2R073

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r07300
1FPN3 2HWD1 5J98B 5C9AB 1VBB2 4GB33 1QJX2 1VRH1 2R041 2X5IA 5ACA1 1K5MA 1VBE3 1AYM1 1RUG1 1VBC2 1RMU2 1ZBE2 2TBVA 3CJIC 4CEYB 4YVSB 1R1A3 1OOPB 1HRV2 1AL23 1FOD2 1HXS3 1RUF1 4PDWA 2HWF2 2BFUL 4CEWA 2R062 2RS51 5CFDC 5BNNA 1RB8G 2RR12 1E57A 1QJY1 3JBG1 1RUI1 3ZFEA 1HQNA 4JGYC 2HWD3 4N43B 4GMP1 1QQP2 1VBB1 1VBD2 1VRH3 2HWC2 1QJX1 1EAH2 4RS5B 5C8CB 4RR3C 4Y5Z0 1AYM3 4CDWA 3VDDA 1OOPA 1RUG3 1R082 1RMU1 1VBC1 1ZBE1 1AUYA 1PGW2 3IDEA 1DDLA 3VBHB 3VBOA 2WS93 1HRV1 3TN92 1FOD1 4Y4YA 3NAPB 1RUF3 1MQTB 2HWB2 2HWF1 3HAGA 2RS53 1ZBA2 4FTBA 2R061 1PO12 2RR11 3JBG3 1RUI3 2PLV2 2X5IC 1K5MC 4Q4W2 5FOJB 1BEV2 4GMP3 1RHI3 1QQP1 5D8AB 1QJU2 1VBD1 1GFF2 2HWC1 1EAH1 4LLFA 1TMF2 3ZFGA 4NWWA 2BPA2 1H8TA 3VBSB 1VBC3 1R081 5LK7B 4PDWC 1AR92 1PGW1 4CEWC 1BBT2 3ZFFA 5BNNC 1HRV3 1CJDA 4GMP0 3TN91 1FOD3 3ZFEC 4JGZB 4WM7B 2HWB1 2R063 1ZBA1 1PO11 3VBUB 5L7OA 2PLV1 4CDXA 1NY72 4Q4W1 1BEV1 4CDWC 3VDDC 1OOPC 1TME3 1QJU1 2BFUS 5C4WA 2HWC3 1D4M3 1EAH3 2GSYA 3VBOC 4N53B 4QPGB 1TMF1 4IV3B 4CDUB 2ZAHA 5A32A 1VBA2 1AR91 1AR72 3VBRA 1BBT1 4AEDA 4IV1B 3TN93 1Z7S2 2HWB3 1RUE2 3DPRB 4YVWB 2R072 1ZBA3 1ASJ2 5ABJB 1PO13 1NCQA 4CDQC 3ZFGC 1NOVA 1H8TC 4Q4W3 1NY71 1BEV3 2FZ2A 3JB4C 5K0UB 1COV2 4QPGA 4BCUA 1ND2B 1QJU3 1NCRB 1HX6A 4QPIA 4CDUA 4WM8B 1X33A 3ZFFC 1TMF3 1FMD2 1OPOA 4IV1A 1VBA1 1AR82 1W39A 2MEV3 2WFF2 1PIV2 1AR71 4GH4B 1ND3A 5AC92 1V9U2 3S6PA 5L7OC 4CDXC 5BNPA 1Z7S1 4RQPA 1A6CA 1RUE1 2HWE2 1B35A 2R071 5BNOA 1ASJ1 5C4WC 5C9AA 2QQPA 4WM8A 5A33B 2FZ1A 1COV1 2R043 5ACA3 4CEYA 3VBRC 4YVSA 1M06G 4AEDC 1FMD1 1RUC2 4GH4A 1RVF2 5JZGC 1VBA3 1AR81 2WFF1 1AR73 1PIV1 1OHFA 1NCQC 1PO22 1EV12 5AC91 1V9U1 2BUKA 2BBVA 1HRI2 1IHMA 1RUE3 2IZWA 2HWE1 2R073 4FTEA 1ASJ3 3VBFB 5FMOL 1QJY3 4N43A 1QJZA 4QPIC 1NA1B 5GKAC 4RS5A 5C8CA 1VBB3 1COV3 1QJX3 2RS12 1ND3C 1RUD2 4NWVA 1SMVA 3VBHA 4Q4V2 1R092 1RUC1 1RMU3 1ZBE3 1CD3G 1RVF1 5BNPC 3CJIB 4RQPC 1AR83 2WFF3 1B35C 3NAPA 1PIV3 5BNOC 1PVC2 1MQTA 1PO21 1EV11 5C9AC 1V9U3 4EJRA 2HWF3 1HRI1 2HWE3 4WM8C 2VQ0A 2RR13 5CFDB 2WZR2 5D8AA 4CEYC 4YVSC 4JGYB 1F8VA 1QQP3 4GH4C 1AR62 1VBD3 3VBSA 2RS11 1RUD1 4Q4V1 1R091 1R083 4RR3B 2RM22 4JGZA 1PVC1 4WM7A 4N43C 1PO23 1EV13 3VBUA 1NG0A 1VAKA 1HRI3 1POV0 4RS5C 1VRH2 1RUJ2 5C8CC 2XBO2 2WZR1 2PLV3 1RUH2 2X5IB 1K5MB 4FSJA 3VBHC 4N53A 1AR61 2WS92 2DF7A 4IV3A 2RS13 3NAPC 5FMOS 1MQTC 4RHV2 4Q4V3 1R093 3ZXAC 4Q4Y2 2RMU2 5CFCB 2RM21 1AR93 1AL0G 4PDWB 1BBT3 4CEWB 1PVC3 4Q4X2 4YVWA 3DPRA 5BNNB 5ABJA 3M8LA 1RHI2 5D8AC 3ZFEB 2ZTNA 1RUJ1 2XBO1 3VBSC 2WZR3 3JD72 5K0UA 1RUH1 1ND2A 1NCRA 4SBVA 1AR63 4CDWB 3VDDB 2WS91 1VB2A 4JGZC 4WM7C 5CFCA 4RHV1 3VBOB 3J8F2 1PGL2 3VBUC 4Q4Y1 2RM23 2RMU1 4Q4X1 1RHI1 1Z7S3 1TME2 1RUJ3 2WWSA 4N53C 4QPGC 3LOBA 1D4M2 2XBO3 1X36A 4IV3C 5A33A 4CDUC 3JD71 1MEC2 1RUH3 2WLPA 5DDJ2 4CDQB 3ZFGB 1AYN2 1H8TB 4IV1C 1C8M2 1POV1 3FBMA 5J96B 4RHV3 4YVWC 1FMD3 3DPRC 3ZFFB 3J8F1 2RS32 1PGL1 5ABJC 4Q4Y3 2RMU3 4Q4X3 1FPN2 4FTSA 5AC93 5K0UC 3VBFA 1BMV2 1ND2C 5L7OB 1NCRC 4CDXB 4GB32 1TME1 1NA1A 1D4M1 4CDQA 1VBE2 3JD73 5C4WB 1MEC1 2Y26A 5CFCC 5DDJ1 1R1A2 1AYN1 2MEV2 4Z92B 1AL22 5A32B 2ZZQA 1POV3 1C8M1 3CJIA 1HXS2 1VB4A 3VBRB 3J8F3 1RUC3 2RS31 4AEDB 1RVF3 5JZGB 1FPN1 2HWD2 1NCQB 1BMV1 5CFDA 4GB31 2R042 5ACA2 4RFT0 4JGYA 1VBE1 1AYM2 2GH8A 1MEC3 1RUG2 4QPIB 5DDJ3 1WCDJ 1R1A1 1C8NA 1AYN3 2MEV1 1AL21 4RR3A 1C8M3 3JB8A 1RUD3 1RUF2 1HXS1 5JZGA 1ND3B 2XPJA 2RS33 2RS52 3VBFC 1F2NA 1QJY2 5BNPB 1NA1C 1RUI2 3JBG2 4RQPB 1B35B 5BNOB
chains in the Genus database with same CATH superfamily
3LB9A 4XTMA 1JUIA 1N47A 3PTYA 5J98B 2XKPA 4E2SA 5C9AB 2SBAA 1VBB2 1RJ7A 4B3NA 1I3HA 2ZEYA 1QJX2 4B29A 2ENRA 2IXKA 1W0NA 2D3RA 1K45A 5IUQA 2CYFA 1Q3EA 4YM0A 1G9CA 1W8OA 1AYM1 2P17A 4JDMA 1YJKA 1RMU2 1ZBE2 4IGQA 5I8YA 4CEYB 3UYJA 4YVSB 1R1A3 4A7YA 4KGQA 2Y38A 5EYXA 3WP4A 2BQPA 1KRIA 3UT0A 1WCQA 2HYKA 2E53A 2ZX2A 5F5QA 2DUQA 4JKLA 3OYWB 3QBQA 2VZSA 1RUF1 4AFCA 4MV2A 2HWF2 1JYWA 2DVGA 1UU4A 2QKDA 2OZ6A 5E8AA 4Y1VA 1GQGA 4K7JA 1RB8G 2ZGNA 1TNRA 1UAIA 1VAMA 2ARXA 2RR12 4DINB 4DXZA 4GWIA 4ISQA 5KWRA 3JBG1 3RDIA 3OOXA 2HJIA 1HQLA 1G9FA 2P1BA 3WHTA 1W2AX 3ZMOA 4IEVA 1OLQA 2OYZA 4N43B 1IG3A 1QIQA 2ZHNA 1QQP2 3W5NA 1VBB1 1H8VA 2W08A 1QJX1 3A0KA 1CAVA 1HB1A 3ZX7A 3T0BA 4NPLA 4Y5Z0 1AYM3 3VDDA 1RMU1 1ZBE1 4YLZA 5T52A 3ACLA 1XBFA 1DDLA 3VBHB 3I2HA 3VBOA 5KC5A 1HB3A 3LEIA 5I0UA 4QXBA 1US3A 1SDDB 3CZUA 3NJZA 1VAVA 3NAPB 1RUF3 4KH9A 2G9ZA 5F3GA 2HWF1 3HAGA 5A6ZA 1JODA 3AZWA 3VD3A 1ACCA 4BM8A 2RR11 4BMEA 3JBG3 3M2MA 3Q8CA 1O8PA 5EYYA 2D43A 2XJVA 4Q4W2 4I02A 3FZ3A 5LY2A 3K4DA 3UL2A 3S5AA 4FFHA 1QQP1 4RD7A 1QJU2 3USUB 3W58A 1UZZA 2WABA 3NO8A 3FHIB 1VJ2A 2J22A 3WT3A 2EXIA 2BPA2 3MHZA 1SFNA 3VBSB 3QH6A 3WG3A 3ZN4A 5IK4A 2A6WA 2VPVA 1W8TA 4TLFA 4D6RA 3WZ1A 1YFYA 1OFSA 3DYPA 4D6SA 4HPKA 4K8RB 2B9VA 3BPSA 3H8UA 5LBEA 3ZFFA 1W6NA 3W59A 1KEXA 2VZTA 3RZHA 2E63A 1C1FA 4JVAA 4ARXA 5I93A 2JDNA 4YARA 4RN5A 1S2KA 4FPHA 4TWTA 1YRZA 2NM1A 1JZ4A 1KDMA 2CNAA 4OCTA 3SXWA 2NN8A 5A70A 1MZFA 5HCHA 1D4VB 4Q4W1 5L36A 3I2FA 3VDDC 1LOBA 1NKGA 4OYUA 1LOAA 5LEJA 1QJU1 4HG6B 5C4WA 4GULA 2XUMA 5DG2A 4LIVA 4YW3A 1XU2A 1JOPA 2OS2A 4W6WA 3RS6A 2B4KA 4K1ZA 2A3YA 3VBOC 3WW1A 2ARAA 3NMBA 4CU9A 1AX2A 2PYTA 3BGAA 2WZ8A 3VKFC 5A32A 1EP0A 3FLPA 1SBDA 4AXOA 4HVOA 5A1FA 1I5ZA 1VBA2 3IT8A 2C6SA 5FKCA 3VHNA 5JPNB 1AR72 1W6MB 4LORA 2IUWA 4IV1B 4AF9A 2AGSA 2VAUA 3FMGA 1DGWA 3P3NA 4J6GA 1LR5A 4LQRA 3VKOA 1YIPA 3MLJA 2VUJA 4YVWB 1PZ9A 4DEVA 1KS4A 3GBFA 5IVEA 4I01A 1ASJ2 4EYUA 1NCQA 4PIXA 5JOXA 1O8SA 4K20A 2NQYA 1OLME 2ZX3A 2QQVA 4QDRA 5IW0A 1LNSA 1D7PM 3PIJA 4CDQC 4FPKA 4LJHA 1GNHA 1NOVA 1XNCA 1T6GC 2VCCA 4Q4W3 5T5OA 3ZN6B 1LB2A 2FZ2A 5C71A 4N9IA 4DQAA 1UXXX 1ODNA 1QJU3 3GYDA 3OTFA 2Q30A 1HX6A 3BTAA 4JHZA 4NRMA 4QPIA 1YXWA 4WM8B 3KHCA 4IEOA 1WA6X 4XDPA 3ZFFC 4AZZA 2VOVA 4ZU7A 1UL9A 1FMD2 3LIGA 1WZXA 1J3PA 4IV1A 1VBA1 1AR82 2K46A 2X09A 4QGMA 1AR71 1ND3A 3MW4A 2AENA 4QHZA 5IVBA 2FDFA 3J26N 3POEA 5HV0A 2ZGLA 3LEMA 1V9U2 3S6PA 5H9QA 2AUYA 4BXFA 3AXDA 2QNKA 2R32A 1A6CA 1QJEA 3P3PA 1WD3A 4QXKA 5JXGA 3ZKYA 1ASJ1 3JQXA 4ASKA 1QNYA 2CWMA 5C4WC 3GGLA 5FO7B 1K12A 4LBKA 4K21A 2QQPA 1RGSA 1I9RA 1D2QA 4LMFA 4DXSA 4WM8A 1UPIA 1K5JA 2YZ4A 2ILMA 1Q8OA 3ZXFA 1GP4A 4MLOA 1OQEA 2ZKLA 4IEPA 3PURA 5ACA3 3GZAA 4PLNA 1REEA 3FWEA 4KQ7A 1M06G 2OIIA 5SV5A 1FMD1 1OVSA 3P6BA 4XW3A 4A41A 5JZGC 4D7YA 2E26A 3MF6A 1VBA3 1OD5A 1U5YA 1AR81 4KWKA 1AR73 2DFBA 4MO3M 2W1WA 1NCQC 1PNFA 2GU9A 2Z69A 3AJYA 3NV1A 5BPXA 1V9U1 4XJ9A 2Q1ZB 4QHBA 2Y6GA 3A23A 3N9PA 3OY8A 3B9CA 2TNFA 2VNRA 4UFLA 3NNJA 1ASJ3 3VBFB 4LBOA 3D82A 1OUSA 2VCMA 1QJY3 1JUHA 2YC0A 5LWBA 2Y60A 1MS3A 5IK5A 1QJZA 4QPIC 4QD2A 2WR9A 5GKAC 4NHMA 1O4YA 2P6CA 2UWAA 4JKMA 4RS5A 4ZXEA 5EP9A 3OBTA 3LPFA 4UOJA 2WNOA 5FYBA 1W8WA 3C7GA 1AJOA 1H4HA 2RS12 1S0CA 2ZEZA 5F32A 2QCSB 4BZ4A 1DIWA 1ND3C 1PHMA 2GC3A 1QEXA 3UJOA 1UZ0A 3CO2A 3N7JA 3KCYA 3U11A 2BVBA 4P00B 5DQ0A 5FYUA 2A1XA 4COWA 2E32A 3CJIB 1OPMA 5FZ8A 2ZZJA 4AFAA 1AR83 3U37A 3ZYHA 1DP0A 4CUCA 4WZCA 1NYWA 2VW0A 5E1RA 2OVUA 1KS5A 1V9U3 2VMGA 1BQPA 5LY1A 1NE4A 2EXHA 1DYKA 4AI8A 1DLLA 4WM8C 2A3XA 2QQWA 2Y0IA 4R9BA 4EN6B 1IGOA 2VULA 3IIIA 2PTMA 3ROUA 4QQPA 1W9WA 2BW8A 4FFFA 2ZMKA 1GOHA 1O5LA 2WO3A 4JGYB 1JZ5A 4XHXA 1W6PA 1VBD3 4KGGA 2F17A 3CLPA 3K2OA 4HANA 3GZUC 1S0BA 2RS11 2YY1A 3WR0A 4B1LA 1U5ZA 1QXJA 1QGLA 1LECA 5LA0A 1R083 2WSVA 3I59B 2RM22 2VUCA 5F5CA 3N7LA 3RPQA 2ZMNA 2WRAA 1HB4A 1KGYA 3PLQA 4HK8A 4WM7A 4MXWA 1SFYA 3VV1A 3ZSLA 1ENQA 4AK3A 4LKDA 1LOGA 2GDFA 4NIDA 2HEYF 4O9EA 2A6YA 4RS5C 1W05A 1VRH2 1RUJ2 3OG2A 2VBPA 3RZKA 2EIBA 4NMIA 2DU1A 1E5HA 1PK6A 1RXFA 2R1BA 5F39A 2WBKA 3C7OA 4ES8A 1VLNA 2QJVA 1CZVA 3JXSA 2O8OA 3I97A 3K3OA 5FP9A 5A7NA 1D0HA 1FATA 5CEHA 5JSOA 4QM8A 1H9WA 2J1TA 4IV3A 2ZGUA 4IE0A 4AQTA 2XB6C 1GWKA 2FBEA 2NZ9A 2RS13 5LEKA 4OZXA 5F9TA 4LBJA 3WEZA 3LDKA 2QUOA 4CP9B 3WF1A 1W6OB 2V09A 3UKTA 5AFEA 4Q4Y2 2ZJCA 4O65A 4Q8KA 2C9KA 5CFCB 2RM21 1AR93 4A3XA 1NAEA 2E7QA 1YQ5A 4K8FA 1LJ7A 2D7FA 4URTA 4AI1A 2JDAA 1BBT3 1WW5A 1YQ6A 1OD3A 4Q4X2 4YG3A 3V0BB 4D7SA 4Y5SA 3FUQA 3IWZA 4LO8A 4QB1A 3FHQA 4P08A 5DZGA 1W2TA 1RINA 3NV3A 3ORJA 2ZTNA 4FXGB 5DG1A 3AMPA 1RUJ1 3AL5A 4OMDA 5I8TA 1W2OA 1PNGA 3E97A 2JDHA 1SACA 2X10A 5LA2A 4BIOA 1AXKA 1O3QA 5K0UA 1KQRA 3L2HA 4LA2A 3OD0A 5FMBA 1ND2A 1R1ZA 3MUZ1 4OI2A 3S0MA 3W21A 1YI7A 1NCRA 1NUKA 4FP2A 3K3NA 2JG9B 1UY1A 4NJ4A 1W9SA 2XHNA 2R0HA 3MPBA 1H1MA 4MX3A 4EWDA 5FMDA 1VB2A 2A75A 3NNLA 4WM7C 5CFCA 4UBHA 1TNFA 4RGAA 4BU2A 2BTVC 5DPNA 1BK1A 1UXZA 4Q4Y1 4AHWA 1CJPA 1L7RA 1GZCA 2RM23 4M0HA 1Q5OA 2LRPA 4UFHA 5JXIA 4UYBA 4I3GA 2ZGMA 3IMNA 4Q4X1 1G7YA 1A34A 3BOPA 2W95A 3INAA 4Y1UA 1XU1A 4Q0PA 1PK6C 2EXKA 1MS5A 3H1MA 5IJRA 3FN9A 4XFBA 4WBBA 3K51A 3ZSEA 4FFIA 1RUJ3 2WWSA 3LOBA 1SG3A 3W20A 1CPMA 5K4LA 2J1VA 3ZXDA 4IV3C 2NLRA 2KXLA 3JZVA 3LF7A 3OBZA 1YQ8A 4HMZA 5FYHA 1DYOA 5GZGA 2EVXA 3E6DA 3SCFA 1OH3A 4AGVA 3ZFGB 1IQAA 5JI9A 1AVBA 2D97A 3P5BA 3THCA 3THDA 3Q8AA 2CGNA 4B1MA 4CUBA 2QQOA 4YYOA 1ZA4A 4YZ2A 2I2SA 3WCSA 4E8DA 3RZMA 1LODA 3NJYA 4JX0A 3LAGA 2RS32 3OPTA 5A7OA 4L0PA 2Q8CA 3ZXEA 3HT1A 2RV9A 4EE2A 4Q4Y3 4IGOA 4FPGA 4NPRA 3AVSA 1O59A 5LBCA 4Q4X3 3ZOIA 4HZFA 1G86A 1W2NA 4H55A 1EUTA 3VZKA 5K0UC 1ND2C 1HKDA 2ZX1A 2ZGTA 4QGNA 5GM0A 1UPSA 1NCRC 2A3WA 3ALQA 2ZXQA 1CX4A 4WVZA 1JN2P 2A6ZA 2DCZA 4GB32 1NA1A 5FZOA 4CYDA 5EHDA 3PJQA 2WNVB 3PUIA 4XAEA 2XQRA 1MS1A 4LK7A 2P4EA 2RJ2A 1VBE2 2XLGA 3BCWA 3OD4A 1VR3A 4QPWA 1JW6A 1YEWA 2C0ZA 5CFCC 2A70A 1GQHA 4OQ8A 4LULA 4CCEA 5GZDA 1AL22 3T2OA 2I74A 4ASMB 4NHXA 1YWKA 3UJQA 3NRUA 3M1HA 1S1AA 2BOJA 3DV8A 2BJSA 4EN8B 2D6NA 2RS31 1K3IA 1SPPA 4AEDB 3I7DA 4I30A 4LNVA 3PTRB 4CXYA 3WXPA 3WUCA 3H0OA 5JI7A 3I3DA 1O3RA 3D3AA 3LCPA 2R1DA 2W87A 5LB6A 5BNQA 3QH7A 5JXHA 4D8MA 3RMXA 3O12A 2HWD2 3EO6A 4I2OA 2YPDA 3PVEA 3AMQA 4LHNA 4FOWA 4GJZA 1OF3A 3NQHA 4GB31 2XG3A 5DAWA 2W2IA 2XWBB 4RFT0 1DFQA 1S2BA 2HBUA 4KNCA 2XDVA 3RJRA 4Q0QA 5C3RA 1W0PA 1VBE1 4LT5A 1RUG2 4ZZ5A 2JICA 4R9AA 4A6OA 4AI3A 1WCDJ 3UGFA 1DQ6A 1JHJA 1HB2A 1UU5A 4DZGA 3VD9A 1A78A 2CTVA 4NIHA 1GZWA 2AH2A 1JTZX 3ILNA 4XUTA 3O1MA 3O1PA 1AL21 5GALA 2WJSA 2JDKA 3B02A 3JB8A 3OGRA 5FZKA 3WG1A 3ZN5A 2ARBA 5DMYA 5K8SA 1G9BA 4CP1A 2RJLA 2RS33 2VMCA 5JR2A 4OFGA 3T0AA 4ZS3A 3WQ7A 3I8TA 1CAWB 3CU7A 4A3ZA 1W90A 3MIFA 5BNPB 2NYYA 1NA1C 1RUI2 4XACA 5A3OA 3WDXA 5LA1A 3VHOA 1HLCA 1B35B 1PMIA 4W50A 2HWD1 3NV2A 5DAVA 2WNUA 2QBXA 5HPOA 4XF0A 1OA3A 1TQ5A 5FP7A 5FZIA 4GB33 1DBNA 2FCUA 3N9NA 5EIYB 2X5IA 2X8KA 1K5MA 5H9RA 3POGA 4ZU5A 1VBE3 1RUG1 2VW2A 2YFUA 4UT5A 3PVOA 2DTYA 2LUWA 4LBMA 2JDUA 1CGPA 5FZ1A 4BH9A 4WVVA 3CJXA 1IQDC 1AL23 2W9XA 4OI4A 1FOD2 1CAUA 1OT5A 3OGVA 5FZBA 4BMBA 5HI0A 3JQWA 3ECQA 1MPXA 3HQXA 4PDWA 4B4PA 2BEOA 2Q8DA 4E9KA 3N4MA 2BFUL 1YQCA 2WSUA 3Q8FA 2GNBA 1XE8A 4KU7A 5DAPA 5GZEA 2Z42A 5D2AA 3N7KA 5FY7A 3J7NA 3RWNA 1RUI1 2J1SA 3ZFEA 4MGIE 4BQ3A 4XE9A 3VKNA 4OHZA 2HWD3 2JIJA 3AKSA 1X9TA 1QU0A 4K1YA 1HIXA 3O1VA 1AXYA 2FMYA 4XDQA 5FQ0A 4AHYA 3C7HA 1SQ4A 3FFQA 4AFBA 3L9JT 5C8CB 1GOFA 3B5LB 3IBMA 1C3HA 5ISLA 1RUG3 3AK0A 4MSVA 5CYYA 2AACA 3TEZA 4JV4A 2XJRA 3H7YA 2IC1A 3PVNA 1L3JA 1HJFA 2ORXA 2P37A 3VUOA 2LALA 1AX1A 4CXXA 1FOD1 3FLRA 1UOJA 1MQTB 2HWB2 3GBWA 3KQRA 4FTBA 3KVAA 2WNUC 2OZJA 2OW4A 1XRUA 1ZNPA 4ORFA 3U0ZA 3T0DA 1RUI3 3I3QA 3GF6A 2X5IC 2ZEXA 4XQWA 1K5MC 2W1QA 4URAA 1H6YA 1TG7A 4XUQA 3E6BA 4IESA 2D5HA 5CG8A 2D5FA 1RHI3 1V6JA 2D40A 4EV0A 2BP6A 1N1TA 3KD4A 4QDSA 1O7FA 5D8AB 3T4VA 1GFF2 1LKNA 4MGTA 4YNIA 1W8NA 4NUBA 4IEWA 4FXKB 1H8TA 2WQ4A 1O6UA 1NT0A 4P5YA 1LHOA 2E9QA 1WW7A 3I3EA 3J4UH 3GXUA 4PDWC 4PT6A 4A42A 1H2NA 1H2KA 4LKEA 4PBPA 4Y26A 5F37A 2VH9A 1LEDA 4LBQB 4GMP0 3U78A 4NRQA 1FOD3 3ZFEC 4JGZB 3DKQA 2E6VA 4ZZ8A 4P9JA 1ULOA 5F3CA 4N7IA 2HWB1 5FZEA 3UV9A 3MGUA 5IAVA 4IW3A 3NW4A 3VBUB 3A4UA 2VM9A 2Y34A 3D5OA 4B4RA 5A3UA 1O91A 5L7OA 2VBDA 2GNTA 2W3JA 5JOZA 2EA7A 2XJQA 3OGSA 4MZUA 1RTVA 1REDA 2ZS6B 1TME3 1A3KA 5EJZB 4DY5A 5IAXA 2G1MA 2GALA 2GSYA 1ZRCA 4GWNA 2VUAA 4QPGB 2WO7A 1UW8A 2JECA 4QXHA 5D1IA 3I2JA 4CDUB 2YUEA 4F3JA 3WF4A 4LBQA 5T3NA 4P14A 2IXHA 4BYYA 2W52A 3HWJA 3VBRA 3GCWA 5FZAA 3U4XA 1IS6A 4IQPA 1GR3A 1UZYA 2VTFA 1N1VA 4Y20A 3KGZA 4AI0A 2VMHA 5F7UA 1XE7A 1Z7S2 4YG0A 2LW8A 3TBDA 3BU0A 2HWB3 1B09A 3O7OA 4QQHA 1U5XA 5EFUA 5A80A 4FPEA 3R05A 5A6XA 2ATFA 4CP2A 2YBSA 4HSLA 1ZM1A 4I3PA 1H8TC 3ELNA 4DRRA 3I2KA 3JB4C 4D94A 4X8PA 2R16A 4QPGA 4IETA 2C24A 4CDUA 1WMXA 1DYPA 1ODMA 4IERA 3MV01 5A6QA 2DDUA 1W6QB 2VUDA 3I2OA 1S0IA 2WO1A 5EJ3A 1W9FA 4BQYA 2PMWB 2G9GA 3TNQA 1W39A 3FJSA 5FTTC 1WLWA 2W0XA 4UXAA 3RYKA 4BQ1A 4BWOA 1WW6A 1F4AA 2GC0A 5AC92 2FDKA 2XONA 5FZCA 2WAOA 3U4SA 5L7OC 1ST8A 2CL2A 2X05A 5EZWA 1Z7S1 3RZZA 3JUUA 4RQPA 2HWE2 4OQ9A 2XLFA 2GNMA 5BNOA 1ZREA 3N3HA 3A21A 1JYNA 2A6VA 5C9AA 2J42A 4YG6A 3HVDA 1ZZBA 1YLLA 2KR2A 3RMYA 4UF0B 3NKGA 3D8CA 4BE3A 3LA7A 5A33B 2F4PA 5B2GB 1H30A 4L92A 4D69A 3IPVB 1XNAA 1OXCA 4CEYA 1P8JA 3NNMA 4IEXA 3VBRC 4XJUA 4GJYA 4YVSA 2QDRA 4NHLA 1DGRN 3C3VA 1JYXA 1YFXA 5FYIA 5C3PA 2WDBA 5H9PA 1RVF2 3A7QA 1FNYA 3DEMA 3CL1A 3OYWA 4P5HA 3A0NA 1V00A 3LKJA 1NLSA 3WP6A 2LROA 3VL9A 3MIDA 4AE2A 3DYMA 1U0AA 4BQ5A 2GP3A 2VMIA 3VDCA 5AC91 5IVYA 3T1MA 5FDBA 2YYOA 4RFRB 1HRI2 2NMNA 3MUY1 4JTNA 1JXNA 4LE4A 4TSVA 2D98A 1PZ8A 2HWE1 1OI6A 4K3UA 4Y24A 4FTEA 5FMOL 2WT0A 1GQPA 3HN3A 4N43A 4FOYA 4FOQA 3VZNA 4QKFA 1HN1A 3BALA 2XXZA 2V73A 4BLIA 1QXPA 3IPVA 2GC1A 4JAAA 4LHKA 1VBB3 2LS6A 3WDYA 1QJX3 5FOBB 3F95A 2V5YA 4X8NA 2RHPA 4YW6A 1RUD2 2D6LX 5T5PA 5JMCA 3JU9A 4XABA 5FJKA 2XVLA 5FZ4A 1R092 1UYYA 1RMU3 1ZBE3 2Q4SA 4O61A 2Q1MA 4G4FA 4QDQA 5FYCA 1CD3G 1RVF1 5CKMA 1A8DA 3R4UA 4AI9A 4RQPC 2OUHA 2Y0OA 3AVRA 3NAPA 5A3WA 3ZXKA 1PVC2 5BNOC 2VJXA 3V0AB 4KBZA 3N36A 1W8HA 2ZGSA 5C9AC 5L19A 4CUAA 4Z2AA 2QE3A 3BIWE 2HWF3 4Q1RA 1HRI1 3HMYA 4NHKA 4XETA 2DVFA 2HWE3 5BUVA 4IE6A 1OVPA 4SLIA 2RR13 5CFDB 2WZR2 1OLRA 5FYSA 1LESA 4CEYC 4W8JA 5LW9A 3MBWA 3MV11 4Q2FA 3KF3A 5FZ7A 4YVSC 3USUA 5DUWA 1DQ5A 2CV6A 4XIKA 1QQP3 3IM0A 3KVBA 4UFKA 1AR62 3ATGA 3VBSA 5HCFA 1IKPA 3RSJA 3VB9A 1UYZA 1RUD1 4AL9A 3MIBA 4FOVA 2DWRA 3ZYPA 2BWCA 1R091 2W39A 4RR3B 2HLEA 5GZFA 3O14A 5FPUA 3ST7A 3CBNA 4Y22B 3AYCA 1SDWA 1WBLA 3G7DA 3HR9A 2CDPA 1PVC1 3S7EA 4N43C 4CCOA 1ZZ8A 4IEUA 4FPJA 3VL8A 1AF9A 1NLQA 1UKGA 4KU8A 1W3VA 3R4SA 1UD1A 2VL4A 5I0SA 1HRI3 5JSRA 1POV0 4Q5OA 5FZGA 1GANA 2JIGA 4C0BA 2XBO2 2WZR1 3WD5A 1NZCA 1QF3A 4E8CA 1EUUA 4MGSA 5JIUA 3VDAA 1ULEA 5KHJA 3TB0A 4HXCA 4FSJA 2QQNA 3VBHC 4Y1YA 3WINE 5A7PA 3O1TA 1UO9A 1AR61 1WUVA 2WS92 2DF7A 4GXLA 2WINB 3N9LA 1F5JA 2EAAA 3NAPC 5FXVA 2ZGOA 1O3SA 4RHV2 3UGGA 5EXOA 4L9BA 2B8MA 2BZDA 1R093 3ZXAC 4IXLA 1W6MA 3GDBA 5FZMA 4UFIA 3DXUA 1WW4A 1AL0G 3ACGA 3ME2A 2JDYA 2UURA 3NV4A 4CEWB 1PVC3 4YVWA 3H1WA 3DF0A 5BNNB 4NAMA 2D6KA 3MO4A 5J1XA 1S0JA 4XDOA 3NVCA 5FKBA 5FY9A 2G4IA 2VOWA 4QQOA 4YGEA 2ZGKA 3WVJA 2IVIB 4Q8LA 2Q1FA 2VY0A 2XBO1 3VBSC 2WZR3 3ZN6A 1D2SA 4CRQA 3UK9A 1W99A 3EQEA 3ZXGA 3ACHA 3MZHA 4QQ2A 2DYCA 1UMHA 2VZOA 3E5XA 3PDQA 1JZ7A 3JCIA 3N9QA 5FPZA 1MVQA 3ES1A 2LTNA 4HK9A 2Q8OA 1AR63 1ZRIA 5GLTA 4CDWB 2RG4A 2WS91 2YBPA 2ZHKA 4ISRA 4CU6A 1JH5A 3WOGA 1GWMA 1KJRA 5H9SA 4QX1A 4KWLA 4RHV1 3WV6A 1VP6A 3J8F2 4JRLA 1SCSA 4AQSA 4OI1A 2ZACA 2QQKA 4D0QA 5CU1A 5CIRA 4AOCA 4YPJA 2RDSA 1YFUA 4Y33A 3WF2A 3OGJA 2SLIA 3R6SA 3URFA 1R64A 1OQDA 1PGSA 2E33A 5I0TA 4JKKA 3PJYA 4QB2A 3PIGA 2VZRA 4YW5A 2VZ1A 1QXRA 1ZZ9A 1D4M2 1I5PA 2XBO3 5JMOA 2VNGA 3AP9A 5DZEA 1XNTA 3PU3A 5T54A 3H1YA 3DECA 4JZRA 3BTXA 1JYIA 4LITA 2WLPA 3VDBA 4YZ4A 2BV4A 1ULGA 1CZSA 5LBBA 1AYN2 3ZSJA 1H1AA 3LSDA 2TUNA 4IV1C 5ERLA 1MZ5A 1C8M2 3GHNA 4PJYA 4L2NA 4GZ9A 5J96B 2GMMA 4RHV3 4YVWC 1FMD3 1F9KA 1PZ7A 3J8F1 2C5DA 2PHFA 3ASIA 3K4AA 4GALA 5EPAA 3KM5A 5JR7B 4AAPA 5FO9B 4PQ9A 1H6XA 1JZ8A 4IUGA 2W94A 1FPN2 5KHIA 3B3QE 3EB7A 3VBFA 2UYBA 2JXAA 1T2XA 2VZPA 4CDXB 2FMDA 3ZIXA 2Y6HA 2RDQA 2BNOA 5LRRA 3T2TA 1WLDA 1D4M1 3I4IA 3KWVA 4N7UA 4YZ5A 5A3MA 2X53S 2JDMA 1GP6A 2OPWA 1ULFA 4FQ4A 2XHKA 1QHDA 1UX6A 2CHHA 2WAAA 2VMDA 1AYN1 2MEV2 5F3EA 3H8RA 5FXXA 5A3PA 3M70A 1GMMA 2PHUA 3H3ZA 4MUVA 4CCMA 4XUPA 1C8M1 3ZSMA 3BU7A 3CJIA 4E2QA 5JOWA 1HXS2 4Q27A 3J8F3 3MLLA 4QKDA 2WYSA 4YFWA 1EPZA 5DUXA 4QGLA 4UI9L 1TEIA 3DCQA 4IEZA 5DUUA 3WDWA 1GICA 2AC1A 3HIFA 4LBQD 3VKMA 5A3LA 3EXUA 5IFPA 1FPN1 4CE8A 4QQLA 5JUVA 4Y1XA 3S57A 2R042 4R8HA 1YHFA 4YM1A 4JGYA 2XH6A 2CSGA 4GKYA 3WQBA 1EYBA 1L7QA 5EWSA 1CIWA 1DGWX 1KFXL 2JE9A 1WCSA 2EIGA 3LEKA 2B9UA 3NSTA 1C8NA 1AYN3 4JQRA 2MEV1 2VZ3A 3GHMA 5C33A 2W5FA 2PFWA 1C8M3 3POJA 3THPA 3I59A 4Z82A 3TWIA 1HXS1 5T55A 3RYPA 4ASLA 4GIQA 3WLUA 3Q8BA 2XPJA 2EAKA 2RS52 4HFSA 3VBFC 5LK5A 1W04A 1JHNA 4FPYA 1F2NA 4OI0A 5HXMA 2WLQA 3K75B 3CHXA 1UMZA 1CESA 1Q56A 1PMHX 4EWAA 2D44A 3WNOA 2WO2A 1FPN3 3MICA 3O5SA 4XCBA 2DVAA 3ZKUA 4B7EA 1C28A 4GA9A 5FLJA 4KG0A 4X6QB 2VZVA 3RGBA 1LENA 1SLAA 4KWJA 5A7QA 1O5UA 1VRH1 4XQDA 2R041 2VMEA 4TLGA 3PNAA 5HCBA 3E5QA 3WNPA 4A6SA 1F4HA 1VBC2 3CJIC 4DY3A 1VALA 4DXRA 4FBFA 4MG2A 4DIQA 1TVGA 4QMAA 4CP9A 2QZ3A 1W6OA 3X29B 5KXEA 2KD7A 4LUMA 4LKFA 1XJAA 5I0DA 5LCWL 3UNPA 4XCAA 4MVTA 4XOGA 4G3YC 2UY9A 1HXS3 2GMEA 2CWSA 4YRDA 5FZ0A 4XYXA 2GH2A 3LA3A 2JG8B 2RS51 5FFOC 3V0BA 1YCIA 3VD4A 1Y43B 2HYXA 1UF2C 1H0BA 1Z0HA 4DFSA 1E57A 2VVEA 5FR3A 5FO8B 1RITA 5FMCA 3BIEA 4OULA 5FUPA 2BU9A 4JGYC 3I54A 4PQQA 3EBRA 3ZYIB 3MEPA 1ZYBA 4GMP1 1Y3TA 1Y7BA 4AEMA 3QOPA 4NPMA 2JB8A 4KMQA 1V70A 1VRH3 2HWC2 4HL0A 4XF3A 3T2QA 3Q8EA 1DQ1A 1SLBA 2QTWB 2JG9A 3EJKA 4XFAA 3T2PA 3UESA 1DQ4A 2WC2A 1VBC1 3O0WA 5CADA 2RDRA 5FPXA 5FLIA 4OVEA 1PM4A 5FRAA 3AKQA 1PGW2 3BTZA 5A6YA 2FCTA 2UU8A 3MLKA 3MIGA 2Y8KA 3TYJA 3FUOA 5CNAA 3TN92 3TRSB 1ULCA 3KV5A 1DG6A 1BVP1 1SLIA 4AVTA 1D0GA 4H14A 5CB7A 2B46X 2RS53 3SEPA 1JMUB 4D6QA 1AXZA 2GP5A 4FPFA 3RNSA 3AYDA 5FWEA 2P3JA 3KQ4B 1WA4A 2PLV2 2WA4A 5DAQA 1Y9QA 5CZKA 3QACA 3CNAA 3SITA 3VHRA 2Z5WA 1S0DA 2YROA 2UWBA 4GMP3 2GN7A 4QU2A 3OBRA 5JSPA 1BKZA 1WD4A 1QH6A 5FAXA 3AL6A 4UW6A 1REFA 3DKWA 1UOGA 1CAXB 2HWC1 5C5UA 4LLOA 2VG9A 4LLFA 1TMF2 4JHTA 4NN0A 3ZFGA 3EMRA 2DUPA 4JDNA 3AP4A 2K9ZA 1W28A 1VBC3 2BRTA 2VOKA 3VBHA 4B7KA 1AX0A 2O14A 3WNLA 2YPJA 3VZJA 1WKYA 1QH7A 2B39A 1PGW1 4FPCA 5IK8A 2WN3A 4MGQA 4AG4A 3IDAA 3KLSA 4Y5TA 3TN91 4PHZA 2GZWA 3NL1A 1DQ2A 1ULDA 3M3IA 3CDZB 1N3QA 1GYKA 1S0FA 2QFEA 5FYTA 4XFFA 2YMZA 2DV9A 3HBZA 4GAZA 2A6XA 2PLV1 1X8EA 3LIHA 5FK7A 2JG9C 3D4KA 5FUNA 1LU2A 3KCXA 3SH5A 1NY72 1S55A 2YG0A 3VLBB 2WNVA 4NAOA 2MNGA 5FZHA 2FDIA 2QQUA 1W8ZA 2BFUS 4QT6A 2HWC3 1JI6A 4YWAA 1QOTA 2W92A 3WNNA 4AAXA 4N53B 4RGGA 1TMF1 4QKBA 4ZY9A 3J7MA 5B4NA 3H8OA 2A73B 2P2KA 4HKWA 2ZAHA 4P9LA 2DBNA 4GD4A 3HN1A 1FYUA 5C3OA 2EF6A 3THTA 4D3WA 2H6CA 2FDHA 4AEDA 4WZFA 5FY8A 3TN93 2GAUA 4G9SB 2FDGA 3T09A 1UIKA 3DPRB 4QM9A 3VD5A 4L8QA 2EIEA 2XJUA 2ZEWA 3PMEA 5ABJB 5F2SA 1CVNA 3BODA 3I2IA 1A8MA 4BA6A 1N1SA 2ZGQA 3U10A 3ZFGC 1SHWB 5FY4A 1NY71 4AR2A 5J48A 2ZHMA 4Q0VA 1W06A 5L9VA 4LK6A 4BCUA 1VMJA 3SC7X 4QX7A 4S2FA 3MPPG 1X33A 4DMIA 1TMF3 1VRBA 2VZUA 2HEWF 4FAHA 2XR4A 2W46A 4BQWA 1QY4A 3W5MA 3BB6A 2ERFA 1N1YA 1SZBA 2WFF2 1GNYA 1PIV2 2WKKA 1LOEA 4ITCA 3T30A 4XURA 1IPSA 1ZX5A 2ZKNA 2D3PA 1RUNA 1CAWA 1UKRA 1OFNA 3KB5A 2VXJA 3OPZA 4C91A 5BNPA 1F31A 1SLCA 2XLAA 4C1WA 3FFZA 1W03A 1B35A 1WMFA 2WNVC 1MS9A 3HQRA 2JE7A 2E7AA 4CZSA 3AYEA 1X9PA 4EZ4A 1UYPA 3RRDA 1LGNA 4DNYA 2BGOA 3IZOA 3OUHA 4AVAA 4XAAA 5F5AA 1DQ0A 3PMSA 1TE1B 2VCAA 1Q8PA 4H3WA 5DN2A 5DABA 2RDNA 3H3UA 2FZ1A 3APBA 3I49A 1NZIA 2ZA9A 4AI2A 1XB9A 5E89A 2A7AA 1Y9GA 3WNMA 5FK8A 3H50A 4ZHNA 1G8WA 4AEDC 1XPWA 4C0HA 3RVHA 1RUC2 1NQJA 3RZLA 2WIIB 1OBNA 5CA6A 3NWKA 2WFF1 3HOBA 4TZDA 1PIV1 2YC2A 5J09A 5FZLA 1EV12 5CG9A 4CA9A 3ZDSA 4DS0A 2VO5A 1V6OA 1IHMA 2VTXA 4PBOA 3KZ4C 3SCGA 1OA4A 3U75A 3OF1A 2Y6KA 4U36A 2PQSA 3F2ZA 2CDOA 3POIA 5HBAA 2CGPA 4M3CB 2Y6FA 3HBKA 2P3YA 4XIOA 4P9IA 3UGHA 1RL3A 1UCXA 2EIDA 4QXCA 3ILRA 5C8CA 4R4XA 3OBAA 5L73A 4AVVA 2JD9A 2A5ZA 3FC0A 4PIYA 5FYZA 2P3IA 4L97A 4N90A 4NWVA 4NRPA 5FCCA 3PUHA 4LO6B 1J83A 1LULA 1NLRA 3NJXA 1RUC1 4JCKA 1JS9A 3IMMA 4XILA 5BNPC 3ZLIA 5FV3A 2YHJA 3H42B 2WFF3 1B35C 4BQ4A 1RIRA 1PIV3 1MQTA 3QCWA 2DTWA 5A3NA 5C6CA 2QQLA 2YXSA 3NNFA 3WP3A 4BQ2A 3TEWA 2W68A 1EV11 3ACFA 3AKTA 1QJFA 1OUXA 3KCCA 4EJRA 4H7MA 4ONUA 4ARYA 1GZ9A 1SFPA 4M4PA 1QDCA 5FPAA 4CPBA 1GU3A 2IXCA 1LOCA 2FDJA 1HQWA 2YC4A 2QZ2A 5D8AA 5FY0A 1UIJA 2XVKA 3SNMA 1KD7A 2KM2A 4JTOA 4QWNA 3UKVA 2XMLA 5DZFA 4EN7B 3FX3A 1QWRA 2WWJA 3POSA 2G19A 3RI8A 4BOWA 1MVEA 3GM8A 5JDBA 1URXA 3NKTA 4BDVB 4DXTA 2OUJA 2YDEA 1GOGA 1BXHA 2A71A 2DURA 4EROA 1JOJA 1UN1A 2WUHA 3QD6A 4JGZA 5FXWA 3WUDA 1MS8A 3MYXA 1EV13 2DCTA 1YFWA 2UY8A 3SEEA 3VBUA 2BERA 4O7XA 1UNBA 1NG0A 1VIWB 1O3TA 1BK0A 1LHUA 3LOIA 5C8CC 2Y6LA 1UOFA 1YC61 3DYOA 3PUAA 5L9RA 1LU1A 2OA2A 5CISA 2WZEA 4OUSA 1LCLA 2ADEA 2MPFA 2VW1A 1XYNA 2ZGPA 2DBIA 3H3LA 3KF5A 3LGRA 5AVPA 5LBFA 5J36A 4Q0SA 1GNZA 4Y1ZA 4A2UA 2YU2A 2HH9A 2P3KA 4LOTA 5F5IA 4UW5A 4XC9A 3RQ0A 2D3SA 5FMOS 4LE3A 1Q8QA 1UY3A 1MQTC 1ZZ6A 3EYPA 4MGYE 4K9SA 1RJ8A 3K77A 3M3OA 4QAWA 3LWCA 4IGPA 2MHFA 2RMU2 3ZPYA 3WF3A 1ENXA 1PX3A 4QX8A 4LHSA 2L9LA 3TEXA 4LO7A 4H2AA 3M8LA 5D8AC 1UU6A 4XF4A 5G04L 1W2UA 4NVPA 4MGKE 5FJHA 2Y64A 2J1AA 5G05L 4AVBA 2QQIA 2G9FA 5JPMB 4R52A 5C5TA 2PAMA 1SEFA 4HETA 1OF4A 3VZLA 4SBVA 3T1LA 1CAVB 2ETEA 1X50A 5F2WA 5FLHA 4CCDA 3KS7A 1IG0A 4UWDA 4LXLA 3SCHA 3CEWA 1UZWA 2FHRA 3SKVA 3VDDB 1W6QA 5FPVA 2PHXA 3LD8A 3KT4A 4QU1A 4JGZC 3RFRA 5FZDA 3VBOB 2VCBA 4ZS2A 5IATA 1PGL2 4WV8A 3VBUC 5FPBA 2RMU1 3POFA 4LOSA 5F3IA 2IFWA 1J1TA 2NP0A 1CWPA 2XJSA 4AQ2A 3HT2A 4NO4A 1E5SA 4IE4A 3WG4A 3J7HA 4XF1A 2VNOA 3IDCB 3N7MA 1Z7S3 3ZVXA 4UBGA 3VN4A 4ZU4A 2GC2A 2VGDA 5GLUA 5KXDA 2FQPA 4QPGC 2J1RA 3ZYBA 4UF0A 3VZOA 4A7KA 1XXNA 1X36A 5A33A 4CDUC 3AZZA 5CKQA 2BDRA 1LHWA 4HT1T 4CDQB 3D6EA 3O0VA 4COVA 5BV6A 5E16A 2H0BA 1XNDA 1AZDA 1BYHA 3IB3A 1F35A 5EQUA 1UOBA 4C8DA 1JZ2A 1YNAA 4OHVA 5KHGA 3WQ0A 1X82A 2OT7A 2ZMLA 4HPKB 3OGGA 3ZFFB 1T6BX 3GZEA 4COUA 1PGL1 4HOOA 1W6NB 3GALA 3WG2A 4BHPA 1H1IA 1QDOA 4HSJA 4FI9A 2RMU3 3LZZA 1UY4A 3AXEA 4UW3A 3NJVA 4WVWA 5AC93 3HQUA 4AEJA 5KR7A 3ZYRA 3AZXA 1OSGA 5IWFA 3ZMNA 4N8MA 1DZQA 1YJLA 2WFPA 4BXSV 3D0JA 3AYAA 4GWJA 3WY6A 2N7GA 4CDQA 4YW1A 4KI5M 2PQQA 3LEGA 1LGCA 1XSRA 5TSWA 5C4WB 1EY2A 2OXBA 1S2EA 3VKLA 3VGIA 4PIZA 4AW7A 4TYSA 4DRVA 1QOOA 3VHPA 3K48A 4V2WA 5A32B 2ZZQA 4FP3A 2XKOA 1Q43A 4R9DA 1UY2A 1GWLA 1WWYA 2WZPP 1FV3A 1VB4A 1JOBA 4XEZA 4Q0UA 3V0AA 1RVF3 1GZTA 5JAXA 1UZVA 1X7NA 5F6LB 3M3CA 4NIAA 4PCRA 1OC1A 5JZGB 3LFIA 2Z4FA 3IDBB 2BOIA 1NCQB 1DZTA 1LOFA 2F4LA 1V6LA 5CFDA 4DPNA 1WLCA 4GKXA 2ET7A 4P9YA 4AWDA 3G6JB 4PI2A 5ACA2 4QX3A 3CQOA 4AEKA 4HONA 3ZDVA 2GH8A 5I8SA 2PN5A 5J7MA 1E5RA 3PHMA 4PLOA 4QPIB 1U5IA 5FYMA 4IE7A 2ZBJA 2NPIA 2VR4A 3B9IA 2UWCA 3POWA 3T08A 1VMFA 3RWKX 4W6YA 4RR3A 1QMJA 4RL7A 1DGLA 4Z07A 4F7ZA 1LRHA 1RUD3 4DB5A 1UY0A 4Y22A 4WVMB 1ND3B 3RG0A 5JZGA 3HNBM 3M3EA 4FAGA 3SHRA 3C2UA 2XGXA 1J3QA 4K6BA 3WHUA 1QJY2 4JC1A 2UYAA 2VECA 1HN0A 3WNKA 4AYUA 2BNNA 1FAYA 2E51A 4KL1A 4RGKA 3ABZA 1YQ2A 5LZ6A 1DLCA 1GLHA 2H6BA 5LATA 5I91A 2J1EA 2VTXJ 1IS3A 1MZEA 2ZX4A 4X6RB 5JIAA 1RC6A 2V5DA 4IEYA 4KG8A 1W8UA 4YGCA 5C7GA 1ZVFA 5ACA1 4A7ZA 1BHGA 1KITA 3AP7A 1JZ3A 2I07B 1UMIA 4YSFA 5FPLA 1XC6A 2VC9A 3BVCA 4QPYA 3ZSKA 1JBCA 5CAZA 2E31A 2TBVA 2CY6A 2KA3A 4LIUA 3WSOA 3FE5A 2ZAAA 1ALYA 1BLZA 1PMJX 1IKQA 1LTEA 1WCUA 4QX2A 1OOPB 5ANNA 4QB6A 4AHZA 1LEMA 4WVMA 5BYNA 1HRV2 3TNPB 4FO9A 4E4DX 5FZ3A 3FBYA 3KSCA 1W9TA 4INDA 2AEZA 3C7FA 4YZ3A 4BQXA 3WCRA 1X8MA 2OPKA 2BBAA 4CEWA 1ZRDA 2R062 1LOFC 4AVCA 5CFDC 5BNNA 5KBFA 3LDBA 1QJY1 2J7MA 1CIYA 1C4RA 2YB7A 3B69A 3OY8B 1HQNA 3B7MA 3WW2A 5JWPA 3HEIA 4XFIA 4TTGA 2HEVF 2ZABA 1GBGA 4ET7A 4RA0A 3AFKA 4J1WA 3MW2A 4GWMA 1VBD2 2ZPXA 5ANQA 2PHTA 1KFUL 3H9AA 5FP8A 3WDVA 3AP6A 1EAH2 4RS5B 4LPLA 5FP4A 4XJWA 1JU3A 4RR3C 1QOSA 3VZMA 2CAUA 1GSLA 4CDWA 1SLLA 2IXIA 1OOPA 1R082 1J3RA 2DVDA 3KHBA 1AUYA 4CCNA 2R30A 4KBBA 1CR7A 1DU3D 3OB8A 3IDEA 4MGZE 4CU7A 5IFTA 1OH4A 2R0FA 2WS93 4XBLA 4CCLA 3E6CC 1HRV1 3WW4A 3J7LA 4OHWA 4Y4YA 1BCXA 1W9YA 3AZVA 5F6KA 4XVHA 1GV9A 5SV8A 1K42A 1MACA 4MXVA 5GZCA 1ZBA2 2JKXA 2R061 2BVVA 4XJZA 1PO12 5FXZA 4COZA 4PLMA 2CU5A 3SLIA 2Y6JA 3DN7A 5IVJA 5KXCA 3ZM8A 1ULPA 4YW4A 3T3YA 2O8QA 1F5FA 4W65A 5FOJB 1BEV2 4HKOA 2WT1A 3GNEA 5FREA 4HN0A 3ZR5A 1VBD1 3BYWA 4META 1I6XA 4LBNA 4AHXA 2XQXA 4XFCA 1EAH1 1W6PB 1J59A 3WP5A 2YGMA 4XFGA 4NWWA 5K9YA 4CPBD 2C26A 1HV1A 5FP3A 4Z2WA 1R081 5LK7B 4W6XA 3BN6A 5APAA 1AR92 2YV8A 3AMNA 4OUMA 4P9GA 4YGBA 3AJZA 4CEWC 1BBT2 5BNNC 1HRV3 1CN1A 1CJDA 3WW3A 4NE9A 5IVVA 2VMFA 3FHAA 1C57A 4WM7B 1JYVA 1APNA 4MXWB 4BB3A 2R063 1ZBA1 4FVVA 1CZTA 3B01A 1PO11 3R4DB 5FY5A 1PX4A 4NIIA 5JCTA 2H0VA 3LA2A 2RVAA 2BGPA 2XL9A 4Y4RA 2QVSB 4CDXA 3SKJE 2JDZA 3AB0A 4CSWA 1Q8SA 1LHNA 4MADA 1BEV1 4CDWC 1IPKA 1OOPC 4S2GA 3HPNA 1PK6B 4MOAA 1YIFA 3AFGA 3PU8A 5A1LA 2EALA 1D4M3 1EAH3 4PF5A 2VQTA 1Y9MA 3ZYGA 4I0AA 5A3TA 3OCPA 1BVVA 4JRAA 4RYDA 5GJ6A 4IV3B 4R9CA 1NQDA 1LHVA 1XQNA 2BGCA 2E7TA 4LR4A 3E5UA 1IOAA 5LA9A 5FIXA 5FBJA 2JDPA 3BPZA 5A7WB 2Q0AA 1AR91 4LO5B 2VOXA 4FPLA 1BBT1 1SBEA 1OQ1A 1CONA 3PL0A 3D0SA 5A7SA 2XOMA 3HJRA 3MFCA 1Z78A 3POYA 4I0BA 4IL7A 4U2AA 4COYA 2ID4A 4BJ0A 5IVFA 2WQZC 3E1F1 3WNXA 1RUE2 2FCVA 2R072 1E5IA 2ZCWA 4Q26A 1ZBA3 5BXXA 3RI9A 4BK5A 5JOYA 1PO13 4QHOA 2V4AA 3WX5A 4QKNA 3BKZA 2VZQA 2JE8A 5GLWA 2ET1A 3KGLA 2TEPA 2VU9A 3M7AA 3V56A 4M00A 3LFMA 1BEV3 1Q8VA 3AX4A 4JQTA 2ORZA 2XWJB 1COV2 4QX5A 4ZONA 5K0UB 1ND2B 3RJ2X 1UWWA 2HKXA 2VE1A 1NCRB 3Q9OA 4XZUG 4LHLA 3ZXJA 5HXVA 5JLVA 1V6MA 2YBKA 3ILFA 3SH3A 5A7WA 3ZYFA 3OJBA 4LBLA 3TEYA 2XJPA 3WDUA 1OPOA 4PI0A 3C7EA 4R4ZA 2R7EB 5C3QA 4OLLA 3SMHA 2MEV3 4M3CE 2JJ6A 4GH4B 3POBA 3BUCA 1ONAA 4EZHA 2YGLA 5DUVA 4AFDA 1GKBA 3SQOA 5L9BA 4CDXC 2DCJA 3KT7A 4LO4B 2ZOEB 3ZPOA 1G9AA 1RUE1 2R071 2JEMA 1IZ3A 1G6NA 4XBQA 4YW2A 1MR5A 3IKWA 4CVUA 2QDNA 5FWJA 1NX9A 4NOTA 4CCKA 4XUOA 1GUIA 3ZO0B 5F1RA 3CMGA 1V6KA 1FV2A 2R49A 1YYNA 5AFBA 3BI3A 2B45X 2DFCA 1COV1 3AMMA 4OMCA 4AFMA 2BYVE 2V4VA 2R043 3KV9A 3N35A 4W4ZA 2DU0A 1XSQA 1SCRA 3O1SA 1XOYA 4XMIA 4XHBA 3K46A 3LSEA 1XNKA 4I09A 4GH4A 2DCKA 4YGDA 2VD7A 3GJAA 3OEBA 3IAPA 3MIEA 4UAPA 4S2DA 5FZ9A 3V65A 3ON7A 3TOJA 1V6IA 5E6HA 2WL1A 3PVBB 1OHFA 2Q8EA 1PO22 2JG8A 2PHRA 2Y33A 4TXWA 3S30A 2VNVA 3S5QA 3ZXLA 2BUKA 2J1UA 4DUWA 1FNZA 2K2SA 2BBVA 2QQMA 5A1AA 2AEYA 1VPHA 3RZJA 1RUE3 2IZWA 4P9XA 2R073 2IVJA 3AKPA 4M4RA 3A22A 1J1LA 3K4ZA 3MIHA 1IPJA 5FZOB 3WQ1A 1XE0A 1NA1B 1DF0A 1OA2A 2JWPA 3LQCA 2YFZA 1OKQA 4CUGA 5FZFA 4B8EA 1EPWA 1COV3 4ZXKA 3J9SA 1LAJA 2JX9A 5HV4A 1US2A 1OLMA 3LE0A 1SMVA 1AJKA 1S0EA 4Q4V2 3MI8A 4Z1VA 3GJBA 5DAXA 2VQUA 2VQAA 1SPPB 1H4GA 3L2YA 4GQ7A 4XQ4A 3VD7A 4EN9B 4CTEA 1AHSA 1PO21 4EQVA 1UX7A 1IS4A 3U14A 1GP5A 2JENA 2AREA 4EWEA 4HKLA 4F8AA 2Q5TA 2PHLA 2VQ0A 5C8WA 5KXBA 4S2HA 1C5IA 2C1FA 4FT8A 3MFAA 4FFGA 4DOUA 4I0WB 2PAEA 2ZHLA 2GMPA 4NHYA 1S4CA 1CAXA 5EV7A 1BJQA 3I2GA 4LTAA 3ZR6A 5BY5A 1F8VA 4GH4C 3O0XA 1O4ZA 3OSDA 3PUQA 4J1XA 4NR1A 3CF6E 3FL7A 3MW3A 4A4AA 5T5LA 4YZ1A 1WLTA 4J25A 1WBFA 3UKNA 1G9DA 1CX1A 1TZOA 1Y4WA 1GZWB 2JG8C 2QQJA 4LKSA 2DCYA 3AP5A 1MS0A 4Q4V1 2W47A 1JU4A 4LEJA 2W1SA 4UFJA 2WNEA 4XJ8A 5FZ6A 3CKHA 5T50A 2OQ7A 3ES4A 3R0RA 5K7PA 2VOTA 2D6OX 3IN9A 2VVFA 3KT1A 1PO23 3B93A 4LUKA 3O1OA 3WDTA 4NIGA 3LPGA 2AZ5A 1KJLA 3S7IA 1UYXA 1VE0A 1VAKA 3EHKA 2BWAA 4H7LA 3RYRA 4AQ6A 1C5HA 2PXJA 2ZX0A 5B4XA 4HVRA 2AYHA 4L11A 1JYTA 1H2MA 2WNUB 3OUJA 4M0NA 3AZYA 1W8FA 2O0OA 1RUH2 2PLV3 4FQZA 4RSUA 4CCJA 1J84A 4XXPA 1NXMA 2WN2A 2X5IB 4CU8A 5I0RA 1K5MB 1ZRFA 2D93A 2XJTA 4N53A 5GLVA 4FPOB 1S0GA 4YM3A 2ES3A 5KHHA 5EJ1B 4AGGA 1WMEA 2W1UA 4IDZA 4BIFA 1L7LA 3U07A 1OKOA 5FYYA 2EICA 3SH4A 4Q4V3 1SBFA 5F8PA 1N3OA 4BISA 1CAUB 4E4SA 5JXJA 3WF0A 1U12A 4PDWB 4DUVA 2CGOA 4M3CF 5FBZA 4B4QA 2IXLA 4AGRA 3DPRA 4HBNA 4XXAA 3USSA 1FX5A 1ENRA 3NNGA 4ATFA 1ZZ7A 3C8XA 5ABJA 2GN3A 1RHI2 4A45A 5KC6A 4OUEA 5AVAA 4MHUA 3ZFEB 3N9OA 3DXTA 4K40A 1C1LA 1YI9A 4EN0A 4L99A 1QNWA 3UETA 4E4ZA 5CBLA 4LA3A 4DEQA 5M0TA 3JD72 1RUH1 2PAKA 4BK4A 5FQ0B 3FLTA 1O4TA 5GLZA 2WT2A 2DVBA 1NE6A 2P34A 2R6QA 2RJKA 3HD8B 3H8XA 3I3MA 1I1EA 1IS5A 5T5JA 4A44A 2BNMA 1KXGA 2JKBA 4E27A 4HLTA 4V2VA 3ZYJB 4DUXA 3ZIWA 4BLJA 5FY1A 4ATEA 1LGBA 2XL7A 1DGRA 2HBTA 3ITQA 3ACIA 1XYPA 2LM3A 4UW4A 4ZPIA 5KHKA 1NXD1 4C90A 5E88A 4QX0A 1RYYA 3GZTB 4XJAA 1W3XA 1KDKA 2W91A 1JZ6A 3I2DA 1WMDA 3B00A 2OQ6A 4XTPA 1HDKA 1VMHA 3KV6A 3BTYA 3H7JA 2AR6A 1H9PA 4XMAA 4OHXA 4XUNA 2X29A 4C1XA 5J37A 1RHI1 4XPVA 1CPNA 3AKRA 1TME2 2WQ8A 4N53C 4E4HA 4MHRA 2I45A 2IXJA 2IFRA 2B5HA 3JD71 1MEC2 1RUH3 2GNDA 3LDRA 1V0AA 2ARCA 2PHWA 5DDJ2 2IWGB 1ZRRA 1OMIA 1UQXA 2JB4A 2PELA 5JVVA 1H8TB 3AMHA 2ADDA 4TN7A 1DHKB 4O9GA 3T4HB 4Q1PA 1POQA 4N9HA 1POV1 1HV0A 4OHYA 4OZOA 3FBMA 2PHDA 3DPRC 1RUOA 4CXWA 3OEAA 5CVRA 5ABJC 3ETPA 4PF1A 3AC0A 4P9WA 5C3SA 3RZGA 3U1XA 5IK7A 1W0OA 4HVQA 2DUOA 1HJGA 1V6NA 3DGTA 1N3PA 2WWUA 3MF9A 5D21A 3SISA 5IVCA 1H2LA 2B7YA 3IAQA 5IYYA 5FUIA 3AM2A 4FTSA 1J58A 5C70A 1BMV2 1M4WA 5DXDA 2OX0A 1MZ6A 1PM7A 5L7OB 4YFZA 4IE5A 5LRSA 1TME1 3N9MA 4XFHA 4M3CA 4MH0E 5IHRA 2C9AA 4YM2A 4ZKTB 2NMOA 4KWUA 1DZRA 3I3BA 3O1UA 1BZWA 2D6MA 3JD73 1MEC1 3MDPA 1MS4A 2Y26A 4D7TA 2ZGRA 5DDJ1 5HCAA 5J3UA 1R1A2 1ENSA 2OKXA 4Z92B 4HN1A 1OURA 2XVGA 2WYFA 1POV3 2Z79A 3QLQA 5FYVA 5LASA 3TAYA 1WCKA 3P1IA 1DCSA 3DUIA 3CZJA 2VVDA 3W9AA 3VBRB 1RUC3 3M4FA 4JDOA 2VXRA 1FXZA 4Y20B 2WA3A 4XF9A 1ZA7A 2Z2SB 4YW7A 1PVXA 4NROA 4F83A 3KMHA 3GCXA 2O1QA 3OPWA 2K0GA 1CQ9A 1QKQA 3PUSA 1XNBA 1STMA 1BMV1 1WGPA 4M01A 4XBNA 4UFMA 2C4XA 3ETQA 1XYOA 4V1PA 4BPZA 3CIHA 3O1RA 2CAVA 4CCCA 1AYM2 2B42B 1MEC3 4DO0A 4P02B 2EXJA 3B94A 3HNYM 4AVSA 2VBBA 1FT9A 5DDJ3 1ZZCA 4FCAA 4Z8BA 1R1A1 1HW5A 3IIAA 3HNMA 4Q29A 3DL3A 3OUIA 2PA7A 3ENRA 1FI2A 2XUEA 2V72A 2FD8A 4ES9A 1JYCA 3BOWA 5IT6A 1YO8A 1RUF2 1SLTA 2D6PA 4MYEA 2JD4A 2P6HA 3GBGA 3KV4A 4IEQA 4XZPA 4CP0A 2P5BA 5CKNA 2F6BA 3M3QA 1F15A 1RXGA 1YUDA 2RE9A 3JBG2 3V64A 4RQPB 4Y3OA 2YU1A 4E2GA 5BNOB
chains in the Genus database with same CATH topology
3LB9A 4XTMA 1JUIA 1N47A 3PTYA 5J98B 2XKPA 4E2SA 5C9AB 2SBAA 1VBB2 1RJ7A 4B3NA 1I3HA 1QJX2 4B29A 2ENRA 2IXKA 2D3RA 5IUQA 2CYFA 1Q3EA 4YM0A 1G9CA 4JDMA 1AYM1 2P17A 1YJKA 1RMU2 1ZBE2 5I8YA 4CEYB 4YVSB 1R1A3 4A7YA 4KGQA 2Y38A 5EYXA 3WP4A 2BQPA 1KRIA 2HYKA 2E53A 2ZX2A 5F5QA 2DUQA 3OYWB 3QBQA 4AFCA 1RUF1 4MV2A 2HWF2 2DVGA 1UU4A 2QKDA 2OZ6A 5E8AA 4Y1VA 1GQGA 4K7JA 1RB8G 2ZGNA 1TNRA 1UAIA 1VAMA 2ARXA 2RR12 4DINB 4DXZA 5KWRA 4ISQA 3JBG1 3RDIA 2HJIA 1HQLA 1G9FA 3WHTA 3ZMOA 4IEVA 1OLQA 2OYZA 4N43B 2ZHNA 1QQP2 1VBB1 1H8VA 2W08A 1QJX1 3A0KA 1CAVA 3ZX7A 4Y5Z0 1AYM3 3VDDA 1RMU1 1ZBE1 4YLZA 5T52A 3ACLA 1DDLA 3VBHB 5KC5A 3VBOA 5I0UA 3NJZA 1VAVA 3NAPB 1RUF3 4KH9A 2HWF1 3HAGA 3AZWA 4BM8A 2RR11 4BMEA 3JBG3 3M2MA 5EYYA 2D43A 2XJVA 4Q4W2 4I02A 3FZ3A 3UL2A 1QQP1 4RD7A 1QJU2 3USUB 3W58A 1UZZA 3NO8A 3FHIB 1VJ2A 3WT3A 2EXIA 2BPA2 1SFNA 3VBSB 3QH6A 3WG3A 3ZN4A 5IK4A 2A6WA 2VPVA 4TLFA 3WZ1A 1YFYA 1OFSA 4HPKA 3ZFFA 3H8UA 1W6NA 3W59A 2E63A 1C1FA 4JVAA 5I93A 4YARA 1S2KA 4FPHA 4TWTA 1YRZA 2NM1A 1KDMA 2CNAA 3SXWA 2NN8A 1MZFA 1D4VB 4Q4W1 5L36A 3VDDC 1LOBA 1LOAA 5LEJA 1QJU1 5C4WA 4GULA 2XUMA 5DG2A 4YW3A 1XU2A 4W6WA 3RS6A 3VBOC 4K1ZA 2A3YA 3WW1A 1AX2A 2PYTA 3VKFC 5A32A 1EP0A 3FLPA 1SBDA 4AXOA 4HVOA 5JPNB 1I5ZA 1VBA2 3IT8A 3VHNA 1AR72 1W6MB 4IV1B 4AF9A 2AGSA 3FMGA 1DGWA 3P3NA 4J6GA 1LR5A 3VKOA 1YIPA 3MLJA 2VUJA 4YVWB 1PZ9A 1KS4A 3GBFA 4I01A 1ASJ2 1NCQA 4PIXA 5JOXA 4K20A 2NQYA 2ZX3A 4CDQC 4FPKA 1GNHA 1NOVA 1XNCA 1T6GC 4Q4W3 5T5OA 3ZN6B 1LB2A 2FZ2A 4N9IA 4DQAA 1QJU3 3GYDA 3OTFA 2Q30A 1HX6A 3BTAA 4QPIA 1YXWA 4WM8B 4IEOA 3ZFFC 2VOVA 4ZU7A 1UL9A 1FMD2 1J3PA 4IV1A 1VBA1 1AR82 4QGMA 1AR71 1ND3A 3MW4A 2AENA 3J26N 2ZGLA 1V9U2 3S6PA 5H9QA 2AUYA 3AXDA 2QNKA 2R32A 1A6CA 3P3PA 1WD3A 4QXKA 1ASJ1 3JQXA 1QNYA 2CWMA 5C4WC 5FO7B 4LBKA 4K21A 2QQPA 1RGSA 1I9RA 1D2QA 4WM8A 1UPIA 2YZ4A 2ILMA 1Q8OA 3ZXFA 4MLOA 1OQEA 2ZKLA 4IEPA 5ACA3 3GZAA 4PLNA 1REEA 3FWEA 4KQ7A 1M06G 2OIIA 5SV5A 1FMD1 4XW3A 5JZGC 4D7YA 3MF6A 1VBA3 1OD5A 1U5YA 1AR81 4KWKA 1AR73 2DFBA 1NCQC 1PNFA 2GU9A 2Z69A 3AJYA 3NV1A 5BPXA 1V9U1 4XJ9A 2Q1ZB 4QHBA 3OY8A 3B9CA 2TNFA 2VNRA 1ASJ3 3VBFB 4LBOA 3D82A 2YC0A 1QJY3 1JUHA 5IK5A 1MS3A 1QJZA 4QPIC 4QD2A 5GKAC 4NHMA 1O4YA 2UWAA 4RS5A 3OBTA 1AJOA 1H4HA 2RS12 1S0CA 2QCSB 4BZ4A 1DIWA 1ND3C 1PHMA 2GC3A 3UJOA 3CO2A 3N7JA 3KCYA 3U11A 2BVBA 4COWA 3CJIB 1OPMA 2ZZJA 4AFAA 1AR83 4WZCA 1NYWA 2VW0A 5E1RA 2OVUA 1KS5A 1V9U3 2VMGA 1BQPA 1NE4A 2EXHA 1DYKA 4AI8A 1DLLA 4WM8C 2A3XA 4R9BA 2Y0IA 4EN6B 1IGOA 2VULA 2PTMA 3ROUA 4QQPA 2BW8A 2ZMKA 1O5LA 4JGYB 4XHXA 1W6PA 1VBD3 4KGGA 3CLPA 4HANA 3GZUC 1S0BA 2RS11 2YY1A 3WR0A 1U5ZA 1QXJA 1QGLA 1LECA 1R083 2WSVA 3I59B 2RM22 3N7LA 3RPQA 2ZMNA 4HK8A 3PLQA 4WM7A 4MXWA 1SFYA 3VV1A 3ZSLA 1ENQA 4AK3A 1LOGA 2GDFA 2HEYF 4O9EA 2A6YA 4RS5C 1VRH2 1RUJ2 2DU1A 1PK6A 2R1BA 4ES8A 1VLNA 2QJVA 2O8OA 1D0HA 1FATA 5JSOA 4QM8A 1H9WA 4IV3A 2ZGUA 4AQTA 2XB6C 2FBEA 2NZ9A 2RS13 5LEKA 4OZXA 5F9TA 4LBJA 2QUOA 1W6OB 2V09A 3UKTA 5AFEA 4Q4Y2 2ZJCA 4Q8KA 5CFCB 2RM21 1AR93 4A3XA 4AI1A 2E7QA 4K8FA 4URTA 1LJ7A 2D7FA 1BBT3 1WW5A 4YG3A 4Q4X2 3V0BB 4D7SA 3FUQA 3IWZA 4LO8A 5DZGA 1RINA 3NV3A 4FXGB 2ZTNA 5DG1A 3AMPA 1RUJ1 5I8TA 3E97A 1PNGA 4BIOA 1SACA 1AXKA 1O3QA 5K0UA 1KQRA 3L2HA 4LA2A 3OD0A 1ND2A 1R1ZA 4OI2A 3S0MA 1YI7A 1NCRA 4FP2A 2JG9B 2R0HA 3MPBA 1H1MA 4MX3A 4EWDA 1VB2A 2A75A 4WM7C 5CFCA 4UBHA 1TNFA 4RGAA 2BTVC 1BK1A 4Q4Y1 4AHWA 1CJPA 1GZCA 2RM23 4M0HA 1Q5OA 4I3GA 2ZGMA 3IMNA 4Q4X1 1G7YA 3BOPA 3INAA 4Y1UA 1XU1A 4Q0PA 1PK6C 2EXKA 1MS5A 3H1MA 4XFBA 4WBBA 3K51A 3ZSEA 1RUJ3 2WWSA 3LOBA 1CPMA 3ZXDA 4IV3C 2NLRA 2KXLA 3JZVA 4HMZA 5GZGA 2EVXA 3E6DA 3SCFA 4AGVA 5JI9A 3ZFGB 1IQAA 1AVBA 2D97A 2CGNA 4YYOA 1ZA4A 4YZ2A 2I2SA 3WCSA 1LODA 3LAGA 2RS32 3ZXEA 3HT1A 4Q4Y3 4FPGA 4NPRA 4Q4X3 4HZFA 1G86A 4H55A 3VZKA 5K0UC 1ND2C 1HKDA 2ZX1A 2ZGTA 4QGNA 5GM0A 1UPSA 1NCRC 2A3WA 3ALQA 4WVZA 1CX4A 1JN2P 2A6ZA 2DCZA 4GB32 1NA1A 4CYDA 3PJQA 2WNVB 1MS1A 2XLGA 3BCWA 1VBE2 3OD4A 1VR3A 1JW6A 2C0ZA 5CFCC 2A70A 1GQHA 4LULA 5GZDA 1AL22 2I74A 4ASMB 1YWKA 3UJQA 3M1HA 1S1AA 3DV8A 4EN8B 2D6NA 2RS31 4AEDB 3I7DA 4I30A 4LNVA 3WXPA 3WUCA 3H0OA 5JI7A 1O3RA 3LCPA 2R1DA 5BNQA 3QH7A 3RMXA 3O12A 2HWD2 3EO6A 4I2OA 3PVEA 3AMQA 4LHNA 4FOWA 4GB31 2XG3A 2XWBB 4RFT0 1DFQA 1S2BA 4KNCA 3RJRA 4Q0QA 1W0PA 1VBE1 4LT5A 1RUG2 2JICA 4R9AA 4AI3A 1WCDJ 4DZGA 1DQ6A 1UU5A 1A78A 2CTVA 1GZWA 2AH2A 1JTZX 3ILNA 1AL21 5GALA 2WJSA 3B02A 3JB8A 3WG1A 3ZN5A 2ARBA 1G9BA 5K8SA 4CP1A 2RJLA 2RS33 4OFGA 3WQ7A 3I8TA 1CAWB 3CU7A 3MIFA 5BNPB 2NYYA 1NA1C 1RUI2 3WDXA 3VHOA 1HLCA 1B35B 1PMIA 2HWD1 3NV2A 2WNUA 4XF0A 1OA3A 1TQ5A 4GB33 1DBNA 2X5IA 2X8KA 1K5MA 5H9RA 4ZU5A 1VBE3 1RUG1 2VW2A 3PVOA 2DTYA 2LUWA 4LBMA 1CGPA 4BH9A 4WVVA 3CJXA 1AL23 4OI4A 1FOD2 1CAUA 4BMBA 5HI0A 3JQWA 3ECQA 3HQXA 4E9KA 4PDWA 4B4PA 2BEOA 3N4MA 2BFUL 2WSUA 2GNBA 1XE8A 4KU7A 5GZEA 2Z42A 3N7KA 3RWNA 1RUI1 3ZFEA 4MGIE 4XE9A 3VKNA 4OHZA 2HWD3 3AKSA 1QU0A 4K1YA 1HIXA 1AXYA 2FMYA 4XDQA 5FQ0A 4AHYA 1SQ4A 3FFQA 4AFBA 3L9JT 5C8CB 3IBMA 3B5LB 1C3HA 1RUG3 3AK0A 4MSVA 4JV4A 2XJRA 3H7YA 2IC1A 3PVNA 1L3JA 2P37A 3VUOA 2LALA 1AX1A 1FOD1 3FLRA 1MQTB 2HWB2 3GBWA 3KQRA 4FTBA 2WNUC 2OZJA 2OW4A 1XRUA 1ZNPA 4ORFA 3U0ZA 1RUI3 3GF6A 2X5IC 4XQWA 1K5MC 5CG8A 3E6BA 4IESA 2D5HA 2D5FA 1RHI3 1V6JA 2D40A 4EV0A 1N1TA 3KD4A 5D8AB 1O7FA 1GFF2 1LKNA 4YNIA 4IEWA 4FXKB 1H8TA 2WQ4A 1LHOA 2E9QA 1WW7A 3J4UH 4PDWC 1H2NA 1H2KA 4PBPA 4Y26A 2VH9A 1LEDA 4LBQB 4GMP0 1FOD3 3ZFEC 4JGZB 2E6VA 4P9JA 4N7IA 2HWB1 3UV9A 3MGUA 3NW4A 3VBUB 3A4UA 3D5OA 4B4RA 5L7OA 1O91A 2GNTA 5JOZA 2EA7A 2XJQA 4MZUA 1RTVA 1REDA 2ZS6B 1TME3 1A3KA 4DY5A 2GALA 2GSYA 1ZRCA 4GWNA 2VUAA 4QPGB 1UW8A 2JECA 5D1IA 4CDUB 2YUEA 4F3JA 4LBQA 5T3NA 4P14A 2IXHA 4BYYA 2W52A 3HWJA 3VBRA 3U4XA 1IS6A 4IQPA 1GR3A 1UZYA 1N1VA 4Y20A 3KGZA 4AI0A 2VMHA 1XE7A 1Z7S2 4YG0A 3TBDA 2HWB3 1B09A 3O7OA 4QQHA 1U5XA 5EFUA 4FPEA 3R05A 2ATFA 4CP2A 4HSLA 1ZM1A 4I3PA 1H8TC 3ELNA 4DRRA 3JB4C 4D94A 4X8PA 2R16A 4QPGA 4IETA 4CDUA 1DYPA 4IERA 1W6QB 1S0IA 5EJ3A 2G9GA 3TNQA 1W39A 3FJSA 5FTTC 1WLWA 2W0XA 4UXAA 3RYKA 4BQ1A 4BWOA 1WW6A 2GC0A 5AC92 5L7OC 2CL2A 5EZWA 1Z7S1 3RZZA 3JUUA 4RQPA 2HWE2 2XLFA 2GNMA 5BNOA 1ZREA 3N3HA 2A6VA 5C9AA 4YG6A 1ZZBA 1YLLA 3RMYA 3NKGA 3D8CA 4BE3A 3LA7A 5A33B 2F4PA 5B2GB 1H30A 4L92A 4D69A 3IPVB 4CEYA 4IEXA 3VBRC 4XJUA 4YVSA 2QDRA 4NHLA 1DGRN 3C3VA 1YFXA 5H9PA 1RVF2 1FNYA 3CL1A 3OYWA 4P5HA 3A0NA 1V00A 3LKJA 1NLSA 3WP6A 3VL9A 3MIDA 4AE2A 1U0AA 5AC91 2VMIA 3T1MA 5FDBA 2YYOA 1HRI2 2NMNA 4TSVA 4JTNA 1JXNA 4LE4A 2D98A 1PZ8A 2HWE1 1OI6A 4K3UA 4Y24A 4FTEA 5FMOL 2WT0A 4N43A 4FOYA 4FOQA 3VZNA 3BALA 2V73A 4BLIA 1QXPA 3IPVA 2GC1A 4JAAA 4LHKA 1VBB3 3WDYA 1QJX3 5FOBB 2V5YA 4X8NA 2RHPA 1RUD2 2D6LX 5T5PA 5JMCA 3JU9A 3VBHA 2XVLA 1R092 1RMU3 1ZBE3 2Q4SA 2Q1MA 4G4FA 1CD3G 1RVF1 1A8DA 3R4UA 4RQPC 2OUHA 2Y0OA 3NAPA 3ZXKA 5BNOC 1PVC2 3V0AB 3N36A 5C9AC 2ZGSA 5L19A 2QE3A 3BIWE 2HWF3 4Q1RA 1HRI1 3HMYA 4NHKA 4XETA 2DVFA 2HWE3 5BUVA 4SLIA 2RR13 5CFDB 2WZR2 1OLRA 1LESA 4CEYC 4Q2FA 4YVSC 3USUA 5DUWA 1DQ5A 2CV6A 4XIKA 1QQP3 3IM0A 1AR62 3ATGA 3VBSA 5HCFA 1IKPA 3RSJA 1RUD1 3MIBA 4FOVA 2DWRA 3ZYPA 2BWCA 1R091 2W39A 4RR3B 5GZFA 3O14A 3ST7A 4Y22B 3AYCA 1SDWA 1WBLA 3G7DA 3HR9A 1PVC1 3S7EA 4N43C 1ZZ8A 4IEUA 4FPJA 3VL8A 1AF9A 1UKGA 4KU8A 3R4SA 5I0SA 1UD1A 1HRI3 5JSRA 1POV0 1GANA 4C0BA 2XBO2 2WZR1 3WD5A 1NZCA 1QF3A 5JIUA 5KHJA 1ULEA 3TB0A 4FSJA 3VBHC 3WINE 4Y1YA 1AR61 1WUVA 2WS92 2DF7A 4GXLA 2WINB 1F5JA 2EAAA 3NAPC 2ZGOA 1O3SA 4RHV2 5EXOA 4L9BA 2B8MA 1R093 3ZXAC 4IXLA 1W6MA 1WW4A 1AL0G 3ME2A 2UURA 3NV4A 4CEWB 1PVC3 4YVWA 3H1WA 3DF0A 5BNNB 2D6KA 1S0JA 3NVCA 2G4IA 2VOWA 4QQOA 4YGEA 2ZGKA 3WVJA 4Q8LA 2VY0A 2XBO1 3ZN6A 3VBSC 2WZR3 1D2SA 4CRQA 3UK9A 3EQEA 3ZXGA 3MZHA 4QQ2A 2DYCA 3E5XA 3JCIA 5FPZA 1MVQA 3ES1A 2LTNA 4HK9A 2Q8OA 1AR63 4CDWB 5GLTA 2WS91 2ZHKA 4ISRA 1JH5A 3WOGA 1KJRA 5H9SA 4KWLA 4RHV1 3WV6A 1VP6A 3J8F2 4JRLA 1SCSA 4AQSA 4OI1A 2ZACA 5CU1A 5CIRA 1YFUA 3OGJA 2SLIA 3R6SA 3URFA 1OQDA 1PGSA 5I0TA 3PJYA 4YW5A 1QXRA 1ZZ9A 1D4M2 2XBO3 2VNGA 3AP9A 5DZEA 5T54A 3H1YA 1JYIA 2WLPA 4YZ4A 1ULGA 1AYN2 3ZSJA 1H1AA 3LSDA 2TUNA 4IV1C 1MZ5A 1C8M2 3GHNA 4PJYA 4L2NA 5J96B 2GMMA 4RHV3 4YVWC 1FMD3 1F9KA 1PZ7A 3J8F1 2C5DA 2PHFA 3ASIA 4GALA 3KM5A 5JR7B 5FO9B 4PQ9A 1FPN2 5KHIA 3B3QE 3VBFA 2UYBA 2JXAA 4CDXB 2FMDA 3ZIXA 5LRRA 2BNOA 3T2TA 1WLDA 1D4M1 3I4IA 4N7UA 4YZ5A 5A3MA 2X53S 1ULFA 4FQ4A 2XHKA 1QHDA 1UX6A 1AYN1 2MEV2 3M70A 2PHUA 3H3ZA 4MUVA 1C8M1 3ZSMA 3BU7A 3CJIA 4E2QA 5JOWA 1HXS2 4Q27A 3J8F3 3MLLA 4YFWA 1EPZA 5DUXA 4QGLA 1TEIA 4IEZA 5DUUA 3WDWA 1GICA 3HIFA 4LBQD 3VKMA 5A3LA 3EXUA 1FPN1 4QQLA 4Y1XA 2R042 4R8HA 1YHFA 4YM1A 4JGYA 2XH6A 4GKYA 1EYBA 5EWSA 1CIWA 1DGWX 1KFXL 2JE9A 1WCSA 2EIGA 3NSTA 2B9UA 4JQRA 1C8NA 1AYN3 2MEV1 5C33A 3GHMA 2PFWA 1C8M3 3THPA 3I59A 4Z82A 3TWIA 1HXS1 5T55A 3RYPA 4ASLA 4GIQA 3WLUA 2XPJA 2EAKA 2RS52 4HFSA 3VBFC 5LK5A 1JHNA 4FPYA 1F2NA 4OI0A 2WLQA 1UMZA 1CESA 1Q56A 4EWAA 2D44A 1FPN3 3MICA 3O5SA 2DVAA 4B7EA 1C28A 4GA9A 5FLJA 4KG0A 4X6QB 1LENA 1SLAA 4KWJA 1O5UA 1VRH1 4XQDA 2R041 3PNAA 5HCBA 3E5QA 1VBC2 3CJIC 4DY3A 1VALA 4FBFA 4QMAA 2QZ3A 1W6OA 3X29B 5KXEA 4LUMA 4XOGA 4MVTA 4G3YC 2UY9A 1HXS3 2GMEA 2CWSA 4YRDA 4XYXA 2GH2A 3LA3A 2JG8B 2RS51 5FFOC 3V0BA 1YCIA 1Y43B 1UF2C 1H0BA 1Z0HA 4DFSA 1E57A 2VVEA 5FO8B 1RITA 4OULA 4JGYC 3I54A 3EBRA 3ZYIB 3MEPA 1ZYBA 4GMP1 1Y3TA 1Y7BA 4AEMA 3QOPA 1V70A 1VRH3 2HWC2 4HL0A 4XF3A 1DQ1A 1SLBA 2JG9A 3EJKA 4XFAA 1DQ4A 2WC2A 1VBC1 3O0WA 5CADA 5FPXA 5FLIA 4OVEA 5FRAA 3AKQA 1PGW2 3MLKA 2UU8A 3MIGA 3TYJA 3FUOA 5CNAA 3TN92 3TRSB 1ULCA 1DG6A 1BVP1 1SLIA 4AVTA 1D0GA 4H14A 5CB7A 2B46X 2RS53 1AXZA 4FPFA 3RNSA 3AYDA 2P3JA 1WA4A 2PLV2 2WA4A 1Y9QA 3QACA 3CNAA 3SITA 3VHRA 2Z5WA 1S0DA 2YROA 2UWBA 4GMP3 2GN7A 4QU2A 3OBRA 5JSPA 1BKZA 1WD4A 1QH6A 5FAXA 4UW6A 1REFA 3DKWA 1CAXB 2HWC1 4LLOA 2VG9A 4LLFA 1TMF2 4NN0A 3ZFGA 2DUPA 4JDNA 3AP4A 2K9ZA 1VBC3 2VOKA 4B7KA 1AX0A 2YPJA 3VZJA 1QH7A 2B39A 1PGW1 4FPCA 5IK8A 4AG4A 3KLSA 3TN91 2GZWA 3NL1A 1DQ2A 1ULDA 3M3IA 1N3QA 1GYKA 1S0FA 2QFEA 4XFFA 2YMZA 2DV9A 3HBZA 2A6XA 2PLV1 1X8EA 2JG9C 3D4KA 1LU2A 3KCXA 3SH5A 1NY72 1S55A 3VLBB 2WNVA 2MNGA 2BFUS 4QT6A 2HWC3 1QOTA 4N53B 4RGGA 1TMF1 2A73B 2P2KA 4HKWA 2ZAHA 4P9LA 3HN1A 1FYUA 2EF6A 3THTA 4D3WA 2H6CA 4AEDA 4WZFA 3TN93 2GAUA 4G9SB 1UIKA 3DPRB 4QM9A 4L8QA 2XJUA 3PMEA 5ABJB 1CVNA 3BODA 1A8MA 4BA6A 1N1SA 2ZGQA 3U10A 3ZFGC 1NY71 5J48A 2ZHMA 4Q0VA 4BCUA 4S2FA 3MPPG 1X33A 4DMIA 1TMF3