2R042

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
molecule tags Virus
source organism Human rhinovirus 14
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r04200
1M06G 1BBT1 1RUH3 2WFF2 1RUJ3 1AYN2 5CFCC 4YVWB 1A6CA 1FMD3 1RHI3 1QJU1 2HWE1 1BMV2 4CDQA 3VBHC 4Q4W1 1HQNA 2WLPA 4GH4C 3VBFC 1RVF1 2RM23 2WFF1 1AYN1 4Y5Z0 3ZFFC 4WM8A 1AR73 5JZGA 2WWSA 1BMV1 2RS33 5A33B 1COV3 4IV1B 1OOPC 4JGYA 2QQPA 1NG0A 1ZBA2 5C9AA 1HXS3 1BEV2 1RUJ2 1HX6A 5AC93 4CDUA 1RHI2 3J8F3 4QPIC 5D8AB 2FZ2A 3DPRC 1HRI3 4YVWA 1ZBA1 4FSJA 4PDWB 5ABJC 2WZR3 1BEV1 2RM22 4GB33 1RUJ1 3VBHB 1AR72 4CEWC 3VBFB 1RHI1 2RS32 2MEV3 1VB2A 3ZFFB 4LLFA 1VBA3 1HXS2 1R083 1R093 4AEDC 2RM21 1DDLA 5AC92 1OOPB 1OPOA 4QPGB 1AR71 3J8F2 3NAPB 2RS31 1POV3 3VBOC 1PIV3 1MQTC 5D8AA 1HXS1 2WZR2 4GB32 3LOBA 5CFCA 3DPRB 5AC91 3VBSC 3JBG3 3J8F1 1MEC3 4WM7C 1NCQC 5ABJB 1R1A3 4RS5C 2MEV2 3VBHA 4GH4A 1E57A 3VBFA 1AR63 1VBA2 3ZFEB 1R082 4CEWB 3JD72 1R092 2WZR1 1PGW2 4GB31 3ZFFA 1AUYA 1RB8G 3JB8A 1PIV2 2MEV1 1BBT3 1OOPA 3VBRB 4CDUC 1VBA1 3NAPA 1R081 3JD71 1R091 1QJZA 1PGW1 1QJU3 3VBOB 1W39A 3JBG2 1RUC3 1MQTB 1WCDJ 4GMP3 4QPIA 1FOD3 4RFT0 5FMOS 1POV1 1PIV1 3DPRA 4CDWC 5LK7B 1AR62 1Z7S2 5ABJA 4WM7B 2BFUL 4RS5B 1RUF3 1AR93 4CEWA 3JBG1 1ND2C 2VQ0A 1RMU3 4IV1C 1NY72 5C8CC 1AR61 1Z7S1 4AEDA 1ZBE3 1C8NA 1X33A 3VBRA 1RUC2 1FOD2 1QQP3 2RMU3 1BEV3 3VBOA 5CFDC 1VBB3 1CJDA 1NY71 2XPJA 3FBMA 1MQTA 1POV0 4IV3C 2X5IC 4PDWC 1RUF2 4CDWB 1AR92 3VBSA 1RUC1 5L7OB 4GMP1 1TMF3 1FOD1 4WM7A 1NCQA 1RMU2 1RUD3 4RS5A 1AR82 5BNNB 1ND2B 1X36A 1ZBE2 1PVC3 1SMVA 1RUF1 5J96B 1AR91 4QPGC 5C8CB 2DF7A 4RHV3 3NAPC 1QQP2 1D4M3 1OHFA 1RMU1 2RMU2 2ZTNA 1VBB2 1AR81 1PO23 1ZBE1 2BUKA 5BNOB 5CFDB 1TMF2 5DDJ3 4IV3B 4EJRA 2X5IB 1QQP1 1RUD2 2RMU1 4CDWA 1VBB1 4GMP0 3ZFEC 1H8TC 1RUE3 1PVC2 1AL22 2IZWA 4RHV2 1ND2A 1TMF1 5C4WB 1D4M2 3JD73 1RUD1 4RQPB 5A33A 2BPA2 1QJX3 4IV1A 3VBRC 5C8CA 1PO22 1VBD2 2Y26A 1PVC1 4NWWA 4RHV1 5DDJ2 1RUI3 1K5MB 1RUG3 2GH8A 1D4M1 5CFDA 1PO21 1VBD1 3VDDC 4IV3A 2X5IA 3TN93 4PDWA 1RUE2 5A32B 4N53B 3IDEA 5DDJ1 1H8TB 1Z7S3 1QJX2 2HWF2 1RUE1 4QPGA 1RUI2 1TME3 1RUG2 1QJX1 2HWB3 1VRH3 2HWF1 1FPN3 3TN92 4JGZC 1B35C 1PO12 1VAKA 1RUI1 3VDDB 5L7OC 5A32A 1RUG1 1NA1C 1AYM3 4Q4Y3 1VB4A 3ZFEA 1H8TA 2PLV3 3TN91 5BNNC 1VBE3 1ND3C 1C8M2 1PO11 3VBUC 1TME2 1AR83 2BFUS 2FZ1A 4CEYC 2HWB2 2WS93 1VRH2 1FPN2 4Y4YA 1F2NA 1QJY2 4SBVA 1C8M1 5BNOC 4Q4X3 1ASJ2 2RS13 1TME1 2R043 4JGZB 1B35B 1CD3G 1AYM2 2HWB1 4Q4Y2 1VRH1 1VBC3 2R063 1FPN1 2PLV2 3VDDA 1VBE2 4NWVA 1QJY1 2RR13 1NA1B 2R073 5C9AB 2BBVA 1ASJ1 2HWD3 4RR3C 5C4WC 4RQPC 1ND3B 2ZZQA 2XBO3 1AL0G 1AYM1 1AL23 2WS92 3VBUB 4FTEA 4Q4Y1 2PLV1 3CJIC 2ZAHA 1VBE1 4CEYB 4Q4X2 1HRV3 2RS12 1VBD3 2R042 1K5MC 2WS91 4N43C 2TBVA 1VBC2 2R062 4JGZA 1B35A 2RR12 2R072 4Q4X1 1EV13 2RS53 1V9U3 4N53C 2RS11 2HWD2 5L7OA 2R041 5BNPC 1NA1A 2XBO2 4FTBA 1NOVA 1RUH2 4Q4V3 1VBC1 1NCRC 2R061 3ZFGC 5BNNA 4RR3B 1FMD2 1ND3A 4Z92B 2RR11 2R071 1HRV2 2HWC3 3VBUA 2HWD1 4YVSC 5CFCB 2HWF3 3CJIB 4CEYA 2XBO1 5K0UC 1AL21 1RUH1 3JB4C 4GH4B 1FMD1 3M8LA 5BNOA 1EV12 2RS52 1HRV1 2GSYA 1GFF2 1V9U2 4N43B 5GKAC 1COV2 1PGL2 4Q4V2 1PO13 4CDXC 5BNPB 4FTSA 1EV11 2RS51 2HWC2 5ACA3 1V9U1 1HRI2 1COV1 1NCRB 4RR3A 5C4WA 3ZFGB 4RQPA 3S6PA 1PGL1 1C8M3 4QPIB 4Q4V1 4CDQC 4YVSB 3CJIA 5K0UB 2HWC1 1HRI1 3ZXAC 1K5MA 1QJY3 4WM8C 5JZGC 4N43A 1EAH3 1ASJ3 4JGYC 5C9AC 5ACA2 4AEDB 4N53A 5FMOL 4CDXB 5BNPA 1F8VA 2HWE3 1NCRA 3ZFGA 4Q4W3 4YVWC 5FOJB 1MEC2 1RVF3 1IHMA 1R1A2 5ACA1 4YVSA 4CDQB 2WFF3 1AYN3 3VBSB 5K0UA 1EAH2 1NCQB 1MEC1 4WM8B 5JZGB 1R1A1 1BBT2 4JGYB 4BCUA 3HAGA 1EAH1 1QJU2 2HWE2 4CDXA 4Q4W2 5J98B 4CDUB 1RVF2 5D8AC 1ZBA3
chains in the Genus database with same CATH superfamily
4XETA 1HB3A 2FCVA 2PHWA 5CFCC 4Z07A 4OHWA 3GNEA 2PHLA 1VMFA 1RHI3 4FPJA 1JU3A 4CDQA 3URFA 3AKPA 3H1MA 4FPKA 4OUSA 3VBFC 4N7UA 5FZEA 4CE8A 5A6ZA 1CVNA 4X8PA 4XMAA 3I3MA 2VBDA 3MBWA 3AMNA 3T2PA 2DVBA 3UL2A 5FZ9A 5B4NA 3AJYA 1KQRA 4WM8A 1HJGA 5H9SA 4B29A 5FWEA 1CQ9A 2MPFA 3NRUA 3T09A 2RS33 2FDJA 2ZEWA 1COV3 3TNQA 3VHRA 1DYPA 3OPWA 1UY4A 4XBQA 3ATGA 5C9AA 4H14A 4BQXA 2Y6JA 4HG6B 5GLTA 1HX6A 2D6OX 2PFWA 2A3XA 1RHI2 3VDAA 4BLJA 2XVLA 1GNZA 3WT3A 3DPRC 1HRI3 2R30A 4PI0A 2ID4A 4XEZA 2VCAA 1D0GA 2EIDA 4AHYA 4FSJA 4PDWB 4I30A 2WZR3 4GB33 2WDBA 4AFAA 4HETA 1SZBA 3C8XA 1OI6A 4L9BA 4LKFA 2GNTA 3NQHA 3C7FA 2ZXQA 5DG1A 1VPHA 2W47A 2RV9A 2RS32 2R0FA 3AFKA 5D21A 5FY9A 3ZFFB 4LLFA 3J7HA 2P17A 1VAVA 1SLBA 1L7RA 3DL3A 2KA3A 1DDLA 3APBA 2DCTA 4BK5A 3BIEA 3USSA 1OOPB 1OPOA 2FMYA 3U4SA 4A7ZA 3AYAA 2D6NA 4DUVA 2GNBA 3NAPB 1UNBA 3WF2A 2GMEA 1Y9GA 3AMQA 3U75A 3NJXA 5FZ0A 3UGHA 2OPWA 2Y6KA 3ENRA 1XYOA 4AI9A 1GICA 2ORZA 4Y4RA 4IEQA 4XFIA 3KV5A 1UF2C 1SBDA 1HXS1 2WZR2 2VZPA 4GB32 3V64A 1CIYA 5A3UA 3LOBA 2K46A 5I91A 1LODA 1LAJA 2J1UA 3JBG3 4K8RB 3ES4A 1KS5A 4WM7C 5CNAA 1NCQC 5CG9A 3OBZA 2ZZJA 3AC0A 4LE4A 4F8AA 3SISA 3MV01 3ZXDA 3GCWA 1ENSA 1JOBA 5DAQA 1FV3A 5H9PA 2B46X 2DBNA 1EP0A 1DGWA 3PVEA 2JJ6A 3ZFFA 4QM9A 5F37A 1B09A 5FRAA 3CZJA 1IQAA 4XJAA 3FLRA 2VNVA 3JB8A 1O91A 1UPIA 2MEV1 3B5LB 3LWCA 4IEXA 1J1LA 1OOPA 1QIQA 5FPUA 4D6SA 3U07A 1F5JA 4CDUC 5KC6A 3NAPA 3JD71 5A3NA 1QJZA 5F7UA 5FZFA 2MNGA 3BN6A 3I54A 3KF3A 4L97A 1H6XA 4LBKA 3WDUA 2B9UA 1GQPA 1IKPA 3JBG2 1RGSA 4GMP3 5I0UA 5LY2A 2BZDA 1POV1 2NPIA 3PU8A 4NRMA 1PIV1 4AEMA 2JE9A 5T5PA 4AGVA 5E89A 5GZCA 3NMBA 4L99A 1OC1A 2AZ5A 3RFRA 5LK7B 1MS5A 2JDUA 1QJEA 1REEA 1Z7S2 1NKGA 5JI7A 4AHXA 1UY0A 2QCSB 3NSTA 1OKOA 3KT4A 1AXZA 2GMMA 1R1ZA 2A70A 4FBFA 2BQPA 3AKTA 1RMU3 4FPCA 3ZLIA 1VRBA 2VCCA 4OUMA 2KD7A 1NY72 3SITA 5C8CC 2FDIA 4CU9A 3R05A 1PZ7A 1JHNA 3VZJA 3HBZA 2F17A 1W9YA 5KHGA 4YW3A 5ISLA 1DQ0A 4UI9L 5KXBA 2B45X 3R6SA 2E7QA 1QQP3 4UFMA 4EN9B 4S2DA 4OQ9A 1YC61 2EAKA 3GGLA 3VDCA 1UU4A 2D3PA 3AKSA 3ZYBA 4BWOA 1AXKA 3GHMA 4NR1A 2Y8KA 4IV3C 2WL1A 4YGEA 3ZXJA 4N8MA 3WDYA 4YGCA 3I4IA 5F6KA 4D3WA 2CDOA 2DWRA 5HXMA 2YY1A 4WZCA 4LT5A 2LM3A 2VTXA 1RMU2 1RUD3 3M1HA 4FAGA 3K4AA 5GZFA 3NJYA 3GF6A 2BNNA 1V0AA 5JWPA 3SH3A 2XVKA 4A45A 3O0XA 2ET1A 1SMVA 2K0GA 4HPKA 4Q1PA 5J96B 5LRSA 4QPGC 2R32A 2YROA 5FP3A 4DUWA 2ORXA 3R0RA 1QQP2 4CCCA 5A7QA 1PO23 3AVSA 5JIUA 2WWUA 2WYSA 4FFFA 4QT6A 2BJSA 1SLAA 3RZJA 2XJTA 1H2KA 3R4SA 1GQHA 4MGZE 1RUD2 2ZHKA 2ZMKA 4BXFA 3ZYJB 3FE5A 3ZSLA 4BQ4A 4TTGA 3POEA 1RUOA 3HPNA 2XL7A 2EF6A 1STMA 2D93A 1AL22 3NV4A 2IZWA 5E6HA 1W6PB 2VQUA 4HSLA 1CAVB 5FIXA 5FO7B 4COWA 4LO4B 2ZGTA 2Q8OA 5IAXA 1IG0A 1DQ5A 2ARAA 3JD73 4ZZ5A 4DXRA 3HQUA 1QJX3 5EHDA 4CXXA 4Y3OA 2ZPXA 3D5OA 5EXOA 1PO22 3CJXA 5E88A 4LJHA 1YHFA 1WGPA 3VHNA 4XJUA 3CEWA 4XF4A 2ES3A 2ZGSA 3KF5A 3OUHA 2OA2A 1PVC1 2VOXA 2ZKNA 1PVXA 1PNFA 5FZ8A 3W59A 1RUI3 4YW7A 1H8VA 4FPEA 2C24A 3WNOA 4XABA 3OUJA 1D4M1 5FPAA 4DXTA 5GZGA 2CWMA 1YIFA 5A1FA 2VQAA 3QOPA 3WNXA 1W9SA 4CU8A 2QUOA 3H50A 2W68A 2DUPA 4NVPA 2JB8A 3MIGA 4Y5SA 3S30A 1GBGA 1NX9A 1GSLA 2XHNA 5AFBA 4TXWA 1JS9A 1XNAA 5G05L 1QJX2 5FXXA 1CAVA 1GNYA 1J1TA 1GOFA 1HV1A 4FOVA 2GH2A 5C5TA 5HI0A 5CA6A 4LHNA 4OHVA 1LRHA 2RG4A 4IEOA 4X6QB 4OZOA 4XE9A 5H9RA 3B9IA 3WG2A 4COZA 1RUI2 4DO0A 1TME3 2XVGA 4ZS3A 3SQOA 3CQOA 3MW3A 4FP2A 2JD4A 4NIIA 3WCSA 4LO7A 1RJ7A 2JEMA 1Y7BA 5FY8A 3ETQA 4W50A 5A7SA 4AFBA 2XMLA 1FPN3 2VZQA 4YZ2A 4JGZC 4DEQA 5CADA 5A7NA 3JQWA 3HOBA 5FUIA 1LB2A 5IVYA 2WZ8A 4K1YA 4MUVA 3O1UA 1LTEA 1OUSA 1R64A 1RUG1 2E7TA 2VG9A 2ATFA 2WABA 2WYFA 3AXEA 5EZWA 2Y6FA 4TLFA 1ZRIA 2VOKA 4HT1T 1VB4A 1CN1A 1YQ5A 2R1BA 4NROA 3ZFEA 5C70A 5IVVA 4LPLA 5LBCA 2WAOA 5FR3A 3ZM8A 4OLLA 4BOWA 1TME2 1KRIA 4N9HA 1MACA 2VECA 1UY3A 1DQ1A 3AKQA 2WN2A 3IKWA 4BM8A 4FPLA 5HCHA 1FPN2 4XZPA 2E63A 4XQ4A 5LEJA 4Y4YA 4SBVA 2JDKA 3A4UA 3AP9A 3B00A 4DOUA 4UYBA 5FZBA 4PT6A 1CJPA 2DYCA 3NNMA 4Q4X3 2Q30A 3I3BA 4GKXA 3MIHA 2GDFA 5CYYA 3VN4A 2JG9C 5FYVA 4XJWA 2V73A 3FUOA 3FWEA 3WF1A 3N7KA 5DABA 4XCAA 5A7PA 3MGUA 1T6BX 2DURA 4OHZA 1QOSA 3SH4A 3WDVA 3SH5A 5FY7A 1LU1A 3VZKA 1VBC3 3MDPA 1WMEA 4NWVA 1S2BA 3J7MA 1OQDA 4Z1VA 3N9MA 1NA1B 3IMNA 5FZGA 3E6DA 1ASJ1 3CL1A 1H0BA 2HWD3 3AZXA 3QH6A 4QDRA 4AXOA 4B3NA 1OPMA 4IESA 4CCDA 4RQPC 4NHMA 1VP6A 5EYXA 1V70A 2XBO3 5A3WA 4EWEA 2AC1A 4KBBA 4JCKA 2BDRA 5K4LA 1KDKA 3LFIA 4RN5A 2A5ZA 1VBE1 3AJZA 3AP6A 1HV0A 4Q4X2 4BA6A 5HXVA 1O3SA 4XBLA 1JYXA 5FZHA 1RXGA 1GANA 3EYPA 5M0TA 5DG2A 2R7EB 5B2GB 1JZ2A 2XQRA 3AZWA 4Z8BA 3GBGA 4QKNA 4ITCA 1QGLA 1VBC2 1XU1A 4ZXKA 2WO1A 3UGFA 1OUXA 2B5HA 4IE7A 1KD7A 2Y60A 1PK6B 2Y0OA 2RS53 4EN6B 1W0PA 4WBBA 2RS11 2HWD2 4U2AA 4QX7A 1WMXA 4BIFA 5L7OA 4OI2A 5BNPC 2GC3A 5FY0A 1NA1A 2XBO2 1VALA 2VZUA 3WP6A 2HBUA 3U37A 1KXGA 1RUH2 3VL8A 1DZTA 4XXAA 4BQ3A 5BNNA 2CYFA 4RR3B 1ZRFA 1UYYA 3N3HA 2R071 2ARXA 2YFUA 2HWC3 3NNFA 4BHPA 5C7GA 1W04A 1POQA 2ET7A 4Y1ZA 5LBEA 2XDVA 5CFCB 5HV4A 5C71A 1ZZBA 1W2TA 1BJQA 2JXAA 4HK8A 4ZONA 5IAVA 4ZZ8A 4XUPA 1AXYA 3FHQA 4GXLA 5CISA 4XOGA 4COUA 2QFEA 3QD6A 4U36A 3N9NA 1M4WA 1YNAA 4MADA 1GUIA 5B4XA 4YSFA 3GJBA 1SLIA 2BOJA 2XR4A 2RS52 2A6YA 1GFF2 3HBKA 4UAPA 1O5UA 1S0BA 2XJPA 1JTZX 3JQXA 4XAAA 1PK6A 3UJOA 1W0OA 2VMEA 3ZYHA 4LUKA 5C33A 1L3JA 3ZR5A 2FDHA 1UKGA 2K2SA 4V2VA 4FTSA 1AF9A 4KGGA 1EPZA 4KWJA 2BERA 4Q0SA 2NP0A 5E8AA 2HWC2 3WLUA 4CCKA 1V9U1 2PA7A 4RR3A 3ST7A 1VLNA 1VMJA 4D94A 1BZWA 3S6PA 4XZUG 3THTA 1OBNA 2A7AA 3K3OA 4HK9A 3ZMNA 3W5MA 2WQZC 1WLCA 4URAA 4FOQA 3VKFC 3N7MA 4KG8A 4TLGA 4UWDA 4LK7A 1UU5A 2CNAA 3K4DA 3LDKA 1LOFC 4P9YA 1DU3D 1D7PM 4UFJA 4LBNA 4R9DA 3VKMA 1CAXB 2FCUA 2W1UA 4HLTA 4I09A 2BNOA 2E9QA 1TNFA 5JOWA 2W0XA 1UYPA 1ASJ3 3HD8B 3OGRA 4YFZA 3I2OA 5KHKA 2BEOA 4KMQA 2Y34A 3UETA 4BXSV 1W6OB 4N53A 3UKNA 3I2IA 2EVXA 3POGA 4BMEA 1W2OA 1DQ2A 4V1PA 4ES8A 2IUWA 3USUB 3P1IA 1IS5A 5JPNB 2HWE3 1JZ6A 2NM1A 5EJ1B 4Q4W3 5CKQA 3J4UH 2OZJA 2JE8A 4AK3A 1MEC2 1RVF3 2EA7A 4DY5A 4W8JA 1R1A2 5ACA1 3WY6A 2Q1MA 2Q8DA 4AOCA 1WCKA 4YZ4A 2WFF3 1NXMA 4CP1A 3H3LA 1QHDA 2YUEA 3E97A 5FWJA 2QNKA 4XW3A 4P5YA 1NCQB 3MIBA 1PGSA 3POJA 1G9DA 1GMMA 1CAXA 4HKOA 4XF9A 3O0VA 4IEUA 1XNBA 3LA7A 5JZGB 2NQYA 2OKXA 1D0HA 1BBT2 4MGYE 5J36A 3O1SA 2ZEYA 3E1F1 1OFSA 4JGYB 4XPVA 2VBPA 4BCUA 1W0NA 1U5ZA 1EAH1 2HWE2 2EXIA 3PIGA 5DZEA 3BGAA 2JE7A 1ACCA 4Q4W2 3N36A 4CDUB 1RVF2 2W92A 4ZKTB 3USUA 1ZBA3 1O7FA 3SEPA 1MR5A 4GWNA 1M06G 1YFUA 5FZ3A 2WFF2 1RUJ3 4XQWA 1WW6A 4YVWB 4FXKB 4P08A 2V4VA 1G8WA 4IETA 4JDOA 3IAPA 4QHZA 3WEZA 1QJU1 4BZ4A 1LULA 2QQKA 4XUTA 2C5DA 3O1PA 3VBHC 1BMV2 3UJQA 4J6GA 4GH4C 1O3TA 2BVVA 4XCBA 2D5HA 3TEWA 3JCIA 4P9GA 4PHZA 3BUCA 2CTVA 1E5RA 2BOIA 2B7YA 4PBPA 2WFPA 5FPVA 1OURA 4IL7A 5JZGA 1SLCA 1Q8PA 1UXZA 3I2FA 3HNMA 1ODNA 3GZUC 2VULA 4Y33A 5IVBA 4JGYA 2WLQA 2NZ9A 2QQPA 4OZXA 1SCSA 3N9OA 1KS4A 1ZNPA 1ZBA2 3ZPOA 2YZ4A 1Q56A 1BEV2 2RJLA 1KJLA 3AP5A 1RUJ2 1QMJA 1UMHA 5F2WA 3RMYA 4CDUA 2IXKA 3IDBB 2DBIA 1H6YA 4QPIC 2JX9A 4XAEA 4XQDA 3WHUA 1PM7A 4YVWA 1N3OA 1WMFA 1WLTA 2DU0A 4XFCA 3FUQA 5FZLA 3AL6A 1A8MA 2QQWA 3T3YA 3DV8A 5ABJC 3I2HA 5L9VA 3MHZA 4JZRA 1ZRCA 3LSEA 2XXZA 3LEKA 4JHZA 3RMXA 1RTVA 1WCUA 3AMMA 1KEXA 1RHI1 2C4XA 2W52A 4IUGA 3NJVA 4KWKA 4UFLA 4Y1VA 1F4HA 2P6HA 4NHYA 4B1MA 2ZGQA 4ZU7A 2TUNA 1KJRA 1VBA3 4QB2A 1R093 4AEDC 2E6VA 3R4UA 3WP4A 1MZ5A 4QPGB 2VVDA 2IXHA 2RS31 4GULA 2DVAA 3VBOC 2E7AA 2TNFA 3A23A 3MIEA 4UW3A 4E9KA 3WZ1A 2R49A 3WUCA 3WXPA 1BK1A 1YRZA 2QE3A 4ASLA 5KWRA 4AVBA 1H1AA 1TEIA 4JDMA 2D3RA 2W91A 5HBAA 4CU6A 5CU1A 4Q0VA 2AEYA 3RDIA 4QXHA 5GZEA 2XHKA 1Q3EA 3K4ZA 3WNNA 1XRUA 1AX1A 4RS5C 4OHYA 4HSJA 5BY5A 5JXGA 1UOGA 1DGRA 5FZ6A 1E57A 2NYYA 2ZGNA 1VBA2 4AHWA 4J1WA 4CEWB 1G7YA 1C4RA 1R092 1V6NA 4A7KA 5JOYA 2WZR1 1PGW2 2W9XA 2VZ1A 2ZGOA 4GB31 4Q2FA 4RYDA 1Q8OA 5FPBA 3OBTA 3POBA 4IW3A 4LKSA 1UCXA 3N4MA 5FMBA 2XKOA 2DCYA 3LSDA 2JDPA 1URXA 5AC91 2Q4SA 4XF3A 4DRRA 1RB8G 4O9EA 1IGOA 1OXCA 4FT8A 4N7IA 2PAEA 5CKMA 2W95A 3VD4A 3NVCA 4QM8A 5G04L 3H1YA 1IS4A 3B94A 3VKOA 3O1VA 4Q0PA 1QJU3 5DUWA 4PIZA 4LKDA 4CCOA 2PHFA 2D5FA 1UWWA 1MQTB 3IBMA 1FOD3 3FN9A 3AFGA 3MYXA 3T4VA 1SFPA 2XL9A 3MEPA 2KM2A 1YO8A 1W90A 1SACA 3PUQA 2BGOA 2VZRA 3G6JB 5FYCA 5FYZA 2Q1FA 4ZU4A 1RUF3 2LTNA 3ORJA 2W1SA 2UWBA 1US2A 3JBG1 1GWMA 4URTA 4CEWA 4F7ZA 1P8JA 3LGRA 3TB0A 2R16A 5FZOB 1UMZA 4IV1C 3EB7A 3GJAA 4UBHA 1C57A 1YQ6A 2VW2A 3INAA 3FHIB 1O6UA 1WUVA 1Z7S1 1ZBE3 3OEBA 4ASMB 4A6SA 4KH9A 2WT1A 5GZDA 1QH7A 4XBNA 4RA0A 1I1EA 1W8OA 1DBNA 3SXWA 3W5NA 1FOD2 4Z2AA 1LEDA 1CZSA 3UK9A 4JAAA 4I2OA 4YM2A 1W05A 1OFNA 5FKBA 1CJDA 1NY71 2WC2A 3ACFA 1OLME 1MQTA 3FBMA 3JXSA 1POV0 4META 5FZIA 2X5IC 1QWRA 3P3PA 4D7YA 1QOOA 4H2AA 4KL1A 2B4KA 4B4QA 2VZ3A 1RUF2 4CDWB 3O1MA 2WZEA 3LZZA 3T1MA 2EALA 3VBSA 3UKVA 1PZ9A 4NPRA 4GMP1 4B1LA 4QKFA 2PHXA 3ZSJA 4CP9B 1W3XA 2AH2A 4M00A 3HQXA 1DFQA 2V09A 2X8KA 4E2QA 2F6BA 4EYUA 1AR82 2D40A 1MS9A 4LXLA 1ND2B 1ZBE2 3MZHA 4FCAA 3UKTA 3AK0A 1A3KA 1W2NA 4FP3A 4FFGA 1OQ1A 2WSUA 1UY2A 5FO9B 1OHFA 1RMU1 2XOMA 1EPWA 3I59A 1S0IA 3RPQA 2ZTNA 4K6BA 3RGBA 1O59A 3CZUA 3OY8B 2EAAA 4LUMA 2CHHA 3C7GA 3N7LA 5CFDB 2W5FA 1PHMA 5T5LA 1CONA 1GYKA 1JOPA 1JXNA 3DKWA 3H7JA 3LQCA 2WQ4A 3EXUA 3WDTA 1QQP1 4BK4A 3MPBA 4K21A 5EYYA 3ZXFA 4CDWA 4NIHA 3LE0A 1X9PA 4UFKA 3AXDA 5JPMB 2ZMLA 2UYAA 4HZFA 4CP9A 1ZREA 2I45A 2P34A 2VUCA 2WJSA 3K3NA 4XTMA 2J42A 1GP6A 5T52A 2JG8C 3B9CA 4GIQA 1KGYA 1GP5A 1ND2A 1ODMA 4RQPB 1RUD1 2R1DA 3PMEA 3D4KA 4FO9A 4YW6A 2XUEA 3AB0A 4NHLA 2CWSA 3VD7A 4E4HA 1VBD2 2TEPA 3V65A 1Y4WA 4LULA 4YYOA 2SBAA 2W87A 5IT6A 1DGLA 1QXPA 2ADEA 3KVBA 3MUY1 3EMRA 3PNAA 3OY8A 1S1AA 4H55A 4UBGA 4JC1A 4AAPA 1G9BA 4IE0A 5FZ1A 5CFDA 4HOOA 3ILRA 4AQ6A 3AVRA 1ZRRA 4Y1UA 1PO21 4PQQA 3KV6A 3VDDC 1V6IA 1OT5A 1K5JA 2G4IA 1SCRA 3BCWA 4PDWA 3TN93 5K7PA 2YYOA 4IE5A 2FDKA 5D1IA 3N9LA 4AF9A 3NW4A 2V5DA 4I02A 1DLLA 2YC2A 1XNKA 2LW8A 2W3JA 3IDEA 2QQLA 5LA1A 1H8TB 3OEAA 4G9SB 4B4PA 5A70A 1Z7S3 2N7GA 4QHOA 4XDPA 4GWIA 1E5IA 2PXJA 2VBBA 1HDKA 2HWF2 3EO6A 4QB6A 5T5OA 3RRDA 4AEJA 1O5LA 3PVNA 4QGMA 4C91A 1S2EA 1ZYBA 4EE2A 1AX0A 2GN7A 2DTWA 4ISRA 2VNRA 4IE4A 2ETEA 1CAWB 5DUXA 1ULCA 4DFSA 3SKVA 2LALA 3OG2A 1K3IA 1LHNA 1QJX1 2HWB3 2WUHA 2Z2SB 3OOXA 4IEWA 1NLRA 4K9SA 4IGQA 3TNPB 3TN92 1G9FA 2WN3A 4UFHA 3FLTA 4AI1A 1PO12 4YWAA 1W6QB 3NV3A 1HQLA 3WD5A 4CSWA 1JZ7A 1CAUB 1RUI1 1H2MA 4NN0A 3TAYA 1LEMA 1K12A 4FVVA 1OQEA 2OPKA 1FI2A 1RC6A 5I8YA 3AM2A 2JICA 5I0TA 3G7DA 1PNGA 1JN2P 1H8TA 3RYKA 2FDFA 3D0SA 3AMHA 3NV1A 1QNYA 4XFBA 1MZ6A 4PI2A 5FP7A 4QU1A 3VZNA 4FQZA 4TZDA 1DG6A 1JYVA 2D43A 2G19A 3VBUC 1MVEA 3DCQA 4HVQA 2BFUS 3LA2A 2J1SA 4CEYC 4Q8KA 2HWB2 4LKEA 3H8XA 3POYA 2OUHA 4DXSA 1CAWA 1U12A 4XXPA 2BRTA 5LZ6A 3BKZA 1F2NA 2ZJCA 3HVDA 3M3IA 1WLDA 4I3PA 2YMZA 3WNKA 1AZDA 2PQSA 4YARA 5BNOC 1NLQA 2OUJA 4FPFA 2XLAA 1J3RA 1AX2A 1XSQA 2GP3A 1TME1 2R0HA 2R043 1B35B 3V0BB 1O4YA 2JB4A 3GZAA 4M0HA 1W6QA 1DCSA 2J1RA 1FPN1 1LHVA 5FYBA 2BWCA 2O8QA 2JIJA 2PAKA 2RR13 2VMFA 4YLZA 2VVEA 4JV4A 5IFTA 1NE4A 1GOGA 3RI9A 1LOAA 4EQVA 5C4WC 2JKXA 3PUIA 4YW4A 3Q9OA 1ND3B 4MGKE 1WW7A 1AL23 5CVRA 2Y33A 4L92A 2WO3A 1Q8VA 3CMGA 4EN0A 1ZZ6A 1X82A 1DZQA 3C7EA 5FDBA 5LASA 2NMNA 1U5XA 3KS7A 3LD8A 5F5CA 1HRV3 5FMCA 1Q8QA 4LOTA 1HJFA 4NJ4A 5BNQA 3KV9A 1AJKA 4DRVA 5C5UA 2R042 4IXLA 4PLOA 1K5MC 2RDNA 4MX3A 5A80A 2A73B 4M4RA 3A7QA 4CCMA 1LU2A 2HH9A 4N43C 5DAXA 2FCTA 3SCFA 1G9CA 1WW4A 1GZCA 5FYUA 1TZOA 2C1FA 4A4AA 2C26A 3BB6A 1B35A 2RR12 3BPZA 4NUBA 3V0BA 4Q4X1 3KQ4B 3T4HB 3OYWB 1W8NA 1X8MA 5FJKA 2DCZA 3LF7A 3ZSKA 3DN7A 3EBRA 1F5FA 1E5HA 4FTBA 3WOGA 2Y6HA 4BQ5A 2WNUB 3HN1A 1VBC1 1NCRC 5FYMA 2JECA 1N1YA 2P3JA 3MF9A 1FMD2 4P9IA 1ND3A 4Z92B 3ASIA 3RVHA 3OB8A 4LA2A 1HRV2 4XHXA 1X7NA 1YJKA 3HN3A 2HWD1 3M2MA 5FKCA 4EZHA 5FLJA 3BYWA 3CJIB 2QKDA 4MXVA 2XPJA 3D6EA 2XBO1 1I5ZA 5FK8A 3IM0A 4BH9A 3E6BA 3ILNA 4NHKA 1DP0A 1RUH1 2LUWA 1XXNA 2WNVB 1JMUB 3I2GA 3JB4C 4GH4B 5F5AA 3A0NA 1QKQA 2GSYA 2ZX2A 4AVTA 3BODA 2WO7A 1VIWB 3U14A 4RSUA 5A1LA 3E5QA 4FI9A 2JDNA 1PGL2 3K48A 4JTNA 4LEJA 3OYWA 2DVGA 4CXYA 5F9TA 1LHOA 2CY6A 3VKNA 2C6SA 2VZVA 4HXCA 4NO4A 1RL3A 4QKDA 5LCWL 4QGNA 1HKDA 5DN2A 1W6PA 2RS51 2WNUA 5I0SA 1NZIA 2E31A 2HEWF 4R4XA 4DS0A 3H8RA 1SQ4A 2F4PA 2IWGB 3VZOA 3ZFGB 5EIYB 1CPNA 4OMCA 1PZ8A 3A21A 4AFDA 4CRQA 5JSOA 4QPIB 5F2SA 2Q8CA 1LHUA 4PJYA 3M7AA 4PLMA 5ANQA 5A6QA 2B8MA 3OTFA 5FY4A 3W58A 3I3EA 1BVP1 4YVSB 1AJOA 4PLNA 3CJIA 4LR4A 4ASKA 3ZXKA 3DGTA 5JR2A 5K0UB 2HWC1 1NQJA 3PJQA 3WHTA 2WNVA 2C9AA 1Y3TA 4KI5M 4NE9A 1HLCA 1G86A 2ZGMA 4WM8C 4ZU5A 3IB3A 1UKRA 2VZSA 4XIOA 1FXZA 3ALQA 4J1XA 5HPOA 2DVDA 2W08A 1W2UA 2HLEA 3CHXA 3KSCA 3ZN5A 1WD4A 5C9AC 3AP7A 4AEDB 4AI8A 3ZN6B 3OPTA 1MS1A 4LHKA 5LBFA 4CDXB 4DXZA 3ZN4A 2DFBA 3S5QA 4ATEA 5FPZA 2WNEA 3DF0A 4K8FA 4AVSA 1UZWA 2WWJA 2Y0IA 3KGZA 3OGJA 4XFAA 1O4TA 3ZFGA 3N9PA 5JDBA 5FOJB 2CV6A 2V5YA 3AYCA 3BPSA 3DYPA 4XILA 1QXJA 4YVSA 1UL9A 2ZCWA 1XYNA 3OBRA 1AYN3 1KDMA 2VL4A 2AREA 5K0UA 4M3CF 1JYWA 4Y22B 3KHCA 3ACHA 3MLLA 3I3DA 2NMOA 5AVPA 5IK5A 1BVVA 1MEC1 4P9JA 4Y20B 3C7HA 4CUBA 1R1A1 1W8WA 5FFOC 2VMIA 3P3NA 5EJ3A 4DZGA 1GWKA 1UOJA 1HW5A 2YBSA 1BKZA 3IT8A 4IEVA 1LNSA 2YGMA 5EV7A 2NLRA 5FMDA 4MO3M 5JCTA 3ZN6A 5L9BA 1IS3A 2PHRA 4CUCA 2P3IA 4CDXA 2OVUA 3HT2A 2EIGA 3ZMOA 2YC0A 1G9AA 1DHKB 1H2LA 1TQ5A 4AZZA 2XLFA 1BBT1 1RUH3 1AYN2 3F2ZA 5DAVA 5F3EA 3QLQA 1HQWA 2VXJA 1LOGA 1XSRA 5IJRA 2D7FA 4X6RB 4CP2A 2DUQA 2HWE1 3HR9A 3WDXA 5JMCA 1WD3A 2WLPA 4Q4W1 2UU8A 1HB1A 3MO4A 1OF4A 1OH4A 1RITA 1RVF1 2D3SA 3LKJA 1A78A 1Y43B 4C0BA 4E2SA 3IDCB 5DUVA 3D3AA 5DMYA 1UN1A 1XQNA 4KGQA 2RM23 1N3PA 3UNPA 5IUQA 2WFF1 2ZX4A 4KU7A 4Y1YA 3ZFFC 3ZXGA 4Q27A 1ENQA 3SNMA 1IPSA 3PIJA 1XYPA 4Y20A 1AR73 2YV8A 4NAMA 2WWSA 4Q0QA 4IQPA 1BMV1 5A33B 2ZA9A 4AI0A 4DIQA 2G9GA 1RINA 5AVAA 4IV1B 1OOPC 4NPMA 3K75B 1ZZ9A 2XJQA 5L36A 5IW0A 3RZHA 3HMYA 4BDVB 3NV2A 2VUDA 4G4FA 5FXWA 5AC93 3LDBA 5D8AB 3J8F3 5FAXA 2C9KA 3GBWA 4F3JA 2WNOA 1CGPA 2E51A 5EP9A 3NNGA 1YQCA 2XG3A 3L2YA 3O1OA 1UYXA 5EQUA 1SG3A 4CVUA 2YFZA 4Y1XA 1ZBA1 4UOJA 1FNZA 2E33A 1BEV1 2RM22 1JODA 1ULDA 1RUJ1 4XMIA 2QZ2A 3WW4A 4KG0A 2A6ZA 3U78A 5K9YA 4L2NA 1W28A 2YHJA 3CDZB 4OULA 1AR72 3VBFB 5CKNA 3VV1A 2D6PA 3OF1A 3WP5A 4QXBA 4R9AA 4IDZA 4GKYA 4EWDA 1LGCA 4GAZA 1R083 3J9SA 5F8PA 1PX4A 2EIEA 2Q5TA 4CCLA 1SBEA 1UY1A 4Y5TA 1JBCA 1QDCA 1GZ9A 5AC92 1OD5A 3JUUA 4OQ8A 3PURA 1TE1B 2QDNA 2GZWA 3J8F2 2AACA 2AYHA 2DTYA 2IFWA 3KQRA 3OD4A 5DAWA 3PDQA 4QDSA 4DPNA 4FQ4A 2EXKA 3W20A 5GJ6A 2XQXA 1NT0A 3PTYA 2VGDA 1ULGA 3ZR6A 5D8AA 1S2KA 2CL2A 4OI0A 3ABZA 2O1QA 1FNYA 1PX3A 2OZ6A 4IEPA 1Y9QA 5DUUA 3WX5A 5CFCA 3I2KA 5FPXA 3DPRB 3HT1A 1LGNA 1RJ8A 3O14A 1C1LA 3J7LA 3PMSA 4CP0A 1E5SA 5J3UA 1MEC3 5LATA 4AE2A 1R1A3 5FOBB 4AG4A 5IVCA 4RGKA 2CAVA 2VXRA 1WCQA 1OLMA 1AR63 2UURA 4MH0E 5FYIA 1R082 3VBFA 1ZZCA 2UY9A 4F83A 3TRSB 3OGSA 3P5BA 5KBFA 2ZX1A 4EV0A 2JG8B 5EFUA 1XBFA 4MV2A 1AUYA 2RJ2A 2FBEA 1YWKA 1VE0A 3NL1A 4UW5A 2YPDA 5DQ0A 3SEEA 1GR3A 2VTXJ 1BBT3 4HMZA 4PIYA 2O8OA 3BU7A 3SCGA 2ZMNA 4XTPA 1VBA1 4A3ZA 1ZA7A 3UGGA 5BYNA 1BXHA 1R091 3T30A 1W8ZA 4WVZA 5A3PA 1PGW1 3Q8BA 1N47A 2QQJA 1MPXA 2JDAA 1UQXA 3KHBA 1RUC3 2V4AA 1WCDJ 3FBYA 3BOWA 3M3OA 4RFT0 5FZKA 5FMOS 2PHTA 4AW7A 3DPRA 3VB9A 1XNTA 1PMHX 2D6MA 5HCFA 4IERA 3A0KA 1AR62 1H2NA 4LBJA 4QDQA 4WM7B 3J26N 4P00B 4E8CA 5I93A 1ULFA 1WBLA 4AQSA 5FY1A 3H3UA 3VHOA 3ZO0B 1AR93 1OVSA 4BQYA 1IOAA 4BQ2A 2VQ0A 1JI6A 3VHPA 2C0ZA 2WO2A 2H0VA 4ZS2A 3VD5A 3I97A 1S0EA 4LMFA 4QQLA 3O1RA 3K2OA 2GAUA 2EXHA 1XC6A 5FLIA 1BCXA 2UWAA 4UW4A 3RYPA 3B93A 1C8NA 1W6OA 4CU7A 3RJRA 4YW2A 3IIAA 1RUC2 3BOPA 4D6RA 3O0WA 2RMU3 1BEV3 1OA4A 3DXUA 4G3YC 4D8MA 1W9FA 1DQ4A 1VBB3 4JKLA 4YFWA 2PTMA 1U5IA 4XIKA 5FYTA 3OJBA 3VZLA 2HKXA 2H6BA 1UX6A 4HANA 4QX2A 5EWSA 2Z4FA 1AR92 1GNHA 1US3A 3C2UA 4NIDA 1TMF3 1FOD1 3LEIA 4WM7A 1NCQA 3HQRA 3DKQA 3LIHA 1UU6A 2VMCA 2W94A 4IEYA 1CZVA 1ENXA 3M4FA 1XPWA 2A6VA 1TG7A 2BV4A 1ZA4A 4K20A 1EYBA 2WIIB 1QJFA 3SHRA 1SDWA 1WA6X 1DGWX 1RUF1 4YGBA 2IC1A 2AEZA 3MW4A 5C8CB 5JSPA 4RHV3 2W1QA 2W39A 3VDBA 3PUSA 2PQQA 2DDUA 2RMU2 4HVOA 4QPWA 5FUPA 1RYYA 1HN0A 2JDYA 3WF0A 1S0FA 1VBB2 2YPJA 1ULPA 1AR81 4CZSA 1W8TA 1ZBE1 2BUKA 4CTEA 1W8FA 5BNOB 2OQ6A 4TN7A 3U10A 5APAA 1TMF2 5DDJ3 4IV3B 4QMAA 4EJRA 4LIUA 3E6CC 4O61A 3LFMA 4BMBA 2P2KA 1Z0HA 4LBQB 5GM0A 4GMP0 1SLTA 5SV5A 3ZFEC 4I0WB 1JHJA 1RUE3 2KR2A 4QQHA 3ZXEA 1IPKA 4PQ9A 3ZPYA 1VR3A 3KZ4C 4RHV2 2CU5A 3FL7A 2BYVE 1OSGA 3MIDA 4K7JA 4YPJA 3SMHA 1O8PA 4QHBA 3FC0A 1S4CA 3K51A 4RFRB 5FYSA 1HB4A 2BPA2 2E26A 2HYXA 1H4HA 4UF0B 2IXIA 3VBRC 5C8CA 4EROA 2RDRA 4GJYA 2AENA 4KWLA 5JVVA 4C90A 5HCAA 3C7OA 3DXTA 2VMGA 3ECQA 2WQ8A 3CIHA 1MS8A 5LRRA 4E27A 4HL0A 4BISA 4NWWA 4DEVA 2VCMA 5DDJ2 1K5MB 5F3GA 3HNBM 2F4LA 4WVMB 4GD4A 1L7QA 3D0JA 4HKWA 1KFXL 1WW5A 2PYTA 4XF1A 1VBD1 4XHBA 4IV3A 3ZSEA 1RUE2 1U5YA 2QTWB 5A32B 4LBQA 1QDOA 1TNRA 2P3YA 2X10A 4P9XA 5J1XA 2G9FA 3WVJA 3I8TA 4QU2A 4E4ZA 4L8QA 2BU9A 2BP6A 2VOVA 5FQ0B 1UOFA 4LITA 2PHUA 3TYJA 3UT0A 3WNPA 3WNMA 3A22A 4AGRA 1NQDA 4UF0A 5CB7A 2VC9A 3NKGA 2V72A 2VMDA 4QPGA 5KXDA 1OH3A 3GXUA 4GWMA 3DYMA 4DINB 2ZS6B 2YU1A 4MYEA 4CPBD 3I2DA 4AL9A 5FXZA 1VRH3 2HWF1 5T55A 1XE0A 4UXAA 3WQ7A 5BV6A 1JZ5A 3I7DA 2VUAA 4LHSA 4WVMA 4LO8A 5I0DA 5GLWA 5DAPA 4DQAA 4P02B 3RNSA 3OUIA 4QX5A 3ZYRA 5A32A 5KC5A 5L7OC 5C3RA 2X53S 4JX0A 3ON7A 3ZVXA 3RZMA 1NA1C 1AYM3 4MGTA 3KMHA 2ZEZA 3POWA 4LBOA 4Q4Y3 5LEKA 5A6XA 2PLV3 5F32A 3TN91 5BNNC 1C8M2 2WZPP 2Q8EA 1PO11 4ARXA 4I01A 3WR0A 1D4VB 2CGPA 1AR83 2O0OA 4PBOA 1RIRA 2FZ1A 2RDQA 1IG3A 2Y38A 4YG3A 3O7OA 4RL7A 2WS93 1VRH2 2BTVC 1GP4A 3WUDA 3TWIA 2ZGLA 1WKYA 2HEVF 1QJY2 3H8UA 2J22A 3WW2A 2GMPA 2VH9A 4COYA 3THDA 1CX1A 3JZVA 4JGZB 3W9AA 1LKNA 2P3KA 1JH5A 1PK6C 4GJZA 1AYM2 2HWB1 2J1VA 4Q4Y2 4AQ2A 2R063 2PLV2 2YGLA 5L73A 2VD7A 4Q0UA 4DUXA 4Y24A 5KHHA 1GV9A 2R6QA 3PJYA 5C9AB 1YQ2A 2NN8A 2OQ7A 2CDPA 2BBVA 3FJSA 3T2TA 1JYTA 1OVPA 4RR3C 3ZXLA 3ZX7A 5FZOA 3RI8A 2ZZQA 4YG6A 5FV3A 1AL0G 1CPMA 2ARBA 2D44A 2Q0AA 2WS92 4WVVA 3ZDSA 4GA9A 4DY3A 4AI2A 3AZVA 5JXJA 3KT7A 2FMDA 3POFA 2WA4A 3ZOIA 1C5IA 2E53A 3Q8CA 4MG2A 3KGLA 1YFWA 1I9RA 4GZ9A 2Z79A 2HEYF 4QD2A 5FZCA 1VBD3 4FPYA 1Z78A 1HB2A 2B39A 4LIVA 3LEMA 1YFYA 2KXLA 2R062 3FZ3A 4E8DA 1W9TA 2JG9B 1O4ZA 1JU4A 4JGZA 3S57A 4IE6A 1IQDC 3E5XA 4EN8B 5E1RA 5GALA 3PVBB 3RSJA 1EV13 1LCLA 3LPFA 4LORA 3PL0A 5FJHA 4N53C 4Z2WA 5C6CA 2CGOA 3KB5A 2R041 3D8CA 4MLOA 1YI9A 3VGIA 4FPHA 4CUAA 1NOVA 4QQOA 4Q4V3 2OX0A 2B42B 4YGDA 4N90A 2ZX3A 4ZXEA 3ZDVA 1CESA 2RHPA 2RR11 3N9QA 2ZGKA 2D6LX 4X8NA 2RJKA 2XLGA 5DZFA 5T50A 2HWF3 3WQBA 4FAHA 5KXEA 3OD0A 1D2SA 1IPJA 1FYUA 2ARCA 3DEMA 4JVAA 4HONA 4ONUA 4NOTA 1AL21 3SKJE 2VPVA 2OYZA 1H9WA 2CSGA 3OPZA 1JZ8A 1YFXA 4LQRA 1FMD1 1KITA 1JYNA 1EV12 3E5UA 3T0BA 1HRV1 4S2FA 5GKAC 3ACLA 3BTXA 3OSDA 1COV2 2JG9A 2QQNA 2P37A 3H8OA 1SFYA 1BYHA 4H7MA 4Q4V2 4CA9A 1NYWA 1PO13 3H7YA 4B7EA 4XYXA 1X8EA 4NRPA 5FLHA 4KU8A 2GNDA 5BNPB 3TEZA 2Q1ZB 2Y6GA 1YUDA 1HRI2 4OVEA 1UIKA 4MVTA 2YBPA 4MSVA 4RQPA 2A75A 2DCKA 1V6KA 3KCCA 1PGL1 1LECA 4FOYA 2PELA 3H3ZA 2VY0A 3LCPA 4Q1RA 5LY1A 5LWBA 1H30A 1PMIA 1V6LA 5DXDA 3VKLA 3WG4A 2YU2A 4OI4A 3ZYIB 3ZXAC 1O8SA 1S55A 4KWUA 2A3YA 4FOWA 3ZYFA 1QU0A 2GP5A 2XKPA 4XDQA 3BALA 5JZGC 3RZLA 4B8EA 1NUKA 3M3QA 5J48A 3LIGA 4XFHA 1OA3A 3L2HA 4JGYC 4KNCA 1C1FA 1YXWA 3BI3A 1S0CA 1UZYA 3GZTB 4XFGA 4M3CE 4DNYA 3S5AA 5BNPA 3NKTA 1T6GC 3VL9A 1X50A 4Q26A 1QF3A 3O1TA 4K1ZA 3H9AA 1F15A 2P4EA 2XB6C 4AR2A 4ISQA 4LA3A 4XDOA 4I3GA 2VQTA 2QJVA 3KWVA 4YVWC 3CKHA 3IN9A 3WW1A 4W65A 5DZGA 5IYYA 3MI8A 3MPPG 1UOBA 2LROA 3UESA 3IZOA 3B69A 5FBJA 1REDA 2Y6LA 1QOTA 4O65A 4XUNA 1W6MB 3T0AA 2A6WA 4CCJA 1OD3A 1W9WA 2GNMA 4XJZA 5C8WA 5F6LB 2ERFA 2XONA 4IGOA 2J1AA 2RVAA 1DYOA 3Q8FA 3KM5A 3FHAA 3PUAA 3R4DB 1CAUA 1F4AA 4N9IA 4HPKB 1XB9A 4AEKA 1DF0A 2AGSA 4W4ZA 3U11A 2ZGPA 5IVFA 1JYCA 4PIXA 2X09A 5J09A 5IK7A 3GCXA 1QXRA 5JXHA 2ZEXA 4Q8LA 3MF6A 1GZWB 3IWZA 4BIOA 4YZ3A 1A6CA 2P1BA 1FMD3 5BUVA 1CIWA 4D7TA 1CX4A 3GDBA 3FFZA 2OW4A 5FP4A 1J3QA 1BLZA 3WF3A 3MLKA 1HQNA 4LHLA 2FDGA 3W21A 1LOFA 5H9QA 1W6MA 3AL5A 2EIBA 3J7NA 4YW5A 1WWYA 1AYN1 2ZABA 1GKBA 4Y5Z0 3H0OA 3KLSA 4PCRA 4BQWA 5DPNA 1UZZA 1YYNA 4Z82A 5CBLA 2G1MA 2ZHLA 3OCPA 1SPPB 1LJ7A 1WLWA 4J25A 3VLBB 3ZYPA 2PHDA 5HCBA 1NG0A 1HIXA 3RS6A 4BJ0A 1HXS3 3I3QA 2GN3A 5E16A 2E32A 3AP4A 5LA2A 5LK5A 1GZWA 2LRPA 2ZHMA 4INDA 2FZ2A 3BVCA 2VU9A 4ZY9A 4M01A 3RQ0A 3GBFA 1UZ0A 2YG0A 4HKLA 3DECA 1BHGA 3NWKA 2W2IA 2J7MA 2VOTA 2XJVA 2Y64A 2ENRA 2GU9A 3K46A 4GQ7A 3VBHB 2A3WA 4BPZA 4YZ1A 5C3OA 2XWJB 4CEWC 1JZ4A 4PF1A 2BWAA 4KBZA 4C1XA 2WBKA 3GYDA 3WQ1A 3B3QE 1RXFA 4MHUA 2MEV3 4B4RA 4BYYA 4E4SA 1VB2A 2XJRA 3ZKUA 1GLHA 4R9BA 4O7XA 1JOJA 1I6XA 4I0BA 4XC9A 1X9TA 3EQEA 3MIFA 3RWNA 1HXS2 2I2SA 2QVSB 4EZ4A 3MUZ1 2RM21 1ZX5A 1WBFA 4HN1A 1NAEA 1JW6A 1SPPA 1U0AA 2VTFA 1S0GA 1N1SA 4K3UA 4S2GA 4AI3A 2UWCA 1AR71 4TWTA 2VMHA 4RD7A 1POV3 1HN1A 1PIV3 4ATFA 1EUTA 1Q5OA 2VZTA 1VAMA 1XU2A 4QB1A 4CYDA 1MQTC 4C1WA 1SEFA 2WRAA 4BLIA 2DCJA 4OYUA 1UW8A 2A6XA 1DGRN 2VW0A 5EJZB 1SHWB 1W3VA 5IWFA 4AGGA 2VVFA 2CGNA 4OFGA 5LA9A 1ULOA 1NXD1 4JRLA 3RWKX 3VBSC 4CPBA 3J8F1 3ZYGA 1FAYA 2GC2A 1F31A 4M4PA 5ABJB 3U1XA 4Q29A 1J83A 1SFNA 2MEV2 1Q43A 3OGVA 3VBHA 2QQMA 3QBQA 4GH4A 3PU3A 1GZTA 2Z5WA 4LBQD 5FZAA 2XUMA 3ZFEB 3JD72 4FFHA 2GC1A 3GM8A 1J3PA 4LOSA 1UIJA 1IS6A 5IATA 3BTZA 1O3QA 3V56A 1J58A 4JQRA 3P6BA 5IK8A 2MHFA 2VUJA 4XVHA 1PIV2 5I8TA 1OA2A 5F3IA 1LESA 3VBRB 4D69A 3T08A 1UAIA 2W1WA 3B7MA 5ERLA 5FYHA 3X29B 1R081 2WSVA 3KCYA 4Y26A 2J1TA 5JAXA 1YJLA 1OMIA 2JDHA 3VBOB 3SLIA 5TSWA 1W39A 5JOXA 2IXLA 2UYBA 4QPIA 3LPGA 4W6YA 3I49A 2EXJA 1UXXX 2G9ZA 4M0NA 1S0DA 4CDWC 1GQGA 2HBTA 4LTAA 4HFSA 4JDNA 5IVEA 2XJUA 1C28A 3WF4A 5ABJA 4V2WA 2GALA 1MS0A 2BFUL 2QQUA 2XGXA 4RS5B 5JMOA 3MFAA 5FZMA 2ADDA 4YM3A 4TSVA 2RDSA 1H4GA 1ND2C 1XJAA 2QZ3A 2VO5A 4QX8A 5FREA 4BB3A 1MS4A 1NZCA 2OXBA 2VNGA 4W6XA 2VNOA 1AR61 3ETPA 4AYUA 4AEDA 3BTAA 4A6OA 1X33A 3AMPA 3VBRA 2QQIA 5L19A 4AWDA 5FO8B 1FV2A 1H1IA 5BPXA 4QX1A 4QQ2A 2ZGRA 2JDZA 3LEGA 3IIIA 3VBOA 1CZTA 3WNLA 2Z69A 5CFDC 4L11A 4E4DX 3CF6E 4YW1A 4JKKA 1UO9A 4XACA 4QKBA 1WZXA 4AFCA 4PDWC 1YIPA 2VZOA 4CCEA 2K9ZA 4TYSA 1UYZA 1YEWA 2DFCA 1UPSA 1WMDA 1JUHA 1LOBA 1RUC1 5L7OB 3VD9A 1GU3A 2WT0A 4RS5A 5T3NA 4Y22A 5GLUA 3KCXA 3PUHA 1LHWA 5CIRA 5FP9A 2VE1A 3KT1A 4R9CA 5BNNB 5IK4A 1X36A 3VZMA 3T2OA 4AFMA 1XE8A 3KVAA 1PVC3 1CR7A 3TBDA 5K8SA 5A7OA 5KHJA 1CWPA 1AR91 3EJKA 1IZ3A 2DF7A 3PHMA 3NAPC 1APNA 2W46A 1D4M3 1LOCA 2IVIB 2AR6A 1XNCA 4MXWB 1W6NB 2ZKLA 3UYJA 5FPLA 2JWPA 1OLQA 3HEIA 3MFCA 3O5SA 4YG0A 5FUNA 3MW2A 3WG3A 4C0HA 3H42B 4IEZA 1ST8A 3AYEA 5I8SA 4NIAA 1K42A 4MGSA 5FK7A 5CZKA 1A8DA 2YB7A 2O14A 4R8HA 4XJ9A 5F1RA 3B02A 2OS2A 4QGLA 2X5IB 5SV8A 3MICA 2RMU1 5A6YA 2DVFA 3NNJA 1G6NA 1VBB1 3OGGA 1RUNA 5F3CA 3WCRA 3BTYA 1DIWA 1H8TC 2BBAA 3ACGA 3WV6A 1PVC2 2VJXA 3GZEA 4OUEA 1H9PA 4XF0A 5JSRA 4YM1A 3MV11 3T2QA 5A3OA 3ZIXA 3TEYA 3ITQA 4BQ1A 1TMF1 2BGCA 5D2AA 1ENRA 1D4M2 4FPGA 3ILFA 5A33A 3UV9A 2I07B 4IV1A 1SBFA 5A3TA 4FPOB 3T0DA 3HIFA 2JD9A 1QEXA 5IFPA 1T2XA 2Y26A 2ZGUA 2WA3A 4MXWA 4JRAA 1W6NA 3LB9A 4EWAA 1ZVFA 4RHV1 3IAQA 2YBKA 4RGGA 2GH8A 1RUG3 3PLQA 1ZZ8A 1EUUA 5F5IA 2IXJA 1OKQA 4L0PA 5F5QA 2XWBB 4QX3A 2X5IA 5T54A 3TEXA 3PTRB 4NIGA 1ONAA 4MGQA 5F39A 4N53B 1ZZ7A 4YZ5A 4QPYA 2JDMA 5DDJ1 4XURA 2LS6A 3S7EA 1ZM1A 5LA0A 1VJ2A 3D82A 1W06A 2DUOA 1BQPA 5JXIA 1RUE1 3IMMA 1IKQA 2RE9A 3NNLA 3BU0A 2YDEA 2FQPA 1JYIA 4A44A 2JIGA 1ULEA 2VOWA 1RUG2 1F9KA 4H7LA 2D6KA 5AFEA 2D97A 3NO8A 4CCNA 2WINB 3ELNA 2ZACA 1XOYA 1FX5A 1B35C 3HJRA 3S7IA 2HJIA 4FXGB 1K45A 2JKBA 2VAUA 4NPLA 1UD1A 2EICA 2FHRA 1VAKA 4OHXA 2P6CA 3VDDB 4XFFA 2FD8A 1ALYA 3ZIWA 4UW6A 4P5HA 5GLVA 5A3MA 4D6QA 4PF5A 1TVGA 4NHXA 4H3WA 1KFUL 4D7SA 1DZRA 4LO5B 5C3SA 4CUGA 1PM4A 1VBE3 1ND3C 1V6JA 5L9RA 2CAUA 4MZUA 5JI9A 1Q8SA 4WV8A 3WDWA 3ACIA 2JG8A 5FY5A 4NRQA 3L9JT 4QXKA 4AQTA 1AHSA 3CNAA 5J37A 1JUIA 3IDAA 2WKKA 4QXCA 4BU2A 4AVVA 1XNDA 5IHRA 4S2HA 2PN5A 4JQTA 2OIIA 5CAZA 1C8M1 2PMWB 3VUOA 1NE6A 5JOZA 3RG0A 3S0MA 3RZKA 1ASJ2 2H0BA 2RS13 3BIWE 4YM0A 5LBBA 3RJ2X 1J59A 4MHRA 2PAMA 2I74A 2WT2A 1CD3G 3HWJA 3KD4A 3N35A 4A3XA 4ET7A 4WZFA 2DU1A 3AKRA 1VRH1 5FBZA 3VDDA 4R4ZA 4WVWA 1LOEA 4DMIA 1VBE2 4LLOA 1QJY1 4KQ7A 2R073 2WNUC 2ILMA 4ZHNA 2VW1A 4UT5A 4QQPA 3RZGA 1WCSA 2B9VA 3M70A 1QNWA 2D98A 3RZZA 4MOAA 4ORFA 1AYM1 2A71A 3AZYA 5FP8A 4CXWA 5FXVA 3VBUB 4FTEA 4LE3A 3NJZA 4M3CB 4Q4Y1 5C3QA 2PLV1 1YI7A 1MS3A 2H6CA 1I5PA 1I3HA 2OT7A 2ZAHA 3CJIC 2X05A 3FLPA 4CEYB 4AHZA 1FATA 1N3QA 3HNYM 5IVJA 4CDQC 3AYDA 4JTOA 4R52A 1GOHA 2RS12 2WNVC 2BW8A 4A42A 2WS91 4LO6B 1GWLA 4AAXA 5KHIA 4MGIE 2TBVA 1YLLA 5EPAA 3WG1A 1W8UA 2ZAAA 3IPVB 3O12A 4LK6A 2R072 2ZX0A 3POIA 3THPA 1V9U3 1FT9A 3DYOA 5I0RA 4JHTA 5LB6A 1UZVA 1N1TA 2ZHNA 1NLSA 1L7LA 1SLLA 4OI1A 1QH6A 4A41A 2R061 3FFQA 3QH7A 4QWNA 1MVQA 4QAWA 3ZFGC 4YRDA 1S0JA 1W8HA 4W6WA 1F35A 2Z42A 5FTTC 4LBLA 3VBUA 4LNVA 4M3CA 4ZPIA 2J1EA 4YVSC 4HVRA 2IXCA 1AVBA 3C3VA 4CEYA 3DUIA 4FFIA 1DQ6A 3ES1A 5FZ4A 5K0UC 3M3CA 2L9LA 5CEHA 4BE3A 2VCBA 1UMIA 3WSOA 3SCHA 4P9WA 2VR4A 3LOIA 4OCTA 4I0AA 3M8LA 4IGPA 4NAOA 4COVA 1SDDB 5BNOA 3KV4A 4XUQA 3CO2A 3M3EA 4E2GA 1V9U2 4N43B 2XJSA 4GWJA 3CBNA 3GHNA 2IFRA 1V00A 3AZZA 3IPVA 2GC0A 1MZEA 5A7WB 1PMJX 3F95A 3RYRA 4ES9A 5JLVA 1XE7A 2AUYA 5JR7B 3AX4A 1W2AX 4Q5OA 1W99A 3I2JA 3H1WA 1N1VA 5ANNA 2X29A 4CDXC 2QQOA 1EY2A 3CLPA 2UY8A 2IVJA 3Q8AA 4JKMA 1EV11 1DLCA 3THCA 3TOJA 4DB5A 1VMHA 4AVAA 4B7KA 5ACA3 1COV1 2YC4A 1NCRB 3ZKYA 1A34A 3K77A 5C4WA 2VM9A 1UX7A 1C8M3 5HV0A 4NMIA 4Q4V1 3FX3A 4HBNA 1V6OA 4AVCA 1H1MA 4P9LA 3CU7A 3WQ0A 3U4XA 2JENA 4A7YA 3PVOA 4HN0A 2DV9A 2WAAA 3WP3A 4A2UA 5C3PA 5J7MA 1HRI1 2SLIA 4QX0A 4XUOA 5KR7A 1K5MA 1C5HA 1QJY3 5BXXA 3U0ZA 4N43A 1EAH3 2BVBA 2QDRA 3JU9A 4EN7B 3V0AB 3QCWA 3Q8EA 4ARYA 5A7WA 5JIAA 3LA3A 1DYKA 5ACA2 5FCCA 2WR9A 4LBMA 5FMOL 2XH6A 4XJ8A 4P14A 4C8DA 3LDRA 1W03A 3SC7X 5C4WB 5FQ0A 1F8VA 3N7JA 1O3RA 1NCRA 4D0QA 2ZBJA 3ZSMA 3EHKA 3FMGA 1YQ8A 1IHMA 1REFA 2A1XA 3ME2A 1J84A 3GALA 4CDQB 5JUVA 1QY4A 2HYKA 4SLIA 5T5JA 3WINE 2QBXA 3VBSB 3LAGA 1WA4A 5KXCA 1D2QA 1EAH2 4OMDA 5FYYA 5FZDA 4GALA 1BK0A 3POSA 5A1AA 1LGBA 5FZ7A 1LENA 4K40A 1C3HA 5LW9A 4WM8B 3T1LA 3VD3A 1ZRDA 3V0AA 1Y9MA 4UFIA 1YCIA 4RGAA 1LR5A 1MZFA 2BNMA 2YXSA 3OBAA 4O9GA 5CG8A 3HAGA 3MLJA 1OF3A 3B01A 1QJU2 3QACA 2QQVA 1OLRA 3I59B 5GLZA 5A3LA 4YNIA 1JZ3A 5J98B 3WW3A 2BGPA 5D8AC 2ZOEB 2P5BA 1V6MA 3ROUA
chains in the Genus database with same CATH topology
4XETA 2PHWA 5CFCC 4Z07A 4OHWA 3GNEA 2PHLA 1RHI3 4FPJA 4CDQA 3URFA 3AKPA 3H1MA 4FPKA 4OUSA 3VBFC 4N7UA 1CVNA 4X8PA 4XMAA 3AMNA 3UL2A 2DVBA 3AJYA 1KQRA 4WM8A 5H9SA 4B29A 1CQ9A 2MPFA 2RS33 1COV3 3TNQA 3VHRA 1DYPA 4XBQA 3ATGA 5C9AA 4H14A 5GLTA 1HX6A 2D6OX 2PFWA 2A3XA 1RHI2 4BLJA 2XVLA 1GNZA 3WT3A 3DPRC 1HRI3 2R30A 4XEZA 1D0GA 4AHYA 4FSJA 4PDWB 4I30A 2WZR3 4GB33 4AFAA 4HETA 4L9BA 1OI6A 2GNTA 5DG1A 2RS32 2R0FA 3AFKA 3ZFFB 4LLFA 2P17A 1VAVA 1SLBA 3DL3A 2KA3A 1DDLA 3APBA 2DCTA 3USSA 1OOPB 1OPOA 2FMYA 4A7ZA 3AYAA 2D6NA 2GNBA 3NAPB 2GMEA 3AMQA 3ENRA 1XYOA 1GICA 4IEQA 4XFIA 1UF2C 1SBDA 1HXS1 2WZR2 4GB32 3V64A 3LOBA 5I91A 1LODA 3JBG3 3ES4A 1KS5A 4WM7C 5CNAA 1NCQC 5CG9A 4LE4A 2ZZJA 4F8AA 3SISA 3ZXDA 1ENSA 1FV3A 5H9PA 2B46X 1EP0A 1DGWA 3PVEA 2JJ6A 3ZFFA 4QM9A 1B09A 5FRAA 1IQAA 4XJAA 3FLRA 3JB8A 1O91A 1UPIA 2MEV1 3B5LB 3LWCA 4IEXA 1J1LA 1OOPA 3U07A 1F5JA 4CDUC 5KC6A 3NAPA 3JD71 1QJZA 2MNGA 3I54A 4L97A 4LBKA 3WDUA 2B9UA 3JBG2 1IKPA 1RGSA 4GMP3 5I0UA 1POV1 2NPIA 5FO9B 4AEMA 1PIV1 2JE9A 5T5PA 4AGVA 5E89A 5GZCA 5LK7B 4L99A 2AZ5A 1MS5A 1REEA 1Z7S2 5JI7A 4AHXA 2QCSB 3NSTA 3KT4A 1AXZA 2GMMA 1R1ZA 2A70A 4FBFA 2BQPA 3AKTA 1RMU3 4FPCA 4OUMA 1NY72 3SITA 5C8CC 3R05A 1PZ7A 1JHNA 3VZJA 3HBZA 5KHGA 4YW3A 1DQ0A 5KXBA 2B45X 3R6SA 2E7QA 1QQP3 4EN9B 4S2DA 2EAKA 1UU4A 2D3PA 3AKSA 4BWOA 1AXKA 3GHMA 4NR1A 4IV3C 2WL1A 4YGEA 3ZXJA 3WDYA 4YGCA 3I4IA 5F6KA 4D3WA 2DWRA 2YY1A 4WZCA 4LT5A 2LM3A 1RMU2 1RUD3 3M1HA 4FAGA 5GZFA 3GF6A 2BNNA 5JWPA 3SH3A 2XVKA 3O0XA 2ET1A 1SMVA 2K0GA 4HPKA 4Q1PA 5J96B 5LRSA 4QPGC 2R32A 2YROA 3R0RA 1QQP2 1PO23 5JIUA 4QT6A 1SLAA 2XJTA 1H2KA 3R4SA 1GQHA 4MGZE 1RUD2 2ZHKA 2ZMKA 3ZYJB 3FE5A 3ZSLA 1RUOA 2XL7A 2EF6A 2D93A 3NV4A 1AL22 2IZWA 1W6PB 4HSLA 5FO7B 1CAVB 4COWA 4LO4B 2ZGTA 2Q8OA 1DQ5A 3JD73 1QJX3 2ZPXA 3D5OA 5EXOA 1PO22 3CJXA 5E88A 3VHNA 1YHFA 1WGPA 4XJUA 3CEWA 4XF4A 2ES3A 2ZGSA 2OA2A 1PVC1 2VOXA 2ZKNA 1PVXA 1PNFA 3W59A 1RUI3 1H8VA 4FPEA 1D4M1 5GZGA 2CWMA 1YIFA 2VQAA 3QOPA 3WNXA 2QUOA 3H50A 2W68A 2DUPA 4NVPA 3MIGA 3S30A 1GBGA 1GSLA 5AFBA 1QJX2 1CAVA 1J1TA 1HV1A 4FOVA 2GH2A 5HI0A 5CA6A 4LHNA 4OHVA 1LRHA 4IEOA 4X6QB 5H9RA 4XE9A 3B9IA 3WG2A 4COZA 1RUI2 1TME3 2XVGA 3MW3A 4FP2A 2JD4A 3WCSA 4LO7A 1RJ7A 2JEMA 1Y7BA 3ETQA 4AFBA 1FPN3 4YZ2A 4JGZC 5CADA 3JQWA 1LB2A 4K1YA 4MUVA 1LTEA 1RUG1 2E7TA 2VG9A 2ATFA 5EZWA 3AXEA 4TLFA 2VOKA 4HT1T 1VB4A 1CN1A 2R1BA 3ZFEA 4OLLA 4BOWA 1TME2 1KRIA 4N9HA 1MACA 2VECA 1DQ1A 3AKQA 3IKWA 4BM8A 4FPLA 1FPN2 4XZPA 2E63A 4XQ4A 5LEJA 4Y4YA 4SBVA 3A4UA 3AP9A 3B00A 4DOUA 1CJPA 2DYCA 4Q4X3 5JSRA 2Q30A 4GKXA 3VN4A 3MIHA 2GDFA 2JG9C 4XJWA 2V73A 3FUOA 3FWEA 3N7KA 3WDVA 4OHZA 3MGUA 2DURA 3SH4A 1QOSA 3SH5A 1LU1A 3VZKA 1VBC3 3MDPA 1WMEA 4NWVA 1S2BA 4Z1VA 1OQDA 1NA1B 3IMNA 3E6DA 1ASJ1 3CL1A 1H0BA 2HWD3 3AZXA 3QH6A 4AXOA 4B3NA 1OPMA 4IESA 4RQPC 4NHMA 1VP6A 5EYXA 1V70A 2XBO3 4EWEA 4KBBA 4JCKA 1KDKA 2A5ZA 1VBE1 3AJZA 3AP6A 1HV0A 4Q4X2 4BA6A 5HXVA 1O3SA 4XBLA 1GANA 5DG2A 5B2GB 3AZWA 4Z8BA 3GBGA 4ITCA 1QGLA 1VBC2 1XU1A 4ZXKA 2B5HA 1KD7A 1PK6B 2Y0OA 2RS53 4EN6B 1W0PA 4WBBA 2RS11 2HWD2 4U2AA 5L7OA 4BIFA 4OI2A 5BNPC 2GC3A 1NA1A 2XBO2 1VALA 3WP6A 1KXGA 1RUH2 3VL8A 1DZTA 4XXAA 5BNNA 2CYFA 4RR3B 1ZRFA 3N3HA 2R071 2ARXA 4BHPA 2HWC3 4Y1ZA 2ET7A 5CFCB 1ZZBA 1BJQA 2JXAA 4HK8A 1AXYA 4GXLA 4XOGA 4COUA 2QFEA 3QD6A 4U36A 1M4WA 1YNAA 4YSFA 1SLIA 2RS52 2A6YA 1GFF2 1O5UA 1S0BA 2XJPA 1JTZX 3JQXA 1PK6A 3UJOA 1W0OA 4LUKA 5C33A 1L3JA 1UKGA 2K2SA 4FTSA 1AF9A 4KGGA 1EPZA 4KWJA 4Q0SA 2NP0A 5E8AA 2HWC2 3WLUA 1V9U1 2PA7A 4RR3A 3ST7A 1VLNA 4D94A 1BZWA 3S6PA 3THTA 2A7AA 4HK9A 3ZMNA 2WQZC 1WLCA 4FOQA 3VKFC 3N7MA 4KG8A 1UU5A 2CNAA 1LOFC 4P9YA 1DU3D 4LBNA 4R9DA 3VKMA 1CAXB 4HLTA 4I09A 2BNOA 2E9QA 1TNFA 5JOWA 2W0XA 1ASJ3 3HD8B 4YFZA 5KHKA 2BEOA 1W6OB 4N53A 3UKNA 2EVXA 4BMEA 1DQ2A 4V1PA 4ES8A 3USUB 5JPNB 1IS5A 2HWE3 2NM1A 4Q4W3 3J4UH 2OZJA 4AK3A 1MEC2 1RVF3 2EA7A 4DY5A 1R1A2 5ACA1 3WY6A 2Q1MA 1WCKA 4YZ4A 2WFF3 1NXMA 4CP1A 1QHDA 2YUEA 3E97A 2QNKA 4XW3A 1NCQB 3MIBA 1PGSA 1G9DA 4XF9A 1CAXA 4HKOA 3O0VA 4IEUA 1XNBA 3LA7A 5JZGB 2NQYA 1D0HA 1BBT2 4MGYE 5J36A 1OFSA 4JGYB 4XPVA 4BCUA 1U5ZA 1EAH1 2HWE2 2EXIA 5DZEA 2JE7A 4Q4W2 3N36A 4CDUB 1RVF2 4ZKTB 3USUA 1ZBA3 1O7FA 1MR5A 4GWNA 1M06G 1YFUA 2WFF2 1RUJ3 4XQWA 1WW6A 4YVWB 4FXKB 1G8WA 4IETA 4JDOA 1QJU1 4BZ4A 1LULA 1BMV2 2C5DA 3VBHC 3UJQA 4J6GA 4GH4C 1O3TA 2BVVA 2D5HA 3JCIA 4P9GA 2CTVA 2B7YA 4PBPA 2WFPA 4IL7A 5JZGA 1SLCA 1Q8PA 3GZUC 2VULA 4JGYA 2WLQA 2NZ9A 2QQPA 4OZXA 1SCSA 1KS4A 1ZNPA 1ZBA2 2YZ4A 1Q56A 1BEV2 2RJLA 1KJLA 3AP5A 1RUJ2 1QMJA 3RMYA 4CDUA 2IXKA 3IDBB 4QPIC 2JX9A 4XQDA 3WHUA 1PM7A 4YVWA 1N3OA 1WMFA 1WLTA 2DU0A 4XFCA 3FUQA 1A8MA 5ABJC 3DV8A 1ZRCA 3LSEA 3RMXA 1RTVA 3AMMA 1RHI1 2W52A 4KWKA 4Y1VA 2ZGQA 4ZU7A 2TUNA 1KJRA 1VBA3 1R093 4AEDC 2E6VA 3R4UA 3WP4A 1MZ5A 4QPGB 2VVDA 2IXHA 2RS31 4GULA 2DVAA 3VBOC 2E7AA 2TNFA 3MIEA 4UW3A 4E9KA 3WZ1A 2R49A 3WUCA 3WXPA 1BK1A 1YRZA 2QE3A 4ASLA 5KWRA 4AVBA 1H1AA 1TEIA 4JDMA 2D3RA 5HBAA 5CU1A 4Q0VA 3RDIA 5GZEA 2XHKA 1Q3EA 1XRUA 1AX1A 4RS5C 4OHYA 4HSJA 5BY5A 1DGRA 1E57A 2NYYA 2ZGNA 1VBA2 4AHWA 4J1WA 4CEWB 1G7YA 1C4RA 1R092 1V6NA 4A7KA 5JOYA 2WZR1 1PGW2 4GB31 4Q2FA 2ZGOA 1Q8OA 3OBTA 1UCXA 3N4MA 2XKOA 2DCYA 3LSDA 1URXA 2Q4SA 4XF3A 4DRRA 1RB8G 4O9EA 1IGOA 4FT8A 4N7IA 2PAEA 3NVCA 4QM8A 3H1YA 1IS4A 3B94A 3VKOA 4Q0PA 1QJU3 5DUWA 4PIZA 2PHFA 2D5FA 3IBMA 1MQTB 1FOD3 3AFGA 3MYXA 2XL9A 3MEPA 2KM2A 1YO8A 1SACA 3G6JB 4ZU4A 1RUF3 2LTNA 2UWBA 3JBG1 4URTA 4CEWA 4F7ZA 3LGRA 3TB0A 2R16A 1UMZA 4IV1C 4UBHA 1C57A 2VW2A 3INAA 3FHIB 1Z7S1 1WUVA 1ZBE3 4ASMB 4KH9A 2WT1A 5GZDA 1QH7A 4XBNA 4RA0A 1I1EA 1DBNA 3SXWA 1FOD2 1LEDA 3UK9A 4JAAA 4I2OA 4YM2A 1OFNA 2XPJA 1CJDA 1NY71 2WC2A 4META 3FBMA 1MQTA 1POV0 2X5IC 1QWRA 3P3PA 4D7YA 1QOOA 4KL1A 4B4QA 1RUF2 4CDWB 3LZZA 3VBSA 3T1MA 2EALA 3UKVA 1PZ9A 4NPRA 4GMP1 2PHXA 3ZSJA 2AH2A 4M00A 3HQXA 1DFQA 2V09A 2X8KA 4E2QA 2F6BA 1AR82 2D40A 1MS9A 1ND2B 1ZBE2 3MZHA 4FCAA 3UKTA 3AK0A 1A3KA 4FP3A 1OQ1A 2WSUA 1OHFA 1RMU1 3I59A 1EPWA 3RPQA 1S0IA 2ZTNA 4K6BA 3OY8B 2EAAA 4LUMA 3N7LA 5CFDB 5T5LA 1PHMA 1CONA 1GYKA 1JXNA 3DKWA 3H7JA 2WQ4A 3EXUA 3WDTA 1QQP1 3MPBA 4K21A 5EYYA 3ZXFA 4CDWA 3AXDA 5JPMB 2ZMLA 2UYAA 4HZFA 1ZREA 2I45A 2P34A 2WJSA 4XTMA 2JG8C 3B9CA 4GIQA 1ND2A 4RQPB 1RUD1 2R1DA 3PMEA 3D4KA 4FO9A 3AB0A 4NHLA 2CWSA 1VBD2 2TEPA 3V65A 4YYOA 4LULA 2SBAA 5IT6A 1DGLA 1QXPA 3PNAA 3OY8A 1S1AA 4H55A 4UBGA 4JC1A 1G9BA 5CFDA 3ILRA 4AQ6A 1ZRRA 4Y1UA 1PO21 3VDDC 1V6IA 2G4IA 3TN93 4PDWA 1SCRA 3BCWA 5K7PA 2YYOA 5D1IA 4AF9A 3NW4A 4I02A 1DLLA 1XNKA 3IDEA 1H8TB 4G9SB 4B4PA 1Z7S3 2N7GA 1HDKA 2HWF2 3EO6A 5T5OA 3RRDA 4AEJA 1O5LA 3PVNA 4QGMA 4C91A 1ZYBA 1AX0A 2GN7A 2DTWA 4ISRA 2VNRA 2ETEA 1CAWB 5DUXA 1ULCA 4DFSA 2LALA 1LHNA 1QJX1 2Z2SB 2HWB3 4K9SA 4IEWA 1NLRA 3TNPB 3TN92 1G9FA 3FLTA 4AI1A 1PO12 3WD5A 1W6QB 3NV3A 1HQLA 1CAUB 1RUI1 1H2MA 4NN0A 3TAYA 1LEMA 4FVVA 1OQEA 2OPKA 1FI2A 1RC6A 5I8YA 3AM2A 2JICA 5I0TA 3G7DA 1PNGA 1JN2P 1H8TA 3RYKA 3D0SA 3AMHA 3NV1A 1QNYA 4XFBA 1MZ6A 4TZDA 3VZNA 4FQZA 1DG6A 2D43A 3VBUC 1MVEA 4HVQA 2BFUS 3LA2A 4CEYC 4Q8KA 2HWB2 3POYA 2OUHA 1CAWA 1U12A 4XXPA 1F2NA 2ZJCA 3M3IA 4I3PA 1WLDA 2YMZA 1AZDA 5BNOC 4YARA 2OUJA 4FPFA 2XLAA 1J3RA 1AX2A 1TME1 2R0HA 2R043 1B35B 3V0BB 1O4YA 3GZAA 4M0HA 1W6QA 1FPN1 1LHVA 2BWCA 2O8QA 2PAKA 2RR13 4YLZA 2VVEA 4JV4A 1NE4A 3RI9A 1LOAA 5C4WC 4YW4A 3Q9OA 1ND3B 4MGKE 1WW7A 1AL23 5CVRA 4L92A 1Q8VA 4EN0A 1ZZ6A 1X82A 1DZQA 2NMNA 1U5XA 3KS7A 1HRV3 1Q8QA 5BNQA 1AJKA 4DRVA 2R042 4IXLA 4PLOA 1K5MC 4MX3A 2A73B 1LU2A 4N43C 3SCFA 1G9CA 1WW4A 1GZCA 2C1FA 3BB6A 1B35A 2RR12 3BPZA 3V0BA 4Q4X1 3OYWB 1X8MA 2DCZA 3ZSKA 3DN7A 3EBRA 1F5FA 4FTBA 3WOGA 2WNUB 3HN1A 1VBC1 1NCRC 2JECA 1N1YA 2P3JA 3MF9A 1FMD2 4P9IA 1ND3A 4Z92B 3ASIA 4LA2A 1HRV2 4XHXA 1X7NA 1YJKA 2HWD1 3M2MA 5FLJA 3CJIB 2QKDA 4MXVA 3D6EA 2XBO1 1I5ZA 3IM0A 4BH9A 3E6BA 3ILNA 4NHKA 1RUH1 2LUWA 1XXNA 2WNVB 3JB4C 4GH4B 3A0NA 1QKQA 2GSYA 2ZX2A 4AVTA 3BODA 1VIWB 4RSUA 3E5QA 1PGL2 3K48A 4JTNA 4LEJA 3OYWA 2DVGA 5F9TA 1LHOA 2CY6A 3VKNA 4NO4A 1RL3A 4QGNA 1HKDA 1W6PA 2RS51 2WNUA 5I0SA 2HEWF 4R4XA 4DS0A 1SQ4A 2F4PA 2IWGB 3VZOA 3ZFGB 1CPNA 1PZ8A 4AFDA 4CRQA 5JSOA 4QPIB 1LHUA 4PJYA 3M7AA 4PLMA 2B8MA 3OTFA 3W58A 4CDQC 1BVP1 4YVSB 1AJOA 4PLNA 3CJIA 4LR4A 3ZXKA 3DGTA 5K0UB 2HWC1 1NQJA 3PJQA 3WHTA 2WNVA 2C9AA 1Y3TA 1HLCA 1G86A 2ZGMA 4WM8C 4ZU5A 1UKRA 4XIOA 1FXZA 3ALQA 4J1XA 2DVDA 2W08A 1W2UA 3KSCA 3ZN5A 1WD4A 5C9AC 3AP7A 4AEDB 4AI8A 3ZN6B 1MS1A 4LHKA 4CDXB 4DXZA 3ZN4A 2DFBA 4ATEA 5FPZA 2WNEA 3DF0A 4K8FA 4AVSA 2Y0IA 3KGZA 3OGJA 4XFAA 1O4TA 3ZFGA 5JDBA 5FOJB 2CV6A 2V5YA 3AYCA 4XILA 1QXJA 4YVSA 1UL9A 2ZCWA 1XYNA 3OBRA 1AYN3 1KDMA 2AREA 5K0UA 4M3CF 4Y22B 3MLLA 2NMOA 5AVPA 5IK5A 1BVVA 1MEC1 4P9JA 4Y20B 1R1A1 5FFOC 2VMIA 3P3NA 5EJ3A 4DZGA 1HW5A 3IT8A 1BKZA 5EV7A 4IEVA 2YGMA 5T52A 5JCTA 2NLRA 3ZN6A 1IS3A 2PHRA 2P3IA 4CDXA 2OVUA 3HT2A 2EIGA 3ZMOA 2YC0A 1G9AA 1DHKB 1H2LA 1TQ5A 2XLFA 1BBT1 1RUH3 1AYN2 3QLQA 1HQWA 1LOGA 4CP2A 2D7FA 4X6RB 2DUQA 2HWE1 3HR9A 3WDXA 5JMCA 1WD3A 2WLPA 4Q4W1 2UU8A 1RITA 1RVF1 2D3SA 3LKJA 1A78A 1Y43B 4C0BA 4E2SA 3IDCB 5DUVA 1UN1A 1XQNA 4KGQA 2RM23 1N3PA 5IUQA 2WFF1 2ZX4A 4KU7A 4Y1YA 3ZFFC 3ZXGA 4Q27A 1ENQA 3SNMA 1XYPA 4Y20A 1AR73 2YV8A 2WWSA 4Q0QA 4IQPA 1BMV1 5A33B 2ZA9A 4AI0A 2G9GA 1RINA 5AVAA 4IV1B 1OOPC 5L36A 1ZZ9A 2XJQA 3HMYA 3NV2A 4G4FA 5AC93 5D8AB 3J8F3 5FAXA 4F3JA 3GBWA 1CGPA 2E51A 2XG3A 3L2YA 4Y1XA 1ZBA1 1FNZA 1BEV1 2RM22 1ULDA 4XMIA 1RUJ1 2QZ2A 3WW4A 4KG0A 2A6ZA 5K9YA 4L2NA 2YHJA 4OULA 1AR72 3VBFB 3VV1A 2D6PA 3OF1A 3WP5A 4R9AA 4GKYA 4EWDA 1LGCA 1R083 3J9SA 2Q5TA 1SBEA 1JBCA 1QDCA 1GZ9A 5AC92 1OD5A 3JUUA 1TE1B 2QDNA 2GZWA 3J8F2 2DTYA 2AYHA 2IFWA 3KQRA 3OD4A 4DPNA 4FQ4A 2EXKA 5GJ6A 3PTYA 2VGDA 1ULGA 5D8AA 1S2KA 2CL2A 4OI0A 5DUUA 2O1QA 1FNYA 2OZ6A 4IEPA 3WX5A 1Y9QA 5FPXA 5CFCA 3DPRB 3HT1A 1LGNA 1RJ8A 3O14A 1C1LA 3PMSA 4CP0A 5J3UA 1MEC3 4AE2A 1R1A3 5FOBB 4AG4A 2CAVA 2VXRA 4MH0E 1AR63 2UURA 3VBFA 4F83A 1R082 1ZZCA 2UY9A 3TRSB 5KBFA 2ZX1A 4EV0A 2JG8B 5EFUA 4MV2A 1AUYA 2FBEA 1YWKA 3NL1A 4UW5A 1GR3A 1BBT3 4HMZA 4PIYA 2O8OA 3BU7A 3SCGA 2ZMNA 4XTPA 1VBA1 5BYNA 1BXHA 1R091 4WVZA 1PGW1 1N47A 1RUC3 1WCDJ 3FBYA 3BOWA 3M3OA 4RFT0 5FMOS 2PHTA 4AW7A 3DPRA 2D6MA 5HCFA 4IERA 3A0KA 1AR62 1H2NA 4LBJA 4WM7B 3J26N 5I93A 1ULFA 1WBLA 4AQSA 3H3UA 3VHOA 3ZO0B 1AR93 1IOAA 2VQ0A 3VHPA 2C0ZA 2H0VA 1S0EA 4QQLA 2GAUA 2EXHA 5FLIA 1BCXA 2UWAA 4UW4A 3RYPA 3B93A 1C8NA 1W6OA 3RJRA 4YW2A