2R042

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r04200
2X5IA 4Q4Y1 1RMU2 5C8CC 4RQPA 1BBT2 1VRH1 3IDEA 2HWC3 1D4M2 1ASJ1 4GH4B 1EV11 5LK7B 2RMU3 1ZBA3 2MEV3 3ZFEC 1RUG2 4IV1C 4JGYB 2RS53 3J8F2 5BNNA 2WS91 1BEV1 1EAH1 5BNPB 1VAKA 1FPN2 1C8M3 1RUF2 5JZGA 2RS11 3VBHC 1Z7S1 3NAPB 4WM8C 1RHI1 2BFUS 1RUC2 1PVC2 3VDDA 4AEDB 2VQ0A 3ZXAC 1PO22 4CDXC 2DF7A 1MQTC 2WFF1 4Q4V3 4GMP1 1NCRC 1QJX3 1OHFA 5D8AA 1QQP3 1TME3 4BCUA 1TMF1 3DPRC 5AC91 1R092 2RS32 1AR61 1DDLA 1HX6A 3VBUA 4IV1B 2RR12 1BBT3 1HXS1 4YVWC 3VBHB 1D4M3 4RS5C 1PO11 3J8F3 1ZBE2 1R082 2BFUL 1FPN3 1AR81 2R042 1RUF3 4CDXB 1MQTB 1PIV3 2HWE2 2HWB2 2ZTNA 4GMP0 1NCRB 2R061 4GH4A 1RUC3 1PVC3 2TBVA 4JGYA 3DPRB 2WWSA 5BNPA 4Y5Z0 1RUI1 4IV3A 1RUH1 1HRI2 1H8TB 4WM7C 3NAPA 4QPIB 4RS5B 1C8NA 1VBA1 1R093 2RS33 4Q4Y2 2QQPA 1AR71 2WZR2 4AEDA 1COV1 1VRH2 2RR13 5L7OA 1PGL2 2BBVA 1ASJ2 4N43C 5A32B 1VBD1 3VBSA 1AR91 1WCDJ 4RFT0 2WS92 4CDQC 1EAH2 1ZBE3 4N53C 1R083 2WLPA 2RS12 4Z92B 2R043 4Y4YA 1Z7S2 2HWE3 2HWB3 1CJDA 1RHI2 3VBHA 2XBO1 1VBC1 4CDUC 5A33B 1FMD1 1V9U2 3CJIC 1ND3C 3VBFC 3JB8A 2WFF2 3TN92 1RVF1 4CDXA 1HRV1 1MQTA 1HRI3 5C4WC 1NCRA 1TMF2 5AC92 4N43B 1AL21 2WZR3 3DPRA 4CDQB 1OOPA 1B35B 4Q4W2 1VRH3 5ACA2 1HXS2 1MEC1 4RHV1 5CFCC 1ASJ3 1ND2C 1PGW2 1H8TA 5DDJ1 1FOD1 4QPIA 1PO12 4RS5A 5ABJC 5J96B 2WS93 4CDUB 4FTBA 1AUYA 1RUJ1 3CJIB 1AR82 3ZFFB 1ND3B 3JD71 3VBFB 5BNOC 1Z7S3 4CEYA 1C8M1 1RHI3 4PDWA 5J98B 4CDWA 1RUE3 5C8CB 3VBRC 5A32A 1V9U3 5C4WB 1VBE3 2R071 3JB4C 2WFF3 3TN93 1RUI2 4GMP3 1RUH2 3ZFEB 1RMU3 5CFCB 4RR3C 1ND2B 1TMF3 1VBA2 5AC93 2HWD1 5A33A 1NCQC 1AR72 2X5IC 1COV2 5ABJB 4WM8B 4Q4W3 1HQNA 1VB2A 5ACA3 1RUG3 1QJY1 5BNOB 1VBD2 1AR92 4QPGC 1PO13 1QJU1 5BNNC 1AR83 4CDQA 1AYM1 3VBOC 1B35A 4Q4X1 1PO23 2XBO2 1AYN2 1VBC2 2GSYA 1FMD2 1AL0G 1K5MC 1PIV1 3VDDC 4RR3B 3JBG2 4YVWB 4CDUA 1NCQB 3CJIA 1RUI3 3ZFFA 1RVF2 1HRV2 1RUH3 4CEWC 5CFDC 1RUD1 1F2NA 5C8CA 1VBA3 1EV12 4QPGB 1AL22 1AR73 5C4WA 1COV3 3FBMA 1MEC2 4GB31 4RHV2 2BPA2 1BEV2 1R1A1 1E57A 2RM21 3VBOB 3ZFEA 5DDJ2 4FTEA 1FOD2 4IV1A 5FOJB 1AR93 1RUJ2 1A6CA 1K5MB 3VDDB 4EJRA 1BMV1 1VBB1 5GKAC 3HAGA 2FZ2A 3JD72 4WM7B 4WM8A 1NY71 4JGZC 1POV1 2XBO3 5BNOA 1AYN3 1VBC3 3M8LA 1FMD3 1VB4A 4CEWB 5CFDB 2HWF1 2HWE1 5FMOL 2R072 3JBG3 4YVSC 2ZAHA 5BNPC 1AR62 5C9AC 1RVF3 1HRV3 4Q4Y3 2ZZQA 4IV3C 3ZFGC 2PLV1 2HWD2 4N53B 4RR3A 2BUKA 1EV13 1AL23 4AEDC 4YVWA 1F8VA 1MEC3 4RHV3 5L7OC 2HWC1 1QJZA 1QJY2 2WZR1 1BEV3 1EAH3 2RMU1 1ZBA1 2MEV1 5K0UC 1RB8G 5DDJ3 4JGZB 1FOD3 2RS13 1POV0 2RS51 3VBSC 1PGL1 1QJU2 1SMVA 1RUJ3 2R062 4QPGA 1AYM2 3JD73 1NA1C 4Q4X2 4YVSB 4SBVA 4NWVA 5C9AB 3VBOA 4IV3B 1PIV2 3ZFGB 4FSJA 4NWWA 2R073 1RUE1 1K5MA 4Q4V1 1V9U1 1QJX1 1X33A 1VBE1 1AR63 1QQP1 4WM7A 1RUD2 1TME1 5L7OB 3TN91 1X36A 4RQPC 1W39A 1HXS3 5K0UB 2HWD3 4CEWA 5CFDA 1RMU1 3S6PA 3VBSB 1BBT1 4GB32 1OOPC 1R1A2 1D4M1 2IZWA 1NOVA 2RM22 3VBRB 1QJY3 4N43A 1NA1B 4Q4W1 1H8TC 5ACA1 1RUG1 5JZGC 3J8F1 4QPIC 1QJU3 4N53A 1BMV2 1PGW1 1FPN1 2R063 1RUF1 1VBB2 1AYM3 4Q4X3 1NY72 4CEYC 1RUC1 1PVC1 2X5IB 4PDWC 4CDWC 4JGZA 1ND3A 2HWF2 3VBFA 4RQPB 5FMOS 2GH8A 1PO21 5D8AC 1OOPB 4YVSA 1CD3G 3VBUC 1RUD3 2PLV2 4LLFA 5BNNB 5C9AA 1R091 2RS31 3ZFGA 5JZGB 2RR11 2FZ1A 1OPOA 1VBD3 5CFCA 4GB33 2HWC2 1ND2A 1R1A3 2RMU2 2RM23 1ZBA2 2MEV2 1NG0A 4CEYB 2RS52 5ABJA 1ZBE1 1GFF2 4PDWB 5K0UA 4CDWB 1R081 1C8M2 2R041 2XPJA 1VBB3 4GH4C 5D8AB 3LOBA 4FTSA 1B35C 2HWB1 1POV3 4JGYC 3VBRA 1NA1A 3VBUB 2HWF3 1IHMA 1RUE2 1M06G 4Q4V2 1AYN1 3NAPC 2Y26A 1QJX2 1VBE2 1QQP2 3ZFFC 1HRI1 3JBG1 1TME2 2PLV3 1NCQA
chains in the Genus database with same CATH superfamily
2X5IA 3RWKX 4XABA 3UGHA 5LW9A 4XFIA 5AFBA 3NV2A 5FRAA 3RMYA 2E33A 1U5YA 4YZ2A 3WLUA 2P34A 3BIWE 4GH4B 1AXYA 1H4HA 3OYWB 2WZ8A 4LHKA 2EIEA 3H8OA 1PZ8A 2ZKNA 4GWJA 5ISLA 2ZGNA 4BWOA 4B4QA 3K4ZA 4IV1C 2RS53 4JGYB 1X8MA 4Y24A 2WS91 1BEV1 5DQ0A 4JTNA 1ACCA 4JV4A 1VAKA 3D3AA 2PYTA 1RUF2 3HOBA 2NM1A 1UIKA 1DLCA 4Y1YA 1G9AA 2ZGPA 1RIRA 5F37A 1GZWB 1Z7S1 4V2VA 2PHTA 2CY6A 5FZ7A 2XJSA 5FYUA 4MUVA 5KXBA 5FYHA 4GZ9A 2BNNA 2ZHKA 4CZSA 3N9MA 1QNWA 1SG3A 1JZ2A 4XDQA 2VQ0A 1N47A 1PO22 2Q5TA 4HVOA 5F8PA 3MHZA 2A1XA 2WFF1 4XW3A 1H4GA 2D7FA 2XL9A 3WCSA 3RWNA 1QJX3 3ETPA 2GALA 3IKWA 3ZYJB 1ENQA 5JMOA 4BCUA 1GWMA 1TMF1 2W94A 3LSDA 5FPZA 5IVEA 3BOPA 4F83A 4AVCA 1U12A 3MLLA 1RXGA 1DDLA 2FQPA 1V70A 1YEWA 4QM8A 4IV1B 1H2MA 3N7MA 1NLQA 3VKFC 4ZU7A 5LY1A 1LOCA 1BBT3 5L36A 3HBZA 3VB9A 2TUNA 1HB3A 2D5FA 3NV1A 4FT8A 4Y1VA 1O3TA 3ENRA 3OG2A 1HJFA 5LZ6A 2JG9A 4XBLA 4QQHA 3VHNA 1YQ5A 5FK7A 3J8F3 5DZEA 3N9OA 5FZBA 1ZBE2 4COUA 1EUTA 4XAAA 3LF7A 4CUBA 3L9JT 2PHRA 2XLGA 4LNVA 3P3NA 5FREA 3CU7A 3WNXA 3H3UA 3WP6A 2ZX2A 2ZTNA 1DGWA 1CAVB 4GMP0 2EXHA 3HQRA 1SDDB 4FFHA 1ZZ6A 4I2OA 1RUC3 3CO2A 3OGJA 3BN6A 2DCZA 1ZX5A 2Z4FA 4MGKE 1O8SA 1DQ1A 5FAXA 3OD4A 2JDYA 1W6NB 2DCYA 5F2SA 2V5DA 1RUI1 3IDBB 1XYPA 3DYMA 4J1XA 1BYHA 2B7YA 4EN6B 3POGA 3OPTA 1VMJA 1RUH1 1YWKA 4FO9A 2VCAA 1ENRA 2XKPA 4BE3A 3HJRA 2CAVA 5FZEA 4QPIB 4GJZA 4XQWA 1VAMA 2I07B 1GOHA 1S0FA 2JD4A 4XF0A 3O1OA 3DGTA 2DU1A 2QQPA 4GJYA 2OX0A 4LK7A 3W21A 4AE2A 5JXGA 1GANA 3HBKA 4I0AA 2WNUA 1NT0A 3NWKA 4M00A 3R4UA 4D6SA 2BBVA 5HV4A 4ZU5A 1HW5A 2ZEXA 4MYEA 4D94A 4N43C 4NRPA 1AR91 1WBLA 2V4VA 3I4IA 2EAKA 1O3QA 2QZ2A 1UY0A 1EAH2 2RJ2A 3RNSA 3CMGA 4TYSA 3K4AA 1R083 2VCBA 4OQ9A 3NMBA 2BZDA 3O0VA 3ZXFA 4Z92B 3MIEA 4LE4A 2JDPA 5JXJA 2ZEYA 3AZWA 4JZRA 3VN4A 2HWE3 2HWB3 3J7MA 4XZPA 2G4IA 2WQZC 1RHI2 3VBHA 3O7OA 1J3QA 2XBO1 1EUUA 5HPOA 3VKMA 4CDUC 5A33B 4WZCA 1YFWA 3U14A 1YHFA 5A1LA 2WO1A 4FVVA 4W50A 3W5MA 1KDMA 2XJRA 4PLMA 2ZAAA 2W92A 5FK8A 1WLDA 3LSEA 3U11A 2ARAA 1GP6A 3ZSLA 2ZACA 3BU7A 1UZWA 3IN9A 4FOWA 4HONA 2DURA 4AI9A 1X8EA 1NXD1 2A5ZA 1MQTA 2H6CA 4I01A 5FYSA 4CVUA 4KG8A 5K9YA 4PIYA 1NCRA 4QWNA 1JYXA 3KV4A 3E97A 4N43B 3ME2A 4HSLA 4HG6B 3H9AA 4OMCA 2XUMA 2BOJA 3RGBA 1MZ6A 3ZN6A 1OOPA 4CCMA 4EN0A 1VRH3 2C9AA 1DP0A 4OUMA 4GKYA 4RHV1 4OQ8A 5GLZA 5E16A 4XJZA 1XOYA 2XMLA 1ASJ3 5I93A 3AXDA 4GAZA 3OGRA 1FOD1 2PQSA 5CG9A 1RJ7A 3MIBA 4RS5A 3ZX7A 2XG3A 4CDUB 2ZGTA 1OC1A 3CL1A 3FMGA 1ALYA 4GKXA 5C7GA 5CA6A 1URXA 1QGLA 1ULOA 3ZYHA 4E4HA 1DZQA 1HN0A 2SLIA 4KNCA 4PDWA 3RJRA 1Z0HA 4Y1ZA 1ULFA 1V9U3 2YFUA 3Q8CA 5CKMA 3ILRA 4QGMA 1TQ5A 4FPOB 3RYKA 2YC2A 3DECA 5FJHA 1CZSA 4UI9L 4JX0A 1K42A 3TN93 4XUQA 1XC6A 4GMP3 5CG8A 3OJBA 1NKGA 1RTVA 2JKXA 5GZEA 4PQ9A 1W6QA 2C5DA 4CE8A 3ZPOA 5FIXA 5KBFA 4DFSA 3RRDA 4FPJA 4MOAA 3KS7A 1GYKA 1OKOA 3MBWA 2P37A 5JVVA 2HWD1 5F39A 1WA6X 2BERA 1BLZA 1AR72 2X5IC 1AXZA 1SQ4A 5FZ4A 1HJGA 4BXFA 2IXHA 1LCLA 4XF3A 4QHOA 1BJQA 4KWJA 2W46A 2OQ6A 1VB2A 2ID4A 1XRUA 1RUG3 5ACA3 3TEWA 1Y43B 4QXBA 5A80A 4HKLA 1XE8A 1W6PA 2D6OX 3AL5A 3DXUA 2D6NA 1S0CA 4MXVA 1F9KA 2OUJA 1VBD2 5FZKA 4FOVA 3AP7A 5DUUA 5FUIA 1Z78A 1DYPA 1YI7A 1S0DA 5FO7B 4SLIA 3AYAA 3MLKA 4YYOA 5FMDA 1AR83 4BQ4A 5FZ8A 1DFQA 1H9PA 4WVZA 3VL9A 4RL7A 3BYWA 1PNFA 4X8PA 1RL3A 1VIWB 3USSA 1S55A 4LO7A 3KT7A 1AYN2 1OH3A 2WWUA 1W6MB 1FMD2 2ZEWA 3IAPA 3THTA 5IVCA 5K7PA 1AL0G 3GGLA 4GXLA 2Q8OA 1CAXB 1LEMA 1BVVA 4NROA 3WNNA 3HVDA 4I02A 2ZJCA 4YW1A 3V0BA 2XR4A 2R6QA 4BZ4A 4L99A 2ZX3A 2W9XA 3N7LA 1HRV2 5HCBA 2B4KA 5IFTA 1SLAA 4HKWA 1ZRFA 2Q8DA 2DBNA 3T2QA 1PZ7A 3POYA 3ACFA 3RZMA 2R49A 4QQLA 3DL3A 4CA9A 5C8CA 3PVOA 4AFDA 4CCJA 1TG7A 3WF3A 4FFIA 4LLOA 3AKRA 3WG2A 1COV3 3AMPA 2W87A 1XNTA 1MEC2 5FZOA 4AOCA 1JTZX 4YLZA 3OCPA 4XC9A 2PA7A 4DPNA 1LKNA 2BVVA 5EZWA 2W1SA 4IETA 3DEMA 5H9PA 2JG9C 5T52A 5FOJB 3DXTA 1IS6A 3LD8A 3B01A 4LITA 1J83A 4Q1RA 2GNBA 2GMMA 1RUJ2 4MADA 4QDRA 1WLTA 2A6WA 3HNBM 4K8FA 2NLRA 4P9WA 5LBFA 1VBB1 2AGSA 4JDMA 1XYOA 4DMIA 2FZ2A 1XNBA 3OSDA 4LBNA 1XSQA 2MHFA 4EN7B 1NZIA 2BWCA 3CZJA 1NY71 4QHBA 1POV1 2F4LA 3E5XA 4XIKA 3TB0A 1OA2A 3SH4A 2YGLA 4XXAA 4NMIA 5BNOA 1VBC3 3VDCA 2ILMA 4ZPIA 2HWF1 2HWE1 5EJZB 4DIQA 5T5LA 1LU1A 3H1MA 4C0HA 1JZ6A 2RDNA 1DG6A 3WG1A 5CEHA 2WJSA 1Y7BA 2ORXA 3WINE 4L97A 4QX0A 2Q30A 2YZ4A 2XWBB 1JN2P 4Q4Y3 2JXAA 1O3RA 4XUOA 3HQUA 1W28A 4IE5A 4K8RB 4QX5A 1TE1B 2BVBA 1ZVFA 1PNGA 2BUKA 4L8QA 1AL23 3PUQA 1JXNA 4Z2AA 3PL0A 4YVWA 2GC2A 3AZXA 4ONUA 1F8VA 1IOAA 1S4CA 2IXJA 2HWC1 1QJY2 2W52A 2JIGA 4NIHA 1AJKA 2RMU1 5T50A 1HQWA 3GZTB 3M4FA 1RB8G 5DDJ3 3VUOA 2XQXA 5FP4A 1KS4A 3RMXA 4CCCA 2K0GA 3LA2A 5J37A 1QJU2 3LB9A 1W3XA 3I2KA 1PGL1 1FATA 2QQKA 3T08A 5C3OA 2Y6JA 5J1XA 4XBNA 2NN8A 2C24A 5DMYA 1AYM2 1XPWA 2JENA 2VNGA 4FPGA 3MLJA 1C28A 3JD73 3TEXA 1NA1C 2B46X 3MV01 5FZFA 3ZSEA 2LTNA 1ZYBA 2QE3A 2A3WA 3GALA 3K3OA 3I59A 1PIV2 3IMNA 2R073 3MZHA 4W6YA 1W2NA 5H9SA 4OI4A 4KGGA 4LT5A 1ZRRA 1V9U1 3VD3A 2WNVC 3K2OA 4I09A 2ZGRA 1OF4A 1W8FA 1LNSA 1XE0A 2AZ5A 2FDJA 1RUD2 1TME1 4BMBA 3TN91 3QH6A 3NL1A 1LHNA 4QKFA 1W39A 2K9ZA 4CU8A 3C7EA 1HXS3 4YG3A 4UF0A 3C7HA 3RYRA 4YFZA 3RVHA 5H9QA 5DUXA 2HJIA 5BXXA 2JIJA 1OOPC 4UXAA 2JD9A 1I1EA 1D4M1 1JHNA 5DAVA 1NA1B 3DKWA 4H7MA 2Y60A 4P08A 3A7QA 5T5JA 4XJWA 4A2UA 5ACA1 1SBEA 5C3QA 1RUG1 1O5UA 5FOBB 3FWEA 4AFMA 3WNMA 4P9XA 4XURA 4E4SA 4N53A 4W8JA 1BMV2 1Q5OA 5FP8A 2Y6KA 5IATA 2R063 3I54A 3VZKA 1WUVA 4LK6A 4P9LA 3BI3A 4W6WA 3EBRA 4YM1A 5F5AA 2WNVB 2YC0A 3WDVA 3BTZA 2F17A 3MF6A 1TZOA 4YM2A 4CPBD 1PVC1 1YI9A 2ADDA 3RQ0A 2JECA 4PDWC 4ASKA 1YCIA 3T4HB 2J1RA 2YG0A 4XBQA 2GMEA 5A7WA 3THCA 4XQ4A 2BGCA 4HBNA 3FUOA 2AYHA 4PCRA 2AEZA 2O1QA 5EXOA 1H1AA 2X05A 2WA3A 4HK9A 1QU0A 3I3DA 3H8RA 3ZN6B 1OOPB 2C6SA 1LHOA 3VBUC 1LGCA 4LLFA 4P5YA 1JI6A 2VNOA 1OA3A 5FFOC 3N7JA 1VALA 1W9YA 3FHQA 4M4PA 5C9AA 3E6CC 1UZZA 2VMDA 3ZFGA 4YW4A 5FP9A 1UF2C 1XSRA 1W8NA 4XXPA 3MYXA 1OPOA 3ACHA 1S0GA 2A75A 5GLTA 4GB33 1XU1A 4OI0A 4ZS2A 4LMFA 1GSLA 5FP3A 4COZA 1H8VA 3OY8A 2MEV2 1UPIA 2IVIB 3VHPA 4A6OA 3CIHA 4Q0SA 3BB6A 4Z8BA 1FXZA 5I0UA 4B1LA 4OZOA 1WW4A 2X8KA 4XILA 4X6QB 3IT8A 3T0DA 1JZ5A 4IESA 4ORFA 5JOYA 1QXRA 4PDWB 5K0UA 4O61A 3VD9A 4RFRB 1HV0A 1JMUB 3W9AA 2WT1A 4QX7A 3DN7A 5IK8A 4FXGB 4DS0A 1IG0A 1O8PA 2QQNA 2RE9A 4LUMA 4NHLA 2RV9A 4NHXA 3KB5A 1M4WA 3PUAA 3T1MA 3M70A 2Q8EA 3A0KA 3PU8A 2NMNA 1SCRA 1W6QB 1K45A 3RG0A 3VBUB 4AQTA 1L3JA 1LESA 3WT3A 4UW5A 3OBZA 1HQLA 1NX9A 4I3PA 5H9RA 5FZDA 2IXCA 3MUZ1 2GMPA 3DYOA 4NO4A 2EICA 4N8MA 3VZLA 4KBBA 5LATA 5A7NA 3FHIB 4OHYA 2EIDA 2ZGKA 4M3CA 4EWDA 1JZ4A 1S0BA 2DV9A 2K2SA 2PLV3 5I0RA 1NCQA 3LE0A 4L11A 5F6LB 3U75A 3USUA 4Q4Y1 2J1SA 5D1IA 1IPJA 3GF6A 5LY2A 5C8CC 3NJXA 5A3OA 1WZXA 5A1AA 4RQPA 1V6MA 4DXZA 5FZ0A 5LWBA 2PHUA 3FLTA 3IDEA 2GH2A 4MG2A 2VJXA 2A6XA 2J1AA 2VMHA 2VW1A 3ACIA 2A70A 3NSTA 3M3CA 4WVVA 3RPQA 5LK7B 1BK0A 4UT5A 1ZBA3 3WSOA 2E7TA 2XJPA 1A34A 2KR2A 4FOQA 2GC1A 2AH2A 4NHKA 3N9LA 1J59A 3POBA 2B45X 4IXLA 1FPN2 2NQYA 1C8M3 4BOWA 2R0FA 1CAUB 3AZVA 2DWRA 4IQPA 3GNEA 4LIUA 5JZGA 2OPWA 3FN9A 2V73A 3LDRA 5C8WA 4E9KA 4QGLA 1O4YA 4DY5A 2XJVA 4XFAA 2JICA 3ATGA 2VPVA 4YW7A 4OHZA 1JBCA 2ZGQA 1DZRA 1KJLA 4IDZA 4BJ0A 2Z2SB 3PURA 2UU8A 4AL9A 4DRRA 2WZEA 3HR9A 4CDXC 2YU1A 4R9BA 4MGYE 2VW2A 4Q4V3 1JOJA 3H3LA 3NNJA 4PF1A 2WABA 1QQP3 3SC7X 4FXKB 4Y20B 1NYWA 4XCAA 1GWKA 4XE9A 4AVTA 3DPRC 5AC91 4ZS3A 1R092 1C57A 2RS32 1LOFA 2N7GA 3D6EA 2P5BA 3R6SA 1PK6C 4V2WA 1HX6A 2P17A 2X09A 3GYDA 3EJKA 4QQPA 2WINB 3M3QA 3U37A 2RR12 5FZ6A 4K3UA 2R30A 3FJSA 3VV1A 5KWRA 3ZMOA 1HXS1 4YVWC 3ACGA 3BPSA 3AMNA 3TEZA 1UIJA 4B7EA 2VQAA 4BLJA 2Z5WA 1JOBA 3LPFA 3HT2A 2CWSA 1PO11 3VKNA 3U10A 1WCKA 2R7EB 3RFRA 3O1TA 4CU7A 3H50A 3WF0A 1J1TA 2BFUL 3WUCA 4AI0A 4KMQA 1FAYA 2WUHA 2R042 1RUF3 2VE1A 3N7KA 3URFA 2FCTA 3ZXKA 3TAYA 2E63A 2FMYA 4CDXB 5A3TA 3BTXA 3ZIXA 4AI2A 1QXJA 2R061 1F15A 5FV3A 3B7MA 5GLWA 2UWCA 3SCFA 3JXSA 4Z2WA 2XKOA 4P14A 1IKQA 3DPRB 2WWSA 3WG4A 5BNPA 1PK6B 4ZXEA 1GZTA 3GXUA 1HB1A 1ULEA 1SFPA 2VVEA 5D21A 5JIAA 5IHRA 1HRI2 4BU2A 3ORJA 1H2LA 1CN1A 2PXJA 3IPVA 3NAPA 3X29B 1ULCA 4GD4A 5F5CA 1C5HA 3U4SA 4DB5A 5FYBA 4WVMA 1VBA1 1VLNA 3D0SA 2J1EA 1W8OA 1GKBA 1VR3A 1FNYA 2LRPA 3GCXA 2ZEZA 4AEDA 5JPMB 1YFYA 1DYKA 1C1LA 2ARXA 4LBJA 3KT1A 4HANA 3CEWA 5A6YA 4AEMA 1GQHA 1OI6A 1U0AA 4CU9A 1CZTA 1LHVA 2FBEA 3WNPA 2YY1A 2WO7A 3P5BA 4FPFA 4HZFA 5FZGA 5GJ6A 3PUIA 1VAVA 2BRTA 1QHDA 1NUKA 3AYCA 3VBSA 4EWAA 5C6CA 1IKPA 2D98A 2WS92 1A8MA 4CDQC 2EAAA 5CISA 1G9BA 1ZBE3 2G9ZA 2P3JA 4N53C 2WLPA 4XUPA 2C0ZA 2D3SA 2ZGLA 5FPUA 4Y4YA 1Z7S2 1YQ2A 3PU3A 4HL0A 2FDHA 4X8NA 3WXPA 2G9FA 3CJXA 3JZVA 3OF1A 4AI1A 3I3QA 4L92A 1OD3A 3KCYA 3OTFA 2DFCA 1DGWX 1W0PA 2UURA 4JDOA 3CJIC 3V64A 3KM5A 1YUDA 2ZPXA 1OQDA 4FP2A 1WA4A 4KGQA 2WFF2 3OGGA 2FHRA 4XFFA 4AK3A 5FYIA 1RVF1 3WF4A 1UKGA 2OW4A 2VECA 4DOUA 4HT1T 4OCTA 2HBUA 1TNFA 4UOJA 1TMF2 2VGDA 2FD8A 2OVUA 3WQ7A 1OH4A 4FPYA 2QBXA 4HN1A 4IL7A 1OURA 1H1IA 2GC0A 2VZ1A 2P6HA 2VTFA 3PIJA 3ZIWA 4CDQB 4Q4W2 2YPJA 4BISA 1F5JA 3T4VA 5F1RA 5LA2A 4Q26A 4OHXA 2W08A 2E51A 1PGW2 1H8TA 3ZDVA 5GALA 3NRUA 4XYXA 5A3NA 2VTXA 3ASIA 1YNAA 2Y64A 1YXWA 3GM8A 2ARBA 5J96B 3KV6A 2ZHNA 5KHIA 4UFHA 1CAWA 3CJIB 3DYPA 3ECQA 3ZFFB 4ZONA 3A23A 5A7WB 3ZSMA 5C33A 4CP9A 2BYVE 3AFKA 3PUSA 4CEYA 4COYA 1US3A 4AFCA 4CPBA 2G9GA 1RUOA 1IPKA 5FQ0B 1C8M1 4GA9A 4HVRA 1RHI3 4CDWA 1F31A 2TNFA 1IQAA 5A32A 5B4NA 1NAEA 3BTYA 1APNA 4IE6A 4OUSA 4IEUA 3AP9A 2JB4A 2ZMLA 4H14A 3FHAA 5IW0A 5GLVA 4OI2A 1RUI2 2OUHA 2PN5A 4FPEA 2VZVA 4LEJA 5F3CA 3W5NA 4W65A 1IS3A 1LENA 1RUH2 2D40A 4X6RB 1IZ3A 1RMU3 2PHDA 4ZY9A 2ZBJA 2RDSA 3GJBA 3C7OA 2DVDA 2PAMA 4NJ4A 3NJVA 3CZUA 3MV11 3WW2A 5I0DA 2DUPA 4P02B 1NCQC 4CXWA 4LBQB 1UZYA 1QDOA 5HV0A 5J36A 3I2GA 4HPKA 5A3LA 3UYJA 4NIDA 5LB6A 4Y1UA 1UYPA 1CPMA 2VUCA 4KQ7A 1VRBA 4E4ZA 2KA3A 5JLVA 3GZUC 2XVGA 1OT5A 4RGKA 1AR92 3T2TA 2BBAA 1DLLA 2FDIA 5JR2A 1YQCA 4AEKA 1MS8A 4LBOA 1FV2A 5A3MA 2XOMA 2Y0OA 1O5LA 4XCBA 2PAEA 2XONA 1QJFA 4CCNA 4WZFA 3VD7A 4A45A 5FDBA 3M1HA 3VBOC 3ZXDA 3G6JB 1B35A 1YFXA 4DEVA 4DINB 3TEYA 1A8DA 4Q4X1 2BV4A 2OXBA 4I3GA 1O4ZA 2Q0AA 2BU9A 5T5OA 1G8WA 1V6LA 2BNOA 2XBO2 3C7FA 4ET7A 2BNMA 2JDZA 2VH9A 1E5IA 1K5MC 3THPA 1ZZ7A 3ZSKA 1R1ZA 2YHJA 3BODA 3ABZA 5FZ3A 5J48A 4AF9A 1NCQB 2BW8A 1EP0A 2AACA 1W0OA 3H8XA 1LGNA 2QDNA 1FNZA 4UW4A 5CFDC 5JXIA 4ATFA 2VZPA 4MSVA 1XNAA 2TEPA 4D0QA 1Y9QA 1V6IA 4COWA 1DQ6A 1EV12 3KCCA 1AR73 2Y6GA 5C4WA 3B9CA 2KD7A 1OSGA 3ZYIB 2AREA 4MGQA 1CWPA 1N3QA 1OUXA 1YLLA 1Q8QA 3U1XA 4RHV2 2BPA2 2YXSA 3T2OA 5E88A 5FCCA 5CBLA 4XFCA 4C1XA 1R1A1 1E57A 2RM21 3AMQA 1LOGA 3VBOB 4DZGA 4S2FA 1W06A 3WY6A 3ZFEA 5A3UA 1FOD2 4QDSA 4KU8A 5CNAA 1VJ2A 4PIXA 4JC1A 3RZKA 3N9QA 2PHXA 4IEVA 1QF3A 1XBFA 1QH7A 1K5MB 2JWPA 2VW0A 3FL7A 4R4XA 5GKAC 5FZ1A 3M2MA 4INDA 4WM8A 4HLTA 3BGAA 4AGRA 4JGZC 1W9TA 5EP9A 4CXXA 2Q1FA 4MXWB 2GNTA 1L7RA 5IUQA 4A3XA 4LHLA 4MLOA 1AYN3 1FMD3 1VB4A 5CFDB 4NRMA 4Q1PA 4MHUA 4XJ9A 2YV8A 1REDA 5FUNA 3W59A 4D8MA 4YVSC 5BNPC 1Q8VA 4JQRA 3KV5A 2JE9A 2SBAA 1Q56A 1QIQA 3GBFA 1AR62 3VKOA 2A3YA 2VD7A 1T2XA 4IEWA 4G4FA 1HRV3 3AZYA 3T30A 2G1MA 4LBLA 5GM0A 3WCRA 5DABA 4P5HA 1RXFA 3BIEA 3ES1A 1QMJA 2HWD2 2L9LA 5BYNA 1ZREA 4L2NA 3J7NA 4YG6A 4RR3A 3GHNA 3LFIA 5LBCA 2QQLA 2R32A 2X29A 4AVVA 3GCWA 4AEDC 5FYVA 5I0SA 5JXHA 3WD5A 1UU5A 4LO4B 4N9IA 2R0HA 1MEC3 4F8AA 2QTWB 2R16A 4FFGA 5C3RA 1WW6A 3UT0A 2WSVA 3UL2A 1LEDA 3I7DA 4LJHA 5DG1A 3TBDA 4QXKA 3V56A 4JGZB 5JSRA 2BGPA 2RS13 2RS51 3THDA 4LQRA 3VBSC 2IXIA 4Y5SA 1UMIA 3BTAA 2Z42A 3NKGA 4RA0A 1KXGA 1RUJ3 4QPGA 5FJKA 4E4DX 4U2AA 3LAGA 4AWDA 5DAPA 3WOGA 3FFQA 3VZNA 1WCQA 2FMDA 1W2OA 2EIBA 3GDBA 4QPYA 4YVSB 5DPNA 4BPZA 4CUGA 2K46A 1QNYA 2Q4SA 3OPZA 4QQOA 5FBJA 3AJYA 4P9YA 4E8CA 2WNOA 3I2DA 3AK0A 1OFNA 2VBDA 5LBEA 4A41A 4FSJA 3WQ1A 3VD5A 4QKDA 1P8JA 4XHXA 5G05L 2VZOA 4H3WA 2OIIA 1WCSA 4AGGA 4H7LA 3RS6A 1QJX1 1UOFA 3DF0A 3HNMA 3VGIA 3WUDA 3Q8BA 4WM7A 3AVSA 3NO8A 3UKTA 1DBNA 2FDKA 3DKQA 1X36A 3BOWA 4ARYA 4BQ5A 4O7XA 4CEWA 4KI5M 1RMU1 1J3PA 1YJKA 3E1F1 4PBPA 3S6PA 1GP4A 1POQA 2Y6HA 3VBSB 4P9JA 1X50A 3LEIA 1YQ6A 1BBT1 4MH0E 5F3EA 2Y33A 5EYYA 1AXKA 2IZWA 4B8EA 1NOVA 2LS6A 1QJY3 4BK4A 2MNGA 2GU9A 4Y26A 5FYZA 3ZN4A 5LA1A 1CONA 1DHKB 1H8TC 3I2FA 5JI7A 4PHZA 3J8F1 5EYXA 1UOJA 2O8OA 1QJU3 3HD8B 4AQ2A 3KSCA 1JU3A 2WN3A 4FQ4A 1VBB2 1AYM3 4CCKA 2OZJA 4BQWA 1BQPA 2A6ZA 3NJYA 4IE4A 2XH6A 2WKKA 1WLWA 1NY72 1YRZA 4CEYC 3B00A 3ROUA 1U5XA 1RC6A 2DUQA 1RUC1 5F32A 4OULA 2X5IB 4MZUA 4CDWC 2HWF2 1H6YA 2DDUA 4CP0A 3QCWA 3VBFA 2GH8A 1NZCA 4KBZA 2VMIA 4MHRA 3AYDA 4XVHA 2W2IA 4BQYA 3H7YA 2VQTA 1V6JA 2ZKLA 3P3PA 3L2YA 3S7IA 4UFJA 3VHRA 2DBIA 2XLAA 5J3UA 1AX1A 1RUD3 4R9AA 1W04A 2JEMA 5ANQA 2J22A 5KHHA 1SDWA 2VOTA 4P9IA 4ZKTB 5DAWA 4Z82A 1QWRA 4MGZE 3U78A 3E5UA 2WBKA 3O1VA 2WA4A 4MGSA 3LZZA 2YROA 2WQ8A 3AMHA 3Q8FA 5CFCA 2HWC2 2EF6A 4LA2A 1CAWB 1YC61 4K9SA 2XGXA 1WMFA 2QQWA 2RMU2 3M3EA 1PX4A 3OUJA 1V00A 2CL2A 3W20A 3WDWA 3A21A 1AVBA 5T54A 4CEYB 2ZGSA 5ABJA 4OMDA 4Q27A 4CDWB 1X9TA 1R081 1I5PA 2XPJA 1IGOA 1GICA 1XJAA 3D4KA 1B35C 2HWB1 1ZRIA 1F5FA 5FP7A 4PQQA 2ETEA 4XF4A 4YWAA 4Y33A 3VBRA 1RINA 5BY5A 5EJ3A 4EYUA 4KWLA 5HI0A 3B3QE 1IS4A 5DAXA 3OBTA 3EMRA 2DCKA 4D7YA 4AEJA 1M06G 2VU9A 1AYN1 4IERA 4UAPA 3S5AA 5IVJA 3B9IA 1KEXA 2RJLA 1OFSA 2GDFA 3WW3A 3SCHA 1JYIA 2JG9B 3WVJA 1W6OA 4HPKB 1TME2 2W39A 1UQXA 3PIGA 1KD7A 1LHUA 3K3NA 2ATFA 2J7MA 2WNUC 2P3IA 5A6QA 4Q0QA 1GNHA 3WZ1A 1N3OA 2UYBA 3INAA 1CIYA 2OQ7A 2P3KA 4B1MA 3H8UA 1VRH1 2IVJA 2DUOA 2LROA 3MW3A 4PIZA 1GP5A 1D4M2 4NOTA 1ASJ1 4IW3A 3B93A 3MW4A 3HN3A 2MEV3 1VE0A 2W5FA 3ITQA 4YRDA 3ZFEC 4XUTA 1RUG2 3P1IA 3JQWA 4YW6A 5BNNA 1GZ9A 1TNRA 4FPHA 5CAZA 1CJPA 2JDUA 4TSVA 3NV4A 1LB2A 1VP6A 1F35A 1FYUA 3QD6A 4XJAA 5FYCA 4BQ2A 1JYNA 1YIPA 2RS11 3APBA 4YZ3A 3RSJA 3VBHC 3DUIA 2A3XA 1V0AA 3R05A 1JOPA 1WWYA 3HEIA 4WM8C 2WT2A 1DQ4A 2E31A 2YGMA 1PVC2 3VDDA 5FPVA 2ZOEB 5LEJA 5DXDA 4ARXA 1W8HA 1C5IA 3ZXAC 1BZWA 4N9HA 1NE4A 2DF7A 2WNUB 4FOYA 1MQTC 4BM8A 2VUJA 1H2KA 5B2GB 4GMP1 4GALA 1NCRC 4QM9A 3I8TA 5D8AA 2JE8A 5FMCA 4BLIA 1WCUA 2CHHA 1SLCA 1V6KA 5DUVA 3V0AA 2XVLA 1D7PM 4M3CF 2QQUA 3O0XA 4ES8A 4YARA 4BIOA 2RVAA 4KL1A 1EY2A 2A7AA 3A22A 2AC1A 4AVAA 4M3CE 4D3WA 1GMMA 3R4DB 5HXMA 1JHJA 1SPPA 3VBHB 4RS5C 3NNFA 2CU5A 3AFGA 3O5SA 4DXTA 3HWJA 5L9VA 1D2QA 1CQ9A 3SKVA 3T3YA 4BA6A 1BKZA 1AR81 1FPN3 2VVFA 4UFLA 4EN9B 1SLLA 3ZYFA 1MQTB 4LO8A 5E1RA 5F7UA 1JUIA 5F9TA 1NCRB 1ZZBA 3KQ4B 4GH4A 4HFSA 5T55A 1ZZ9A 4Z1VA 3OYWA 2VM9A 1DYOA 2WFPA 4D7TA 3UESA 5IK5A 5DG2A 4Y4RA 3KV9A 1MVQA 3HN1A 4JGYA 4JRLA 2YFZA 3NW4A 3QH7A 2VUDA 2OT7A 3Q8EA 4AVBA 3LCPA 3S0MA 1GZWA 2J1UA 4IV3A 2VC9A 3Q8AA 3NKTA 3MIGA 4WM7C 4Q0PA 5IYYA 4ZZ5A 5CVRA 4K6BA 4F7ZA 3ZLIA 4RS5B 5GLUA 1CESA 3B02A 4C8DA 1R093 2RS33 2YMZA 3NQHA 4Q4Y2 5AVPA 4A3ZA 2QUOA 2VQUA 2WZR2 2UY9A 5G04L 1COV1 4L0PA 2CTVA 2RR13 4PLNA 4YM0A 1MR5A 3WR0A 3ZVXA 1Q8SA 4BK5A 5L7OA 3TRSB 4Q8LA 2Y34A 4IUGA 2XJQA 5IVBA 3M7AA 4YSFA 5FXXA 4BHPA 5DUWA 5FXWA 1JZ7A 1F4HA 5LEKA 3KHCA 4RFT0 2BJSA 1O3SA 4MO3M 3WV6A 4CYDA 2BDRA 2RJKA 4B4PA 4UW6A 1UXXX 5T3NA 3EXUA 3C8XA 2DVFA 3LEGA 5JOWA 4QU2A 3L2HA 2R043 2V09A 2EXJA 1Y9MA 3KCXA 4I0BA 3S30A 3SH3A 4XACA 1CJDA 3N35A 1A3KA 2Z69A 1JUHA 1VBC1 3CKHA 5DAQA 2LUWA 2QKDA 4XF9A 1I6XA 4JKKA 3VBFC 5KC5A 5FWJA 4B3NA 2I2SA 1PGSA 1K5JA 1W6PB 5FY0A 2RDRA 5JAXA 1HRI3 2GP5A 1OQEA 1C3HA 3LWCA 3WG3A 1UZ0A 3ST7A 4CCDA 5AC92 3OBAA 3B69A 1GR3A 3LQCA 3KZ4C 4FQZA 4P00B 1AF9A 5FPXA 1AL21 1MACA 5L73A 1KFUL 3MW2A 4DEQA 3ILNA 4GQ7A 1HXS2 4BIFA 4NRQA 3C3VA 2YBKA 5CFCC 3T2PA 1G7YA 4YNIA 3LOIA 4WV8A 5FY7A 5DDJ1 1XQNA 4OVEA 3EHKA 4QPIA 4MX3A 1PO12 3VLBB 2HH9A 5ABJC 2AUYA 2OZ6A 1DGLA 5L19A 2WS93 4FTBA 2EXIA 1S2KA 3V0BB 1KJRA 4QU1A 1KQRA 3IB3A 2CWMA 2QFEA 3JD71 3VBFB 5BNOC 1Z7S3 4JKLA 3WEZA 5FO9B 4OYUA 5JR7B 3SNMA 1ODNA 5J98B 5C8CB 1RUE3 3VBRC 5JDBA 2R1DA 1OLRA 3NV3A 3RZGA 1TVGA 4AR2A 3ALQA 1VBE3 4LPLA 2R071 4C0BA 3IIAA 3JB4C 3PNAA 2V4AA 2ZGMA 3D5OA 4GWIA 4HXCA 4IEPA 2VMCA 4QX3A 5FZOB 2WFF3 3SQOA 4AHXA 4AHZA 2YC4A 3MIFA 3WP5A 1GZCA 1W2AX 2ZA9A 4PI0A 4PT6A 1C4RA 2ZMNA 1N1VA 1ONAA 4XFGA 3IM0A 3DV8A 2C4XA 3GZEA 3KF3A 4JDNA 4RSUA 4NPRA 5CFCB 2X53S 4YFWA 5J09A 1JZ8A 3AJZA 1TMF3 1VBA2 2EXKA 2WLQA 4XHBA 2VAUA 5A33A 3RZZA 3UETA 1UOBA 5JOXA 1N1TA 2H0VA 5ABJB 1Q8PA 4E2GA 1E5RA 5FZCA 4QX1A 4Q4W3 3UV9A 2A6VA 5AFEA 5FXZA 4R9DA 3D8CA 1HV1A 1G9CA 4MGTA 2C26A 4COVA 5BNOB 1AHSA 2ZCWA 5CYYA 2HLEA 1N1SA 4IGOA 5BNNC 2YDEA 2W0XA 2D93A 2B42B 3KT4A 4BQXA 3MFCA 3PMEA 4FCAA 3ZKUA 2DFBA 2E6VA 1C1FA 3TYJA 4TLFA 1PVXA 4TZDA 5GZGA 3TNQA 1AZDA 4NIGA 1PO23 3NVCA 3AKQA 5EQUA 2CDOA 2UYAA 4UYBA 3AX4A 3VDDC 4S2GA 5HCHA 1MS1A 1SLTA 5FPAA 3JBG2 3O1MA 4YVWB 4CDUA 4LKSA 4C1WA 3B5LB 3OPWA 5JOZA 3RZLA 5FXVA 1I9RA 1OLQA 1RUI3 2QQJA 1RVF2 3POSA 4YGDA 4LBMA 5DZFA 3E6DA 1RUH3 3ZYPA 5JSPA 1JYWA 4IE7A 1GWLA 2G19A 1WW7A 3KVAA 4R52A 1EPWA 2VUAA 4CP2A 4RD7A 2W3JA 2ZGOA 1SFYA 1WD3A 1PZ9A 2E7QA 4DXSA 1JW6A 1O6UA 1UCXA 2D5HA 1N3PA 4K21A 1A78A 4GB31 4XZUG 3SLIA 4OLLA 1BEV2 1UXZA 2D97A 4ASMB 3PVBB 4R9CA 5I8SA 1UYXA 3I59B 2BEOA 4FTEA 3VDBA 1AR93 5B4XA 1CIWA 4UBGA 3BKZA 2YYOA 1MS9A 1QH6A 4PBOA 3A4UA 4Y5TA 5I91A 1A6CA 3VDDB 4EJRA 1PHMA 5SV8A 5LBBA 2AENA 3WP3A 5HCFA 3ETQA 1YQ8A 3OD0A 2O8QA 2VO5A 1X82A 3ZR5A 1SLIA 3KLSA 4CCLA 4FPCA 1HLCA 2XBO3 5KHKA 4QDQA 4UF0B 3BUCA 4HETA 3SEEA 4EWEA 3V0AB 1FX5A 3G7DA 5JMCA 2ZAHA 4LHSA 1OMIA 5J7MA 1S2BA 1CX4A 5C9AC 2IC1A 4M0NA 5FZLA 5IAXA 4FPLA 1UL9A 2ZZQA 4IV3C 5LA9A 3ZFGC 1WGPA 2WSUA 5HCAA 2PLV1 4D7SA 2XHKA 1W6MA 2CYFA 4N53B 2PHLA 3WP4A 2VMGA 4JQTA 1EV13 2Q1MA 3SXWA 3EB7A 2JKBA 3ZOIA 4ZXKA 4RHV3 2VCCA 1PM4A 3GHMA 1UW8A 2CSGA 1S0IA 1QJZA 4S2HA 2I74A 3SKJE 5L7OC 1EAH3 1ZBA1 3J7HA 4RGGA 4LORA 1JYVA 5K0UC 3SHRA 1FOD3 1POV0 1O59A 3FX3A 1UYYA 4ISQA 4ZU4A 4QXHA 1V6OA 5F3IA 1CZVA 4LUKA 4G3YC 4XJUA 2UY8A 3AB0A 5EJ1B 2P6CA 3N4MA 4QX8A 4Q0VA 1RGSA 4Q4X2 4TLGA 4DO0A 2JB8A 2PAKA 5IVFA 5JSOA 3BALA 5C9AB 1LU2A 4QB6A 4NR1A 1GOGA 1QKQA 2FCVA 3PVNA 4IV3B 3ZFGB 4LE3A 4N7IA 3JQXA 4ITCA 4JKMA 4LULA 4IGPA 1RUE1 2JE7A 3ACLA 4Q4V1 4XDOA 1WD4A 5FZIA 3WW4A 3FLPA 1QOSA 1UZVA 4CSWA 4EROA 1MVEA 1X33A 1VBE1 2VNVA 3OY8B 3OB8A 1AR63 1QQP1 2X10A 2YB7A 4HMZA 1UO9A 2QNKA 1PM7A 5KXDA 5L7OB 3T1LA 1EPZA 2VXJA 3UNPA 3UJOA 4RQPC 3AKPA 5E89A 1OLME 1FI2A 5K0UB 2HWD3 4IEYA 2CGPA 5A7OA 2FDGA 2DVGA 4E8DA 1VMHA 3LKJA 4NUBA 2P3YA 5KXEA 4V1PA 1J58A 4QT6A 3MFAA 4NVPA 3HQXA 1R1A2 2ZX0A 2RM22 4NIAA 3KD4A 3TNPB 2YUEA 2ENRA 2GZWA 3IDAA 5A6ZA 4Q4W1 4O65A 3KMHA 5JCTA 2WZPP 4MGIE 5JZGC 5I8TA 3MO4A 4QPIC 5KXCA 1Y9GA 5IAVA 3O1SA 3H0OA 2ZXQA 3KHBA 1OF3A 1PGW1 1DF0A 3OOXA 1RUF1 1IPSA 1UWWA 3CDZB 3RYPA 3LEKA 3FBYA 5EHDA 2OKXA 2ZABA 2QQMA 2VULA 4M3CB 3WDUA 3WF2A 3MUY1 4A4AA 4UFKA 5FR3A 1G86A 4BQ1A 1W9FA 3USUB 1ND3A 2VTXJ 3WNOA 5JPNB 2XLFA 4RQPB 5FMOS 5JUVA 5A6XA 1PO21 3PDQA 4O9GA 1U5IA 1QOTA 1DZTA 2UWBA 2XQRA 3QOPA 1SCSA 4W4ZA 3FE5A 2VZUA 3MEPA 1LOFC 5A7SA 5LRSA 1LAJA 4OFGA 3K75B 4K7JA 1QEXA 2VMEA 3DCQA 3K46A 2D43A 5TSWA 4XAEA 1RITA 5JZGB 4IE0A 3W58A 2QZ3A 4A7KA 3J9SA 5CZKA 2HEWF 1VBD3 4A44A 3ILFA 3IIIA 5BV6A 3PVEA 4GWMA 1W05A 1ND2A 3VKLA 3GBGA 1DU3D 1XNDA 1AX2A 4JCKA 1Q3EA 2RS52 2F6BA 4AHYA 4BYYA 2XJUA 1KFXL 5AVAA 1ZBE1 5IT6A 4QB2A 2GN3A 1GFF2 5FLHA 1OQ1A 4A7ZA 2WIIB 2VZQA 3J7LA 1DCSA 1OUSA 1VBB3 2D6LX 2ZMKA 3LOBA 1W2UA 3KGLA 3FLRA 4FTSA 1POV3 3QACA 1T6BX 4DUWA 4QB1A 1HN1A 2VVDA 2XB6C 1NA1A 1OLMA 1PX3A 4EZ4A 1LHWA 2IWGB 1E5HA 1CPNA 3NNLA 4HK8A 2HWF3 3LIHA 3I2HA 2NYYA 3O0WA 5GZDA 1SEFA 4KH9A 2ZGUA 3NAPC 5FY8A 3QLQA 4YW3A 1QJX2 2E26A 1NXMA 3A0NA 4XFHA 5SV5A 2WNVA 2VZ3A 4AQSA 1GBGA 3AKSA 5I0TA 1RMU2 2PMWB 2ZS6B 4OI1A 2A6YA 2VOXA 4KWUA 2PQQA 5CU1A 4EZHA 4DY3A 4XFBA 5EFUA 5M0TA 1BBT2 1W90A 3RZJA 2EA7A 1WBFA 2E32A 2HWC3 2R1BA 5ERLA 1EV11 1WMEA 2RMU3 4NAOA 4R8HA 4DUXA 4OZXA 2IXLA 1N1YA 1W2TA 1GNYA 4B4RA 1H2NA 4NIIA 2WDBA 3J8F2 4K40A 5T5PA 3NNMA 1EAH1 5BNPB 2XWJB 4IGQA 3C2UA 5FLJA 4XUNA 1YJLA 3UJQA 5DN2A 4DQAA 4XDPA 3O1PA 2JDAA 2WRAA 3ZM8A 2JX9A 1GLHA 4LBQD 3NAPB 2XHNA 5L9BA 3IPVB 4BDVB 4GIQA 3B94A 2BGOA 4ATEA 1RHI1 2BFUS 1RUC2 2VZSA 2ZZJA 4Q5OA 4WVMB 4FBFA 1JH5A 5C3SA 4DXRA 1B09A 3AZZA 3IWZA 3UGFA 3POIA 4QKBA 4AEDB 4AQ6A 2CAUA 2VCMA 2WAOA 3AP4A 1DQ2A 2B9VA 1JYTA 4XIOA 1HB2A 1RYYA 3PUHA 1XE7A 3RI8A 4LKFA 5A1FA 3OGSA 1OHFA 1LGBA 1OVPA 2XXZA 3BU0A 4LIVA 2WWJA 5ANNA 4YGEA 1ZZCA 5BNQA 1NLSA 1TME3 3AMMA 4QPWA 1W0NA 2VR4A 4BMEA 4ASLA 1AR61 4CU6A 1G6NA 2ADEA 3VBUA 2ARCA 2VMFA 4JAAA 4HKOA 1STMA 1S0JA 2OYZA 3AL6A 5FYTA 2ERFA 3S7EA 1LOBA 4YZ5A 2GC3A 4AAXA 2XDVA 1PMHX 4DNYA 4ZHNA 1D4M3 1RJ8A 3OUIA 4FFFA 1GV9A 1OD5A 1OKQA 2DU0A 1XYNA 2D3PA 2P4EA 3D0JA 4H2AA 5BUVA 1UN1A 2HEYF 3CNAA 1MS4A 1SHWB 2DYCA 2Q1ZB 2WO2A 2WN2A 3KF5A 2A71A 3MIHA 1LRHA 4Q0UA 2FDFA 1XB9A 3OEBA 1R082 3MGUA 2VBPA 2QQOA 2D6MA 4FP3A 4J25A 2VOWA 1K12A 1PIV3 2HWE2 2HWB2 4AW7A 1BVP1 4CUCA 1XU2A 3ZYBA 4UWDA 2EIGA 4TN7A 3VDAA 4NHYA 5FY4A 1ULGA 1T6GC 4MV2A 1PVC3 1Y3TA 2IXKA 2ORZA 2TBVA 3QBQA 5DZGA 5E8AA 1F4AA 4CXYA 3VZOA 1JU4A 3WNLA 3RZHA 5FKBA 1LTEA 2D3RA 4EN8B 1OBNA 4Y5Z0 3LA3A 1DGRN 4XEZA 5L9RA 4AFBA 1CAUA 1D0GA 3MI8A 1LODA 2PELA 4XTMA 4BB3A 5IFPA 1H8TB 1JODA 2ET7A 4TTGA 3ZYRA 4AZZA 3KWVA 2NPIA 1C8NA 3HNYM 4ISRA 3I3BA 2AR6A 4DUVA 2VZTA 2VG9A 4C91A 4GWNA 1AR71 1J3RA 5E6HA 5BPXA 4YZ4A 1H0BA 1KS5A 1W8UA 1VRH2 3POFA 4NAMA 3WW1A 4CP9B 2MPFA 4I30A 1D2SA 4BXSV 1MZEA 1PGL2 2KM2A 1ASJ2 4K1YA 5JI9A 2P2KA 2LM3A 5FUPA 5A32B 1VBD1 4Y20A 1WCDJ 2RHPA 1Y4WA 3LFMA 3GBWA 4NPLA 5KC6A 2WNEA 4M01A 3LA7A 1LOAA 1NLRA 2RG4A 4D69A 4HSJA 5CB7A 2RS12 3HIFA 3K51A 4QXCA 3T0BA 4JTOA 3ZKYA 1TEIA 4OHWA 2QQVA 3K48A 3OUHA 4N7UA 2HKXA 3ZYGA 1REFA 1W9WA 1LOEA 1QDCA 4Y22A 1FMD1 1V9U2 5F6KA 3CF6E 2BTVC 5IWFA 1ND3C 3MICA 4KG0A 2BQPA 1GUIA 4YGBA 3CBNA 3JB8A 4M4RA 1G9FA 5C70A 3TN92 4OHVA 1L7LA 3MPPG 1UKRA 3Q9OA 1O4TA 3FC0A 4LOSA 4XETA 4CDXA 1HRV1 2VL4A 3LGRA 2QCSB 4YW5A 1FT9A 3WHUA 5C4WC 2E7AA 3SMHA 3OGVA 3KGZA 4XPVA 2CGOA 1UPSA 4ZZ8A 5FMBA 4WBBA 2Y6LA 5CIRA 1UX6A 2CGNA 1S1AA 3J26N 2B39A 2WZR3 3DPRA 5EIYB 1LR5A 4RYDA 3I2OA 1B35B 3U07A 1UY1A 5LK5A 1GQPA 1PK6A 5ACA2 1MEC1 1MS3A 2ZX1A 3POJA 5EV7A 4A6SA 4FAGA 3KQRA 3LEMA 1ND2C 1OPMA 1ZRCA 3TOJA 4LO6B 4WVWA 3PHMA 1WMXA 3MF9A 3IAQA 5K4LA 5LCWL 5CADA 2IFRA 3AC0A 3S57A 3HT1A 3NNGA 1AUYA 1GQGA 1RUJ1 2J42A 2VY0A 3N9NA 3PMSA 4QMAA 2Y38A 1CGPA 1AR82 1ND3B 5FZ9A 4Q8KA 3N9PA 3UGGA 2B9UA 1RUNA 3T09A 1DQ5A 1ULPA 2XVKA 4JRAA 1UU4A 3F2ZA 2PFWA 4CP1A 3TWIA 1KRIA 5C4WB 1W9SA 5HBAA 3R4SA 1J84A 1UMHA 5EPAA 4YM3A 3F95A 3J4UH 3WDYA 4QAWA 4W6XA 2Q8CA 3EQEA 1J1LA 3AKTA 2E9QA 4AAPA 1KDKA 3ZFEB 3P6BA 1MZFA 3PTYA 4RR3C 1NQDA 3CHXA 4UFMA 1ND2B 4ES9A 5AC93 2JG8A 1BXHA 2Z79A 4QHZA 5FY1A 3ZSJA 2BWAA 2WC2A 4FI9A 4Z07A 5CKNA 3K77A 4EV0A 2I45A 1COV2 2CDPA 5A7QA 5EWSA 4WM8B 5FPLA 1UNBA 1HQNA 1SBDA 1ZA7A 3JCIA 2PTMA 3WQBA 2WQ4A 3MIDA 3WQ0A 2EVXA 1W3VA 2LW8A 3AP5A 1QJY1 4LXLA 2QVSB 1IG3A 1O91A 3U4XA 5GZCA 1ULDA 3N36A 3WDTA 4XF1A 3WHTA 2PHWA 2IFWA 3C7GA 4QPGC 1MS5A 2LALA 4H55A 4CCOA 1PO13 5D2AA 1QJU1 1JYCA 2VNRA 4HN0A 4LTAA 1UY3A 4CDQA 1AYM1 3K4DA 4LBKA 3ZXJA 2O0OA 2W1QA 1SFNA 2WL1A 4RGAA 1NQJA 2YBSA 1GOFA 2C9KA 3I2JA 2VXRA 3O14A 4NN0A 2JDNA 5IVVA 1UYZA 1VBC2 2GSYA 3R0RA 2OA2A 2QQIA 1REEA 2W95A 1PIV1 3WX5A 1HIXA 2WYSA 2ZHLA 4RR3B 4QX2A 1L7QA 5I8YA 3D82A 1YFUA 5GZFA 3H3ZA 1XNKA 2BP6A 1V6NA 2VBBA 5F5IA 4EE2A 2JDKA 1BHGA 1SACA 1UAIA 2DCTA 2J1VA 3CJIA 4A42A 4GULA 2W1WA 3ZFFA 2W91A 1YYNA 5FYYA 4E2SA 2EALA 2NZ9A 4AGVA 3OEAA 4JVAA 3VZJA 3ZDSA 1RUD1 5IJRA 4E27A 4CEWC 4J1WA 5FQ0A 5C71A 3FFZA 3AVRA 1F2NA 2V5YA 1VBA3 4IEOA 5JIUA 1AJOA 3H1YA 4QPGB 1AL22 3VL8A 1LULA 3FBMA 3EO6A 5FKCA 3UK9A 1IS5A 4AXOA 1ZRDA 3UKNA 4FAHA 1AX0A 3N3HA 5FTTC 2AEYA 4AYUA 4HOOA 5DDJ2 5FYMA 1PMJX 2WYFA 4IV1A 2B8MA 3ON7A 5F5QA 4HVQA 4AHWA 1WMDA 1XXNA 3HMYA 4LO5B 1GNZA 3POEA 4UFIA 1UX7A 3BCWA 2WR9A 1BMV1 2YU2A 3E6BA 4LBQA 1Q8OA 3HAGA 3JD72 2DVBA 4JHZA 4WM7B 2HBTA 3NJZA 1NE6A 3V65A 1SLBA 1HKDA 2DCJA 3PJQA 5C5UA 3M8LA 4TXWA 4PLOA 3SITA 4CEWB 2JJ6A 4XJ8A 4PJYA 4AVSA 4LA3A 2R072 5FMOL 4QKNA 3FZ3A 3JBG3 4D6RA 1CAVA 5IK4A 1SBFA 1ZZ8A 1DIWA 3AP6A 5LA0A 4LKEA 4XOGA 4YZ1A 3LDKA 3I97A 1RVF3 4JHTA 3ZXLA 4YPJA 4S2DA 4BQ3A 3VD4A 1W6NA 3JU9A 5IVYA 2B5HA 1WLCA 3ZN5A 4NE9A 3H42B 3BPZA 2CV6A 3IDCB 1MPXA 3IMMA 1G9DA 1W8ZA 5A3WA 4FPKA 1ODMA 2W1UA 2Y0IA 4TWTA 4XMIA 1S0EA 4B29A 1QOOA 4DRVA 3AM2A 1BEV3 1I3HA 2WZR1 2MEV1 1QXPA 1QY4A 4URTA 5FWEA 3MPBA 4XMAA 1YO8A 3SEPA 1SZBA 1WW5A 4PF5A 5APAA 2H6BA 2NMOA 2OPKA 2ES3A 2HYXA 2GP3A 1SMVA 3CQOA 5LASA 5JWPA 2R062 3VHOA 1JS9A 2D6PA 3GZAA 3CLPA 5FLIA 3ZR6A 1QJEA 4YGCA 4KU7A 4P9GA 1MS0A 1ENSA 1FV3A 4K20A 3JUUA 4IEZA 4XQDA 4N90A 5F3GA 1EYBA 4SBVA 5FBZA 4NWVA 2PHFA 1W03A 3VBOA 3O1RA 1E5SA 3LDBA 2RDQA 2DTWA 3E5QA 4YW2A 1S2EA 4Q2FA 4IEXA 4Y3OA 4NWWA 4AI8A 1WKYA 3H1WA 5IK7A 3PLQA 4QD2A 5FPBA 1I5ZA 3RDIA 3VZMA 3KVBA 1H9WA 1K5MA 4CRQA 2JDMA 3ZMNA 4KWKA 1ZNPA 2W68A 5LRRA 1H30A 2ZX4A 5K8SA 1UY4A 4J6GA 1R64A 4MXWA 4U36A 3RJ2X 2HYKA 5F2WA 5FY9A 1W8WA 4NHMA 5CFDA 2Y6FA 3ZO0B 1H6XA 1KGYA 4AFAA 1OXCA 4GB32 1UU6A 2F4PA 4AG4A 4UBHA 2D6KA 1H1MA 4LHNA 5CKQA 4URAA 1UMZA 3VBRB 4N43A 4BH9A 4OUEA 1IQDC 2C1FA 1K3IA 1JZ3A 3U0ZA 2JDHA 3AYEA 1X9PA 2H0BA 3SCGA 1PMIA 4CUAA 2GN7A 4L9BA 1ST8A 2QJVA 2XJTA 3H7JA 4Y22B 1FPN1 4A7YA 1BCXA 2D44A 1CVNA 4YG0A 2DVAA 3ES4A 1W6OB 2ET1A 4Q4X3 4AI3A 1W8TA 2IUWA 3AXEA 1LJ7A 2XL7A 1UOGA 1HB4A 5FY5A 3PJYA 5KHJA 2E53A 2O14A 4Q29A 3ZPYA 4JGZA 1X7NA 4R4ZA 4I0WB 2VOKA 3SISA 1DQ0A 1W99A 2GAUA 5D8AC 2WT0A 5A3PA 3UKVA 1O7FA 3PTRB 4LOTA 3GJAA 4G9SB 4YVSA 2VZRA 5C5TA 1DGRA 1CD3G 1YIFA 1KITA 4PI2A 2FCUA 2PLV2 4EQVA 5BNNB 4IEQA 1R091 2RS31 3I2IA 3I3MA 2CNAA 1ENXA 3ZXEA 1HDKA 2BOIA 2JG8C 4QQ2A 3S5QA 2YPDA 2V72A 4C90A 5C3PA 4CTEA 2QDRA 2P1BA 4M0HA 2RR11 1GU3A 4XTPA 4D6QA 3O12A 2FZ1A 5KR7A 3ZXGA 3LPGA 4META 5FZAA 5HXVA 2GNDA 1R1A3 2RM23 1ZBA2 4LR4A 1BK1A 3M3OA 2HEVF 1NG0A 3BVCA 3OBRA 4UW3A 3T0AA 3RI9A 1U5ZA 4QGNA 1ZA4A 1OVSA 1VPHA 1C8M2 1UY2A 1D0HA 5FO8B 2ZHMA 2R041 3ELNA 4LKDA 3WF1A 4GH4C 3FUQA 5D8AB 3HPNA 4K1ZA 3IZOA 2KXLA 1CR7A 1US2A 2UWAA 4JGYC 4CCEA 1VMFA 3POWA 2GNMA 3I49A 4E2QA 2DTYA 1D4VB 2OS2A 2VOVA 3EYPA 2Y8KA 3I3EA 1IHMA 3WDXA 1XNCA 4Y1XA 4B7KA 2WO3A 5A7PA 1RUE2 5FZHA 2JG8B 4Q4V2 3M3IA 5KHGA 3WNKA 2XUEA 1ZM1A 2Y26A 3MDPA 5A70A 4O9EA 1VBE2 1SPPB 2A73B 3IBMA 2NP0A 1QQP2 3SH5A 3ZFFC 1CX1A 1OA4A 1HRI1 2W47A 4MVTA 1CAXA 3JBG1 1LECA 1UD1A 2WAAA 1MZ5A 2YBPA 3O1UA 3LIGA 4NPMA 5FZMA 1Q43A 4RN5A 4F3JA 2J1TA
chains in the Genus database with same CATH topology
2X5IA 4XFIA 5AFBA 3NV2A 5FRAA 3RMYA 1U5YA 4YZ2A 3WLUA 2P34A 3BIWE 4GH4B 1AXYA 1H4HA 3OYWB 4LHKA 1PZ8A 2ZKNA 2ZGNA 4BWOA 4B4QA 4IV1C 4JGYB 2RS53 1X8MA 4Y24A 2WS91 1BEV1 4JTNA 4JV4A 1VAKA 2PYTA 1RUF2 4Y1YA 2NM1A 1UIKA 1G9AA 2ZGPA 1RIRA 1GZWB 1Z7S1 2PHTA 2CY6A 2XJSA 4MUVA 5KXBA 2BNNA 2ZHKA 4CZSA 1QNWA 4XDQA 2VQ0A 1N47A 1PO22 2Q5TA 4HVOA 2WFF1 4XW3A 1H4GA 2D7FA 2XL9A 3WCSA 3RWNA 1QJX3 2GALA 3IKWA 3ZYJB 1ENQA 4BCUA 1TMF1 3LSDA 5FPZA 3BOPA 4F83A 4AVCA 1U12A 3MLLA 1DDLA 2FQPA 1V70A 4QM8A 3VKFC 4IV1B 1H2MA 3N7MA 4ZU7A 1LOCA 1BBT3 5L36A 3HBZA 2TUNA 2D5FA 3NV1A 4FT8A 4Y1VA 1O3TA 3ENRA 2JG9A 4XBLA 4QQHA 3VHNA 3J8F3 5DZEA 1ZBE2 4COUA 3L9JT 2PHRA 2XLGA 4LNVA 3P3NA 5FREA 3CU7A 3WNXA 3H3UA 3WP6A 2ZX2A 2ZTNA 1DGWA 1CAVB 4GMP0 2EXHA 1ZZ6A 4I2OA 1RUC3 3CO2A 3OGJA 2DCZA 1ZX5A 4MGKE 1DQ1A 5FAXA 3OD4A 1W6NB 2DCYA 3IDBB 1RUI1 1XYPA 4J1XA 1BYHA 2B7YA 4EN6B 1YWKA 1RUH1 4FO9A 1ENRA 2XKPA 4BE3A 2CAVA 4QPIB 4XQWA 1VAMA 2I07B 1S0FA 2JD4A 4XF0A 3DGTA 2DU1A 2QQPA 4AE2A 1GANA 4I0AA 2WNUA 3NWKA 4M00A 3R4UA 2BBVA 4ZU5A 1HW5A 4D94A 4MYEA 4N43C 1AR91 1WBLA 3I4IA 2EAKA 1O3QA 2QZ2A 1EAH2 3RNSA 4TYSA 1R083 3O0VA 3ZXFA 4Z92B 3MIEA 4LE4A 3AZWA 3VN4A 2HWE3 2HWB3 4XZPA 2G4IA 2WQZC 1RHI2 3VBHA 3O7OA 1J3QA 2XBO1 3VKMA 4CDUC 5A33B 4WZCA 1YFWA 1YHFA 4FVVA 1KDMA 2XJRA 4PLMA 2ZAAA 3U11A 1WLDA 3LSEA 3ZSLA 2ZACA 3BU7A 3IN9A 4FOWA 2DURA 1X8EA 1NXD1 2A5ZA 1MQTA 2H6CA 4I01A 4KG8A 5K9YA 4PIYA 1NCRA 3E97A 4N43B 3ME2A 4HSLA 3H9AA 2XUMA 1MZ6A 3ZN6A 1OOPA 4EN0A 1VRH3 2C9AA 4OUMA 4RHV1 4GKYA 5GLZA 5E16A 4XJZA 5I93A 1ASJ3 3AXDA 1FOD1 5CG9A 1RJ7A 3MIBA 4RS5A 3ZX7A 2XG3A 4CDUB 2ZGTA 3CL1A 3FMGA 1ALYA 4GKXA 5CA6A 1URXA 1QGLA 1DZQA 2SLIA 4KNCA 4PDWA 3RJRA 1Z0HA 4Y1ZA 1ULFA 1V9U3 3ILRA 4QGMA 1TQ5A 4FPOB 3RYKA 3TN93 4GMP3 5CG8A 3OJBA 1RTVA 5GZEA 4PQ9A 1W6QA 2C5DA 5KBFA 4DFSA 3RRDA 4FPJA 3KS7A 1GYKA 5JVVA 2P37A 2HWD1 1AR72 2X5IC 1AXZA 1SQ4A 2IXHA 1LCLA 4XF3A 1BJQA 4KWJA 1VB2A 5ACA3 1XRUA 1RUG3 1Y43B 4HKLA 1XE8A 1W6PA 2D6OX 4AEMA 4MXVA 2D6NA 1S0CA 1F9KA 2OUJA 1VBD2 4FOVA 3AP7A 5DUUA 1Z78A 1DYPA 1YI7A 1S0DA 5FO7B 4SLIA 3AYAA 3MLKA 4YYOA 1AR83 1DFQA 1H9PA 4WVZA 3VL9A 4RL7A 1PNFA 4X8PA 1RL3A 1VIWB 3USSA 1S55A 4LO7A 3KT7A 1AYN2 1W6MB 1FMD2 3THTA 5K7PA 1AL0G 4GXLA 2Q8OA 1CAXB 1LEMA 1BVVA 4I02A 2ZJCA 4YW1A 3V0BA 2R6QA 4BZ4A 4L99A 2ZX3A 3N7LA 1HRV2 5HCBA 1ZRFA 1SLAA 4HKWA 1PZ7A 3POYA 2R49A 4QQLA 3DL3A 5C8CA 3PVOA 4AFDA 4LLOA 3AKRA 3WG2A 1COV3 3AMPA 1MEC2 1JTZX 4YLZA 3OCPA 4DPNA 2PA7A 1LKNA 2BVVA 5EZWA 4IETA 5H9PA 2JG9C 5T52A 5FOJB 1IS6A 3B01A 4Q1RA 2GNBA 2GMMA 1RUJ2 1WLTA 2A6WA 4K8FA 2NLRA 4P9WA 4DMIA 1VBB1 2AGSA 4JDMA 1XYOA 2FZ2A 1XNBA 4LBNA 2MHFA 4EN7B 2BWCA 4QHBA 1NY71 1POV1 3E5XA 4XIKA 3TB0A 1OA2A 3SH4A 2YGLA 4XXAA 5BNOA 1VBC3 2ILMA 2HWF1 2HWE1 5T5LA 1LU1A 3H1MA 4C0HA 1DG6A 3WG1A 2WJSA 1Y7BA 3WINE 4L97A 2Q30A 2YZ4A 2XWBB 1JN2P 4Q4Y3 2JXAA 1O3RA 4QX5A 1TE1B 2BVBA 1ZVFA 1PNGA 2BUKA 4L8QA 1AL23 1JXNA 4YVWA 2GC2A 3AZXA 4ONUA 1F8VA 1IOAA 2IXJA 2HWC1 1QJY2 2W52A 1AJKA 2RMU1 5T50A 1HQWA 3GZTB 3M4FA 1RB8G 5DDJ3 3VUOA 1KS4A 3RMXA 2K0GA 3LA2A 5J37A 1QJU2 3LB9A 1PGL1 1FATA 4XBNA 2NN8A 1AYM2 2JENA 2VNGA 4FPGA 3MLJA 1C28A 3JD73 1NA1C 2B46X 3ZSEA 2LTNA 1ZYBA 2QE3A 2A3WA 3GALA 3I59A 1PIV2 3IMNA 2R073 3MZHA 4W6YA 5H9SA 4OI4A 4KGGA 4LT5A 1ZRRA 1V9U1 2WNVC 4I09A 2ZGRA 2AZ5A 1RUD2 1TME1 4BMBA 3TN91 3QH6A 3NL1A 1LHNA 1W39A 2K9ZA 1HXS3 4YG3A 3RYRA 4YFZA 5H9QA 5DUXA 2HJIA 5BXXA 1OOPC 4UXAA 1I1EA 1D4M1 1JHNA 1NA1B 3DKWA 4H7MA 5T5JA 4A2UA 4XJWA 5ACA1 1SBEA 1RUG1 1O5UA 5FOBB 3FWEA 4AFMA 4E4SA 4P9XA 4N53A 1BMV2 1Q5OA 2R063 3I54A 3VZKA 1WUVA 4P9LA 4W6WA 3EBRA 4YM1A 2WNVB 2YC0A 3WDVA 3MF6A 4YM2A 1PVC1 1YI9A 3RQ0A 2JECA 4PDWC 1YCIA 4XBQA 2GMEA 4XQ4A 2BGCA 4HBNA 3FUOA 2AYHA 4PCRA 2O1QA 5EXOA 1H1AA 2WA3A 4HK9A 1QU0A 3ZN6B 1OOPB 1LHOA 3VBUC 1LGCA 4LLFA 5FFOC 2VNOA 1OA3A 3E6CC 3N7JA 1VALA 5C9AA 1UZZA 3ZFGA 4YW4A 1UF2C 4XXPA 3MYXA 1OPOA 1S0GA 2A75A 5GLTA 4GB33 1XU1A 4OI0A 4COZA 1GSLA 1H8VA 3OY8A 2MEV2 1UPIA 3VHPA 4Q0SA 3BB6A 4Z8BA 1FXZA 5I0UA 1WW4A 2X8KA 4XILA 4X6QB 3IT8A 4IESA 4ORFA 5JOYA 1QXRA 4PDWB 5K0UA 1HV0A 3W9AA 2WT1A 3DN7A 5IK8A 4FXGB 4DS0A 2RE9A 4LUMA 4NHLA 3KB5A 1M4WA 3T1MA 3M70A 3A0KA 2NMNA 1SCRA 1W6QB 3RG0A 3VBUB 4AQTA 1L3JA 1LESA 3WT3A 4UW5A 1HQLA 4I3PA 5H9RA 2IXCA 2GMPA 4NO4A 3VZLA 4KBBA 3FHIB 4OHYA 2ZGKA 4M3CA 4EWDA 1S0BA 2DV9A 2K2SA 2PLV3 5I0RA 1NCQA 4L11A 5F6LB 3USUA 4Q4Y1 5C8CC 5D1IA 1IPJA 3GF6A 4RQPA 1V6MA 4DXZA 2PHUA 3FLTA 3IDEA 2GH2A 2A6XA 2VMHA 2VW1A 2A70A 3NSTA 3M3CA 4WVVA 3RPQA 5LK7B 1ZBA3 2E7TA 2XJPA 4FOQA 2GC1A 2AH2A 4NHKA 1J59A 4IXLA 2B45X 1FPN2 2NQYA 1C8M3 4BOWA 2R0FA 1CAUB 3AZVA 2DWRA 4IQPA 3GNEA 5JZGA 2V73A 5C8WA 4E9KA 4QGLA 1O4YA 4DY5A 2XJVA 4XFAA 2JICA 3ATGA 2VPVA 4OHZA 1JBCA 2ZGQA 1DZRA 1KJLA 2Z2SB 2UU8A 4DRRA 3HR9A 4CDXC 4R9BA 4MGYE 2VW2A 4Q4V3 1JOJA 1QQP3 4FXKB 4Y20B 1NYWA 4XE9A 4AVTA 3DPRC 5AC91 1R092 1C57A 2RS32 1LOFA 2N7GA 3D6EA 3R6SA 1PK6C 1HX6A 2P17A 3GYDA 3EJKA 4QQPA 2WINB 3M3QA 2RR12 4K3UA 2R30A 3FJSA 3VV1A 5KWRA 3ZMOA 1HXS1 4YVWC 3AMNA 1UIJA 4B7EA 2VQAA 4BLJA 2Z5WA 3HT2A 2CWSA 1PO11 3VKNA 3U10A 1WCKA 3H50A 1J1TA 2BFUL 3WUCA 4AI0A 1FAYA 2R042 1RUF3 3N7KA 3URFA 3ZXKA 3TAYA 2E63A 2FMYA 4CDXB 3ZIXA 4AI2A 1QXJA 2R061 5GLWA 3B7MA 2UWCA 3SCFA 4Z2WA 2XKOA 4P14A 1IKQA 3DPRB 2WWSA 3WG4A 5BNPA 1PK6B 1ULEA 2VVEA 5JIAA 1HRI2 1H2LA 1CN1A 3NAPA 3IPVA 3X29B 1ULCA 4DB5A 1C5HA 4WVMA 1VBA1 1VLNA 3D0SA 1GKBA 1VR3A 1FNYA 4AEDA 5JPMB 1YFYA 1DYKA 1C1LA 2ARXA 4LBJA 3KT1A 4HANA 3CEWA 1GQHA 1OI6A 1U0AA 1LHVA 2FBEA 2YY1A 4FPFA 4HZFA 5GJ6A 1VAVA 1QHDA 3AYCA 3VBSA 4EWAA 5C6CA 1IKPA 2D98A 2WS92 1A8MA 4CDQC 2EAAA 1G9BA 1ZBE3 2P3JA 4N53C 2WLPA 2C0ZA 2D3SA 2ZGLA 4Y4YA 1Z7S2 4HL0A 4X8NA 3WXPA 2G9FA 3CJXA 3JZVA 3OF1A 4AI1A 4L92A 3OTFA 3KCYA 2DFCA 1DGWX 1W0PA 2UURA 4JDOA 3CJIC 3V64A 3KM5A 1YUDA 2ZPXA 1OQDA 4FP2A 1WA4A 4KGQA 2WFF2 3OGGA 2FHRA 4XFFA 4AK3A 1RVF1 1UKGA 2OW4A 2VECA 4DOUA 4HT1T 1TNFA 1TMF2 2VGDA 2OVUA 3WQ7A 4FPYA 4HN1A 4IL7A 1H1IA 2GC0A 4CDQB 3ZIWA 5F1RA 4Q4W2 2YPJA 1F5JA 4Q26A 4OHXA 2W08A 2E51A 1PGW2 1H8TA 5GALA 4XYXA 3ASIA 1YNAA 1YXWA 2ARBA 5J96B 2ZHNA 5KHIA 1CAWA 3CJIB 3ECQA 3ZFFB 3ZSMA 5C33A 2BYVE 3AFKA 4CEYA 4COYA 4AFCA 1RUOA 2G9GA 1IPKA 5FQ0B 1C8M1 4GA9A 4HVRA 1RHI3 4CDWA 1F31A 2TNFA 1IQAA 5A32A 1APNA 4OUSA 4IEUA 3AP9A 2ZMLA 4H14A 5GLVA 4OI2A 1RUI2 2OUHA 2PN5A 4FPEA 4LEJA 4W65A 1IS3A 1LENA 1RUH2 2D40A 4X6RB 1IZ3A 1RMU3 2PHDA 2ZBJA 2DVDA 2PAMA 3WW2A 2DUPA 1NCQC 4LBQB 1UZYA 1QDOA 5J36A 4HPKA 5A3LA 4Y1UA 1CPMA 4KQ7A 4E4ZA 2KA3A 5JLVA 3GZUC 2XVGA 1AR92 3T2TA 1DLLA 4AEKA 1MS8A 4LBOA 1FV2A 5A3MA 2Y0OA 1O5LA 2PAEA 4WZFA 5FDBA 3M1HA 3VBOC 3ZXDA 3G6JB 1B35A 1YFXA 4DINB 1A8DA 4Q4X1 4I3GA 1O4ZA 2Q0AA 5T5OA 1G8WA 1V6LA 2BNOA 2XBO2 2BNMA 2JDZA 2VH9A 1K5MC 3THPA 1ZZ7A 3ZSKA 1R1ZA 2YHJA 3BODA 4AF9A 1NCQB 2BW8A 1EP0A 1W0OA 1LGNA 2QDNA 1FNZA 4UW4A 5CFDC 4ATFA 4MSVA 2TEPA 1Y9QA 1V6IA 4COWA 1DQ6A 1EV12 3KCCA 1AR73 5C4WA 3ZYIB 3B9CA 1OSGA 2AREA 1N3QA 1YLLA 1Q8QA 4RHV2 2BPA2 2YXSA 5E88A 5FCCA 5CBLA 4XFCA 4C1XA 1R1A1 1E57A 2RM21 3AMQA 1LOGA 3VBOB 4DZGA 4S2FA 3WY6A 3ZFEA 1FOD2 5CNAA 4KU8A 1VJ2A 4PIXA 4JC1A 2PHXA 4IEVA 1QF3A 1QH7A 1K5MB 2VW0A 4R4XA 5GKAC 3M2MA 4INDA 4WM8A 4HLTA 4AGRA 4JGZC 4MXWB 2GNTA 5IUQA 4A3XA 4LHLA 4MLOA 1AYN3 1FMD3 1VB4A 5CFDB 4Q1PA 4XJ9A 2YV8A 1REDA 3W59A 4YVSC 5BNPC 1Q8VA 4JQRA 2JE9A 2SBAA 1Q56A 3GBFA 1AR62 3VKOA 2A3YA 4IEWA 4G4FA 1HRV3 3AZYA 4LBLA 3WCRA 5GM0A 4P5HA 3ES1A 1QMJA 2HWD2 5BYNA 1ZREA 4L2NA 4YG6A 4RR3A 3GHNA 2R32A 2X29A 4AVVA 4AEDC 5I0SA 3WD5A 1UU5A 4LO4B 4N9IA 2R0HA 1MEC3 4F8AA 2R16A 1WW6A 2WSVA 3UL2A 1LEDA 3I7DA 5DG1A 3TBDA 4QXKA 3V56A 4JGZB 5JSRA 2RS13 2RS51 3VBSC 2IXIA 3BTAA 2Z42A 3NKGA 4RA0A 1KXGA 1RUJ3 4QPGA 4E4DX 4U2AA 3LAGA 4AWDA 3WOGA 3FFQA 3VZNA 2FMDA 4QPYA 4YVSB 4BPZA 1QNYA 2Q4SA 3OPZA 4QQOA 3AJYA 4P9YA 3I2DA 4FSJA 3AK0A 1OFNA 3WQ1A 4XHXA 4H3WA 2OIIA 1WCSA 4AGGA 4H7LA 3RS6A 1QJX1 3DF0A 3VGIA 3WUDA 4WM7A 3NO8A 3UKTA 1DBNA 1X36A 3BOWA 4CEWA 1RMU1 1J3PA 1YJKA 4PBPA 3S6PA 3VBSB 4P9JA 1X50A 1BBT1 4MH0E 5EYYA 1AXKA 2IZWA 4B8EA 1NOVA 1QJY3 2MNGA 2GU9A 4Y26A 3ZN4A 1CONA 1DHKB 1H8TC 5JI7A 3J8F1 5EYXA 2O8OA 1QJU3 3HD8B 4AQ2A 3KSCA 4FQ4A 1VBB2 1AYM3 2OZJA 1BQPA 2A6ZA 2XH6A 2WKKA 1WLWA 1NY72 1YRZA 4CEYC 3B00A 3ROUA 1U5XA 1RC6A 2DUQA 1RUC1 4OULA 2X5IB 4MZUA 4CDWC 2HWF2 4CP0A 3QCWA 3VBFA 2GH8A 1NZCA 2VMIA 3AYDA 3H7YA 1V6JA 2ZKLA 3P3PA 3L2YA 3S7IA 3VHRA 2XLAA 5J3UA 1AX1A 1RUD3 4R9AA 2JEMA 5KHHA 1SDWA 4P9IA 4ZKTB 4Z82A 1QWRA 4MGZE 3E5UA 2WA4A 3LZZA 2YROA 3AMHA 5CFCA 2HWC2 2EF6A 4LA2A 1CAWB 4K9SA 2XGXA 1WMFA 2RMU2 3M3EA 3WDWA 1V00A 2CL2A 4CEYB 1AVBA 5T54A 5ABJA 2ZGSA 4Q27A 4CDWB 1R081 2XPJA 1IGOA 1GICA 3D4KA 1B35C 2HWB1 1F5FA 2ETEA 4XF4A 3VBRA 5BY5A 1RINA 5EJ3A 4KWLA 5HI0A 3B3QE 1IS4A 3OBTA 2DCKA 4D7YA 4AEJA 1M06G 2VU9A 1AYN1 4IERA 3B9IA 2RJLA 1OFSA 2GDFA 3WW3A 3SCHA 1JYIA 2JG9B 3WVJA 1W6OA 4HPKB 1TME2 2W39A 1KD7A 1LHUA 2ATFA 2WNUC 2P3IA 4Q0QA 1GNHA 3WZ1A 1N3OA 2UYBA 3INAA 2P3KA 3H8UA 1VRH1 2DUOA 3MW3A 4PIZA 1D4M2 4NOTA 1ASJ1 3B93A 3MW4A 2MEV3 4YRDA 3ZFEC 1RUG2 3JQWA 5BNNA 1GZ9A 1TNRA 4FPHA 5CAZA 1CJPA 4TSVA 1LB2A 3NV4A 1VP6A 1FYUA 3QD6A 4XJAA 1YIPA 2RS11 3APBA 4YZ3A 3RSJA 3VBHC 3DUIA 2A3XA 3R05A 4WM8C 2WT2A 1DQ4A 2YGMA 1PVC2 3VDDA 2ZOEB 5LEJA 5DXDA 1C5IA 3ZXAC 1BZWA 4N9HA 1NE4A 2DF7A 2WNUB 4FOYA 1MQTC 4BM8A 2VUJA 1H2KA 5B2GB 4GMP1 4GALA 1NCRC 4QM9A 3I8TA 5D8AA 4BLIA 1SLCA 1V6KA 5DUVA 3V0AA 2XVLA 4M3CF 3O0XA 4ES8A 4YARA 4BIOA 4KL1A 1EY2A 2A7AA 4AVAA 4M3CE 4D3WA 3R4DB 3VBHB 4RS5C 3AFGA 3O5SA 3HWJA 1D2QA 1CQ9A 4BA6A 1BKZA 1AR81 1FPN3 2VVFA 4EN9B 1SLLA 1MQTB 4LO8A 5E1RA 1JUIA 5F9TA 1NCRB 1ZZBA 4HFSA 4GH4A 5T55A 1ZZ9A 4Z1VA 3OYWA 2WFPA 4D7TA 5IK5A 5DG2A 4JRLA 1MVQA 3HN1A 4JGYA 3NW4A 3QH7A 4AVBA 3LCPA 3S0MA 1GZWA 4IV3A 3NKTA 3MIGA 4WM7C 4Q0PA 5CVRA 4K6BA 4F7ZA 4RS5B 5GLUA 1CESA 3B02A 1R093 2RS33 2YMZA 4Q4Y2 5AVPA 2QUOA 2WZR2 2UY9A 1COV1 2CTVA 2RR13 4PLNA 4YM0A 1MR5A 3WR0A 3ZVXA 1Q8SA 5L7OA 3TRSB 4Q8LA 2XJQA 3M7AA 4YSFA 4BHPA 5DUWA 5LEKA 4RFT0 1O3SA 3WV6A 4CYDA 4B4PA 2RJKA 4UW6A 5T3NA 3EXUA 2DVFA 5JOWA 4QU2A 3L2HA 2R043 2V09A 2EXJA 3KCXA 4I0BA 3S30A 3SH3A 1CJDA 3N35A 1A3KA 2Z69A 1JUHA 1VBC1 2LUWA 2QKDA 4XF9A 1I6XA 3VBFC 5KC5A 4B3NA 2I2SA 1PGSA 1W6PB 5JAXA 1HRI3 1OQEA 1C3HA 3LWCA 3WG3A 3ST7A 5AC92 3B69A 1GR3A 3KZ4C 4FQZA 1AF9A 5FPXA 1AL21 1MACA 5L73A 1KFUL 3MW2A 3ILNA 4GQ7A 1HXS2 4BIFA 3C3VA 5CFCC 1G7YA 4YNIA 3LOIA 4WV8A 5DDJ1 1XQNA