 3F3YA 4N0QA 4KDCA 2P9HA 5BV2P 2WP8J 2QJWA 3AMVA 3JYPA 3TLGB 4WY8A 4EELA 5FEUA 2IHKA 3HJCA 3IYLW 2ZROA 1JJAA 3T5MA 3TZHA 3TZLA 1BHJA 3KK0A 2BWJA 1VG1A 4BVLA 3OETA 4RVUA 5EG5A 4D43A 3AY7A 1C0IA 1KU0A 1NJ5A 3ZR4B 5JVDA 3F4LA 3AUAA 4UAVA 2MWMA 4GUDA 1B1AA 1JDBB 1GAWA 3E3OA 5LQDA 3ELWA 2RI1A 5KYWB 3H9CA 3VDRA 2TYSB 1V7QA 4I9GA 3LQQA 4TTRA 4EUHA 2JI9A 2DTEA 1RWOA 3T4XA 4CL0A 2VPPA 4EY6A 2QRPA 5LPNA 1OX4B 4G8BA 4BXOB 1Z2OX 1Y37A 3Q3VA 4P38A 3SMVA 3VOAA 1B8PA 1J4AA 5CFQA 2EFYA 3EP8B 1Q5PA 3LHSA 1N0VC 3DZ5B 2P8SA 1RI5A 2P41A 3TFQA 3TLYA 4HYQA 5EMHA 3P2YA 2W6ID 3HB0A 3EXIA 4J3JA 1WB9A 5EZQA 3G89A 4FQ8A 3WICA 4BQNA 4H1TA 1FYDA 2YXBA 4JBYA 4F60A 1CDEA 3TW6A 2BEJA 3L9XA 4MLZA 4E88A 1SPBS 3KKEA 3DOHA 5K09A 1N7GA 2Q5EA 1VC2A 1ZD9A 3W2FA 2GLXA 1WXXA 1UJBA 5TMBA 5FWXA 5DZSA 5ESRA 4D0RA 3WZLA 2RC5A 1NASA 3GGOA 1L7RA 1NR7A 2ZSUA 4KO2S 3ZE0B 3K70C 4Q7JB 1KETA 1TLLA 2MSDB 1IN5A 3DMNA 5D1HA 5CCXA 1L5WA 1R15A 1SXJA 3B6EA 3D4NA 4DG5A 4PPYA 4G63A 1IL0A 2G76A 4X94A 4EKNB 3UEOA 4W9RA 3PWKA 3PXGA 3KL4A 1TQHA 2AC7A 1MH1A 1MMFB 1BEEA 2BC9A 3DVLA 1U9ZA 3DAGA 3H5VA 4FGLA 1KI9A 2FQYA 1P5HA 1J21A 4ZRMA 5TT1A 2OPHA 1RIIA 1RAIA 3PEVA 4NL4H 2FWAA 4K40A 4GL2A 1IK6A 1YTLA 5J2UA 3ZZUA 3PZBA 1Y7TA 1MKYA 1R0RE 1NI5A 1XVIA 2H2GA 3GA0A 4XJTA 4OHPA 3V4FA 3WGGA 1H2HA 5KU1A 1J0XO 1HY3A 1OC2A 1QG6A 2AQ8A 3VU9B 1YQ9A 1RMTA 1SUEA 4HLUC 3VH1A 1EZZA 4PQRA 4ZALA 1W8IA 1UKAA 3IAS1 3N87A 4X20B 1K0FA 3H2KA 4V03A 2BIFA 2UDPA 2J4FA 4E51A 4DJEC 1ZN8A 3I9NA 2IVZA 4LXGA 1DBIA 2B7CA 3KSUA 1PW5A 2ZJYA 4L28A 4QDZA 4PRYA 1P3DA 4FC7A 4YBZA 1YH3A 2E18A 1YRQA 2ZDGA 5ANRB 3EY4A 4DSOA 1CIVA 1JAHA 4XGIA 2NNLD 4ROTA 4YQFA 3L0BA 1Z4PX 1JU9A 2C96A 3DBOB 4OJYA 4UEWA 1YBHA 4RDIA 4CTJA 4E09A 3IO3A 1FXWA 5JO9A 1N92A 1OA1A 5AK0A 4BHTA 4DC9A 2YJ4A 5HQTA 1V1RB 2FSIA 5KTNA 2ZU0C 3BE4A 2AFHE 2JS7A 3NJ8A 1R6BX 3NPMA 1THZA 2IYVA 2X3FA 2GASA 3G0GA 1E2GA 4RF5A 4RBNA 4RHFA 4YC7A 1IJKA 2Q7OE 3W6OA 1J0DA 1QMHA 5FOXA 1XYYA 4GFDA 4TTAA 1C7QA 3SNKA 3UPUA 1O5TA 3IA7A 1PG5A 3GW8A 5IVIA 4BKQA 4IIYA 4LZAA 1AB6A 1ZNYA 3PKZA 4P4UA 2E4UA 1DO8A 3PPYA 1X7WB 4CN8A 3Q9SA 2ZUFA 1KEKA 2RCNA 3IQEA 4EVIA 1KS2A 3BJMA 1CR2A 1RXEA 4NYJQ 4ZN6A 2QRJA 3L1KA 1A9TA 5F2NA 4IYRA 4B7XA 2Z9CA 4MXDA 2IOQA 1A77A 2BF4A 2F8MA 4ZIRB 5M5BA 2W37A 3MJVA 1I6WA 2QX4A 4KTTE 5KJCA 4HLNA 1SUDA 5TVKA 1ICEA 5ABPA 2NSHA 4BN4A 4ARIA 3HCDA 4DCUA 2FN8A 2ZJ0A 4I5DA 4PYLA 5A0FA 1JE0A 1ZOSA 3MT7A 2ODNA 1NE2A 1U8FO 3AERA 3LYLA 3PI6A 4J07A 4LVCA 4D0LB 1NJ2A 1C50A 3QVKA 1JDTA 5C18A 4QFMA 3TEFA 2YIJA 5JZBA 1OWPA 3PHBE 3H04A 4X1YB 4AN0A 3AR6A 4YRLA 1PWHA 4LF9B 1N5MA 5KJEA 4YRBA 5JAMA 4U2EA 1DCFA 5JYCA 1GUZA 4E2FA 3O2QB 3AJRA 1ZISA 3GDWA 4X63A 1W36D 5B3JC 1P18A 1NUAA 3S70A 1OHHD 1W96A 5EMLA 4DW8A 1Z2PX 1QV6A 3R3UA 4IHQA 4D8VA 4XYEA 3KALA 1UBLS 1M74A 3GCGA 2DF8A 2H1WA 3BCSA 2X0DA 1E2DA 1E60A 4RXUA 1XNGA 2ZXUA 3EG5A 2AVDA 1J9GA 3I2YX 2Z6UA 1G4AE 3RCBA 2VT2A 1EM8A 3TRJA 3I76A 2WT9A 3BN3A 3UT5B 4HBGA 4DR2B 3GG9A 1DFIA 2AW3A 3MHTA 3B8HA 1XU4A 4X00A 4ZVKA 4TWAA 3GOHA 2VBFA 2WD8A 1OT3A 1Y3IA 1C0PA 1T9HA 2JFHA 2YY7A 2ZULA 4JDUA 4CPDA 5C8DA 2HSDA 1HNZB 3A25A 5CVCA 3PQ3A 4ZAYA 5K7SA 2RAFA 1J5XA 1N0WA 4JR2A 2GD0A 4RHEA 1RKBA 4XGNA 3ZX5A 2QMUA 1MB2A 4ZVLA 1G8PA 2LPMA 1G8JA 2WFZA 1U8AA 1E4EB 3K9HA 3TH5A 4UCFA 1S2MA 3RVPA 1OIXA 1C3JA 1AKYA 4W1QA 4FHZA 4H6XA 1J9ZA 5AJUA 2FN4A 3NT5A 2F3QA 2XE7A 2ZT5A 1FTGA 3ZXYA 5FFMA 4N5HX 4KSYA 2RHLA 1NLMA 1E2BA 4KZKA 3AETB 2ZE6A 2DCMA 4TMFA 2CL5A 1XZHA 2UYQA 3UM9A 2AHRA 2EJBA 4ZVMA 4CLDA 1JT9A 1E2HA 5D2CA 3FPHA 1YZ3A 5FPKA 1AQLA 4PAOA 2Y4NA 3OOSA 5CW1A 1Y5RA 2JFUA 2MYUA 3EHDA 3FRJA 3LY8A 5EWMB 4YP5A 2KX7A 2C94A 2GLTA 2IX9A 8MHTA 1NW5A 4I0WB 3FSJX 3GJTA 3GRRA 3PX3A 4WUVA 4EHBA 5IHXA 1F7VA 1V9SA 1Z6YA 2G5GX 2V6GA 3BDIA 4MWTA 2VNJA 2HDOA 1JWBB 1Z2DA 2PUJA 3ANTA 3SZOA 2NO6A 1C1YA 3L8HA 1ONSA 1OI2A 4RJIA 3ZI4A 4FDUA 4HQKA 4ZXFA 5HILA 5K5EA 2W6MA 4UZFA 1QK3A 4GPBA 4EECA 3ILSA 1PGJA 2CXUA 4HSEA 2HB6A 3H9QA 1OPRA 1UMKA 1ZIPA 1OAAA 3KB6A 4N4AA 5FPSA 4BTVA 2ZB7A 1ZH4A 2QJOA 5LKAA 5JQGA 5EYPA 4U3JB 2IP1A 4HN9A 1GRQA 4GE3A 2CKMA 2OZLA 2P6NA 4AJ4A 1LI4A 3KJNA 1W581 3ZIUA 1CVRA 3MT8A 2J5RA 3U48A 4QBTA 3ZJUA 2OHHA 4LCEA 1C7JA 1I3CA 1JLMA 3G2HA 5T6BA 4F3YA 2W00A 3WB0A 2HA6A 1A7UA 4TV9B 3RRZA 3ZHTA 4RTKA 1EEHA 4RABA 1D4FA 4YP1A 4XTCS 1A72A 1N4DA 2O3QA 3F6BX 3IP1A 2BGRA 2HMUA 3F71A 2I7TA 1K7EB 4C7MA 4O2BA 4MAMA 3VSEA 4YTEA 2Z9BA 5FBHA 1Y7HA 4H0CA 4DQXA 1NVKA 1TT5A 2PO5A 1II0A 2BEUA 1ODKA 3K7EA 4O25A 2A0KA 3Q8XB 4YFVA 5BN3B 3C4JA 4UTOA 4IWXA 4CMIB 4DJTA 4K9SA 3KPJA 1NXVA 1CR6A 1UBTS 4HX2A 1DPGA 3WMGA 4RLQA 2XMZA 2CXNA 1OJLA 1Z39A 4FYYA 4IGAA 1UMBB 4YV7A 7MHTA 2QJRA 4RCVA 1GUAA 1WVMA 1PQPA 4U1RA 5F4BA 3MS7A 4IYJA 3UCFA 1LJ8A 3O75A 4I2NA 1C9KA 5AW4A 4FX5A 3CPSA 1J2RA 1OWNA 2SECE 4LCBA 1N9ZA 3E81A 4CFYA 4RL6A 1U2ZA 1ZSVA 5E6SA 3BQ9A 3N8HA 3OOWA 5KOJA 1U0BB 1SCIA 4YT5A 4ESVA 1DRUA 1RQ7A 4IUBS 4TXJA 3AF6A 2RGNC 2P8JA 4OX9Y 1HURA 5EERA 1NP6A 2BE7A 2XNDA 1Y1PA 2G9ZA 3HYSA 4PQGA 3JR3A 4P93A 4B3SB 5FD8A 1JFVA 1KY5A 4Q4HB 5GJBA 1FQJA 3GBVA 1SC4A 2QBYB 3G59A 1YBMA 1D9XA 3LUDA 3TD9A 2C88A 5J2TA 4BLPA 5L3VA 2QMHA 3GUYA 3L7BA 4JJ4A 4ZHQB 1BW9B 2ODAA 4UCXA 3WQSB 2GPWA 2KS6A 4NZZA 3GFRA 3TX2A 4FB5A 4ZV9A 5ICCA 4QG7A 4DEVA 4DMKA 4M60A 1XTIA 4BMNA 1HNWB 3SZ3A 1YI1A 2D59A 1NYRA 4DA8A 3F6RA 4QA9A 1VKJA 3VYUB 1Y63A 4IUDS 3RC1A 1M1NB 4DMCA 4BO7A 1L7OA 1RYFA 3OIWA 4PTZA 1WR8A 4ZVRA 3COYA 4WXEA 721PA 2VQEB 3OZEA 4UXIA 1TUEA 1Z8NA 2PV7A 1PJAA 3A3PA 2QYOA 3HPRA 1IXSB 2OFXA 4KPUB 1L5OA 1NC3A 2A9QA 2EF0A 1T4CA 2ZDHA 4U7DA 2OFWA 1QF7A 1Q0TA 3BBLA 4JBXA 1GP2A 4QAQA 3EFBA 2H57A 3B3FA 4CM5A 4YIHA 3ZE2B 2DSTA 2KM1A 2PBFA 4OKIA 4B3CA 5KYGA 1ZICA 3IEXA 1DUVG 3RSFA 4Y2SA 4EGFA 1IRXA 2RBEA 4NZNA 4F4HA 3GELA 2JGRA 3VMMA 2P6UA 1ZD4A 2XE6A 3LXXA 1SD2A 2GPAA 1UXIA 5CP8A 4AZ0A 3K0HA 3AUUA 3TLBA 4GW3A 1AHNA 1P8AA 1YS1X 5KYVA 1UPUA 3WGNA 4ID3A 1SD1A 2X5JO 1U7DA 2CLMB 2JCYA 1BYUA 3RS2A 1T5BA 2PRZA 1UANA 2ISSD 3TR5A 4QASA 2QE7A 2FPXA 2WJGA 1RYNA 3ELDA 3H5WA 3IHTA 1WUTA 2ERYA 1N5JA 1WOMA 2J31A 1JHAA 4F4DA 4RTSA 3I8SA 3ZI7A 3VR2D 5TARA 4E5PA 1UFVA 1FMJA 3D4PA 3N2KB 4EDHA 2OGTA 1QFYA 4IQ4A 5ELXA 3MYYA 2Z5VA 4DC1A 3DLHA 3KDPA 2Y0BA 1X1TA 2V7TA 3MBOA 4Q4JA 1TTPB 4LA4A 2EQ5A 3EA4A 4CL2A 2IHTA 5TQ2B 1XZBA 3ADCA 4PU0A 1RWPA 3EVNA 3AUSA 4FTWA 4E70A 1T5OA 5AVXA 2PT6A 4CMIA 3GU3A 4Y2JA 3STTA 3L7LA 2Q6VA 4EHFA 4F45A 1Q3HA 3ZHQA 2Q2VA 1X0VA 2ZYHA 1FDTA 2NZUG 1VM6A 2D1RA 4G0NA 3K9WA 5DISB 3ZVLA 2AR7A 3WYEA 4LVNA 1P6UA 2HN9A 5D3MB 3Q8KA 1NVAA 5FJJA 1O5OA 1QNLA 1MU0A 3IVAA 1WABA 1UT5A 1JEAA 5G1PA 4YUWA 1GAQA 3QBEA 4BFYA 1F60A 2UYOA 3WLPA 3GXBA 4ZI5A 4XFJA 1CZUA 4YMSA 1HG1A 1QVVA 4B79A 4X91A 3JTMA 4JSRA 4B87A 4G67A 2JAHA 4M9QA 2GUWA 5AP9A 1PNRA 3GV0A 5IZ4A 3BRWD 1Y34E 4WGFA 4F9EA 3FBWA 2HEIA 3C6XA 3DGFC 4DMRA 2QGNA 2GEKA 1I79B 2NZXA 4FS8A 1RKXA 2WOJA 1PD1A 3ROFA 2R1ZA 5T5QA 5JQGB 1U1FA 3D2AA 2JCSA 1ZRNA 4GLOA 4GSKA 4F11A 1GNSA 1GZDA 1T4GA 2XHEA 4GI2A 2AG1A 4DARA 1K8RA 3ZY4A 4DM7A 3F1KA 2P9TA 1K1EA 5C34B 2HLPA 3EPHA 1ODSA 3HDHA 1U5AA 4RS3A 2QTNA 2VHWA 4MWDA 5LLSA 3V4OA 3KU1A 5CVTA 1P0CA 4EHDA 5C5EA 5KNCH 4BNDB 1KAOA 2WQ6A 3RC9A 1YXMA 1XYGA 5IN4A 3EEQA 1LKZA 4FK8A 1PF7E 2XGSA 1MF7A 3F4BA 1JSXA 2G1KA 2ZJZA 4A8HA 2FE1A 3G8YA 2FZKA 3HUTA 4ZICA 4IHJA 1TLTA 1VLQA 2CNKA 3ZBTA 2PAAA 2OBXA 2HQSA 3TPFA 1GDHA 3CURA 3ABOB 1Z63A 3IP9A 1C9DB 3GN1A 2I3BA 4HWTA 3TOXA 2AEMA 1CEYA 3HJBA