2R073

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r07300
4RR3A 4GMP3 1QJY3 3J8F3 5BNOC 1ZBE3 1K5MA 2RMU1 1PO12 2R071 1C8M3 4FTEA 3VBFB 2ZAHA 4RHV2 5ACA2 1PIV2 1QQP1 1VBE2 2RR13 4CDQB 4AEDA 2RS11 1EV12 5ABJC 1BMV1 1AL22 3FBMA 1AYM2 4GMP1 3J8F1 2PLV2 1B35B 1HXS2 1RUH3 1MQTC 1CJDA 2Y26A 4JGYC 1RUF3 1ZBE1 1ND2A 1ASJ2 5C9AA 1VRH2 1NCRB 1AR92 2WZR2 2RR11 1NA1C 4CDXC 1HRI3 5BNNC 1RUC1 1VBA3 4QPGA 3VDDC 1RUH1 3JD72 5AC92 2R062 2BUKA 4RHV3 3VBOB 1H8TB 3CJIA 1PIV3 4GH4B 4PDWA 1OOPA 1HRI1 4IV3B 1EV13 1VBA1 5L7OC 1R092 1AL23 1AYM3 3NAPB 3LOBA 2PLV3 4FTBA 1HXS3 4Q4Y2 1VBD2 1PO11 3ZFEA 4CDWB 1AR82 1K5MC 4RHV1 5A33B 1PIV1 1VRH3 4RQPC 1BBT2 5JZGB 2WZR3 1HRV3 5CFDB 1EV11 1AL21 1AYM1 5BNPB 2PLV1 1HXS1 2IZWA 4WM8B 5AC93 2HWE2 1VRH1 1AR91 5C8CA 2WZR1 1HRV1 2RMU2 1R093 4CEYA 5K0UB 2BPA2 5D8AC 4Q4Y3 4QPGC 4CEWB 1VBD3 4JGZB 1RUE2 5CFCA 5BNOB 2R042 5AC91 3ZFGB 2BFUL 4GB32 1QJY2 3J8F2 1QJU3 2X5IB 3CJIC 2RS52 1VBC3 1R091 1C8M2 1V9U3 4NWVA 4RS5A 1OHFA 4WM7A 5ABJB 4YVWC 1PGW2 4Q4Y1 1VBD1 1MQTB 4JGYB 1NCQA 4QPIC 1BBT1 1QJU1 1RUF2 1VBC1 1COV2 1NG0A 1V9U1 4CDXB 4YVSB 1R082 4Y5Z0 1RUE3 3VBRA 3VDDB 2R043 4CDUB 1HQNA 4GB33 3DPRC 3VBSC 2RS53 1FMD2 1AR72 5FMOL 3VBFA 1RUE1 2R041 2ZZQA 5LK7B 1QJZA 2XPJA 3VBHC 4GB31 1QJY1 1Z7S2 4CDQA 2RS51 1POV3 4N43C 1W39A 1C8M1 1COV3 4RQPB 3ZFFB 1B35A 2GH8A 1PGW1 1R083 1HRV2 1MEC2 5C4WC 1NCRA 4Q4V2 5FOJB 4N53B 2MEV3 1POV1 1RUF1 1FMD3 1COV1 1AR73 1R081 3HAGA 1VBB2 3VBOA 1H8TA 5D8AB 2WWSA 4GH4A 4IV1C 4GMP0 1Z7S3 3VBRC 4IV3A 2WS93 4RR3C 2HWF3 1FMD1 3NAPA 1AR71 2FZ1A 3ZXAC 1QJU2 4CDWA 1MEC3 5A33A 1VBC2 4YVWB 4Q4V3 3VBFC 4LLFA 1V9U2 1Z7S1 4AEDC 5JZGA 5A32B 5CFDA 4NWWA 2HWF1 4QPIB 5BNPA 1FPN2 1ND2C 1VAKA 1ZBA3 4WM8A 1DDLA 3TN93 5C9AC 1VBB3 1MEC1 3VBUB 4Q4V1 1VB2A 1ND3B 5GKAC 2RS32 1NCRC 2HWC2 5K0UA 4BCUA 1NOVA 3DPRB 3VBSB 4CEWA 4JGZA 1RUG3 5BNOA 3TN91 5DDJ2 1VBB1 3JBG2 1EAH2 1RUI2 4PDWC 3ZFGA 4SBVA 1OOPC 2WFF2 1M06G 2X5IA 1AR62 2XBO3 2TBVA 3VBHB 1WCDJ 2DF7A 1FPN3 5ABJA 2FZ2A 4N43B 3ZFEC 1PO22 1A6CA 1RUG1 4Z92B 1MQTA 4JGYA 1RMU2 1RVF2 5BNNB 1NA1B 2RS33 5C4WB 1RUD2 2XBO1 1TME3 5J98B 2HWC3 4CDXA 5BNNA 1FPN1 1QJX2 4YVSA 1TMF2 3VDDA 2RM22 2MEV2 1RHI2 2QQPA 5DDJ3 1FOD2 3JBG3 1EAH3 1RUI3 3JB4C 4CDUA 2WFF3 4WM8C 5C8CC 4FSJA 1AR63 2RS31 4CEYC 4IV1B 5L7OB 2HWC1 1E57A 1CD3G 5L7OA 4RR3B 1RB8G 1PO23 5CFCC 1IHMA 1PVC2 2RS13 2WS92 5DDJ1 1K5MB 1RMU3 1EAH1 1RUI1 2HWF2 3JBG1 4JGZC 1D4M2 2WFF1 1X33A 2HWB2 3ZFGC 1RVF3 1AR61 1RUD3 2VQ0A 2X5IC 1R1A2 4RQPA 2BFUS 3ZFFA 4AEDB 4RS5C 1PGL2 4WM7C 2ZTNA 1HX6A 1QJX3 2BBVA 1PO21 1TMF3 1RUC3 2RM23 1RHI3 1FOD3 1NCQC 1RMU1 4FTSA 1ND2B 4Q4W2 4N53A 5C9AB 1RVF1 1RUD1 1ZBA2 3TN92 1AL0G 1QJX1 4QPGB 1TMF1 1PVC3 2RM21 2MEV1 1RHI1 5D8AA 4YVSC 1FOD1 1D4M3 1BEV2 2HWB3 3CJIB 4PDWB 4CDUC 1PO13 1GFF2 1OOPB 1R1A3 1RUG2 1NY72 5ACA3 1AYN2 3IDEA 1VBE3 1PVC1 2GSYA 2WLPA 2WS91 2XBO2 1POV0 4Q4X2 4YVWA 5FMOS 4Q4W3 3ZFEB 1D4M1 4CDQC 2HWB1 5A32A 2HWD2 1ASJ3 4QPIA 1R1A1 1B35C 1PGL1 5ACA1 3JB8A 1AR93 1F8VA 1VBE1 3ZFFC 4RFT0 1TME2 3VBUA 4Q4W1 1BEV3 1ND3A 1VB4A 3JD73 4N53C 1X36A 1ZBA1 1ASJ1 5C8CB 1RUJ2 2R063 3DPRA 1AYN3 3VBSA 4Y4YA 4CEYB 1SMVA 3VBOC 1H8TC 4GH4C 2R072 4Q4X3 4EJRA 5CFCB 1BEV1 4IV3C 5J96B 1AUYA 1QQP2 2HWD3 3JD71 3VBHA 3NAPC 2RS12 1AR83 1BMV2 2R061 1NY71 1AYN1 4N43A 1BBT3 4CDWC 1F2NA 4RS5B 1ZBE2 4WM7B 4Q4X1 1C8NA 1OPOA 5JZGC 3M8LA 3S6PA 5CFDC 1NA1A 5C4WA 1NCQB 2HWD1 2RR12 5BNPC 1RUC2 1RUJ3 1AR81 2HWE3 1RUH2 2RMU3 2R073 1TME1 3VBRB 3VBUC 1QQP3 4IV1A 5K0UC 1ND3C 1HRI2 1VBA2 1RUJ1 2HWE1 4CEWC
chains in the Genus database with same CATH superfamily
3TN93 1OA3A 1ZRDA 3HOBA 1SG3A 2CTVA 4FFHA 5FXXA 1DBNA 4TLFA 4SLIA 4COWA 3JUUA 2YC2A 1ZBE3 3VDCA 1O8PA 2R071 5FYTA 4QHOA 5FYMA 4X8PA 3VBFB 2WWJA 4CUAA 2C6SA 2VOXA 3S5AA 3AP5A 1JYWA 3E97A 2WDBA 5A7WB 3IMNA 1CVNA 2UWCA 4EWEA 1IS3A 5FZ6A 4YFWA 1AYM2 4LLOA 4ZS3A 5JR2A 1B35B 1X8MA 1MQTC 1CJDA 2XOMA 2OZJA 3JQWA 1ZBE1 2YHJA 4HKWA 4JGYC 2LTNA 4QKBA 4ARXA 2XUEA 4B4QA 3OYWA 1CAXB 5F5IA 4CCCA 2CU5A 3RWNA 2ORZA 1NCRB 1V6IA 2ZAAA 2D6NA 2DTWA 5L19A 2H0BA 1ULEA 1JXNA 4QPGA 1YUDA 3MGUA 2E63A 3F95A 4DXSA 1UZZA 4M00A 5JAXA 2BV4A 3LE0A 1EYBA 4AK3A 3WSOA 1BCXA 4AAPA 4Z82A 4NIGA 4GH4B 1JUHA 3SKJE 3OUIA 4AXOA 2UY8A 4X6RB 5FPAA 3ZSMA 2YC4A 4JAAA 4DMIA 1BQPA 4ZU7A 3H42B 1BKZA 4CCLA 3H3UA 3UKVA 3FUQA 3NAPB 1W6PA 2PLV3 4FTBA 1GU3A 1W03A 2W08A 1H6YA 4TYSA 4OQ9A 3RWKX 3SITA 4BQ1A 3ETPA 3NRUA 1V6JA 4CDWB 2VO5A 3MPBA 2VAUA 2NM1A 5IW0A 2SLIA 3I59B 4RQPC 2IVIB 5DAWA 1W8TA 1XE7A 1F9KA 1C4RA 2XWJB 4Y5SA 3AKSA 1AXKA 4EROA 5GJ6A 3VZNA 3DL3A 3WINE 2WYSA 1YFXA 4W65A 1CONA 2CHHA 1W6OA 5FUIA 1FAYA 4LA3A 3KV4A 3E6BA 3PTRB 2PLV1 4O9EA 1Z78A 3WOGA 3DECA 3U07A 1XOYA 2XDVA 4WM8B 2WC2A 5AC93 4MH0E 2HWE2 2ZS6B 5EZWA 5JXHA 4RD7A 5FOBB 5IFPA 1G9FA 2VJXA 5FJHA 1MS0A 4IGPA 2KA3A 5C8CA 5F1RA 4EN0A 2HEYF 4O9GA 1J1TA 4UFHA 4CEYA 2VPVA 2RHPA 4PQ9A 2VH9A 3HD8B 1WLCA 3Q8BA 2GN3A 3PUHA 3UKTA 1W8OA 5D8AC 4Q4Y3 4QPGC 2G19A 3NV4A 3V0AB 3RZMA 3M2MA 4QT6A 5BNOB 4W50A 5AC91 3ZFGB 1HB4A 4BK5A 2Q8CA 2FBEA 1UQXA 3J26N 4LHNA 2LW8A 3J8F2 4QMAA 3S7EA 2BNOA 2YG0A 2X5IB 5F6KA 5J48A 5FXVA 5GLUA 4OI0A 1AF9A 3A22A 1C8M2 3VHOA 2XJVA 1G9DA 2A75A 2EAKA 2XB6C 1LHUA 4NWVA 1N1SA 1QOOA 3M4FA 4M4PA 4QX8A 3R6SA 3UGHA 5IT6A 4YVWC 4Q4Y1 5BV6A 3EO6A 3I3EA 4JTNA 4QQLA 5FY0A 3EHKA 2PQSA 1LOCA 1PM4A 1NCQA 3TEZA 1UU6A 3OBAA 1VLNA 2QKDA 1UD1A 1BBT1 4O61A 2XKOA 1A3KA 3BU7A 2F4LA 4CE8A 2I2SA 4CPBA 3LFMA 3WCSA 1NG0A 1W8WA 2XKPA 4S2DA 5H9SA 4CDXB 3AYDA 1PNGA 3H0OA 2Z4FA 4D6QA 2EXHA 2VL4A 3GDBA 2R043 3BIWE 4NHKA 2IC1A 3NO8A 5FZ4A 1HQNA 4GB33 4AQ6A 3A21A 4QB6A 4YLZA 4F8AA 2K9ZA 4D8MA 5FK7A 2XGXA 4LUMA 2CAVA 2RS53 3P6BA 4D69A 3AK0A 4GWIA 2YC0A 4D7YA 4M3CE 1W8FA 5KHHA 1HJFA 1XB9A 1WW7A 3K75B 3BIEA 5EYYA 4R9CA 1Y9GA 2ZGRA 4QB2A 2B39A 2EXKA 5L9RA 3VBFA 2OZ6A 4AVAA 2R041 2ZZQA 3OPZA 2E7QA 2W1QA 1YNAA 3VBHC 5A7WA 1KD7A 4GB31 1IPKA 1QJY1 1Z0HA 3AZWA 3AP7A 4LBNA 4XJUA 5A3OA 1DF0A 2RS51 1POV3 3DGTA 4TWTA 5EJ3A 3AKPA 3VL9A 1K45A 3B02A 3N9NA 3VV1A 1SPPB 3PIJA 1B35A 1ZZ6A 3ZIXA 5GLVA 1UYZA 5F37A 1CAXA 3KCXA 1ULGA 2UYAA 4ASKA 4OFGA 5FZKA 2WT2A 4A44A 1J3PA 2VMFA 4H7MA 4R4XA 5JMCA 1SLCA 2JDMA 3KT4A 1NCRA 5A7NA 1P8JA 2UYBA 2YU1A 2IUWA 4KU7A 1A8DA 1ZRRA 5GZCA 2MEV3 2ZJCA 2VMCA 1RUF1 2GC2A 1POV1 1N1TA 1FMD3 2ZEZA 4KQ7A 4NHXA 2B4KA 1O3QA 1IPSA 1AR73 2PFWA 5FCCA 5I8SA 1JZ5A 4XPVA 4XJ9A 4AEJA 3R05A 3FFQA 3RI9A 4BE3A 4AVTA 1JYIA 4G9SB 2JE9A 1OH3A 1VBB2 4CP0A 1NAEA 2GC0A 5H9PA 2PHDA 2Z5WA 4GH4A 1WA6X 4Q0QA 4GMP0 2WFPA 4JRLA 2BBAA 4NAOA 3PL0A 4MGIE 5LRSA 1CPMA 5FQ0B 2PAKA 4RR3C 4ASMB 5EJZB 1HB2A 1X9PA 1YJLA 3CQOA 1DQ4A 1FMD1 4GAZA 3NAPA 5A7PA 3MLKA 1AR71 3D6EA 4FAGA 1BLZA 2D43A 5EV7A 3RZKA 4XJ8A 4MYEA 1PZ8A 3ZXAC 1CPNA 1QJU2 4CDWA 1ZZCA 2W0XA 3WQ7A 4EN9B 3GM8A 2ZKNA 3DYPA 3GHNA 2O0OA 3I59A 4Q4V3 3VBFC 1S0BA 1OF4A 2DVAA 3B9CA 4EN6B 1R1ZA 4EZ4A 1WZXA 5A32B 5T50A 2VZOA 2YZ4A 3RDIA 1JYNA 4QPIB 3I2JA 1J84A 3B00A 1FPN2 1EP0A 4LJHA 4ASLA 5A6XA 2W52A 1LCLA 1GWMA 2A6YA 2D7FA 1VAKA 3L2HA 2P6CA 4OQ8A 3HQXA 4WM8A 2QQNA 2VCMA 4NE9A 2UU8A 2YBSA 4FCAA 4NHLA 4DB5A 3VBUB 4Q4V1 5APAA 3W58A 5G04L 1SLLA 4C1WA 1NCRC 4YGEA 3LEIA 4FPGA 2HKXA 1O4YA 3DPRB 1HJGA 4AE2A 1SDDB 1RJ7A 4CXXA 2BGCA 3TRSB 3V0AA 2VC9A 1CAUB 5FO8B 4GULA 5BNOA 1GOHA 1MZ5A 2Y8KA 4M3CB 3SCHA 3ZFGA 4C1XA 5K9YA 2CWSA 1LOAA 1OOPC 2WFF2 3K2OA 5IVJA 3RYKA 3ZKYA 2X5IA 4Y24A 4KWKA 1AXYA 1AR62 2A7AA 1H2KA 3KHCA 5L73A 5LK5A 4HZFA 1C28A 1WCDJ 5J37A 1RYYA 2FDFA 5H9QA 1UOBA 2RVAA 4I30A 5FREA 1CWPA 2QTWB 4L2NA 3JXSA 4PIXA 5I93A 1ZYBA 2VOWA 5DG2A 3ZYGA 4FOVA 2GMMA 5C8WA 3PVNA 3K3OA 2DUQA 3WV6A 1NA1B 1GLHA 1RUD2 3SQOA 4EWDA 3VKLA 5KHJA 2HWC3 1YQ5A 4DEVA 1XQNA 1JZ6A 5CKQA 4CDXA 1IPJA 2DVGA 4N90A 1F35A 1S0GA 1TMF2 4LBOA 3RQ0A 4A7KA 1Q56A 5GZFA 4WBBA 1T2XA 5HV0A 3USUB 1QF3A 3JBG3 1RUI3 5HXMA 5FYIA 4TN7A 4WM8C 4AFMA 3NKGA 3MIDA 3RS6A 4XUPA 3POJA 1G6NA 1PGSA 4QX1A 3LSEA 4IV1B 4W6XA 2HWC1 5DZEA 3NV3A 2A6ZA 3IM0A 2DVFA 2XL9A 5L7OA 3ZSLA 4A7ZA 1RB8G 3NQHA 4R9DA 1IHMA 1PVC2 1DZQA 2WIIB 3MF9A 4E4SA 1LOBA 2WL1A 2WS92 3ACLA 3B3QE 1H9PA 1K5MB 3E6DA 1RUI1 3JBG1 4MZUA 5FY5A 3KF3A 5FWEA 4FT8A 4UFJA 4Q29A 3UL2A 1TNFA 1UYPA 3ZFGC 5B2GB 3M70A 5JOZA 1XXNA 3LB9A 5FPUA 1ULDA 1Q8VA 4QDRA 1NE6A 4QKNA 2X5IC 4FP3A 2XONA 1XNTA 2VD7A 1SPPA 4MHUA 5FZ7A 4ZS2A 1W8ZA 5GZDA 3VB9A 2DCYA 4P00B 2C26A 3OBZA 4PI2A 4A7YA 3PUAA 1ENRA 1Y43B 2IXLA 3A23A 2D98A 1UPIA 2DU0A 3PJQA 1TZOA 2RM23 4HONA 5I0RA 2B8MA 2VULA 1FOD3 2GC3A 4FTSA 4XC9A 4FOYA 5FUPA 1GOGA 4FOWA 3NMBA 3HEIA 5C9AB 3RFRA 3MW2A 5L9VA 4MGTA 1REEA 1UY3A 4UW6A 2VUJA 3OPWA 2P3KA 4UYBA 4Y1YA 4AVCA 3TN92 3B5LB 3N9MA 1AL0G 4PLOA 5F5AA 3N4MA 1GOFA 1I5ZA 4FQ4A 1VMHA 3VL8A 2RM21 4XMIA 1FOD1 3IDBB 2JDPA 4XE9A 4EYUA 1DGLA 2QDNA 2UWAA 2YPDA 4Y1UA 5GLZA 3SC7X 5FQ0A 1WCSA 4IEXA 5GLTA 4ZXEA 1UMHA 2Q1MA 4Q1RA 1GFF2 1V6MA 2JE8A 5E1RA 3GZAA 3RSJA 3WQ0A 2JDZA 1UO9A 5IFTA 1FV3A 3VKMA 1OD3A 1O3SA 5JSPA 4LE3A 2MPFA 4B1MA 2XJPA 4KG0A 1YFUA 4M01A 4COZA 2GH2A 3RZLA 5D2AA 3HMYA 3AFKA 2OKXA 2D44A 4JKKA 2B5HA 4IEZA 4XW3A 2QQIA 4YZ2A 3AMNA 4DUXA 1W2TA 5A32A 4LIUA 2DWRA 2YYOA 2R16A 4IEVA 4XF1A 1YJKA 3ACHA 2XUMA 3NNLA 1WMFA 4QPIA 4BWOA 3TEYA 4KNCA 3ZN5A 4CU8A 1GSLA 3EXUA 1OQ1A 1W05A 2IXKA 4J1WA 4LXLA 4QAWA 3ZR5A 4YZ5A 4XUNA 4FPKA 2V73A 1POQA 2OA2A 5EXOA 5E6HA 3VBUA 1SBDA 3OGVA 5C3RA 1OH4A 2A6XA 5F3CA 1LKNA 5FV3A 4K3UA 1ODNA 2GZWA 4OMDA 4DFSA 2HJIA 2WAOA 1UZYA 5DPNA 4B7EA 3DPRA 1AYN3 4A4AA 4Y4YA 3GYDA 1SMVA 1CAUA 2WJSA 2ZX2A 4M3CA 1X82A 3VBOC 4AL9A 2J1UA 4ZZ5A 4Q8KA 3AKRA 1Y9QA 2QQWA 4IEYA 1UX7A 1G9BA 1WCKA 1UIKA 2HWD3 3WDXA 2O8OA 3P3PA 2RS12 3LDBA 3H7JA 1NY71 4K8FA 1PK6C 1AYN1 2DTYA 2G9ZA 3O1PA 1CAVB 2WNVC 4MGSA 5JPNB 2IFRA 4RS5B 3OJBA 4QX0A 5L9BA 4AI2A 3BPZA 1AX2A 1A8MA 4KWJA 1OPOA 2XJUA 2JDKA 4X6QB 5F3IA 3NNFA 5JZGC 4PIYA 1NA1A 3FHQA 5DUUA 5T55A 1OQDA 3U11A 2HWD1 2VBPA 4CA9A 5DXDA 4FPOB 3WG3A 1U0AA 2AEYA 1RUC2 5CVRA 2HWE3 4UBHA 4CRQA 5I91A 3RZHA 1GUIA 3MEPA 4XXPA 3HIFA 2JKXA 3USUA 5BNQA 1L7LA 4OI1A 3U75A 1X50A 4UW5A 4ZXKA 4BIOA 5CU1A 2ENRA 5M0TA 4JDNA 4D7SA 2ZCWA 4NVPA 5FZ8A 5LBCA 1ZRIA 1DYPA 3VBUC 1QQP3 3M1HA 4IV1A 4YZ1A 3O0VA 4A45A 3WLUA 3W9AA 5K8SA 1RXFA 1LGNA 1VBA2 3ALQA 2P3JA 2HWE1 4P14A 3GF6A 3ZSKA 4AI9A 4CEWC 4CCOA 1UPSA 1QNYA 1ST8A 3J8F3 3WF3A 2WT1A 1LGBA 4META 2PAMA 1EUUA 3P3NA 1VALA 1K5MA 3D0SA 1PO12 4M0HA 1C8M3 1F5FA 3KGLA 3NJYA 4FPCA 4NHMA 4QDQA 4CCEA 5FRAA 5F32A 2LROA 5HXVA 1NZCA 3HBZA 5ACA2 1PIV2 2QQUA 1LU2A 1QQP1 5JDBA 2NYYA 3DEMA 4AEMA 4BLIA 1ZZ8A 3AMQA 1EV12 3T08A 1TG7A 3FBMA 3J8F1 3T0AA 3PLQA 1HXS2 3JCIA 4YWAA 2Y26A 1IQDC 4IGQA 2BW8A 3H8UA 4O65A 1H9WA 1APNA 1A78A 3LIHA 1XNDA 2YGLA 4LO7A 1GBGA 5FZ0A 2W47A 5C9AA 1GV9A 4CU9A 1VAMA 3BOWA 1ZZBA 5DG1A 1WMXA 4ZPIA 2V09A 1NA1C 3L2YA 1HRI3 1YCIA 3MIGA 3WP4A 1KXGA 2I07B 3CZUA 3ZYBA 2WZPP 4GWNA 5J09A 5FZMA 1GNYA 2ZGLA 3VDDC 3KV5A 3T2OA 3IB3A 1Y4WA 2GN7A 1CESA 1KFXL 4GKXA 2PMWB 3R4DB 2GNBA 2K46A 2XLGA 3JU9A 4DY3A 2ARXA 4RHV3 1H8TB 1SFNA 3LDKA 4FVVA 4IEWA 5KBFA 2DCKA 2VM9A 2FHRA 1Y3TA 3LAGA 4NRQA 4WVVA 5JLVA 1GZ9A 2BVVA 1WMEA 1HRI1 4COYA 1GZCA 1V6OA 3VZLA 4DS0A 1AL23 2D3SA 1MZ6A 4HSJA 5LBEA 4IE4A 4LKEA 5EWSA 5FY7A 4YW2A 5I8TA 3LOBA 1X8EA 4CSWA 2R0HA 2FDIA 4KWUA 4K20A 1JZ3A 4UAPA 3H9AA 4QKFA 4QKDA 5CNAA 2A3YA 1K5MC 5EYXA 4RHV1 5FPLA 3THCA 3UETA 1W6MB 1VRH3 1S4CA 1W2AX 4AQ2A 1W9SA 2EALA 2WZR3 1C1FA 5C3SA 5CFDB 2RG4A 2BZDA 1O8SA 1JOJA 5JSRA 1AL21 4OMCA 2YB7A 4C91A 1AVBA 2YBKA 3G6JB 2VW0A 4LPLA 4BIFA 2QVSB 4UI9L 4XF3A 4QDSA 3BYWA 1J1LA 4FPJA 3S7IA 4E2GA 1MACA 4PBPA 3FZ3A 4RSUA 5KXCA 2FCVA 4CXYA 1VRH1 1AHSA 1HV1A 5A3MA 1AR91 3QH6A 4M0NA 4HL0A 1OF3A 2WZR1 2EAAA 2W46A 1T6BX 2DBNA 1R093 2CNAA 2WR9A 1S1AA 5K0UB 3MYXA 2XXZA 4XACA 3WUCA 2EVXA 2D5HA 4XUTA 2OYZA 3PMEA 1ZA4A 2Q4SA 1VBD3 5B4NA 4HG6B 4JGZB 1LENA 1RUE2 4RL7A 3VD9A 1DG6A 3ORJA 5DAPA 3ZX7A 2VQAA 1IG3A 5BY5A 5LEJA 2XQRA 1SLAA 4AYUA 1QJU3 3DCQA 5FAXA 5HI0A 4XCBA 2CWMA 2Q30A 1H8VA 1H0BA 1R091 1UW8A 1WWYA 2XVLA 2ZACA 4K1YA 1CAVA 5L36A 1DYKA 2Y33A 1KJRA 4RS5A 4QHZA 3SKVA 5ABJB 1PGW2 4XXAA 5AFEA 2DCTA 1VBD1 5EPAA 2ZKLA 1W3VA 5I0TA 3C7GA 4C0HA 1RGSA 3LEMA 1TE1B 1QJU1 2D97A 4HLTA 3U78A 1MS5A 5LY2A 3ZN6B 2ZPXA 4UW4A 4S2FA 3EBRA 5DQ0A 4DIQA 1COV2 3AP6A 3RZZA 3T4VA 2OUHA 4FFGA 2JICA 4FP2A 1PMJX 4P9IA 1L7QA 2Q8OA 3WD5A 2W95A 5FYUA 5A3UA 2WWUA 1UIJA 4JVAA 4IDZA 2DCZA 3WY6A 4AG4A 2VZ1A 1LJ7A 5C71A 1W8HA 3ZO0B 2X10A 3SLIA 2BGOA 3C8XA 3MFCA 4YW5A 4NOTA 3VBSC 4CP2A 1OT5A 5C6CA 2CAUA 3HVDA 3WDUA 5FXWA 1UY1A 3CHXA 4AFAA 3EQEA 1SACA 1VIWB 1QJFA 5FFOC 2ID4A 2EIBA 1KGYA 3SXWA 3LDRA 1DQ6A 4Z07A 1ZM1A 2FDJA 3OD0A 3ZSEA 4LHKA 1WCQA 2VCCA 1QJZA 2XPJA 1Z7S2 4CUCA 1QGLA 2E51A 2VZSA 4XMAA 3LA2A 1AXZA 3ME2A 1DGRN 2WQ8A 5HCAA 1UY0A 3ZFFB 4DNYA 2JG8B 4G3YC 4AAXA 5CBLA 4GJYA 3SH3A 2GH8A 3GNEA 4AGVA 1R083 4XJWA 1MVQA 2QDRA 1KFUL 5F7UA 1MEC2 1SEFA 5C4WC 5FOJB 4FOQA 3KF5A 4XFGA 3FLRA 3D82A 4N53B 4QXKA 1QWRA 1W9WA 3FLTA 2VZTA 3MPPG 4IE0A 5F5QA 3WDWA 3WW3A 1MZEA 5FPBA 1J3QA 4NROA 1GKBA 1NYWA 4BXSV 1YC61 1MVEA 5FY8A 1N3OA 4CVUA 5ERLA 1WGPA 4XFHA 3IBMA 2BTVC 4V2WA 3ST7A 5FPZA 1SLTA 4OZOA 3K4AA 4QXHA 1R081 5A7OA 1YXWA 2ZHLA 4MXVA 5JOXA 1J3RA 2R1BA 1S0EA 1G9AA 1H8TA 4TLGA 5LW9A 1WLTA 4LBJA 1WW4A 1FT9A 2BQPA 4P02B 4XTMA 3PU3A 3FN9A 4PQQA 2WS93 3NNJA 3MZHA 2NP0A 1MPXA 2Y34A 2ZEWA 3O1UA 4NIIA 2BU9A 2P37A 4BZ4A 4YSFA 2NZ9A 4XABA 1GP6A 2VW2A 4XFBA 2AEZA 4HN1A 1N1YA 3RNSA 1OXCA 2D6MA 4UWDA 3V64A 4AGGA 4XEZA 3PVOA 1W6MA 1VBC2 4IQPA 4AQSA 3CNAA 3WNNA 2A3XA 5A1LA 3KCCA 3MHZA 5CFDA 1UZ0A 1WLWA 2AENA 3W5MA 3UGGA 3SEPA 2JE7A 1WKYA 4Q0PA 4XF4A 1S2BA 4Q27A 3V65A 4EV0A 2VZRA 3N9LA 2JG9B 2PELA 5TSWA 3CIHA 3TB0A 2BRTA 2JDAA 1FYUA 3T4HB 1DGWX 1QEXA 2A6VA 2DURA 1QNWA 2PQQA 2Y6LA 4OCTA 2J1TA 4Q1PA 1S0CA 2E6VA 3RVHA 2V5YA 3OY8B 4N8MA 1W28A 3C7FA 4DRVA 1VB2A 1ND3B 1NLSA 3WEZA 4DXZA 1UYYA 3AC0A 3I3QA 3C2UA 1E5HA 2PHXA 3KD4A 4UFMA 4YGDA 5K0UA 3N7JA 2WBKA 4BMBA 3B9IA 1G8WA 4R8HA 4WVMB 3ACGA 3Q8CA 4JGZA 1YO8A 3TNQA 3ZXGA 3TN91 5DDJ2 1E5RA 1RL3A 1M06G 1K5JA 4I09A 4OUMA 3ZYFA 1KITA 2NLRA 3ZXFA 2TBVA 4AW7A 1AX1A 3LZZA 3KT1A 1SLBA 3O0XA 1GQGA 5A3NA 2R1DA 3VD5A 2X09A 5ABJA 4YNIA 2YU2A 4N43B 4JTOA 5JXIA 3DKQA 1VR3A 5DZGA 3AXDA 1ZZ7A 1GNZA 4PLNA 2IXCA 2UY9A 3NKTA 4AI8A 1RMU2 5IVEA 4HSLA 2E32A 1ENQA 4YGCA 1K3IA 1QIQA 2ZHNA 3ZN6A 1RVF2 5FZOB 2RS33 1W8UA 4IESA 4NIDA 2ZABA 3DXUA 3U10A 2WNOA 3LCPA 1RUNA 2R6QA 4EWAA 5FZBA 1GANA 3TNPB 5BNNA 4XBNA 1ZA7A 1NQDA 4A41A 5C3QA 4XF9A 1E5IA 1C1LA 2B45X 3VZOA 2WABA 2AH2A 2QFEA 3RPQA 3EMRA 1EAH3 1TEIA 3JB4C 2EXIA 3POWA 5DAXA 2JDUA 4KBBA 4AHYA 5C8CC 2VXJA 2RS31 2A5ZA 1RXGA 1YFYA 1H4HA 2XLAA 4CEYC 2W1UA 5L7OB 1PZ7A 5IVYA 5JOWA 2OT7A 1CD3G 1LECA 4MGQA 4PIZA 4UFLA 3POBA 3U4XA 1PO23 5E8AA 3MBWA 3HWJA 4YG0A 2RS13 1JMUB 2GNMA 2FD8A 1EAH1 3I2DA 4JGZC 3TOJA 1LEDA 2WO7A 4CCJA 3ELNA 1SDWA 2OXBA 3U1XA 4YM3A 1X33A 2HWB2 1W9FA 1XU2A 4TXWA 3NV2A 3J4UH 1LULA 2G1MA 1N3QA 4CP1A 1R1A2 1D2SA 3ZXJA 3MIEA 3IT8A 3HPNA 5FZGA 2JG8A 2PHRA 3ZFFA 4AEDB 2P5BA 4TSVA 4PT6A 1QJX3 2I45A 2PHLA 2XH6A 3ITQA 3IAPA 1PO21 4KGQA 1NXMA 1WLDA 4AHWA 1HB3A 4HK9A 1RUC3 1R64A 3VDAA 1RHI3 5A7QA 1GR3A 1NCQC 4R9BA 1ND2B 4FPHA 4WVZA 4GZ9A 4N53A 4N9HA 3LQCA 4K9SA 3VHPA 4Z8BA 2VE1A 3W21A 1GP5A 2LALA 3I54A 1ZBA2 2QQOA 2VOTA 1NX9A 2W92A 4HOOA 4WVWA 3PMSA 2D93A 4IEPA 4V2VA 5FYVA 3LD8A 4FQZA 5FPVA 1JH5A 1QJX1 4AOCA 2V5DA 4YG3A 3MV01 3MLLA 4NHYA 2P1BA 2VGDA 3MIBA 2MEV1 1RHI1 2BNMA 1XNBA 3ZDSA 4ATFA 2WA3A 1D4M3 3CLPA 1BEV2 4GWJA 4XTPA 2QBXA 4ONUA 1XU1A 4Y20B 2OX0A 4BQ5A 3POGA 4PDWB 1PO13 4NO4A 5GZEA 5IVCA 1JYXA 1O6UA 3T2TA 5CZKA 3BU0A 1RUG2 1EY2A 2AR6A 3AP4A 1JOBA 5ACA3 2LM3A 1CZSA 1CZTA 3FMGA 2CYFA 5FYYA 3IDEA 3OBRA 4W6WA 1IOAA 1RINA 2OPWA 3MLJA 1UCXA 3S57A 3HNBM 1PHMA 5LA2A 2XBO2 4Q4W3 1XSQA 1W2OA 3DYOA 1D4M1 3ZFEB 3OG2A 4LT5A 3SEEA 4FXKB 1GNHA 3PUSA 5ANNA 3IAQA 1BXHA 1SLIA 2DU1A 4D7TA 1Q5OA 3RMXA 1KDKA 3S30A 1B35C 1UY4A 2WZ8A 3FFZA 5JR7B 2JG9A 5ACA1 1PGL1 1V00A 3WF0A 2VMEA 4MSVA 3DYMA 5F6LB 5FZ3A 2ILMA 1O91A 3ZFFC 4L99A 4B7KA 5A3TA 4UBGA 2FDGA 5KC6A 4RFT0 1U5XA 3OY8A 3RG0A 3WW4A 1TME2 1BVVA 4Q4W1 1ALYA 2A6WA 2QQVA 1ND3A 5FLIA 3U0ZA 5HCHA 2I74A 2C1FA 4FI9A 1HQWA 1HB1A 5FUNA 2PHFA 3MICA 4XILA 4N53C 5LBFA 3K3NA 1NLRA 2A3WA 5FP8A 1BK1A 4WVMA 3J7HA 2IXJA 4D3WA 2VR4A 1L7RA 3B93A 4LQRA 4OULA 5FXZA 1U5IA 4E4ZA 4YM1A 4JKMA 4GH4C 1QOTA 2R072 1OKQA 5JIAA 4LNVA 1F4HA 4Q4X3 5JVVA 3UGFA 4F3JA 4BPZA 3BKZA 3AYAA 3CO2A 5CFCB 3AMPA 4Y1XA 1CR7A 2ZGTA 3OF1A 2XHNA 5FTTC 2G9FA 1DIWA 4Y1ZA 1WD4A 2C0ZA 2IWGB 2A1XA 3NAPC 4GALA 2ZHMA 3ZXDA 2DVDA 5CA6A 3RZGA 4AWDA 1AX0A 1LOFA 1UMIA 5DAVA 3S5QA 4N43A 4CCMA 4ES9A 4CDWC 2X29A 2OQ6A 1F2NA 4KL1A 4XAEA 1JZ2A 1ZBE2 4U2AA 1W0OA 4WM7B 3T3YA 4BQ4A 4P9JA 4NJ4A 5IK8A 3IIAA 4Q4X1 2EF6A 3ZPYA 3W5NA 3H1WA 3VD7A 5FZOA 3V56A 2ZGPA 4CU6A 2ZEXA 4WV8A 5CADA 4YYOA 1ULCA 2DYCA 5G05L 2VBBA 1RUJ3 4FPLA 4CCDA 1H1AA 3B01A 1OLQA 4NRMA 3TAYA 4LO4B 1JODA 4A3ZA 2JG9C 1RTVA 1OFNA 1VE0A 3ENRA 3OBTA 4HN0A 2CDOA 2C9AA 3NJXA 3OEAA 3T1MA 2VMGA 4AI0A 4BDVB 4KG8A 4DXTA 2ZGMA 2W91A 1ND3C 5CAZA 4A2UA 1QJEA 4XUOA 4RN5A 3HT1A 5LATA 1YFWA 1UKRA 1RUJ1 2XG3A 3AJYA 1PX3A 4GMP3 4C90A 5EP9A 5BNOC 2J1RA 3OGJA 3NV1A 4XURA 2B9UA 5GM0A 3MUY1 4H7LA 4Q0VA 5B4XA 2ZAHA 4EQVA 3KHBA 2WN2A 3Q8FA 1VBE2 2YGMA 3D5OA 3NWKA 4H3WA 2RR13 4CDQB 4AEDA 5A6ZA 3I2OA 4L9BA 3VDBA 1BMV1 3WNOA 5FK8A 4GMP1 1O5UA 1Q43A 2PLV2 2VQUA 3MF6A 4YM0A 1RUH3 2D6KA 4NR1A 5FY1A 1REDA 4WZFA 2XJTA 2ZGSA 2GNDA 3AFGA 1CQ9A 4E2SA 1ND2A 1U12A 1ASJ2 5FP9A 3ZOIA 3VZJA 2O1QA 1O3TA 1SCSA 3QCWA 5FJKA 2RDSA 2XHKA 4NPLA 3WW1A 2VZPA 1VPHA 3H7YA 3K46A 2RR11 4CDXC 1FV2A 2ZGNA 5GLWA 3M7AA 3OSDA 1JZ8A 2QZ3A 4XAAA 1I1EA 3I7DA 5F3GA 5HCFA 1DCSA 1RUH1 4MO3M 1JS9A 4HVRA 3JD72 2VTXA 3DUIA 1ZNPA 4MVTA 1S0FA 5AC92 4Y20A 1V0AA 4EE2A 4JDMA 4PDWA 4XUQA 5FY4A 2VUCA 1BK0A 3HBKA 1OUXA 4JQTA 3TEXA 3N36A 4IV3B 2Q5TA 5FP4A 2HEVF 3K77A 2XVKA 3VZKA 5L7OC 4CCNA 4URAA 1LRHA 3NJZA 1AYM3 3SH4A 1YI9A 3U4SA 1I5PA 2DBIA 2VCAA 4AHZA 2D5FA 1WW5A 4MGYE 2Y6HA 4Q4Y2 1KJLA 3ZFEA 4KI5M 3BCWA 4AF9A 4NIAA 1QXRA 3BVCA 4L97A 5A33B 4YZ4A 3HNMA 2A73B 4PI0A 1BBT2 3KGZA 4GD4A 5IVBA 1BYHA 1H2MA 1RIRA 5F2SA 1WD3A 2VU9A 3PTYA 2WYFA 4Z2WA 4ISRA 1AYM1 2VBDA 5BNPB 4MUVA 1FATA 1FXZA 4RGKA 4ZY9A 3WW2A 4XJZA 2WN3A 4QXBA 3AVSA 4D6SA 3D4KA 4X8NA 2IZWA 2ETEA 4YW6A 1W06A 4OHXA 4D6RA 4QQPA 3WNPA 4ZKTB 2DFBA 3ETQA 3WP3A 5FYZA 4DUVA 3PIGA 2RMU2 1LHOA 4JRAA 4E8DA 1JYTA 4FAHA 4GWMA 2W9XA 1QH6A 2BPA2 1JU4A 3I3BA 2WNUB 4GKYA 1AZDA 2J1SA 1HN0A 1UOGA 3TWIA 1JTZX 3GBFA 5CFCA 1ULPA 2R042 5T5PA 4XJAA 3VD4A 3E6CC 3RZJA 1NKGA 1UYXA 2BFUL 3M3CA 2GNTA 3OGSA 3ROUA 4GB32 1QJY2 1S0IA 3C7EA 4XHXA 5SV8A 4B8EA 4Y22B 1DQ2A 3AMHA 5HBAA 1NQJA 1PZ9A 4H55A 5I8YA 5KWRA 2RS52 4UF0B 5HCBA 4ET7A 1VBC3 1X7NA 2A71A 4EZHA 2J7MA 1XBFA 2JB8A 1W99A 2AREA 1Q8SA 4YG6A 1WCUA 5D21A 3IPVB 4LMFA 4QU1A 4WM7A 3K4DA 3GJBA 3I2HA 3T30A 2RJKA 4E2QA 5FKCA 3KCYA 2WRAA 2PHWA 3H8RA 5JXGA 1MQTB 4JCKA 4JGYB 5FY9A 1OUSA 4IE6A 1LOEA 4QPIC 2VW1A 5A70A 3WX5A 1YWKA 1YLLA 4PF1A 4OHZA 1RUF2 1ZZ9A 5FDBA 3H8XA 3QOPA 1VBC1 4XZUG 3O14A 4LO8A 3NSTA 4ITCA 4D94A 1A34A 2ZA9A 4KH9A 5EIYB 4LOTA 4Z2AA 2H0VA 2WQZC 1QY4A 1CZVA 4YVSB 4PHZA 3MUZ1 5KHGA 2BEOA 2QCSB 3ZR6A 2B42B 2VNGA 4K40A 3BALA 4XQWA 4DINB 4FPYA 2ERFA 4BOWA 3VKNA 2WZEA 4LKDA 2YXSA 3DPRC 1FNZA 3MV11 5SV5A 3RYRA 4BQXA 1FMD2 3NVCA 1QHDA 1AR72 5FMOL 3UESA 1DP0A 3N9QA 3H1MA 2ZZJA 1LTEA 3LEGA 4PCRA 5LK7B 3DXTA 1B09A 1JW6A 3FL7A 4OZXA 4YM2A 3WF4A 4EN7B 4L11A 1PX4A 3GALA 4CDQA 1UF2C 2W39A 2CSGA 2VUAA 2PHTA 3WNLA 1RUOA 2BOIA 1W39A 4RGAA 3I97A 5A1FA 1C8M1 4RQPB 3Q8AA 1UAIA 2JIGA 3GCWA 1LOGA 3C3VA 3BPSA 4P9LA 1YQ2A 2AGSA 2RJ2A 4LOSA 3CU7A 1HRV2 1RJ8A 1IZ3A 2ZX4A 4Q4V2 3QBQA 3LA7A 4FXGB 3FLPA 3CDZB 2ZX0A 4IETA 4XFFA 4AI1A 4ZU4A 4XHBA 3KMHA 5E88A 4YW3A 1US3A 1PMHX 4AHXA 3AKTA 1KS4A 4C8DA 4LBKA 5LWBA 1W6NB 2JB4A 2QQJA 5AVAA 3VKOA 1D0GA 3HAGA 4IEOA 4E4HA 4LK7A 4AFDA 3FE5A 5D8AB 5FMBA 4IV1C 5JUVA 1TQ5A 1OVPA 2Y6KA 5AFBA 3VUOA 4KBZA 1JZ4A 4IV3A 2XR4A 3WQBA 1DZRA 3UJOA 4V1PA 3GXUA 3FC0A 4XDQA 1V70A 2EXJA 4MADA 4ES8A 3ABZA 1X9TA 2ZGUA 3O1RA 3D0JA 3O1SA 2LRPA 2Y6JA 3AYCA 5F8PA 3UYJA 3O0WA 2R30A 1Q3EA 2NN8A 5F39A 3ZXLA 3FBYA 3LPGA 4YVWB 5A33A 4IL7A 2JIJA 4QD2A 3NNGA 3THPA 4LLFA 1V9U2 3ES4A 1V6LA 4RGGA 4E8CA 4NWWA 1Q8QA 4MGZE 4NRPA 1W2NA 1WW6A 2JJ6A 3D8CA 3BB6A 4CZSA 4DUWA 4M3CF 1JZ7A 5BNPA 1OLME 2VCBA 1XSRA 2AC1A 2XJQA 3FX3A 1ZBA3 4IUGA 3QH7A 4DY5A 2PA7A 5C9AC 4K8RB 1VBB3 1N47A 1V6NA 4JX0A 4OVEA 1PM7A 4PF5A 3VKFC 2ORXA 3GZUC 3I2KA 4HPKB 5EFUA 3UV9A 1RITA 1UXZA 2HWC2 5C5TA 5T5JA 2MNGA 2OUJA 5EHDA 1OSGA 4C0BA 1REFA 2WNUA 2Y38A 1G9CA 1RUG3 4JDOA 5IWFA 1VBB1 3JBG2 1RUI2 4L0PA 1KEXA 3D3AA 3CMGA 4ORFA 4SBVA 4IERA 1F15A 1W9TA 4Y22A 3GZTB 5I0UA 1QOSA 2ADDA 2ES3A 3FUOA 4QPYA 4I3GA 2XBO3 4UF0A 3T0BA 3VBHB 2JEMA 5LB6A 3ZKUA 4K7JA 3H8OA 3AL6A 2VOVA 2WA4A 3IWZA 1FPN3 3AX4A 3IPVA 1LHNA 2Q1ZB 3OB8A 1JYCA 1QXJA 2H6CA 1C57A 4QQ2A 1Y9MA 2ZGOA 3WVJA 1A6CA 1IQAA 2JECA 2MHFA 1RUG1 3UNPA 1ODMA 2VTXJ 1MQTA 4JGYA 1OLRA 4LULA 2OW4A 5JMOA 2AACA 5A1AA 4OHYA 5BNNB 4UOJA 5CISA 2P3YA 2XBO1 1TME3 5FZFA 1SBEA 5J98B 2W1WA 3POIA 3P1IA 2DFCA 1FPN1 2Q8DA 2CV6A 4YVSA 5A3PA 3N35A 2X53S 5FZCA 2ADEA 4HFSA 2K0GA 1M4WA 5IAVA 2RM22 4R4ZA 2YY1A 1FOD2 1TVGA 2WFF3 4LIVA 3DV8A 4JC1A 2ATFA 4FSJA 1AR63 1GQPA 2V4AA 1KDMA 3M3OA 5H9RA 4YPJA 4I01A 2IXHA 4FBFA 2VVFA 1JHNA 3O1VA 2BYVE 1E57A 3M3QA 1G7YA 2BOJA 3GHMA 5C3PA 1MS4A 4QU2A 4RR3B 5A6QA 3MW3A 4HANA 4PBOA 4AZZA 3U14A 2CGOA 1ACCA 3PUQA 4CUBA 2WNUC 4ZZ8A 3J9SA 1MS8A 2HWF2 1OA2A 2P34A 2WFF1 2RV9A 4BXFA 3R0RA 1AR61 1BVP1 1RUD3 3AL5A 1DGWA 4YRDA 4RQPA 1DHKB 2BFUS 3E1F1 4ISQA 4P9XA 4RS5C 4LBLA 5K4LA 5F9TA 4PJYA 1BHGA 3EB7A 2ZEYA 3IKWA 2W3JA 3OGRA 4S2GA 1T6GC 1TMF3 2ZHKA 4L8QA 1TNRA 2QQKA 3USSA 1YHFA 3O12A 2WKKA 3ZYJB 3G7DA 3WF2A 3JZVA 4B3NA 1OI6A 3HQRA 1RUD1 3WDYA 2R0FA 2ZOEB 3WUDA 3BGAA 3KZ4C 2OQ7A 2FMYA 1U5YA 4QQOA 3SCGA 1W6NA 4YARA 3KQ4B 3LOIA 3LPFA 5T5OA 1I6XA 3NNMA 5DUWA 4P9YA 1TMF1 1PVC3 4LUKA 1HW5A 5CB7A 4MG2A 5D8AA 4YW7A 4YVSC 1S2KA 4UFKA 4AR2A 4CXWA 2PYTA 3N7MA 1D0HA 1XE0A 2XJRA 2PN5A 2XMLA 1OQEA 1PVXA 3CJIB 3KQRA 4XFAA 1CX4A 1JBCA 1UN1A 1CJPA 1OOPB 3IIIA 2GAUA 4Z1VA 1W04A 5FZHA 1NY72 2VMIA 3WNKA 1AYN2 3CJXA 2C9KA 2V72A 3ILNA 4MLOA 3SMHA 3ZYIB 1AJOA 1VBE3 4XFIA 1O5LA 1PVC1 1STMA 2ZGKA 4B1LA 2O8QA 2WS91 5FMOS 1POV0 4YVWA 1LAJA 1LR5A 2WAAA 3HR9A 4I02A 1WMDA 5JI9A 1UU4A 2KD7A 4HETA 5GALA 3QACA 4XF0A 3PUIA 4XOGA 5T5LA 3E5UA 4A6SA 2W87A 2HWD2 5DUVA 1RC6A 4XZPA 4FPFA 1ASJ3 3J7NA 3KLSA 3TBDA 5J1XA 2Y64A 4OLLA 3ECQA 3OEBA 4BQ3A 5LEKA 1SZBA 2YFUA 1VBE1 4LBQB 1F8VA 1DLCA 1VAVA 2Y6GA 3MI8A 1LHVA 4GA9A 1F4AA 4HVQA 1C5IA 3I2FA 2EA7A 1BJQA 2JXAA 4HPKA 1ENSA 1H1MA 4Y26A 1D7PM 3I4IA 2L9LA 3JD73 2YROA 5E16A 4NN0A 1X36A 4P9WA 1ASJ1 4LBQD 3WG1A 2BWCA 3HN3A 5T52A 1V6KA 4K21A 2X05A 4UXAA 2CGNA 1H8TC 2P6HA 3WDVA 1VMFA 2W5FA 4INDA 4GJZA 2VZ3A 5LA1A 1VRBA 5J7MA 1QKQA 1KS5A 4KU8A 3E5QA 3LGRA 4QX7A 5FZIA 1QQP2 2Q1FA 4HKLA 1SBFA 3JD71 4KWLA 2GDFA 3VBHA 1ZX5A 2UURA 3OD4A 4ARYA 2ZGQA 2VNRA 3BUCA 3B94A 5KXEA 4XQDA 1BBT3 5FO7B 4E27A 4QGNA 2BNNA 1U5ZA 1XE8A 2XQXA 4BYYA 3R4UA 5A6YA 3T09A 2J1EA 4BK4A 3S6PA 4JHTA 5CFDC 1XNKA 5LASA 1HDKA 1NE4A 4QM8A 2C4XA 2FDHA 2R7EB 3T2QA 4XBQA 4A6OA 3CBNA 3LEKA 3WF1A 5C5UA 4LORA 1NUKA 3GJAA 2VXRA 4Q2FA 3GGLA 5LZ6A 4CCKA 2RMU3 2VG9A 3KV6A 4UFIA 2FCUA 4B29A 1OMIA 4R9AA 4DPNA 3LWCA 1OURA 3AXEA 4D0QA 3AB0A 2YPJA 4Q8LA 3VBRB 2Z2SB 3MO4A 4R52A 5IVFA 3UJQA 2ARAA 2JX9A 1UKGA 4LKFA 5C33A 5K0UC 3THTA 3OPTA 1HRI2 2D3PA 4RR3A 3BN6A 1XYNA 1LNSA 1QJY3 5A3WA 3I8TA 2AYHA 4XDPA 2RMU1 4FTEA 5FO9B 3RJRA 3L9JT 3OOXA 4I2OA 4QGMA 2W2IA 2NPIA 4QX5A 4RHV2 5I0SA 4CP9B 1ZVFA 4QQHA 3WR0A 3O1MA 2RS11 2GMPA 5ABJC 2AZ5A 1S55A 1AL22 5D1IA 4AVVA 4COUA 3OGGA 3MW4A 3OCPA 5KXDA 3AMMA 1RUF3 5JI7A 2ET7A 4BJ0A 2RE9A 1OLMA 3GCXA 4YW1A 5T3NA 4CUGA 2F6BA 2EIEA 3RMYA 4AFCA 5JPMB 1J58A 1VRH2 2WT0A 3EJKA 1AR92 1ULOA 1YQCA 5A3LA 1VP6A 3TYJA 2WZR2 5BNNC 1IKQA 3IZOA 1RUC1 1VBA3 2ARCA 2TNFA 4BHPA 2HEWF 4IGOA 5CG8A 1QXPA 4XETA 1UL9A 2XLFA 5C3OA 3A4UA 3POSA 4Y3OA 1CAWB 5HPOA 4H2AA 3WHTA 1PMIA 2R062 1YYNA 2BUKA 3APBA 3VBOB 1YRZA 3CJIA 1PIV3 3ZLIA 3ZSJA 4BLJA 4RFRB 1HQLA 1OOPA 2WQ4A 3H3LA 4TTGA 1EV13 1VBA1 5EJ1B 1R092 2JENA 4I0BA 4XQ4A 2VOKA 4G4FA 3TEWA 4BA6A 3I3DA 1HXS3 4K1ZA 2E31A 4Y33A 3KSCA 2A70A 1PK6B 1VBD2 2WNEA 4JHZA 1DU3D 1PO11 2EICA 2FQPA 5FZLA 2BVBA 5BXXA 1YIPA 2YMZA 2OVUA 3ZIWA 1AR82 2WNVB 3KM5A 3POFA 1PIV1 5AVPA 3O1OA 3KB5A 4FFFA 4W8JA 5JZGB 2JG8C 2J42A 5F3EA 1HRV3 5ANQA 3SHRA 1EV11 1SFPA 4A3XA 3HJRA 3OUJA 4LBQA 4MHRA 3AVRA 4COVA 5CG9A 1WBLA 1W3XA 1JUIA 4M4RA 1HXS1 3FWEA 3WNXA 3AZZA 2D6PA 3ZYRA 1YI7A 2CY6A 1XC6A 3SCFA 5IJRA 2E53A 2UWBA 3VLBB 4NPRA 5KHKA 2GU9A 3WDTA 1QU0A 3X29B 2JD4A 1YIFA 1HRV1 1US2A 5FLHA 3W20A 4IE7A 3JQXA 5KC5A 3K51A 4Q0UA 3AYEA 2P2KA 3GBGA 2ZXQA 4CEWB 5DUXA 2OPKA 2HBTA 2C24A 1UZWA 4QHBA 4JKLA 2IFWA 1O4TA 3VHRA 1D2QA 3WXPA 4QWNA 4B4PA 2DUPA 1HV0A 1OKOA 4I3PA 4QB1A 3CJIC 2FDKA 1I9RA 3ZYPA 5FZDA 4J6GA 2B7YA 2LS6A 4IXLA 5C7GA 2Y6FA 4MXWB 5LA0A 1V9U3 5T54A 4XFCA 2QJVA 5JXJA 4N7IA 4BMEA 4K6BA 2B46X 1OHFA 3LF7A 3I2GA 4DQAA 4QM9A 3DKWA 4CTEA 1Q8PA 2B9VA 2X8KA 4O7XA 5GZGA 1NZIA 2JKBA 2RJLA 2N7GA 2VZVA 4LTAA 3IN9A 2R32A 2DVBA 3AZVA 5JCTA 1QDOA 2VNOA 2P4EA 2BDRA 3T2PA 2FCTA 5LCWL 1FI2A 4DEQA 1XPWA 3CEWA 3S0MA 3GZEA 5FYHA 4BQYA 1O59A 1QDCA 1URXA 3FJSA 1V9U1 3N3HA 4RYDA 4ZU5A 2QE3A 2XVGA 1DQ5A 3LA3A 2KM2A 2JDYA 1W90A 2WO2A 1R082 4Y5Z0 1RUE3 1CIYA 3LSDA 1C3HA 1OA4A 1S2EA 3RRDA 3VDDB 3VBRA 2VMDA 4AQTA 5A80A 3KVBA 4CDUB 2NMNA 3N7LA 5JSOA 4OYUA 2F4PA 5CKMA 1JHJA 2K2SA 2VNVA 2HBUA 3A7QA 4HKOA 1N3PA 2D3RA 4YZ3A 3KVAA 3R4SA 1DFQA 1RUE1 4J1XA 5LA9A 3HNYM 2JDHA 4CP9A 3MFAA 5I0DA 4LE4A 2VECA 1H2NA 3C7OA 5FP3A 5JWPA 1LOFC 4QXCA 5FIXA 4N43C 5DN2A 4IEUA 2YDEA 4OHVA 2IVJA 3V0BB 1COV3 4QX2A 1HIXA 1QMJA 1VJ2A 3PVBB 1OBNA 4F7ZA 2AUYA 2ET1A 5FYBA 1PGW1 2YV8A 3QLQA 4NMIA 2YUEA 3HN1A 4U36A 2V4VA 4BU2A 4LEJA 5IVVA 3I3MA 1DLLA 1UU5A 1VMJA 2G4IA 2KR2A 2WUHA 4N7UA 3WP5A 5CEHA 2XL7A 3PURA 5FPXA 4AFBA 4AVSA 4MOAA 1DQ1A 3POEA 3HQUA 5FBJA 1LGCA 1COV1 3H1YA 3J7LA 4CU7A 5CKNA 4NIHA 3VHNA 3ACFA 1F5JA 1CAWA 2G9GA 4BH9A 1LU1A 3I2IA 4NUBA 3BTAA 1Y7BA 4AVBA 2F17A 2D40A 3VBOA 2WWSA 2ZMNA 2BJSA 4Y5TA 4E9KA 3O1TA 1CGPA 1Z7S3 3VBRC 3KS7A 1IS4A 1L3JA 4E4DX 4WZCA 5LBBA 4HMZA 2HWF3 2PXJA 3ZN4A 4OI2A 4JZRA 4FPEA 1OPMA 2HYKA 3ACIA 2FZ1A 1LODA 1PK6A 3EYPA 4LR4A 1EPWA 2J22A 3ZDVA 4IW3A 1GZWB 3ZVXA 2WNVA 3MDPA 3N9PA 1MEC3 3NL1A 1SHWB 3VZMA 3DF0A 3OUHA 2ZBJA 3P5BA 5JZGA 1XYPA 1Z7S1 3KT7A 3HT2A 4AEDC 5IATA 3CZJA 1H4GA 1PNFA 2WSVA 2HWF1 1W2UA 2VY0A 4W6YA 4LITA 4NPMA 2VZQA 1H2LA 2ZX3A 1W6QB 2BERA 2E33A 2FMDA 1GWLA 1ND2C 4JQRA 1UMZA 3T1LA 3ZMOA 2DUOA 1DDLA 4P9GA 2WLQA 3PNAA 4NAMA 1MEC1 1FNYA 1DYOA 4OI4A 3SH5A 3AP9A 5CYYA 5GKAC 1W8NA 2J1VA 4KMQA 2RS32 1XNAA 2GALA 2XJSA 1UZVA 1QH7A 2VVEA 3IDAA 1BZWA 3Q8EA 2NMOA 4P5YA 5DMYA 4L92A 1JI6A 4BCUA 2H6BA 5FKBA 3BI3A 1NOVA 3VBSB 3E5XA 4CEWA 3AJZA 3K48A 4YW4A 2JDNA 2RDRA 5FZEA 4P08A 2YBPA 1EAH2 4PDWC 4I0WB 1SCRA 2SBAA 4LBMA 1K12A 1OD5A 1HKDA 5IK4A 3UT0A 5CIRA 3LIGA 5IK7A 2C5DA 1GYKA 1MZFA 4GQ7A 1ZRCA 2Y60A 1XJAA 3CL1A 3DN7A 2D6LX 3FHAA 4MXWA 5FBZA 2DF7A 3IDCB 1XRUA 3H3ZA 4LHLA 2Q8EA 2TUNA 2FZ2A 5IAXA 5IK5A 3CKHA 1MS3A 1UXXX 3ZFEC 1CN1A 1PO22 1FX5A 2OIIA 1UY2A 3PVEA 4BB3A 1GP4A 2BWAA 3AZXA 4Z92B 1XNCA 2IXIA 2ZMKA 1O4ZA 3CF6E 4CYDA 4QGLA 3PHMA 4DO0A 1O3RA 1YQ8A 1H6XA 5C4WB 1EUTA 1LESA 5FMDA 1CX1A 1MR5A 4B4RA 1QJX2 1HN1A 3AZYA 5DABA 2VVDA 2MEV2 1RHI2 3K4ZA 5DDJ3 3UKNA 3VDDA 2QQPA 2QUOA 2QZ2A 4CDUA 3ZXKA 5FYCA 4N9IA 5JIUA 4LK6A 2Y0IA 4URTA 1NLQA 5HV4A 4QX3A 5C70A 3WZ1A 4YGBA 2E7TA 4XBLA 3SISA 1IGOA 3WHUA 3ZXEA 3AKQA 4AGRA 1NT0A 1ZRFA 5CFCC 4LO6B 3BTXA 2Q0AA 3QD6A 5DDJ1 1RMU3 4W4ZA 2LUWA 1D4M2 1LEMA 4BISA 1H1IA 4Y4RA 1RVF3 3AM2A 3C7HA 5BUVA 4HVOA 5LY1A 1JU3A 2VQ0A 1UWWA 3V0BA 3RYPA 3J7MA 2OS2A 3W59A 1PGL2 2E26A 4WM7C 5F2WA 2ZTNA 4TZDA 1HX6A 2KXLA 2W94A 3ON7A 4DOUA 2BBVA 5J36A 1NXD1 4BM8A 3MIHA 2JWPA 1SFYA 2RDQA 2WO3A 2WSUA 3OTFA 3UK9A 2W1SA 1S0DA 1RMU1 3B7MA 4LA2A 3U37A 4Q4W2 3A0KA 3OYWB 1JN2P 5FMCA 4XYXA 5LRRA 1I3HA 1ULFA 1ENXA 1RVF1 4BQWA 3PJYA 3ILFA 1S0JA 1J83A 2BGPA 5FP7A 2O14A 4FFIA 3ASIA 3T0DA 1Q8OA 3M3IA 1SQ4A 3GBWA 4HBNA 4IE5A 4QPWA 4UW3A 1UOJA 1W0PA 3THDA 1GMMA 2VQTA 3ES1A 4QPGB 1JOPA 1AJKA 4HT1T 3F2ZA 5DAQA 4HK8A 4Y1VA 4MV2A 3FHIB 3PDQA 5FWJA 2Y0OA 4J25A 3ZPOA 3BTYA 1IS6A 2HWB3 3PU8A 1LB2A 1DZTA 3ZMNA 5FZ1A 5FLJA 4CDUC 5IUQA 3KWVA 4MX3A 1R1A3 5F5CA 5FYSA 1K42A 4Q26A 4DXRA 1EPZA 3NW4A 2HH9A 1H30A 3SNMA 5KR7A 1N1VA 4XCAA 4S2HA 1GZWA 1W6PB 2GSYA 4ZONA 4BQ2A 5KHIA 2R49A 2WLPA 2Z42A 4DRRA 4Q4X2 1XYOA 1MS9A 5A7SA 2E9QA 3WG4A 4CDQC 5BYNA 1UNBA 2HWB1 3VN4A 2GP3A 1WUVA 5ISLA 3A0NA 4YFZA 2P3IA 1DGRA 4OUSA 3LKJA 2DCJA 2P17A 1R1A1 3Q9OA 4XDOA 4P5HA 3RJ2X 3WP6A 1W6QA 2PAEA 3JB8A 3N7KA 3ZM8A 2DV9A 1OFSA 1JYVA 1W6OB 1AR93 1YQ6A 4DZGA 2TEPA 4ATEA 4F83A 2Z79A 5EQUA 3ATGA 4H14A 3KV9A 4EN8B 2DDUA 1BEV3 1VB4A 3NJVA 3BTZA 1YEWA 1WA4A 2WINB 2CDPA 3I49A 1ONAA 1ZBA1 2JD9A 3N9OA 5FR3A 2D6OX 2NQYA 4JV4A 1GZTA 1RUJ2 1OC1A 2R063 3WCRA 5C8CB 3VBSA 1UX6A 3BODA 3ILRA 1DQ0A 4OUEA 4CEYB 3URFA 3B69A 3IMMA 3RGBA 1KRIA 1KQRA 4EJRA 2RDNA 2XWBB 2EIDA 3VD3A 1BEV1 2GMEA 4PLMA 4IV3C 5K7PA 4XVHA 3MIFA 1AUYA 5J96B 1D4VB 2QQLA 2VUDA 1IS5A 2BP6A 2W68A 5DZFA 4ZHNA 1W0NA 4KGGA 5JOYA 1AR83 1BMV2 2R061 4LHSA 3RI8A 4MGKE 4AI3A 1O7FA 2J1AA 2VTFA 2QNKA 2CGPA 1F31A 1LHWA 4XIOA 3WQ1A 1ZREA 1GICA 1C8NA 2EIGA 1WBFA 3INAA 3M8LA 1E5SA 3WG2A 2VMHA 4UT5A 2E7AA 1W9YA 4XIKA 4HXCA 4Q5OA 1NCQB 5C4WA 3O5SA 4AEKA 3LFIA 2ZMLA 2RR12 2WO1A 3POYA 5BNPC 1J59A 1GQHA 1AR81 4IEQA 2GC1A 3O7OA 5FZ9A 3WT3A 2PTMA 2YFZA 5IYYA 2ARBA 2CL2A 3BOPA 4LO5B 1RUH2 2GP5A 1IKPA 1UOFA 5BPXA 3WNMA 2QQMA 5KXBA 5FZAA 5IHRA 1G86A 2R073 1HLCA 2Z69A 4I0AA 4LKSA 1TME1 4Q0SA 4GIQA 4RA0A 1CIWA 3VGIA 4A42A 2HLEA 1IG0A 2ZX1A 4CPBD 5J3UA 5E89A 3ZYHA 2PHUA 4OHWA 1MS1A 1OVSA 4FO9A 1C5HA 2HYXA 3M3EA 4GXLA 1GWKA 3H50A 2VZUA
chains in the Genus database with same CATH topology
1OA3A 1ZRDA 2CTVA 1DBNA 4TLFA 4SLIA 4COWA 3JUUA 1ZBE3 2R071 4X8PA 3VBFB 2VOXA 3AP5A 3E97A 3IMNA 1CVNA 2UWCA 4EWEA 1IS3A 4YFWA 1AYM2 4LLOA 1B35B 1X8MA 1MQTC 1CJDA 3JQWA 2OZJA 4JGYC 1ZBE1 2YHJA 4HKWA 4B4QA 2LTNA 4DB5A 3OYWA 1CAXB 3RWNA 1NCRB 1V6IA 2ZAAA 2D6NA 2DTWA 5L19A 2H0BA 1ULEA 1JXNA 4QPGA 1YUDA 3MGUA 2E63A 1UZZA 4M00A 5JAXA 1EYBA 4AK3A 1BCXA 4Z82A 4GH4B 1JUHA 4AXOA 2UY8A 4X6RB 3ZSMA 4JAAA 4DMIA 1BQPA 4ZU7A 1BKZA 3H3UA 3UKVA 3FUQA 3NAPB 1W6PA 2PLV3 4FTBA 4TYSA 2W08A 3SITA 4BQ1A 1V6JA 4CDWB 3MPBA 2NM1A 2SLIA 3I59B 4RQPC 1XE7A 1F9KA 1C4RA 2XWJB 3AKSA 1AXKA 4EROA 5GJ6A 3VZNA 3DL3A 3WINE 4W65A 1YFXA 1CONA 1W6OA 1FAYA 4LA3A 3E6BA 2PLV1 4O9EA 1Z78A 3WOGA 3U07A 4WM8B 2WC2A 5AC93 4MH0E 2HWE2 2ZS6B 5EZWA 4RD7A 5FOBB 1G9FA 1MS0A 5C8CA 2KA3A 5F1RA 4EN0A 2HEYF 4O9GA 1J1TA 4CEYA 2VPVA 2RHPA 4PQ9A 2VH9A 3HD8B 1WLCA 2GN3A 3UKTA 5D8AC 4Q4Y3 4QPGC 3NV4A 3V0AB 5BNOB 4QT6A 5AC91 3ZFGB 2FBEA 4LHNA 3J26N 4QMAA 3S7EA 3J8F2 2BNOA 2X5IB 5F6KA 5J48A 5GLUA 4OI0A 1AF9A 1C8M2 3VHOA 2XJVA 1G9DA 2A75A 2EAKA 2XB6C 1LHUA 4NWVA 1N1SA 1QOOA 3M4FA 3R6SA 5IT6A 4YVWC 4Q4Y1 5BV6A 3EO6A 4JTNA 4QQLA 3EHKA 1LOCA 1NCQA 1UU6A 1VLNA 2QKDA 1UD1A 1BBT1 2XKOA 1A3KA 3BU7A 2I2SA 3WCSA 1NG0A 2XKPA 4S2DA 5H9SA 4CDXB 3AYDA 1PNGA 3H0OA 2EXHA 2R043 3BIWE 4NHKA 2IC1A 3NO8A 1HQNA 4GB33 4AQ6A 4YLZA 4F8AA 2K9ZA 2XGXA 4LUMA 2CAVA 2RS53 4D69A 4D7YA 3AK0A 2YC0A 4M3CE 5KHHA 1WW7A 5EYYA 4R9CA 2ZGRA 2B39A 2EXKA 3VBFA 2OZ6A 4AVAA 2R041 2ZZQA 3OPZA 2E7QA 1YNAA 3VBHC 1KD7A 4GB31 1IPKA 1QJY1 1Z0HA 3AZWA 3AP7A 4LBNA 4XJUA 1DF0A 2RS51 1POV3 3DGTA 4TWTA 5EJ3A 3AKPA 3VL9A 3B02A 3VV1A 1B35A 1ZZ6A 3ZIXA 5GLVA 1CAXA 3KCXA 1ULGA 2UYAA 4OFGA 2WT2A 1J3PA 4H7MA 4R4XA 5JMCA 1SLCA 3KT4A 1NCRA 2UYBA 4KU7A 1A8DA 1ZRRA 5GZCA 2MEV3 2ZJCA 1POV1 2GC2A 1N1TA 1RUF1 1FMD3 4KQ7A 1O3QA 1AR73 2PFWA 5FCCA 5I8SA 4XPVA 4XJ9A 4AEJA 3R05A 3FFQA 3RI9A 4BE3A 4AVTA 1JYIA 4G9SB 2JE9A 1VBB2 4CP0A 5H9PA 2GC0A 2PHDA 2Z5WA 4GH4A 4Q0QA 4GMP0 2WFPA 4JRLA 5LRSA 4MGIE 1CPMA 5FQ0B 2PAKA 4RR3C 4ASMB 1YJLA 1DQ4A 1FMD1 3NAPA 3MLKA 1AR71 3D6EA 4FAGA 2D43A 5EV7A 4XJ8A 4MYEA 1PZ8A 3ZXAC 1CPNA 1QJU2 4CDWA 1ZZCA 2W0XA 3WQ7A 4EN9B 2ZKNA 3GHNA 2O0OA 3I59A 4Q4V3 3VBFC 1S0BA 2DVAA 3B9CA 4EN6B 1R1ZA 5A32B 5T50A 2YZ4A 3RDIA 4QPIB 3B00A 1FPN2 1EP0A 4ASLA 2W52A 1LCLA 2A6YA 2D7FA 1VAKA 3L2HA 3HQXA 4WM8A 2UU8A 4FCAA 4NHLA 3VBUB 4Q4V1 3W58A 1SLLA 4C1WA 1NCRC 4YGEA 4FPGA 2HKXA 1O4YA 3DPRB 4AE2A 1RJ7A 2BGCA 3TRSB 3V0AA 1CAUB 5FO8B 4GULA 5BNOA 1MZ5A 4M3CB 3SCHA 5K9YA 3ZFGA 4C1XA 2CWSA 1LOAA 1OOPC 2WFF2 3RYKA 2X5IA 4Y24A 4KWKA 1AXYA 1AR62 2A7AA 1H2KA 5L73A 5LK5A 4HZFA 1C28A 1WCDJ 5J37A 5H9QA 4I30A 5FREA 4L2NA 4PIXA 5I93A 1ZYBA 2VOWA 5DG2A 3ZYGA 4FOVA 2GMMA 5C8WA 3PVNA 2DUQA 3WV6A 1NA1B 1GLHA 1RUD2 4EWDA 5KHJA 3VKLA 2HWC3 1XQNA 4CDXA 1IPJA 2DVGA 4N90A 1S0GA 1TMF2 4LBOA 3RQ0A 4A7KA 1Q56A 5GZFA 4WBBA 3USUB 1QF3A 3JBG3 1RUI3 4AFMA 4WM8C 3NKGA 3MIDA 3RS6A 1G6NA 1PGSA 3LSEA 4IV1B 4W6XA 2HWC1 5DZEA 3NV3A 2A6ZA 3IM0A 2DVFA 2XL9A 5L7OA 3ZSLA 4A7ZA 1RB8G 4R9DA 1IHMA 1PVC2 1DZQA 2WIIB 3MF9A 4E4SA 1LOBA 2WL1A 2WS92 3ACLA 3B3QE 1K5MB 1H9PA 3E6DA 1RUI1 3JBG1 4MZUA 4FT8A 5B2GB 4Q29A 3UL2A 1TNFA 5JOZA 3ZFGC 3M70A 1XXNA 3LB9A 1ULDA 1Q8VA 5EFUA 1NE6A 3RSJA 2X5IC 4FP3A 5GZDA 5CA6A 2DCYA 4A7YA 1ENRA 1Y43B 2IXLA 2D98A 1UPIA 2DU0A 3PJQA 2RM23 5I0RA 2B8MA 2VULA 1FOD3 2GC3A 4FTSA 4FOYA 4FOWA 5C9AB 3MW2A 1REEA 4UW6A 2VUJA 2P3KA 4Y1YA 4AVCA 3TN92 3B5LB 1AL0G 4PLOA 3N4MA 1I5ZA 3VL8A 4FQ4A 2RM21 4XMIA 1FOD1 3IDBB 4XE9A 1DGLA 2QDNA 2UWAA 5GLZA 4Y1UA 5FQ0A 1WCSA 4IEXA 5GLTA 2Q1MA 4Q1RA 1GFF2 1V6MA 5E1RA 3GZAA 3WQ0A 2JDZA 1FV3A 3VKMA 1O3SA 5JSPA 4LE3A 2MPFA 2XJPA 4KG0A 1YFUA 4M01A 4COZA 2GH2A 3HMYA 3AFKA 2D44A 2B5HA 4IEZA 4XW3A 4YZ2A 3AMNA 5A32A 2DWRA 2YYOA 2R16A 4IEVA 4XF1A 1YJKA 4QPIA 2XUMA 4BWOA 1WMFA 4KNCA 3ZN5A 1GSLA 3EXUA 1OQ1A 2IXKA 4J1WA 4YZ5A 4FPKA 2V73A 2OA2A 5EXOA 3VBUA 1SBDA 2A6XA 1LKNA 4K3UA 2GZWA 4DFSA 2HJIA 1UZYA 4B7EA 3DPRA 1AYN3 4Y4YA 3GYDA 1SMVA 1CAUA 2WJSA 2ZX2A 4M3CA 1X82A 3VBOC 4Q8KA 3AKRA 1Y9QA 4IEYA 1G9BA 1WCKA 1UIKA 2HWD3 3WDXA 2O8OA 3P3PA 2RS12 3H7JA 1NY71 4K8FA 1PK6C 1AYN1 2DTYA 1CAVB 2WNVC 5JPNB 2IFRA 4RS5B 3OJBA 4AI2A 3BPZA 1AX2A 1A8MA 4KWJA 1OPOA 2XJUA 4X6QB 5JZGC 4PIYA 1NA1A 5DUUA 5T55A 1OQDA 3U11A 2HWD1 5DXDA 4FPOB 3WG3A 1U0AA 1RUC2 5CVRA 2HWE3 4UBHA 4CRQA 5I91A 3MEPA 4XXPA 3HIFA 3USUA 5BNQA 4OI1A 1X50A 4UW5A 4ZXKA 4BIOA 5CU1A 2ENRA 4JDNA 4D7SA 2ZCWA 4NVPA 1DYPA 3VBUC 1QQP3 3M1HA 4IV1A 4YZ1A 3O0VA 3WLUA 3W9AA 5K8SA 1LGNA 1VBA2 3ALQA 2P3JA 2HWE1 4P14A 3GF6A 3ZSKA 4CEWC 1UPSA 1QNYA 3J8F3 2WT1A 1LGBA 4META 2PAMA 3P3NA 1VALA 1K5MA 3D0SA 1PO12 4M0HA 1C8M3 1F5FA 3KGLA 4FPCA 4NHMA 5FRAA 5HXVA 1NZCA 3HBZA 5ACA2 1PIV2 1LU2A 1QQP1 5JDBA 2NYYA 4AEMA 4BLIA 1ZZ8A 3AMQA 1EV12 3FBMA 3J8F1 3PLQA 1HXS2 3JCIA 2Y26A 2BW8A 3H8UA 1H9WA 1APNA 1A78A 1XNDA 2YGLA 4LO7A 1GBGA 5C9AA 1GV9A 1VAMA 3BOWA 1ZZBA 5DG1A 2V09A 1NA1C 3L2YA 1HRI3 1YCIA 3MIGA 3WP4A 1KXGA 2I07B 5J09A 2WZPP 4GWNA 2ZGLA 3VDDC 2GN7A 1CESA 1KFXL 4GKXA 3R4DB 2GNBA 2XLGA 3JU9A 4DY3A 2ARXA 4RHV3 1H8TB 1SFNA 4FVVA 4IEWA 5KBFA 2DCKA 2FHRA 1Y3TA 3LAGA 4WVVA 5JLVA 1GZ9A 2BVVA 1WMEA 1HRI1 4COYA 1GZCA 1V6OA 3VZLA 4DS0A 1AL23 2D3SA 1MZ6A 4HSJA 5EWSA 5I8TA 4YW2A 3LOBA 1X8EA 2R0HA 4K20A 3H9AA 5CNAA 2A3YA 1K5MC 5EYXA 4RHV1 1W6MB 1VRH3 4AQ2A 2EALA 2WZR3 1C1FA 5CFDB 1JOJA 5JSRA 1AL21 4C91A 1AVBA 3G6JB 2VW0A 4BIFA 2QVSB 4XF3A 1J1LA 4FPJA 3S7IA 4E2GA 1MACA 4PBPA 3FZ3A 4RSUA 5KXCA 1VRH1 1AHSA 1HV1A 5A3MA 1AR91 3QH6A 4M0NA 4HL0A 2WZR1 2EAAA 1R093 2CNAA 1S1AA 5K0UB 3MYXA 3WUCA 2EVXA 2D5HA 2OYZA 3PMEA 1ZA4A 2Q4SA 1VBD3 4JGZB 4RL7A 1LENA 1RUE2 1DG6A 3ZX7A 2VQAA 5BY5A 5LEJA 1SLAA 4AYUA 1QJU3 5FAXA 5HI0A 2CWMA 2Q30A 1H8VA 1H0BA 1R091 1UW8A 2ZACA 2XVLA 4K1YA 5L36A 1CAVA 1DYKA 1KJRA 4RS5A 5ABJB 1PGW2 4XXAA 5AFEA 2DCTA 1VBD1 2ZKLA 5I0TA 4C0HA 1RGSA 1TE1B 1QJU1 2D97A 4HLTA 3ZN6B 1MS5A 2ZPXA 4UW4A 4S2FA 3EBRA 1COV2 3AP6A 3RZZA 2OUHA 2JICA 4FP2A 4P9IA 2Q8OA 3WD5A 1UIJA 4JVAA 2DCZA 3WY6A 4AG4A 1LJ7A 3ZO0B 3SLIA 3MFCA 4YW5A 4NOTA 3VBSC 4CP2A 5C6CA 2CAUA 3WDUA 4AFAA 3EQEA 1SACA 1VIWB 5FFOC 3SXWA 1DQ6A 4Z07A 1ZM1A 3OD0A 3ZSEA 4LHKA 1QJZA 2XPJA 1Z7S2 1QGLA 2E51A 4XMAA 3LA2A 1AXZA 3ME2A 1DGRN 5HCAA 3ZFFB 4DNYA 2JG8B 4G3YC 5CBLA 3SH3A 2GH8A 3GNEA 4AGVA 1R083 4XJWA 1MVQA 2QDRA 1KFUL 1MEC2 1SEFA 5C4WC 5FOJB 4FOQA 4XFGA 3FLRA 3D82A 4N53B 4QXKA 1QWRA 3FLTA 3MPPG 3WDWA 3WW3A 5F5QA 1MZEA 1J3QA 1GKBA 1NYWA 1MVEA 1N3OA 1WGPA 4XFHA 3IBMA 2BTVC 3ST7A 5FPZA 1SLTA 1R081 1YXWA 2ZHLA 4MXVA 5JOXA 1J3RA 2R1BA 1S0EA 1G9AA 1H8TA 1WLTA 4LBJA 1WW4A 1FT9A 2BQPA 4XTMA 3MZHA 2WS93 2NP0A 2P37A 4BZ4A 4YSFA 2NZ9A 2VW2A 4XFBA 4HN1A 1N1YA 3RNSA 2D6MA 3V64A 4AGGA 4XEZA 3PVOA 1W6MA 1VBC2 4IQPA 4AQSA 3CNAA 2A3XA 3KCCA 5CFDA 1WLWA 2AENA 2JE7A 4XF4A 4Q0PA 1S2BA 4Q27A 3V65A 4EV0A 2JG9B 2PELA 5TSWA 3TB0A 1FYUA 1DGWX 2A6VA 2DURA 1QNWA 2PQQA 4Q1PA 3TN93 1S0CA 2E6VA 2V5YA 3OY8B 4DRVA 1VB2A 1ND3B 1NLSA 4DXZA 3C2UA 2PHXA 3KD4A 5K0UA 4YGDA 3N7JA 4BMBA 3B9IA 1G8WA 4R8HA 4WVMB 4JGZA 1YO8A 3TNQA 3ZXGA 3TN91 5DDJ2 1RL3A 1M06G 4I09A 4OUMA 1KITA 2NLRA 3ZXFA 2TBVA 4AW7A 1AX1A 3LZZA 3KT1A 1SLBA 3O0XA 1GQGA 5ABJA 2R1DA 4YNIA 4N43B 4JTOA 1VR3A 5DZGA 3AXDA 1ZZ7A 1GNZA 4PLNA 2IXCA 2UY9A 3NKTA 4AI8A 1RMU2 4HSLA 1ENQA 4YGCA 2ZHNA 3ZN6A 1RVF2 2RS33 4IESA 2ZABA 3U10A 3LCPA 1RUNA 2R6QA 4EWAA 1GANA 3TNPB 5BNNA 4XBNA 1NQDA 4XF9A 2B45X 1C1LA 3VZOA 2AH2A 2QFEA 3RPQA 1EAH3 1TEIA 3JB4C 2EXIA 3POWA 4KBBA 4AHYA 5C8CC 2RS31 2A5ZA 1YFYA 1H4HA 2XLAA 4CEYC 5L7OB 1PZ7A 5JOWA 1CD3G 1LECA 4PIZA 3U4XA 1PO23 5E8AA 3HWJA 4YG0A 2RS13 2GNMA 1EAH1 3I2DA 4JGZC 3TOJA 1LEDA 3ELNA 1SDWA 4YM3A 1X33A 2HWB2 1XU2A 3NV2A 3J4UH 1LULA 4CP1A 1N3QA 1R1A2 1D2SA 3ZXJA 3MIEA 3IT8A 3ZFFA 2JG8A 2PHRA 4AEDB 4TSVA 1QJX3 2I45A 2PHLA 2XH6A 4KGQA 1PO21 1NXMA 1WLDA 4AHWA 4HK9A 1RUC3 1RHI3 1GR3A 1NCQC 4R9BA 1ND2B 4FPHA 4WVZA 4N53A 4N9HA 4K9SA 3VHPA 4Z8BA 2LALA 3I54A 1ZBA2 4WVWA 4XTPA 3PMSA 2D93A 4IEPA 4FQZA 1JH5A 1QJX1 4YG3A 3MLLA 2VGDA 3MIBA 2MEV1 1RHI1 2BNMA 1XNBA 3ZDSA 4ATFA 2WA3A 1D4M3 3CLPA 1BEV2 4ONUA 1XU1A 4Y20B 4PDWB 1PO13 4NO4A 5GZEA 3T2TA 1RUG2 1EY2A 2AR6A 3AP4A 5ACA3 2LM3A 3FMGA 2CYFA 3IDEA 3OBRA 4W6WA 1IOAA 1RINA 3MLJA 1UCXA 1PHMA 2XBO2 4Q4W3 3ZFEB 1D4M1 4LT5A 4FXKB 1GNHA 1BXHA 1SLIA 2DU1A 4D7TA 1Q5OA 3RMXA 1KDKA 3S30A 1B35C 5JR7B 3FFZA 1PGL1 2JG9A 5ACA1 1V00A 5F6LB 4MSVA 2ILMA 1O91A 3ZFFC 4L99A 4B7KA 4UBGA 5KC6A 4RFT0 1U5XA 3OY8A 3RG0A 3WW4A 1TME2 1BVVA 4Q4W1 1ALYA 2A6WA 3U0ZA 1ND3A 5FLIA 2I74A 2C1FA 1HQWA 2PHFA 3MICA 4XILA 4N53C 1NLRA 2A3WA 1BK1A 4WVMA 4D3WA 2IXJA 3B93A 4OULA 1U5IA 4E4ZA 4YM1A 4GH4C 1QOTA 2R072 1OKQA 5JIAA 4LNVA 4Q4X3 5JVVA 4F3JA 4BPZA 3AYAA 3CO2A 5CFCB 3AMPA 4Y1XA 1CR7A 2ZGTA 3OF1A 5FTTC 2G9FA 1DIWA 4Y1ZA 1WD4A 2C0ZA 2IWGB 3NAPC 4GALA 2ZHMA 3ZXDA 2DVDA 4AWDA 1LOFA 1AX0A 4N43A 4ES9A 4CDWC 2X29A 1F2NA 4KL1A 1ZBE2 4U2AA 1W0OA 4WM7B 4P9JA 5IK8A 3IIAA 4Q4X1 2EF6A 3ZPYA 3H1WA 3V56A 2ZGPA 4WV8A 5CADA 4YYOA 1ULCA 2DYCA 1RUJ3 4FPLA 1H1AA 3B01A 1OLQA 3TAYA 4LO4B 2JG9C 1RTVA 1OFNA 3ENRA 3OBTA 4HN0A 2C9AA 3T1MA 2VMGA 4AI0A 4KG8A 2ZGMA 1ND3C 5CAZA 4A2UA 3HT1A 1YFWA 2XG3A 1UKRA 1RUJ1 3AJYA 4GMP3 4C90A 5BNOC 3OGJA 3NV1A 2B9UA 5GM0A 4H7LA 4Q0VA 2ZAHA 1VBE2 2YGMA 3D5OA 3NWKA 4H3WA 2RR13 4CDQB 4AEDA 4L9BA 1BMV1 4GMP1 1O5UA 1Q43A 2PLV2 3MF6A 4YM0A 1RUH3 2D6KA 4NR1A 1REDA 4WZFA 2XJTA 2ZGSA 2GNDA 3AFGA 1CQ9A 4E2SA 1ND2A 1U12A 1ASJ2 3VZJA 2O1QA 1O3TA 1SCSA 3QCWA 2XHKA 3WW1A 3H7YA 2RR11 4CDXC 1FV2A 2ZGNA 5GLWA 3M7AA 2QZ3A 1I1EA 3I7DA 5HCFA 1RUH1 4HVRA 3JD72 3DUIA 1ZNPA 4MVTA 1S0FA 5AC92 4Y20A 4JDMA 4PDWA 3VZKA 3N36A 4IV3B 2Q5TA 2HEVF 5L7OC 2XVKA 1LRHA 3NJZA 1AYM3 3SH4A 1YI9A 4AHZA 2D5FA 1WW5A 4MGYE 4Q4Y2 1KJLA 3ZFEA 3BCWA 4AF9A 1QXRA 4L97A 5A33B 4YZ4A 2A73B 1BBT2 3KGZA 1BYHA 1H2MA 1RIRA 1WD3A 2VU9A 3PTYA 4Z2WA 4ISRA 1AYM1 5BNPB 4MUVA 1FATA 1FXZA 3WW2A 4XJZA 3D4KA 4X8NA 2IZWA 2ETEA 4OHXA 4QQPA 4ZKTB 2DFBA 3ETQA 3WP3A 2RMU2 1LHOA 4JRAA 4FAHA 4GWMA 1QH6A 2BPA2 2WNUB 4GKYA 1AZDA 3TWIA 1JTZX 3GBFA 5CFCA 2R042 5T5PA 4XJAA 3E6CC 2BFUL 3M3CA 2GNTA 3ROUA 5KXEA 4GB32 1QJY2 1S0IA 4XHXA 5SV8A 4B8EA 5HBAA 4Y22B 1DQ2A 3AMHA 1NQJA 1PZ9A 4H55A 5I8YA 5KWRA 2RS52 5HCBA 1VBC3 1X7NA 2A71A 4YG6A 2AREA 1Q8SA 3IPVB 4WM7A 4E2QA 2RJKA 3KCYA 2PHWA 1MQTB 4JCKA 4JGYB 1LOEA 4QPIC 2VW1A 3WX5A 1YWKA 1YLLA 4OHZA 1RUF2 1ZZ9A 5FDBA 3QOPA 1VBC1 3O14A 4LO8A 3NSTA 4ITCA 4D94A 2ZA9A 4KH9A 2H0VA 2WQZC 1QY4A 4