2R073

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r07300
5CFCC 5ABJB 4RQPC 1RVF2 2MEV3 5BNOB 1HRI1 3DPRC 3VBRA 1NCQC 1R1A3 1RHI1 1C8M2 1B35A 1ND2B 1AR62 2R042 3S6PA 1FMD3 5D8AA 1COV2 4WM8C 4CDXA 5ACA1 3ZFGC 1NCRA 4JGYB 3J8F2 3TN92 4RS5A 1RUH1 2RS51 1BBT1 1AL22 3VDDB 1AR82 5BNPC 5AC91 1OHFA 2FZ1A 4AEDA 1FOD2 1RUI1 1EV13 1NOVA 1NCRC 1Z7S2 4Q4Y3 1NY72 1C8M3 4RS5C 2RS12 3ZFEA 1COV3 2WFF1 2HWC1 5A33A 2BFUS 4JGZA 2VQ0A 4N43A 5C9AB 4IV1A 2RR12 1RUE3 1OOPB 1AR83 1RMU2 2HWD2 1VB2A 2MEV1 1RUC2 4QPGA 5J98B 1POV0 1K5MC 1R1A1 4QPIA 4N53C 2RM23 4RHV1 4IV1C 5FOJB 5K0UC 2RS13 1D4M2 1VRH3 4YVSB 1ND3C 3JD72 3VBUC 1QJX2 3VBOB 1VBC2 1AYM2 2RR13 3VBHC 5C4WB 1RMU3 1VBB2 1RVF1 4CDQB 1RUC3 2X5IB 1X36A 4CDUA 5A32B 4PDWB 1RUJ2 2RS32 1C8M1 1ZBE3 1AR61 1NG0A 2R041 1NA1A 4CEWA 4FTBA 1PGL2 2PLV2 3JD73 1COV1 5CFDA 4YVWB 1QJZA 3J8F1 3TN91 4GMP0 5BNNA 2BFUL 1FPN3 1R092 5GKAC 5LK7B 1AL21 1PVC3 4GB33 1FOD1 3JB4C 5DDJ3 4CDWC 4FSJA 4GH4C 1ZBA2 1DDLA 1W39A 1Z7S1 1NY71 3ZFFB 2RS11 4CEYB 3NAPB 5CFCA 1FMD2 4RQPA 3M8LA 5C8CB 2WS93 3DPRA 1NCQA 3JB8A 2RR11 3VBSC 3VBRB 2XBO3 1RMU1 1MEC3 2HWD1 4WM8A 1POV3 1RUC1 3ZFGA 1EV12 1B35B 4RR3A 3VBFC 1ZBA3 4Q4Y2 5D8AB 4CDXB 1VBA3 1SMVA 5BNPA 1D4M1 4IV3C 1PO23 3JD71 1QJX1 1VBC1 1AYM1 4RR3C 1MQTC 4AEDB 2GSYA 1H8TB 1RUE2 4LLFA 1VBB1 1VBE3 5ABJA 3ZFEB 3CJIC 1RUJ1 2RS31 2RM22 1HX6A 3FBMA 2DF7A 1VRH2 1ND2A 5A33B 2RMU2 1PGL1 4JGZB 2PLV1 4N43B 1QJY1 4GMP3 1A6CA 4NWVA 5ABJC 1PIV3 1K5MA 1VBD3 5BNOC 3IDEA 4N53A 2ZAHA 4NWWA 2BBVA 4QPGB 5K0UA 1R091 1EAH3 1ND3A 3VBUA 4QPIB 1ND2C 1POV1 2HWB3 4BCUA 2ZZQA 1ZBA1 1ZBE2 1RUD3 4JGYC 3VBHA 1FMD1 4FTSA 1GFF2 2RMU3 3VDDC 1V9U3 2WLPA 5J96B 1TMF3 1HRV2 1HXS3 5C9AA 1FPN2 4CDUB 1PVC2 2QQPA 4GB32 2R072 5JZGB 5DDJ2 1EV11 4WM7B 1NA1B 4CEWB 4Q4Y1 2WWSA 5CFDB 5C9AC 2GH8A 1RUG3 4YVSA 5BNNB 1OOPC 5L7OB 2WS92 4CDWA 4Q4V2 4GH4A 3HAGA 1HRV3 1RB8G 1RUE1 2ZTNA 1RUI2 1HRI3 2XBO2 1AR81 1MEC2 1BEV2 2WZR2 2BPA2 4YVSC 2R073 1AR72 5CFCB 3VBOC 4RQPB 1PGW2 1QJU2 2RM21 1VBA2 2Y26A 4PDWA 3DPRB 3VBSA 1CD3G 1VRH1 1NCQB 1PO22 2RMU1 1BMV2 5C4WC 2HWF2 4Q4V3 3VBFA 1RUH3 2R062 2RS53 4CDQC 2X5IC 5JZGC 4YVWA 1IHMA 4WM8B 5AC93 3ZFGB 4PDWC 1RUI3 2XPJA 4IV3A 2WZR3 1BEV3 1VBE2 5L7OC 1MQTA 1AR73 5BNPB 4YVWC 1QJU3 1ZBE1 1R082 2IZWA 1CJDA 1AR92 1NCRB 2WFF3 2HWC3 4RS5B 1PIV2 2HWF3 1VBD2 2R063 3CJIA 1AYN2 3JBG2 1HRV1 5FMOS 1FPN1 1EAH2 2FZ2A 1PVC1 3ZFFC 4GB31 4CEYC 3NAPC 1C8NA 2HWB2 2R071 5C8CC 4Q4W2 4RHV3 5DDJ1 5BNOA 4Q4X2 1RUD2 1R083 3ZXAC 1QQP2 1AR93 1K5MB 4N53B 1TME2 3VBRC 1V9U2 4IV1B 2WS91 5K0UB 4Q4V1 1ND3B 1AYN3 3JBG3 1B35C 1TMF2 3VBUB 4JGYA 1HXS2 2HWE2 1RVF3 5D8AC 1H8TA 4Y5Z0 4CDXC 2XBO1 2WZR1 1MEC1 1BEV1 4Y4YA 3VDDA 1RUF2 4Q4W3 3VBHB 1AR71 4Q4X3 1VB4A 1AR63 2R043 1PGW1 1QJU1 1VBA1 1QQP3 1PO12 4AEDC 1H8TC 1RUG2 1ASJ2 1PO21 1TME3 3J8F3 3TN93 4EJRA 3LOBA 1BMV1 2HWF1 2R061 1AL23 1AUYA 3ZFEC 5FMOL 2HWE3 1HRI2 1FOD3 1OOPA 1VBE1 1RUF3 1RHI2 1Z7S3 4JGZC 4N43C 2TBVA 1VAKA 1R081 4CDWB 4RFT0 4GH4B 1HQNA 5ACA2 1AR91 1PO13 4QPGC 1ASJ3 1E57A 4GMP1 4QPIC 1PIV1 1RUH2 2RS52 3VBOA 1VBD1 1WCDJ 1BBT2 1AYN1 3JBG1 5AC92 2HWD3 1X33A 1EAH1 5C4WA 2HWB1 1RHI3 4Q4W1 3VBSB 4CDQA 2X5IA 5JZGA 1M06G 4Q4X1 5A32A 4WM7A 1D4M3 1RUD1 1QQP1 1QJY2 3VBFB 5ACA3 1QJX3 1VBC3 4CDUC 2WFF2 1AYM3 2HWC2 1TME1 1V9U1 5L7OA 4SBVA 2BUKA 4IV3B 1BBT3 4WM7C 1TMF1 1HXS1 1NA1C 4CEWC 4FTEA 1VBB3 2MEV2 2HWE1 4RR3B 1F2NA 1MQTB 5CFDC 1R1A2 1RUF1 1RUJ3 2RS33 4RHV2 5BNNC 1OPOA 1AL0G 2PLV3 1QJY3 4Z92B 1PO11 3ZFFA 3CJIB 1RUG1 1ASJ1 4CEYA 3NAPA 1F8VA 5C8CA 1R093
chains in the Genus database with same CATH superfamily
1NXMA 4XF1A 2NLRA 4EN8B 3MV11 2MEV3 2XJRA 1ZRIA 1HRI1 4KG8A 3VZLA 4FOYA 3DPRC 4BK5A 3ZYRA 3ZIXA 4D69A 1RHI1 2B39A 3WDWA 5FO9B 5CIRA 1V0AA 2QQNA 4UW6A 1B35A 3TAYA 1ND2B 2DDUA 4EWEA 1N3QA 3D82A 3CF6E 3PMSA 3WP5A 3LGRA 5AVPA 1RXGA 1COV2 5FY4A 3P6BA 4GKXA 2W94A 4QAWA 2XLFA 4JGYB 4LBJA 4AEKA 5JMCA 2Y6KA 3VB9A 3LFMA 4IGQA 4RS5A 1US2A 2QKDA 2RS51 4YG3A 3RS6A 1J59A 5FXVA 1AL22 1PK6A 3WUDA 2YC0A 3LPGA 5AC91 2XUMA 3VD4A 3TEZA 4B3NA 2WQ8A 2WBKA 3B3QE 2Y0OA 4QGMA 3THTA 3OCPA 3CLPA 2O1QA 3WNNA 3N3HA 1NOVA 2GP3A 2QUOA 4UFKA 1D0HA 4WVMA 3WD5A 1YNAA 4XFIA 1JH5A 5DQ0A 1Q8PA 3ZMOA 1QH7A 1JYVA 1DLLA 2H6BA 2P6CA 4FFIA 4NAMA 3AB0A 2QVSB 4RS5C 1LNSA 3I2JA 2ZGUA 4UT5A 3N9PA 5CVRA 2R1DA 3MDPA 1SHWB 4IL7A 2GDFA 3LEIA 4I0WB 2OPWA 3AYCA 4PLOA 1OLQA 2R32A 5FV3A 3AKRA 3FFZA 5JDBA 1JZ8A 4ZHNA 1V6JA 2H0VA 2L9LA 2XUEA 4AVTA 4YZ3A 4AVSA 3FE5A 4EYUA 5A3LA 4JVAA 1AR83 2YBPA 1VB2A 3RJRA 4QPGA 4FPHA 1N1SA 4CXYA 4C1WA 1K5MC 2A70A 3VL8A 1R1A1 4INDA 4QPIA 1PX4A 2VVDA 1TNRA 3S57A 3U1XA 4GALA 3WW3A 4ASKA 4Z2WA 1Y7BA 2E9QA 2RS13 1D4M2 4YVSB 1RTVA 1JZ7A 3RYRA 3BN6A 2Q4SA 4DXSA 1WWYA 5A6YA 4Y3OA 2IVIB 3O0WA 2GMPA 5FOBB 5JMOA 5A1LA 5L9RA 5LA2A 1VBC2 3WDVA 4HKOA 3CZJA 1KD7A 5C3PA 5HXVA 5FTTC 2P3YA 3THCA 2RR13 5JPNB 4K9SA 5C3SA 4AAXA 1Z78A 1I5ZA 1ZRRA 4HT1T 1BKZA 5C4WB 2TUNA 5FCCA 1VBB2 2XVLA 1D7PM 2JXAA 1X36A 4AHWA 3FLTA 5A32B 1MACA 2HJIA 4XILA 3WT3A 1LHUA 1W04A 3BODA 5FREA 3VHPA 4PDWB 1JYWA 1W6PA 4CUBA 1C8M1 1ZBE3 2ZGKA 2YC4A 3JXSA 1W0NA 3M4FA 4YW5A 3PUQA 2LRPA 1MPXA 1NA1A 4FTBA 2H0BA 2PAKA 3LDRA 2OS2A 4QX1A 1UXXX 2UY9A 3BTZA 4CU9A 3IBMA 4YWAA 4OHXA 5I0UA 4A2UA 2GU9A 3J8F1 5FPZA 4BWOA 4CU6A 4OULA 3W20A 2J1VA 2YDEA 2C4XA 4ZZ5A 1R092 2YPJA 2XQRA 5KXDA 5LK7B 3WSOA 2ARCA 2D6PA 1PMIA 2NMNA 3W58A 4FSJA 4P9JA 2RHPA 2WA4A 3ZYGA 3MEPA 1ZBA2 1OPMA 1C5HA 4COVA 4O61A 5FIXA 1NY71 1S0FA 2ARXA 1J58A 4HMZA 1ACCA 1W06A 3VHNA 3NAPB 2HEVF 4KNCA 1SLTA 4V1PA 1H1MA 1N1YA 1BJQA 2X8KA 1NCQA 4C1XA 4Y20A 4F83A 3GYDA 3PUIA 4Q5OA 4YGDA 3OBAA 2FDIA 5JCTA 3JB8A 3ZDSA 4HL0A 2P3JA 1APNA 2AC1A 3VBRB 2XWBB 1RMU1 1UW8A 1H6XA 4WM8A 3UGHA 1JZ5A 4EROA 4EE2A 3OBZA 1RUC1 1YFXA 4LKSA 2XWJB 1RIRA 2AR6A 2P5BA 4XF9A 1GMMA 2PHFA 2Y6FA 1SLBA 3R0RA 1JMUB 5D8AB 5ANQA 3ZN6B 3MW2A 1CX4A 4C91A 1ULGA 3P3NA 1HN1A 1WD3A 2JB8A 3K46A 3HBKA 3LDBA 5FY1A 3NMBA 4BQ1A 1EPWA 2RG4A 1PO23 3JD71 4P14A 4XQWA 5JLVA 1F5FA 1WW4A 4XUQA 3A4UA 2N7GA 5AFBA 3THDA 1MQTC 1OQ1A 4JKKA 3FWEA 4Y24A 5D1IA 4D6SA 3MFAA 5F39A 4YGBA 1UYPA 1QDOA 2BWAA 4X8PA 1W03A 2EIEA 4O7XA 3V0BA 1GOGA 4CCCA 5ABJA 4BZ4A 2ZOEB 1T6GC 2W0XA 2XVKA 3JQWA 4OI1A 2CDPA 4R9BA 1HQWA 1GOFA 1RUJ1 2RS31 1PHMA 3LEKA 3T4VA 2E33A 3FBMA 4NPLA 4FPYA 1G86A 1LEDA 1NQDA 2EIGA 5AVAA 5EYYA 1H30A 1CJPA 4L2NA 1PGL1 4LO4B 1REEA 1QJY1 1CAXA 2AENA 3KCYA 4GMP3 5ABJC 4MG2A 4UFIA 3NJYA 4EQVA 2QZ2A 5BNOC 3N7LA 1JOPA 4N53A 3T0AA 2J22A 3WDYA 2CV6A 3VV1A 1LGNA 1ODMA 1UMIA 2P37A 2PAMA 3NNMA 4P5HA 1EAH3 3ZXJA 4LHKA 4B7KA 2B8MA 3KD4A 4CCKA 5BUVA 3C8XA 4Z82A 5JSRA 1H9WA 2E7AA 3T2QA 1S0IA 2K9ZA 3VBUA 3HT1A 4BMEA 1FV3A 2HWB3 5FZAA 3PNAA 1IPKA 5HI0A 2BDRA 2ZZQA 4QKNA 3KS7A 3SKVA 2OA2A 4YM0A 4OZXA 2W46A 5K8SA 2JDKA 5DZGA 1ONAA 1ZBE2 3L2HA 1O4TA 3N36A 4QM8A 5IFTA 3IM0A 2VOVA 1UZYA 2VQTA 5DUXA 1U5YA 3ZYHA 1LESA 1O59A 1N3OA 3IAQA 4HBNA 4UW4A 3FLRA 2VBBA 3HBZA 2SLIA 1TZOA 5DN2A 1ZM1A 1WBLA 2E51A 2A73B 4YGCA 3SHRA 2GALA 2BVBA 2QQLA 4AI1A 2YBKA 5J96B 4GQ7A 5E1RA 4M3CE 2DTYA 2VMEA 4FAHA 2JDMA 5C9AA 3VZKA 5FDBA 3WZ1A 5JOXA 3EBRA 3H7JA 3AX4A 2QQPA 1EUTA 4NHKA 1D2SA 4XF0A 1H4GA 1XNBA 4Q0PA 1OUXA 1XYPA 4AHYA 4QDQA 4LHSA 4CEWB 1MS3A 5F3EA 2DUQA 1J84A 1J3RA 2XKPA 4NVPA 1HB3A 4UBHA 1XYOA 5CFDB 5C9AC 3RWKX 4MGIE 1DIWA 1ALYA 4NIAA 1UKGA 1WLWA 5JR7B 4YW6A 1YHFA 5L7OB 2MNGA 4BXFA 2JDPA 4DPNA 1LGBA 2Z42A 1LR5A 3O1MA 4AGGA 5L9VA 3MICA 3RZGA 2EIDA 4JHZA 2YC2A 3BOWA 3UJQA 1HRI3 1V6NA 4MHRA 2XHKA 2WZR2 2BP6A 2ZX0A 2FDGA 4JTNA 5A7WB 3E1F1 2W08A 4QMAA 2GN3A 1AR72 3VBOC 3PUHA 4D0QA 4BMBA 1QJU2 2PHXA 1NLRA 2Y26A 1EUUA 3DPRB 5FZEA 2UWAA 3U11A 4HFSA 1G9BA 1FX5A 4ES9A 1PO22 1IGOA 4HZFA 2HWF2 2EAKA 3K75B 2R062 2ZXQA 2RS53 3GZAA 4M0NA 3VBFA 4HETA 4CDQC 4P9GA 1KFXL 3AP9A 4KWKA 1C4RA 2OUHA 5AC93 3W5NA 2WIIB 4IGPA 3FHIB 4E2SA 4QQHA 5IVFA 2DCKA 2Y0IA 3A0KA 3VKMA 5FZLA 4E4SA 4Y4RA 3NV4A 2DBNA 2FDFA 4FT8A 3WQ0A 2JDAA 1GNZA 4TN7A 1UCXA 1VMJA 2WO2A 4DRRA 5FMCA 1X50A 4NN0A 4BQYA 1UYXA 1JW6A 1OLRA 5BNQA 4RS5B 3ABZA 2RDNA 3DYPA 3WF1A 3NSTA 1SLLA 3CJIA 3JBG2 4EN0A 4KBZA 4COUA 3HPNA 1LOCA 4DQAA 1HRV1 2B45X 2CL2A 5ANNA 3I97A 3SXWA 1EAH2 3H42B 4CP9A 2FZ2A 2D3SA 2D6KA 4MX3A 3KHBA 3N7JA 1W0PA 2HWB2 2JE9A 4AQ2A 2R071 1XRUA 1W6QB 3VDAA 2VXJA 4FPKA 5FMBA 3AP4A 2J1SA 3ZN4A 5F7UA 2WN3A 3K4AA 1F9KA 3ZXAC 1QQP2 4JZRA 1K5MB 5B4NA 3RZJA 4OUSA 3TB0A 1U0AA 3ACLA 2JDNA 4Z1VA 3RRDA 3CEWA 1AYN3 3AJZA 5LWBA 4JGYA 5FLJA 3J4UH 4IEXA 4UFJA 2JG8C 2VUCA 1UX6A 1UWWA 3GZUC 5FKBA 3BU0A 1BYHA 1H8TA 1I3HA 4QQLA 5J3UA 4DNYA 2XBO1 1BEV1 1BHGA 1GKBA 1XJAA 4S2HA 1RUF2 2ZS6B 4IESA 4OHZA 5E8AA 3OSDA 2Q1MA 3BU7A 5LA0A 1GV9A 1WW7A 2Y33A 1VB4A 2DUOA 1J1TA 2ZKNA 1UY2A 3UKNA 3BCWA 4B4PA 3I2HA 3MI8A 1VBA1 3R6SA 3D0JA 3WR0A 2BYVE 1FATA 2P17A 4XPVA 4AEDC 1H8TC 4XDPA 1DGWA 2DCTA 5JXJA 2QE3A 4LHLA 3OF1A 1UMHA 4V2WA 3J8F3 1BMV1 4BH9A 3HNMA 3UESA 2CGOA 2G19A 5FYZA 3D0SA 4PF5A 3UNPA 3ZSKA 1IS6A 1AUYA 4MLOA 2JDUA 1HRI2 1LHWA 2VZ3A 3WF2A 4Q0VA 4WBBA 1NXD1 5LBFA 3S7IA 1DCSA 1VRBA 1RHI2 2VNGA 4OI4A 5FJHA 4JGZC 4N9HA 4N43C 2P3KA 3AYEA 3ZIWA 1YJKA 1W9FA 3BTAA 1W3VA 2E26A 1PZ8A 2WSUA 3E5XA 3B02A 5JVVA 1F15A 1R081 1HQNA 3OPZA 1PO13 2XLAA 4IEPA 3HNBM 4CZSA 2OQ6A 1E57A 1W2OA 2X10A 1POQA 1CESA 4E27A 3BPZA 1KITA 5GLUA 1IQDC 1ZREA 2RS52 4NR1A 1VBD1 2HYXA 5A3MA 3H1WA 3M1HA 3BYWA 3ELNA 5C3RA 4TWTA 5AC92 4R8HA 2ZGLA 3LSDA 2ZBJA 3KLSA 3MLJA 2OZJA 2WLQA 3Q8EA 3TEXA 4MH0E 2C24A 2ZGTA 4I3PA 4FPCA 4NJ4A 2J7MA 5C4WA 1JN2P 1X9TA 3LEGA 2ILMA 2VZUA 4Q4W1 4WZCA 1M06G 5JZGA 3AMMA 1UNBA 4Q4X1 3GZTB 4LBQD 5A32A 3BTYA 2ZHLA 4N9IA 2ZHKA 2BNNA 1W99A 1G8WA 1SDDB 2VCAA 2XJVA 3LDKA 4LK6A 2ZEYA 1NX9A 1TME1 1V9U1 1RYYA 4IUGA 3EHKA 4SBVA 5FZBA 5K9YA 4KU7A 3WCRA 5I0RA 1AF9A 1XPWA 3H7YA 3EB7A 4P9YA 3TWIA 5EFUA 2J1TA 5EXOA 1H4HA 3ZM8A 2HWE1 3AL6A 5DAPA 2ZX2A 3AMNA 1MQTB 2QQWA 4HOOA 5E89A 1T2XA 2ZKLA 1R1A2 4LUKA 1H2MA 4LT5A 1RUJ3 2RS33 2R1BA 4COYA 3PU8A 1S4CA 5FYUA 3MO4A 3MYXA 3T2OA 1W8UA 4A42A 3SKJE 2G4IA 1OPOA 3RJ2X 1TQ5A 4C90A 4NHMA 4L92A 5JXHA 4ISRA 1QJY3 4Z92B 1GQPA 3ON7A 3J9SA 3CJXA 3NAPA 1IZ3A 3MFCA 5C8WA 2VZSA 3B93A 3LCPA 4OMCA 5FXXA 1JZ4A 4QGLA 3WDXA 1ZYBA 4D3WA 4CXWA 2C26A 5HXMA 1JHJA 1Q8OA 4TLFA 4W6XA 4RQPC 1TNFA 1VR3A 4ARXA 2IC1A 5ABJB 4NROA 4ZPIA 2AREA 4ARYA 5BNOB 2D5FA 2CWSA 3VKOA 1W28A 1H2KA 2VL4A 4XMAA 1UY1A 3VBRA 1B09A 4ATEA 2J1AA 5KXEA 3LD8A 2OW4A 1C8M2 4Q0UA 3LF7A 4BE3A 3CIHA 4YW1A 1UF2C 5DUUA 2YGLA 1QJFA 1ZRFA 2VBDA 3S6PA 1QEXA 3QLQA 1GZWB 5CKQA 4AQ6A 5D8AA 2BNMA 3U10A 3ZN6A 4XTPA 3L9JT 1KGYA 3ZFGC 5CAZA 4E8CA 3J8F2 1OQEA 4XC9A 2IXCA 2FCUA 3D4KA 4AG4A 3DKWA 4QQPA 1QIQA 2ES3A 2YPDA 4K1ZA 1U5ZA 4OVEA 4LTAA 5EZWA 5FPBA 4KQ7A 5C6CA 1BBT1 5FUNA 1DP0A 2JEMA 2LM3A 4C0BA 5BNPC 1OHFA 4BQ4A 3AZVA 4CCDA 4DXRA 1S2EA 3O1TA 3PLQA 3RDIA 4XETA 1C3HA 4E4HA 3H8XA 2E6VA 2BV4A 4FXKB 3N9QA 5FYMA 1NY72 3PIGA 4LBMA 2XVGA 1DQ5A 1YI9A 5F3IA 4NIDA 2ZEWA 4DUXA 3POFA 2QQIA 1UIJA 4DINB 5K4LA 2WC2A 1D0GA 2QQKA 1UN1A 4LORA 3K4DA 1COV3 5CZKA 4DOUA 4QXKA 5FZCA 5JSPA 3P3PA 5JSOA 3VD3A 1O8SA 3SH4A 2GC1A 2HWC1 4QKBA 3SH5A 2VW0A 2Z5WA 3B00A 2BFUS 3VKFC 5C9AB 5A3TA 2LTNA 1X8EA 1LULA 4IE0A 4N90A 1RMU2 1SFPA 2ZZJA 2O8OA 2V4VA 2YG0A 1RUC2 4UF0A 5L9BA 1JI6A 3WINE 1W8OA 1POV0 5IK8A 2HKXA 4K40A 1OF3A 3U4SA 4OLLA 5IJRA 5KHIA 1DGRA 1G9FA 4XFBA 4AQSA 4PCRA 1GBGA 3U4XA 2VG9A 1ZX5A 2JKXA 1ND3C 1QXRA 1ULOA 4J25A 3JD72 2D44A 1W0OA 2VCBA 5F5AA 4FPGA 4MUVA 3VBOB 2BRTA 2VTXJ 3CU7A 4Q0QA 4X6QB 5FY7A 4FFFA 5GZEA 1RUNA 5IVCA 5GLZA 4CCMA 4WVWA 5EHDA 3VBHC 5T50A 2DVBA 1YXWA 4YW7A 4XZUG 5F5CA 2FCVA 4CDQB 5ERLA 3LZZA 3IT8A 1LB2A 1E5HA 3IPVB 4K21A 1A34A 1RUJ2 2RS32 2B46X 4ES8A 3RYPA 1OKQA 4BQXA 2FD8A 4META 2TNFA 4LHNA 4BOWA 1AR61 2BOJA 2R041 3KWVA 1GNYA 3CL1A 2XGXA 4PQQA 4CEWA 4DUVA 5J36A 1G9CA 1PGL2 3QACA 5CFDA 2UWBA 3WG3A 1QJZA 1XU1A 4AVVA 3AXEA 4YZ1A 3H9AA 3VL9A 1CZTA 1SFYA 2BFUL 2YYOA 1DGRN 3AJYA 3K4ZA 4B29A 3LA3A 5GKAC 1OVSA 1VALA 2F17A 4HANA 1CX1A 3SEEA 1S2KA 2R30A 2QQMA 4XFGA 3JB4C 5FZGA 1QXPA 4CDWC 1W90A 1W39A 1C57A 1F4AA 1SZBA 4Y1XA 3TYJA 5A7WA 3JZVA 1L7RA 3ST7A 5LW9A 2A6YA 1JUIA 3JUUA 3PJYA 4XXAA 4O9GA 2VTFA 4NHLA 4RL7A 3M8LA 4QQ2A 4H7MA 1AXKA 1CONA 1UU4A 3DPRA 1KQRA 3U07A 3KHCA 4DZGA 3O1PA 4A6SA 4FP3A 4M01A 3ZYPA 3AZYA 2W1QA 4WVZA 2LALA 3SEPA 2IXLA 2Q0AA 3ITQA 4GWNA 1DZTA 2XBO3 2RV9A 2VQAA 5F32A 2QFEA 5T5JA 4V2VA 5JOWA 4QPWA 5FQ0A 2VNOA 2A7AA 5CNAA 5HCHA 2JD4A 2BOIA 1WMDA 2JG8B 1ZBA3 4JC1A 4QU1A 1TG7A 4H14A 1LODA 3AMPA 1VBA3 4YNIA 5LK5A 2R49A 4I09A 4AI0A 3MGUA 4BQ2A 1I9RA 2WYSA 3OGRA 4AR2A 5A80A 3A0NA 4R9DA 1O91A 5FRAA 4R4XA 1WLCA 1XSQA 1QJX1 1W6NB 4E2QA 1W8WA 4FVVA 2D40A 3ZKYA 1S0CA 1Q8VA 1RJ8A 4XFAA 4AEDB 4BXSV 3RZHA 1H8TB 1YEWA 2GH2A 2XKOA 2ZX4A 4JAAA 4LLFA 2FMDA 1DQ4A 2BTVC 2PHDA 1OLMA 4CCNA 4Z2AA 4JQTA 4LBOA 3FC0A 5FZDA 5FFOC 1OT5A 1BCXA 4OZOA 5J09A 1ZRCA 3ALQA 1CN1A 2CWMA 5FPVA 3I4IA 3KV9A 1GR3A 2J1EA 1PX3A 4A7KA 2DF7A 1W6QA 3D5OA 4NRMA 1UY0A 4OFGA 2D6MA 3TRSB 3MUZ1 2G9GA 4JGZB 3I3EA 4N43B 5HV4A 4XJUA 1ZZ9A 1A6CA 1K45A 5IWFA 1WMXA 2WO7A 1K5MA 1VBD3 3ZX7A 2WWUA 1AX0A 4QX5A 2VZRA 2ZAHA 3FLPA 4HG6B 4NWWA 2XXZA 2ENRA 2OT7A 4XVHA 1BLZA 3GGLA 3QH6A 4CYDA 2E7QA 1ENQA 2ORXA 3UGGA 1POV1 3FFQA 1FNYA 3PU3A 4CRQA 2VCMA 3KB5A 3WP4A 3I8TA 4RFRB 1WGPA 3AZWA 3MIEA 1JU3A 1YIFA 5FBJA 3H1YA 5HCFA 3WNLA 5IK7A 1OFSA 5KHHA 1VPHA 3WX5A 4JDMA 3O5SA 2EXHA 2VW2A 4KL1A 4XOGA 2C1FA 4ZU7A 1GFF2 5IVEA 1ENSA 4LULA 3VDDC 3VZOA 1GICA 1S55A 1V9U3 3KT4A 4LO7A 1D2QA 3GHNA 4YM2A 2Q8EA 3MF6A 5A3NA 3B01A 1HRV2 3USSA 4JRLA 1MZEA 4S2DA 3ZYBA 3PTRB 3S5AA 1YYNA 1FI2A 3Q9OA 2R072 1UZZA 2CSGA 5JZGB 2P6HA 4HVOA 1RGSA 3KV4A 4K1YA 1H9PA 4LPLA 1V6MA 3MIFA 5FPLA 2XJSA 4NAOA 2B7YA 3R4DB 1BK0A 1FAYA 1IKQA 2QDNA 3OPWA 5BNNB 1VP6A 1OOPC 3U78A 4AVBA 2DFCA 1UMZA 5DUWA 5FO7B 3L2YA 5FO8B 2VD7A 5A7QA 2YV8A 2BZDA 2DVAA 2VC9A 3WQ1A 3NKGA 1IOAA 1RUE1 2ZTNA 1RUI2 3MPPG 4KU8A 1JOJA 4WVVA 4X8NA 4Y1YA 2XBO2 4DXTA 1BEV2 2HYKA 1SCRA 2PAEA 5HPOA 4CSWA 2D6NA 4HPKB 5IVJA 5JI9A 5IK4A 4JQRA 4RQPB 2G9ZA 2VOXA 4P02B 5IHRA 3GDBA 2RM21 1VBA2 3GBGA 1OMIA 1Q43A 3WV6A 1XNTA 1JU4A 1VRH1 3K77A 1OKOA 2Y6GA 5A3WA 3ILFA 2OQ7A 1HQLA 2RMU1 4JDOA 5DZFA 4BQ5A 5FUIA 4YSFA 2VOKA 1BMV2 1Q8QA 2W1SA 4NRPA 1A3KA 2D3RA 4HK8A 2YROA 5FYBA 1RINA 1W9YA 2W87A 2VNVA 1XB9A 2BEOA 4PF1A 3ZFGB 4B8EA 2JICA 4OMDA 1DQ6A 4P9IA 2ZGRA 3NL1A 5FYYA 2FDHA 2WZR3 1RUOA 1K12A 1UZVA 4AAPA 1SLIA 3RZMA 2W5FA 3T2TA 1MQTA 1AR73 4L97A 5BNPB 4AZZA 4MOAA 1QJU3 1GP4A 1Q56A 1R082 2E63A 2QTWB 4K6BA 5DMYA 2OPKA 5APAA 1XU2A 2DURA 3OUJA 4AFMA 4B4QA 2WSVA 4K3UA 4W6WA 1PNGA 2HWC3 3RZLA 1XXNA 5KHJA 4XMIA 1ZZ6A 5C3QA 2HWF3 5GZDA 5F1RA 4TYSA 1VBD2 2A1XA 2R063 3MIHA 3ZLIA 5JOYA 2R0FA 3ORJA 4HKWA 2WABA 4BHPA 5FMOS 1SPPA 2XJQA 1JBCA 1PVC1 4LBQB 4UW5A 5HCBA 3ZFFC 4CCOA 4DFSA 5I8YA 4GB31 3OPTA 4CEYC 1DU3D 4ZZ8A 4AI2A 3WF0A 5C8CC 4Q4W2 5DDJ1 2NYYA 1HV0A 5BNOA 1ULEA 3HOBA 4Q4X2 4BYYA 4QXBA 3MW4A 4R9CA 5KXBA 2C6SA 4QWNA 5LBCA 3LIHA 3GHMA 2CGPA 1W6OB 4GIQA 1SEFA 3K2OA 5EYXA 4KWJA 4A7ZA 2J42A 1UXZA 4EWDA 4ZONA 2IFWA 4AXOA 1XSRA 2CAVA 5FK7A 5T3NA 4EZ4A 2W95A 5FPAA 1EPZA 5FZ0A 4YGEA 3O1VA 1TME2 4OHWA 1GZWA 2X29A 1V9U2 1ZZBA 2WS91 4JRAA 1W8FA 4Q4V1 4W8JA 1ND3B 1YI7A 1H8VA 2VECA 2VTXA 3JBG3 1QHDA 1XNDA 2GZWA 5FAXA 4XJ9A 4L99A 3ZXGA 1LEMA 3O1RA 4Q1RA 3OGGA 2HWE2 4UF0B 4A3XA 1F35A 2E7TA 4Y5Z0 5GZCA 2FCTA 4CDXC 3SISA 1MEC1 4OUEA 4PLMA 3BVCA 3WW4A 1JYNA 3J7NA 4YZ5A 4FOWA 4YYOA 4XZPA 1UY3A 2BNOA 4P00B 4B1MA 3VBHB 3LKJA 3IIAA 1HIXA 3O0XA 3PVBB 4LR4A 3PHMA 1AR63 1ULDA 2R043 1PGW1 5T52A 1O8PA 5CU1A 4LO8A 2PHRA 1QQP3 3DEMA 3T30A 5JPMB 4DEVA 4O9EA 3F2ZA 3IMNA 5F2WA 3V56A 3IDAA 2A6XA 3CZUA 2A75A 3WNKA 2RJKA 5C3OA 4R9AA 3RMXA 2OVUA 3H3UA 3Q8FA 1SDWA 1SLAA 2XOMA 1Q3EA 3AKPA 2W68A 4Q1PA 5FMOL 3ZFEC 1YQCA 5FWJA 2K46A 4LKDA 2V5YA 1KFUL 2OYZA 2BWCA 1RUF3 1JYTA 2WYFA 4KGGA 2GC0A 3TBDA 2WO1A 4LIUA 4DUWA 5KR7A 4UFMA 2ZGOA 2Z79A 2AGSA 4UFHA 4CDWB 1Y9QA 4DY3A 3J7HA 3AYAA 1C1FA 2GNMA 2Q8DA 1AR91 3AVSA 5FY5A 2BBAA 3PVNA 4FO9A 2ET1A 1JUHA 1PIV1 1CAVB 4CP2A 2D6LX 3VBOA 3C3VA 1BBT2 1YWKA 2V5DA 3M3QA 3DECA 3VD5A 2VUJA 3VZJA 4XABA 4PIZA 4MGQA 1OXCA 2WKKA 5LY1A 4Y33A 5FZOB 3OEBA 3E97A 3THPA 4PBPA 4LE4A 1GQGA 3SQOA 1O5UA 1RHI3 4IE5A 3ZO0B 2GNBA 3POBA 1UYYA 3VBSB 4CDQA 5A6QA 2IXJA 3USUA 3LQCA 5FPUA 3K3NA 3IPVA 1O3RA 5FZ8A 4CUAA 1DGWX 3D8CA 5FBZA 3AKTA 3B7MA 1QJX3 1REFA 4L9BA 2CTVA 4CDUC 2DCYA 4M3CF 2HWC2 4F7ZA 1SLCA 2GMMA 1VJ2A 1EYBA 3IIIA 3W5MA 2WT1A 3M2MA 4HN1A 5JIUA 4AVCA 2W1UA 4UXAA 4CCEA 3W9AA 1NT0A 1TMF1 1ZZ7A 3I59B 3W59A 1HXS1 4A7YA 1SACA 3WP6A 1GZ9A 3WHUA 5FQ0B 1UYZA 2QQJA 2WNUC 3WG4A 4YARA 2ZGSA 3CBNA 1N1VA 2BQPA 2BW8A 4HSJA 1AVBA 3LA2A 4CPBD 3KGZA 4XTMA 1OH4A 1UO9A 5A3UA 3ZXDA 3A7QA 3LFIA 5H9RA 1ULFA 1VAMA 1C1LA 3ASIA 5FYVA 4LIVA 2EICA 3ACHA 4WZFA 5T55A 1WKYA 3OBRA 1L7QA 4A4AA 1RUG1 1ASJ1 5DAVA 1F8VA 1QH6A 4PI0A 4TSVA 2EVXA 3BTXA 5LRRA 2Q8CA 3TNQA 4XIOA 3WEZA 4MXWB 5E6HA 1VAVA 4NPMA 1UAIA 5CFCC 3H3LA 1N3PA 3H8OA 3OY8B 5CYYA 3ZXEA 2KD7A 5TSWA 3RI8A 2A6WA 1US3A 4MGSA 5LB6A 5I0TA 3HQUA 3B9CA 1R1A3 4P5YA 3WF4A 1SBDA 1DGLA 5I8SA 4UBGA 4A41A 3N9NA 4RN5A 1AR62 2R042 2YU2A 2FDJA 2JG8A 2WL1A 3OG2A 3I49A 5K7PA 3UJOA 1QOOA 2XQXA 4MO3M 4XUOA 5EV7A 5BYNA 5ACA1 1GZCA 1FXZA 2W39A 3GALA 3IDCB 5IUQA 3VKNA 1BVP1 2ZMNA 2SBAA 2WUHA 1X7NA 1OVPA 3GZEA 1W6NA 3VDDB 2HLEA 2YZ4A 3MBWA 2FZ1A 3I2DA 4XBNA 3HT2A 4AEDA 4M3CB 4TXWA 2VQUA 3DYMA 1RUI1 1YC61 3H50A 3SITA 1DYKA 2K2SA 2WDBA 4D6RA 2CAUA 2W3JA 3E6DA 1W9TA 3OUHA 1C8M3 5CB7A 4ASLA 5I8TA 1I6XA 4N8MA 4TLGA 2G1MA 2MHFA 3IZOA 3MV01 5G04L 1DZQA 2PELA 2CDOA 3KZ4C 5A1FA 1WD4A 1X9PA 5FJKA 4CU7A 1U12A 2WFF1 3POEA 5FR3A 2GC2A 4IGOA 3MZHA 4HVQA 1QXJA 4I3GA 2OXBA 4JGZA 4N43A 1IPSA 1J1LA 4IV1A 4FAGA 5CG8A 4LK7A 5CKMA 1RUE3 1O5LA 1OOPB 4MGYE 3VGIA 3OD0A 2IXKA 2BGOA 1AX2A 2MEV1 3CDZB 3KMHA 1S0DA 4HKLA 2JG9C 5J98B 2EF6A 1CWPA 2RM23 4RHV1 1LOBA 2I45A 3ACGA 4MSVA 4IV1C 4QB2A 5FOJB 5K0UC 2B42B 1VRH3 3WQ7A 3MF9A 1H0BA 4GAZA 3PVEA 2VOTA 1NUKA 1L7LA 1QJX2 3KCXA 1UOGA 4H3WA 4Y26A 1CAWB 2DV9A 4D7TA 4CCLA 4LKFA 1J83A 2HH9A 2Y34A 1PNFA 1WUVA 3PMEA 2IUWA 3FJSA 3VD7A 5FZMA 3AMHA 4AGRA 1KXGA 1W2UA 2EALA 3DV8A 5BNNC 1UIKA 1RMU3 1BVVA 3DL3A 4XFFA 3OEAA 1RVF1 3MUY1 2VVEA 1RUC3 4D6QA 2ORZA 1XE0A 2WO3A 4O65A 5D2AA 2VW1A 2Y64A 1Q5OA 3VLBB 1LTEA 2G9FA 1VMHA 4LJHA 2D43A 2RJLA 3IB3A 4UW3A 1LECA 5F5IA 1DQ2A 2VAUA 3BGAA 4HK9A 5GLVA 3JD73 3UT0A 5J48A 2WNEA 2EA7A 3J26N 5JXIA 4GZ9A 2JECA 2CU5A 3TN91 4ZS3A 4GMP0 5BNNA 5M0TA 2QQVA 1X82A 4RA0A 3PVOA 3KGLA 1LU2A 1PVC3 4AL9A 5IT6A 3P5BA 3RPQA 1WMFA 4GB33 4XAEA 1XNAA 1O6UA 1FOD1 1ULCA 2P3IA 5DDJ3 3T0BA 1F4HA 3AFGA 2PXJA 1UZWA 4GH4C 3RQ0A 2A6ZA 1CAUB 5L19A 3ZSLA 5HCAA 1DDLA 2JE8A 4AI9A 1OQDA 1Z7S1 5LATA 3EQEA 3KVAA 4Y1ZA 5FZ4A 3V64A 3WNPA 3I54A 4HPKA 3O1UA 3ZFFB 2RS11 4CEYB 1O4ZA 5SV8A 4RQPA 4ASMB 5EJZB 1OH3A 1WW5A 2PHWA 5C8CB 3H8RA 1PM4A 2E31A 2WS93 1YJLA 2FHRA 5CEHA 4ZXEA 1W8HA 2NP0A 2QQOA 2UURA 1LU1A 3ZYFA 3AMQA 3MW3A 4DMIA 4KMQA 5DUVA 3CKHA 4L8QA 2ZAAA 4B7EA 1SPPB 1AXYA 2YU1A 2RR11 2VY0A 4YM3A 3H0OA 1H2NA 4XUPA 1GANA 1MEC3 2HWD1 2ZGMA 3OJBA 4XDOA 5EJ3A 1IKPA 4GXLA 4IE6A 1OI6A 2VMDA 3AKQA 4YG6A 3ZFGA 5CBLA 4XUTA 2X05A 4RR3A 1ZNPA 2XG3A 1S0BA 3B9IA 1W05A 3H1MA 4GD4A 1KS4A 4ZU5A 5A7NA 1AJKA 4C0HA 5FYIA 4CDXB 4Q26A 5ISLA 4SLIA 3SC7X 1SMVA 5LEKA 5BNPA 3OGVA 2X09A 4JV4A 1GYKA 3WLUA 3WP3A 1JZ3A 2UY8A 2ZPXA 3C7FA 3NJVA 4IV3C 4M4PA 1H2LA 4MGKE 2PHTA 1H6YA 4KGQA 5DG1A 2GN7A 2VZPA 3FUOA 1AYM1 4RR3C 1ENXA 1QF3A 3G7DA 2ATFA 3IDBB 2WZPP 4W6YA 3CHXA 3FN9A 1W9SA 1OD3A 2V73A 3DKQA 5JIAA 1RUE2 2OIIA 1E5RA 4P9XA 4EWAA 2D7FA 2JJ6A 1OA3A 5A6XA 5KC6A 3PIJA 3S30A 4LBQA 3VZMA 3ZFEB 1CIYA 3OD4A 4FI9A 2RM22 4EV0A 2DWRA 1HX6A 4LE3A 3ZR5A 4AFDA 5KC5A 1YQ6A 4PT6A 1VRH2 3RNSA 5A33B 2KR2A 5JAXA 2YMZA 2RMU2 4D7YA 2PLV1 1W6OA 2ET7A 2IXHA 2VCCA 3HQRA 3JCIA 5GLWA 1PIV3 5T5PA 2NN8A 2VMCA 3IDEA 2DU1A 1WW6A 1YFYA 3MIGA 4IETA 5I93A 2BBVA 4UYBA 2YUEA 4BQ3A 4NRQA 1ND3A 3O1OA 4F3JA 2VZVA 4IE4A 2Q5TA 5JI7A 5FYSA 2HBTA 2EAAA 3MHZA 2JIGA 2XL9A 3DUIA 3K51A 3POWA 4BCUA 3NJZA 3OYWB 4GJYA 3LEMA 4W65A 2YXSA 1SG3A 5J37A 2VUDA 2Q30A 3IMMA 3K3OA 4XE9A 4MV2A 5LA1A 4BIOA 3NV3A 3VBHA 3LA7A 4YRDA 3WW1A 5GZFA 2XHNA 2B4KA 1FMD1 2DFBA 2PA7A 5FY9A 4FTSA 4E9KA 4EZHA 1GP6A 3WG1A 2GP5A 3RZKA 4HSLA 5FLHA 5FXWA 1Y9MA 3T4HB 2WLPA 1TMF3 1DQ0A 4LITA 1HXS3 4IEWA 2Y60A 4W50A 4CDUB 4AFBA 4YPJA 2ZABA 3N9OA 1MZFA 4QX7A 1PVC2 2W52A 2ZGPA 3KT7A 4XF4A 5DXDA 3WNMA 4GB32 3TEWA 1MVEA 3GJBA 1CIWA 5DDJ2 2VMFA 2RDSA 1EV11 5FY0A 3USUB 2VU9A 4AFAA 3ROUA 4N7UA 1JZ6A 5IK5A 2YFUA 2ZGQA 4Q4Y1 3HNYM 2WNUB 4Q8LA 2J1UA 2WWSA 4PBOA 3NVCA 3ZVXA 4NHYA 2GH8A 1ENRA 4AFCA 3WW2A 1RUG3 1CQ9A 4FOVA 2PYTA 2CYFA 1OFNA 2ZA9A 3AFKA 3LSEA 4QDRA 1NYWA 2WS92 2UU8A 4CDWA 4Q4V2 4I02A 3ZYIB 4NPRA 3HAGA 5FZHA 2NPIA 4CCJA 4QQOA 3AM2A 4PQ9A 3WVJA 5KBFA 2JDZA 2D5HA 1HRV3 3E6BA 3HWJA 2I74A 3MLLA 3MPBA 4PHZA 1IS4A 2FBEA 3E5UA 1CAVA 1RB8G 3J7LA 1JOBA 5LBEA 1KJLA 1Y9GA 1PZ7A 5CISA 2BPA2 1MEC2 2F4LA 1HN0A 5FP9A 2ETEA 2CGNA 5FZ1A 2A3XA 2R073 1JYCA 5BPXA 4URAA 3D6EA 2A3YA 3GCWA 5CFCB 5FZOA 5FXZA 4GULA 1PGW2 1XC6A 3GM8A 3K48A 3VZNA 3I2OA 2WNVC 4DS0A 2JKBA 2EXIA 3VBSA 4N7IA 3KV6A 4IEUA 4YFWA 5T5LA 1CZVA 1XNCA 5LASA 4XCBA 1W3XA 4QGNA 1GQHA 2KXLA 1GLHA 1FT9A 4FPEA 5EQUA 3H3ZA 2AZ5A 1V6IA 2JB4A 2X5IC 2GMEA 1YFWA 2WN2A 3NRUA 2DVGA 4YVWA 2QJVA 1PMHX 1IHMA 4UOJA 1CVNA 4IQPA 1RUI3 3WXPA 1SCSA 3V0AB 1DBNA 4PI2A 4H2AA 2XPJA 2QQUA 1BEV3 3VDCA 4P9LA 3I59A 5DAWA 4DEQA 2JIJA 2DVFA 3ES4A 3I3MA 3ZXLA 5L7OC 1JYXA 4GWMA 1DQ1A 2W2IA 3WY6A 1KDMA 1I1EA 4XJAA 2UYAA 4YVWC 1URXA 4YW4A 5FZKA 5GZGA 4CTEA 5BV6A 1FYUA 1NAEA 4BQWA 1AR92 4E2GA 3PURA 2RDRA 2WFF3 4Y22A 1NLSA 2AEYA 3DGTA 1PIV2 2XMLA 3AL5A 3O14A 2F4PA 4GA9A 2OUJA 4LA3A 5FMDA 2LROA 5FZ9A 4LNVA 4QHZA 4XBQA 5E88A 3WHTA 1N1TA 1Y43B 5FWEA 5I0DA 1P8JA 4MADA 1FPN1 1Q8SA 1W8NA 3O1SA 1DHKB 1UOJA 3GJAA 3M3EA 4MXWA 4QHOA 4QXCA 5J7MA 4RHV3 3OY8A 4ZKTB 3NNLA 1XOYA 4I2OA 2P4EA 2WFPA 3ZPOA 4U2AA 1R083 4HN0A 2JG9B 4QPYA 2YHJA 1IG3A 1WBFA 4XW3A 1OURA 1QY4A 1REDA 1SBEA 3T08A 4IV1B 4XUNA 4JKLA 5K0UB 3I2KA 2R6QA 2EIBA 3ENRA 1B35C 1TMF2 1UPSA 3HN1A 1HXS2 1QWRA 1Y3TA 3IKWA 1ODNA 4XBLA 4DO0A 1PM7A 2PQSA 4AF9A 1RVF3 4S2FA 3HJRA 4G4FA 1C28A 4MHUA 2P1BA 5F6LB 2ARAA 3FZ3A 4KH9A 4YZ4A 3VDDA 4OHVA 2I2SA 4MGZE 3PL0A 3QD6A 2JENA 4M3CA 4JTOA 4OCTA 4Q4W3 4Q4X3 2VULA 3GCXA 1I5PA 1HB1A 1QU0A 1UZ0A 3AZZA 2GNTA 5CG9A 4IERA 4FPFA 1PK6C 3RI9A 4Q8KA 2W9XA 3DF0A 4KI5M 5FYCA 3BUCA 1WA4A 1RUG2 1ASJ2 2NMOA 5IYYA 1O3SA 3KCCA 1LOAA 1TME3 3LIGA 3TN93 4GWIA 1FV2A 2PHLA 2ADEA 2WNOA 1U5IA 2H6CA 2DVDA 4FOQA 1EY2A 5FP3A 3H8UA 4LQRA 3SCFA 3B94A 3R4UA 2D3PA 2HWE3 1SQ4A 2D97A 1FOD3 2EXKA 1OOPA 1OD5A 4PIYA 2DTWA 4IEVA 3NV1A 3RVHA 2XJTA 1VBE1 1S0GA 1H1AA 1ZZ8A 4RD7A 1Z7S3 2QNKA 2VMIA 1C5IA 2YY1A 1DFQA 1VAKA 5IVBA 3GBFA 2VZQA 3EJKA 4FPLA 3AVRA 4RFT0 4GH4B 5ACA2 4XAAA 4QPGC 1J3QA 5IVYA 4BM8A 1LJ7A 1UX7A 5DAXA 3WUCA 4QPIC 4U36A 1QNWA 1AYN1 4NOTA 1CAWA 2QZ3A 3NNJA 2HWD3 1LOGA 2BVVA 4DIQA 4I0BA 4AE2A 5BY5A 3TEYA 3U37A 4H7LA 2CHHA 1HV1A 4UFLA 3SCGA 4AI3A 2WWJA 3E5QA 4D7SA 4Y5TA 2GNDA 5FZ7A 3UV9A 4LEJA 4WM7A 3IAPA 4NIIA 1GWMA 2KA3A 1RUD1 4QU2A 1UY4A 3KM5A 4LOTA 2A6VA 1AYM3 2WFF2 4HLTA 3FX3A 1WLTA 2FMYA 3Q8CA 4IV3B 3X29B 1BBT3 4WM7C 4ORFA 1NA1C 2GAUA 4KWLA 3ILNA 3N9LA 4FTEA 2MEV2 4UWDA 1V70A 2BU9A 4AEMA 2QCSB 4RR3B 5CKNA 1XYNA 3U14A 2IFRA 4P9WA 1S0EA 2O0OA 1WLDA 4GJZA 2BERA 3VHOA 1QNYA 1AXZA 4RHV2 1CAUA 1ZZCA 4K8FA 1AL0G 2PLV3 1PO11 1W8ZA 4IEZA 4YW3A 5FZIA 3O12A 3ZFFA 5KHKA 1MZ5A 4CEYA 4XJWA 3NW4A 3NV2A 5C8CA 1OC1A 1CGPA 4HXCA 4XACA 2Z2SB 1LKNA 1YQ8A 4IEYA 5B4XA 3TNPB 4DXZA 4XF3A 4CA9A 4NIGA 1RVF2 2Y8KA 4ITCA 4XJ8A 4XXPA 1BZWA 3HIFA 1VLNA 4OYUA 3IWZA 4UI9L 4Z07A 1NCQC 3NO8A 3BPSA 2A71A 1DLCA 3I7DA 5KWRA 4D8MA 3ZKUA 5FP8A 3ZPYA 3KSCA 1FMD3 3LOIA 4NE9A 2VE1A 4E4DX 4WM8C 4CDXA 3KQ4B 4HVRA 1KS5A 4OI2A 4OHYA 1NCRA 3TN92 1AHSA 1VMFA 4IEOA 1RUH1 3I2IA 1MS5A 3T1LA 3T2PA 1AR82 3A21A 3OGSA 5FP7A 3ZDVA 3AYDA 3DXTA 4K7JA 4JKMA 2XR4A 4QX0A 1V6KA 1SBFA 1FOD2 5IVVA 3O7OA 2ZGNA 5FY8A 1EV13 4YG0A 3FHAA 1QJEA 4RSUA 1NCRC 1UU6A 2PTMA 1YO8A 4BJ0A 1Z7S2 4IEQA 4Q4Y3 4Q27A 2IVJA 5C5UA 5CADA 2K0GA 1JS9A 3T1MA 2RS12 2I07B 1HDKA 3B5LB 3ZFEA 2RE9A 3HD8B 4XIKA 3KQRA 1G9AA 5C7GA 2NM1A 1KEXA 1JODA 4LLOA 1OLME 5EIYB 1JHNA 1J3PA 1W6MB 5A33A 2XJUA 1T6BX 5HBAA 2VQ0A 5JWPA 2VZ1A 4CXXA 2RR12 3BALA 3C7OA 3G6JB 3FBYA 4IE7A 2VVFA 2HWD2 1FNZA 3DN7A 2OZ6A 3WDTA 1VE0A 5LEJA 2J1RA 3LWCA 4QXHA 4GWJA 4AHZA 4AK3A 5KHGA 1A8MA 4J6GA 5LBBA 4N53C 1RXFA 2V72A 4QX8A 1OF4A 3ZSMA 4YFZA 5IATA 1DF0A 1ST8A 3OYWA 2JDYA 3NQHA 2R16A 3VBUC 1YLLA 4C8DA 5LCWL 3NWKA 2VNRA 2B9UA 3FUQA 4URTA 3NNGA 3POSA 3Q8BA 1LOFA 4BLJA 1AYM2 2WNVB 1LOEA 4XCAA 2ZEXA 2VGDA 2MPFA 2V4AA 1UL9A 4PIXA 4XQ4A 5HV0A 1CR7A 2Q1ZB 1CPNA 1L3JA 4Q2FA 4XQDA 5FZ3A 3Q8AA 1XE8A 2X53S 2X5IB 4CDUA 2WQZC 1HB2A 1LOFC 4XEZA 3RG0A 1YCIA 4YM1A 3KF3A 4H55A 3ATGA 2WZ8A 5C70A 1NG0A 2TEPA 3E6CC 1WMEA 4CU8A 1ULPA 2PLV2 2WNUA 5I91A 1COV1 5FYTA 3M3IA 5C5TA 3SCHA 1KDKA 4YVWB 1S2BA 1YQ5A 2D98A 4ZY9A 3WQBA 4QDSA 4XFHA 3M3OA 2ZHMA 1FPN3 1MZ6A 1NE6A 2ARBA 3DCQA 3BB6A 4IW3A 5H9SA 3MLKA 3VHRA 1AL21 5JOZA 3BKZA 3BOPA 1H1IA 4I30A 1UKRA 3A23A 2IXIA 5DG2A 2QDRA 5IFPA 1TE1B 4PJYA 1QMJA 3C7EA 4MXVA 5IAVA 3ZMNA 1W2TA 5CFCA 4Y22B 4BISA 1FMD2 4BK4A 4QB1A 2ZMLA 5F2SA 4L0PA 2BGCA 3NKTA 1HJGA 4JDNA 4M0HA 1V6OA 3OTFA 5FZ6A 4AYUA 3ZYJB 2Y6HA 2WT2A 4LBKA 3RGBA 5JR2A 3ES1A 2R7EB 1XBFA 2CY6A 3HVDA 2WQ4A 1WCUA 5GJ6A 3ZN5A 4CVUA 3V65A 1MS8A 2FQPA 3BIWE 1POV3 1MS0A 1UOBA 1U5XA 1M4WA 2IWGB 3RZZA 1WZXA 3M7AA 1EV12 1B35B 4IXLA 3V0AA 3VBFC 3VD9A 2GC3A 4Q4Y2 2VO5A 1UPIA 3LPFA 2YGMA 1D4M1 3ZXKA 1PVXA 4ZS2A 4G9SB 4K8RB 4PLNA 3APBA 3RFRA 1NZCA 4Q29A 1VBC1 3GNEA 1XQNA 1PK6B 2Q1FA 2LW8A 5BXXA 1OA2A 1A8DA 1AJOA 4I0AA 2GSYA 4LKEA 1TVGA 2RVAA 5A3OA 3RSJA 4AI8A 4FQZA 4WVMB 3DYOA 5JUVA 4FFGA 4HONA 1VBB1 4KWUA 3I2FA 1VBE3 2UYBA 1DZRA 3POIA 2WJSA 5DAQA 1LRHA 1DYOA 3PUAA 3CJIC 3OGJA 3POYA 3U75A 5F37A 1G9DA 3JQXA 3QBQA 2Q8OA 3SNMA 3N9MA 2W92A 1GNHA 1OBNA 2AEZA 4BDVB 5LY2A 1ND2A 4JX0A 3C7GA 4W4ZA 3DXUA 4M00A 3EXUA 3S0MA 4Y1UA 4NWVA 3HQXA 2JG9A 5KXCA 3WG2A 2ZX1A 4MZUA 1KRIA 2PMWB 1GOHA 1MS1A 5F3CA 4FQ4A 4QPGB 5K0UA 1O7FA 1R091 1F31A 1XE7A 3AKSA 3F95A 2A5ZA 1ND2C 4FXGB 4QPIB 4CPBA 5EJ1B 1BK1A 4EN7B 4KBBA 5T54A 2ZCWA 1ZRDA 1ZBA1 3HN3A 3GXUA 3ECQA 3QH7A 4A45A 1RUD3 4JGYC 3OB8A 1GSLA 4AVAA 5C33A 3IN9A 5FKCA 2O14A 2OX0A 2Y6JA 2WR9A 1UU5A 1K42A 2A3WA 4DB5A 4YW2A 2RMU3 4KG0A 4QKDA 1LENA 1CPMA 4Y1VA 4ATFA 1GUIA 1R64A 1OSGA 2P2KA 1S1AA 3LAGA 2KM2A 2Z4FA 3MIDA 4AGVA 1QKQA 1FPN2 4QD2A 3RMYA 4BU2A 5H9PA 1BXHA 4JCKA 2AUYA 4AWDA 3ZSJA 5L73A 1W6PB 4AOCA 4A44A 2JD9A 3A22A 3PTYA 2ADDA 3R4SA 3N7MA 2DBIA 4WM7B 4BLIA 2LS6A 1NA1B 3URFA 2E32A 4Z8BA 4ISQA 2AACA 1TEIA 1JZ2A 2F6BA 4CP0A 3J7MA 5C71A 2QBXA 5FZFA 4YVSA 1NE4A 3EMRA 1YIPA 2EXJA 3CMGA 2R0HA 1BQPA 4ZU4A 3WCSA 1W8TA 4GH4A 4XURA 1CZSA 4BB3A 3BI3A 2JX9A 3UKVA 1PMJX 5L36A 1O3QA 3C7HA 4RGGA 3OOXA 1JYIA 3KV5A 1JTZX 3I3BA 5GLTA 1AR81 4LOSA 4TZDA 4YVSC 5GALA 3HEIA 5H9QA 4LUMA 2DYCA 1ZA4A 1IS3A 4QHBA 4XYXA 5DPNA 3INAA 3KVBA 4J1WA 3SMHA 3BIEA 3C2UA 1WCSA 2JE7A 2ZACA 3HR9A 1NKGA 2DCJA 4PDWA 1GU3A 4XFCA 3N4MA 1JXNA 2UWCA 1CD3G 4QM9A 4R52A 4RGAA 4YLZA 1NCQB 5A7SA 5I0SA 4Y20B 3ETQA 1OUSA 2JWPA 2WAOA 4LXLA 5A1AA 1RITA 2VMGA 5C4WC 2VR4A 5LA9A 4DRVA 4DY5A 4Q4V3 1RUH3 4EN6B 1K5JA 4BPZA 5JZGC 5F3GA 2D6OX 4JHTA 3CO2A 4WM8B 4AEJA 3AP7A 2XH6A 1MVQA 4LO5B 4PDWC 5EPAA 4J1XA 3SLIA 1W9WA 5F5QA 1NQJA 5A7PA 4EN9B 1YQ2A 3N35A 4IV3A 4YZ2A 1DG6A 1YFUA 2YB7A 2VPVA 1VBE2 1NZIA 4LO6B 4E4ZA 2BGPA 1YRZA 1WCKA 4OQ8A 1AX1A 1HJFA 1GWLA 1QOTA 3ACFA 4AW7A 3D3AA 2WAAA 2O8QA 3OUIA 4A6OA 3B69A 1ZBE1 4FPJA 1DYPA 1LHVA 4QKFA 2IZWA 1CJDA 2C9KA 4CP1A 2VXRA 1NCRB 4ET7A 1MS4A 3AXDA 1E5IA 3O0VA 2PN5A 3PJQA 3RWNA 2JDHA 1G7YA 4BIFA 2V09A 1R1ZA 3PUSA 4COZA 1ZVFA 3RYKA 3AC0A 1HLCA 3ZSEA 5A6ZA 1AYN2 5JXGA 3V0BB 3I2GA 3ZOIA 2HBUA 3ME2A 2WINB 2ZMKA 1MR5A 2VZTA 4XJZA 2DUPA 2VH9A 1AZDA 5F8PA 3VKLA 4M4RA 4F8AA 3VUOA 3ETPA 4FFHA 5LRSA 1HKDA 4OUMA 3UL2A 2WZEA 3ACIA 5A3PA 4XDQA 5FP4A 2C5DA 1LGCA 3NAPC 1C8NA 1IS5A 2XJPA 3SH3A 3VN4A 1W2AX 2E53A 3AK0A 2XB6C 1V6LA 4X6RB 4NIHA 1RUD2 1CAXB 1K3IA 3NNFA 2WRAA 1IPJA 5AFEA 3WOGA 1AR93 5G05L 1GP5A 3I3QA 3R05A 4N53B 4MYEA 4NUBA 2ZJCA 4RGKA 4UAPA 4TTGA 3VBRC 4E8DA 1LCLA 1LHOA 3UETA 1IQAA 4QX3A 3ZXFA 4D94A 5FYHA 3VBUB 3S5QA 5E16A 5FUPA 4FP2A 3CQOA 4R4ZA 5D8AC 5DABA 3T0DA 4Y4YA 2WZR1 4LBNA 2ERFA 1W2NA 3POJA 1IG0A 2ID4A 2W1WA 5D21A 4AQTA 3ZR6A 4I01A 3UGFA 1AR71 2HEWF 3I3DA 4A3ZA 3M70A 3TOJA 1QJU1 3AP6A 3FMGA 1E5SA 3AZXA 2YBSA 4RYDA 2W91A 3UKTA 2VUAA 4S2GA 1HB4A 1PO12 2VZOA 5FLIA 2NQYA 1PO21 1EP0A 4IDZA 2VBPA 2W47A 1VIWB 5EP9A 1UD1A 1NLQA 4COWA 4EJRA 4OQ9A 2ZEZA 2HWF1 5A70A 2R061 1G6NA 3JU9A 3N7KA 5GM0A 5DZEA 3MIBA 1AL23 1W6MA 2AH2A 2CNAA 3VDBA 4ONUA 5IW0A 2FDKA 2XDVA 3OBTA 4NHXA 2B5HA 1HW5A 2NZ9A 3U0ZA 2D93A 1Z0HA 3ILRA 4Q0SA 1UQXA 3NJXA 2ZX3A 4FPOB 2C9AA 2TBVA 4QB6A 3FHQA 3FL7A 3LOBA 3QCWA 4LBLA 5F9TA 1V00A 1RL3A 2PQQA 2XLGA 3POGA 1XNKA 1ASJ3 3KT1A 4ZXKA 2Y6LA 2BJSA 3VBSC 4GMP1 3GF6A 1RUH2 2C0ZA 2VOWA 1F5JA 5EWSA 1MS9A 1WCDJ 5T5OA 4FCAA 3GBWA 3JBG1 3LB9A 3PDQA 4P08A 3WDUA 2WNVA 4FBFA 1X33A 1EAH1 3UK9A 2LUWA 3WNXA 4WV8A 1QOSA 3UYJA 4MGTA 1O3TA 2HWB1 5J1XA 1GZTA 2VM9A 3AP5A 4QX2A 1QGLA 2X5IA 4XHXA 5IAXA 2RJ2A 1D4M3 1SFNA 3LE0A 2HEYF 2WA3A 2Z69A 3T09A 2XONA 1RC6A 1QQP1 1X8MA 1QJY2 4XHBA 5A7OA 3VBFB 4CUGA 1N47A 5ACA3 1VBC3 1LAJA 3EYPA 2YFZA 1KJRA 4K20A 4BA6A 5FPXA 5L7OA 5B2GB 2WT0A 2XL7A 3M3CA 4G3YC 4CE8A 2P34A 2BUKA 2OKXA 2Y38A 4MVTA 3WNOA 1S0JA 1WA6X 2DCZA 4CEWC 1VBB3 1OA4A 1A78A 1Y4WA 1QDCA 1F2NA 5CFDC 4OI0A 4NMIA 1D4VB 4NO4A 3EO6A 1PGSA 3S7EA 1RUF1 2AYHA 1O4YA 2RDQA 1WCQA 2PHUA 2ZHNA 1GWKA 1STMA 1ZA7A 4L11A 1LHNA 1PZ9A 1RJ7A 3CNAA 5FK8A 2PFWA 3P1IA 4LA2A 3KF5A 1YUDA 2VJXA 3QOPA 5LZ6A 4LMFA 3WF3A 1UOFA 2DU0A 4B1LA 5CA6A 3CJIB 3W21A 4GKYA 2B9VA 4QT6A 5SV5A 3T3YA 4AHXA 5F6KA 3HMYA 4CP9B 4CUCA 4Y5SA 1R093 2VMHA 4B4RA
chains in the Genus database with same CATH topology
1NXMA 4XF1A 2NLRA 4EN8B 2MEV3 2XJRA 1HRI1 4KG8A 3VZLA 4FOYA 3DPRC 3ZYRA 3ZIXA 4D69A 1RHI1 2B39A 3WDWA 5FO9B 5CIRA 4UW6A 1B35A 3TAYA 1ND2B 4EWEA 1N3QA 3D82A 3CF6E 3PMSA 3WP5A 3LGRA 5AVPA 1COV2 4GKXA 2XLFA 4JGYB 4LBJA 4AEKA 5JMCA 4RS5A 2QKDA 2RS51 4YG3A 3RS6A 1J59A 1AL22 1PK6A 3WUDA 2YC0A 5AC91 2XUMA 4B3NA 3B3QE 2Y0OA 4QGMA 3THTA 3OCPA 3CLPA 2O1QA 3N3HA 1NOVA 2QUOA 4WVMA 1D0HA 3WD5A 1YNAA 4XFIA 1JH5A 3ZMOA 1Q8PA 1QH7A 1DLLA 2H6BA 4RS5C 3AB0A 2QVSB 2ZGUA 5CVRA 2R1DA 3MDPA 4IL7A 2GDFA 4I0WB 3AYCA 4PLOA 1OLQA 2R32A 3AKRA 3FFZA 5JDBA 1V6JA 2H0VA 4AVTA 4YZ3A 4AVSA 3FE5A 5A3LA 4JVAA 1AR83 1VB2A 3RJRA 4QPGA 4FPHA 1N1SA 4C1WA 1K5MC 2A70A 3VL8A 1R1A1 4INDA 4QPIA 2VVDA 1TNRA 4GALA 3WW3A 4Z2WA 1Y7BA 2E9QA 2RS13 1D4M2 4YVSB 1RTVA 3RYRA 2Q4SA 3O0WA 2GMPA 5FOBB 1VBC2 3WDVA 4HKOA 1KD7A 5HXVA 5FTTC 2RR13 5JPNB 4K9SA 1Z78A 1I5ZA 1ZRRA 4HT1T 1BKZA 5C4WB 2TUNA 5FCCA 1VBB2 2XVLA 2JXAA 1X36A 4AHWA 3FLTA 5A32B 1MACA 2HJIA 4XILA 3WT3A 1LHUA 3BODA 5FREA 3VHPA 4PDWB 1W6PA 1C8M1 1ZBE3 2ZGKA 3M4FA 4YW5A 1NA1A 4FTBA 2H0BA 2PAKA 2UY9A 3IBMA 4OHXA 5I0UA 4A2UA 2GU9A 3J8F1 5FPZA 4BWOA 4OULA 2YDEA 1R092 2YPJA 5LK7B 5KXDA 2D6PA 1PMIA 2NMNA 3W58A 4FSJA 4P9JA 2RHPA 2WA4A 3ZYGA 3MEPA 1ZBA2 1OPMA 1C5HA 4COVA 1NY71 1S0FA 2ARXA 1J58A 4HMZA 3VHNA 3NAPB 2HEVF 4KNCA 1SLTA 4V1PA 1H1MA 1N1YA 1BJQA 2X8KA 1NCQA 4C1XA 4Y20A 4F83A 3GYDA 4YGDA 5JCTA 3JB8A 3ZDSA 4HL0A 2P3JA 1APNA 3VBRB 2XWBB 1RMU1 1UW8A 4WM8A 4EROA 1RUC1 1YFXA 2XWJB 1RIRA 2AR6A 4XF9A 2PHFA 1SLBA 3R0RA 5D8AB 3ZN6B 3MW2A 1CX4A 4C91A 1ULGA 3P3NA 1WD3A 4BQ1A 1EPWA 1PO23 3JD71 4P14A 4XQWA 5JLVA 1F5FA 1WW4A 3A4UA 2N7GA 5AFBA 1MQTC 1OQ1A 3FWEA 4Y24A 5D1IA 3MFAA 4YGBA 1QDOA 2BWAA 4X8PA 3V0BA 5ABJA 4BZ4A 2ZOEB 1T6GC 2W0XA 2XVKA 3JQWA 4OI1A 4R9BA 1HQWA 1RUJ1 2RS31 1PHMA 3FBMA 4FPYA 1G86A 1LEDA 1NQDA 2EIGA 5AVAA 5EYYA 1H30A 1CJPA 4L2NA 1PGL1 4LO4B 1REEA 1QJY1 1CAXA 2AENA 3KCYA 4GMP3 5ABJC 2QZ2A 5BNOC 3N7LA 4N53A 3WDYA 2CV6A 3VV1A 1LGNA 2P37A 2PAMA 4P5HA 1EAH3 3ZXJA 4LHKA 4B7KA 2B8MA 3KD4A 5BUVA 5JSRA 4Z82A 1H9WA 2E7AA 3VBUA 1S0IA 2K9ZA 3HT1A 4BMEA 1FV3A 2HWB3 3PNAA 1IPKA 5HI0A 2ZZQA 3KS7A 2OA2A 4YM0A 4OZXA 5K8SA 5DZGA 1ONAA 1ZBE2 3L2HA 1O4TA 3N36A 4QM8A 3IM0A 2VOVA 1UZYA 5DUXA 1U5YA 1LESA 1N3OA 4HBNA 4UW4A 3FLRA 3HBZA 2SLIA 1ZM1A 1WBLA 2E51A 2A73B 4YGCA 3SHRA 2GALA 2BVBA 4AI1A 5J96B 4GQ7A 5E1RA 4M3CE 2DTYA 4FAHA 5C9AA 3VZKA 5FDBA 3WZ1A 5JOXA 3EBRA 3H7JA 3AX4A 2QQPA 4NHKA 1D2SA 4XF0A 1H4GA 1XNBA 4Q0PA 1XYPA 4AHYA 4CEWB 1MS3A 2DUQA 1J3RA 2XKPA 4NVPA 5CFDB 4UBHA 1XYOA 5C9AC 4MGIE 1DIWA 1ALYA 1UKGA 1WLWA 5JR7B 5L7OB 1YHFA 2MNGA 4DPNA 1LGBA 2Z42A 1LR5A 4AGGA 3MICA 3BOWA 3UJQA 1HRI3 1V6NA 2XHKA 2WZR2 2ZX0A 4JTNA 2W08A 4QMAA 2GN3A 1AR72 3VBOC 4BMBA 1QJU2 2PHXA 1NLRA 2Y26A 3DPRB 2UWAA 3U11A 4HFSA 1G9BA 1FX5A 4ES9A 1PO22 1IGOA 4HZFA 2HWF2 2EAKA 3VBFA 2R062 3GZAA 2RS53 4M0NA 4CDQC 4HETA 4P9GA 1KFXL 3AP9A 4KWKA 1C4RA 2OUHA 5AC93 2WIIB 3FHIB 4E2SA 4QQHA 2DCKA 2Y0IA 3A0KA 3VKMA 4E4SA 3NV4A 4FT8A 3WQ0A 1GNZA 1UCXA 4DRRA 1X50A 4NN0A 1JW6A 1OLRA 5BNQA 4RS5B 3NSTA 1SLLA 3CJIA 3JBG2 4EN0A 4COUA 1LOCA 4DQAA 1HRV1 2B45X 2CL2A 3SXWA 1EAH2 2FZ2A 2D3SA 2D6KA 4MX3A 3N7JA 1W0PA 2HWB2 2JE9A 4AQ2A 2R071 1XRUA 1W6QB 4FPKA 3AP4A 3ZN4A 1F9KA 3ZXAC 1QQP2 1K5MB 4OUSA 3TB0A 1U0AA 3ACLA 4Z1VA 3RRDA 3CEWA 1AYN3 3AJZA 4JGYA 5FLJA 3J4UH 4IEXA 2JG8C 1UX6A 3GZUC 1BYHA 1H8TA 1I3HA 4QQLA 5J3UA 4DNYA 2XBO1 1BEV1 1GKBA 4S2HA 1RUF2 2ZS6B 4IESA 4OHZA 5E8AA 2Q1MA 3BU7A 1GV9A 1WW7A 1VB4A 1J1TA 2DUOA 2ZKNA 3UKNA 3BCWA 4B4PA 3MI8A 1VBA1 3R6SA 3D0JA 3WR0A 2BYVE 1FATA 2P17A 4XPVA 4AEDC 1H8TC 1ZRDA 1DGWA 2DCTA 2QE3A 4LHLA 3OF1A 1BMV1 3J8F3 4BH9A 2CGOA 3D0SA 4PF5A 3ZSKA 1IS6A 1AUYA 4MLOA 1HRI2 1LHWA 4Q0VA 4WBBA 1NXD1 3S7IA 1RHI2 2VNGA 4OI4A 4JGZC 4N9HA 4N43C 2P3KA 3AYEA 3ZIWA 1YJKA 3BTAA 2WSUA 1PZ8A 3E5XA 3B02A 5JVVA 1R081 1HQNA 3OPZA 1PO13 2XLAA 4IEPA 4CZSA 1E57A 1CESA 4E27A 3BPZA 1KITA 5GLUA 1ZREA 2RS52 4NR1A 1VBD1 5A3MA 3H1WA 3M1HA 3ELNA 4TWTA 5AC92 4R8HA 2ZGLA 3LSDA 2ZBJA 3KLSA 3MLJA 2OZJA 2WLQA 4MH0E 4I3PA 2ZGTA 4FPCA 5C4WA 1JN2P 2ILMA 4Q4W1 4WZCA 1M06G 5JZGA 3AMMA 4Q4X1 3GZTB 4LBQD 5A32A 2ZHLA 4N9IA 2ZHKA 2BNNA 1G8WA 2XJVA 1TME1 1V9U1 3EHKA 4SBVA 5K9YA 4KU7A 3WCRA 5I0RA 1AF9A 3H7YA 4P9YA 3TWIA 5EFUA 5EXOA 1H4HA 2HWE1 2ZX2A 3AMNA 1MQTB 5E89A 2ZKLA 1R1A2 4LUKA 1H2MA 4LT5A 1RUJ3 2RS33 2R1BA 4COYA 5BNNC 3MYXA 2G4IA 1OPOA 3RJ2X 1TQ5A 4C90A 4NHMA 4L92A 4ISRA 1QJY3 4Z92B 3J9SA 3CJXA 3NAPA 1IZ3A 3MFCA 5C8WA 3B93A 3LCPA 4QGLA 3WDXA 1ZYBA 4D3WA 1Q8OA 4TLFA 4W6XA 4RQPC 1TNFA 1VR3A 5ABJB 2IC1A 5BNOB 2AREA 2D5FA 2CWSA 3VKOA 1H2KA 4XMAA 3VBRA 1B09A 4ATEA 5KXEA 2OW4A 1C8M2 4Q0UA 4BE3A 4YW1A 1UF2C 5DUUA 2YGLA 1ZRFA 3S6PA 3QLQA 1GZWB 4AQ6A 5D8AA 2BNMA 3U10A 3ZN6A 4XTPA 3L9JT 3ZFGC 5CAZA 3J8F2 1OQEA 2IXCA 3D4KA 4AG4A 3DKWA 4QQPA 4OVEA 2ES3A 4K1ZA 5EZWA 1U5ZA 5C6CA 4LTAA 4KQ7A 1BBT1 2JEMA 2LM3A 4C0BA 5BNPC 1OHFA 3AZVA 3PLQA 3RDIA 4XETA 1C3HA 2E6VA 4FXKB 1NY72 4LBMA 2XVGA 1DQ5A 1YI9A 4DINB 1UIJA 2WC2A 1D0GA 1UN1A 1COV3 4DOUA 4QXKA 5JSPA 3P3PA 5JSOA 3SH4A 2GC1A 2HWC1 3SH5A 2VW0A 2Z5WA 3B00A 2BFUS 3VKFC 5C9AB 2LTNA 1X8EA 1LULA 4N90A 1RMU2 2ZZJA 2O8OA 1RUC2 3WINE 1POV0 5IK8A 2HKXA 4K40A 4OLLA 5KHIA 1DGRA 1G9FA 4XFBA 4AQSA 4PCRA 1GBGA 3U4XA 2VG9A 1ZX5A 1ND3C 1QXRA 3JD72 2D44A 1W0OA 4FPGA 4MUVA 3VBOB 3CU7A 4Q0QA 4X6QB 5GZEA 1RUNA 5GLZA 4WVWA 3VBHC 5T50A 2DVBA 1YXWA 4CDQB 3LZZA 3IT8A 1LB2A 3IPVB 4K21A 1RUJ2 2RS32 2B46X 4ES8A 3RYPA 1OKQA 4META 2TNFA 4LHNA 4BOWA 1AR61 5J36A 2R041 4CEWA 1G9CA 3CL1A 2XGXA 1PGL2 3QACA 5CFDA 2UWBA 3WG3A 1QJZA 1XU1A 4AVVA 3AXEA 4YZ1A 3H9AA 3VL9A 1SFYA 2BFUL 2YYOA 1DGRN 3AJYA 4B29A 3LA3A 5GKAC 1VALA 4HANA 1S2KA 2R30A 4XFGA 3JB4C 1QXPA 4CDWC 1W39A 1C57A 4Y1XA 3TYJA 3JZVA 3ST7A 2A6YA 1JUIA 3JUUA 3PJYA 4XXAA 4O9GA 4NHLA 4RL7A 3M8LA 4QQ2A 4H7MA 1AXKA 1CONA 1UU4A 3DPRA 1KQRA 3U07A 4DZGA 4FP3A 4M01A 3ZYPA 3AZYA 4WVZA 2LALA 3VBSC 2IXLA 2Q0AA 4GWNA 1DZTA 2XBO3 2VQAA 2QFEA 5T5JA 5JOWA 5FQ0A 2VNOA 2A7AA 5CNAA 2JD4A 1WMDA 2JG8B 1ZBA3 4JC1A 4H14A 1LODA 3AMPA 1VBA3 4YNIA 5LK5A 2R49A 4I09A 4AI0A 3MGUA 1I9RA 3A0NA 4R9DA 1O91A 5FRAA 4R4XA 1WLCA 1QJX1 1W6NB 4E2QA 4FVVA 2D40A 1S0CA 1Q8VA 1RJ8A 4XFAA 4AEDB 1H8TB 2GH2A 2XKOA 2ZX4A 4JAAA 4LLFA 2FMDA 1DQ4A 2BTVC 2PHDA 4LBOA 3FC0A 5FFOC 1BCXA 5J09A 3ALQA 1CN1A 2CWMA 3I4IA 1GR3A 4A7KA 2DF7A 1W6QA 3D5OA 4OFGA 3TRSB 2D6MA 2G9GA 4JGZB 4N43B 4XJUA 1ZZ9A 1A6CA 1K5MA 1VBD3 3ZX7A 1AX0A 4QX5A 2ZAHA 3FLPA 4NWWA 2ENRA 4CYDA 3QH6A 2E7QA 1ENQA 1POV1 3FFQA 1FNYA 4CRQA 3KB5A 3WP4A 3I8TA 1WGPA 3AZWA 3MIEA 5HCFA 1YIFA 3H1YA 5IK7A 1OFSA 5KHHA 3WX5A 4JDMA 3O5SA 2EXHA 2VW2A 4KL1A 4XOGA 2C1FA 4ZU7A 1GFF2 1ENSA 4LULA 3VDDC 3VZOA 1GICA 1S55A 1V9U3 3KT4A 4LO7A 1D2QA 3GHNA 4YM2A 3MF6A 3B01A 1HRV2 3USSA 4JRLA 1MZEA 4S2DA 1YYNA 1FI2A 3Q9OA 2R072 1UZZA 5JZGB 4HVOA 1RGSA 4K1YA 1H9PA 1V6MA 3MIFA 2XJSA 2B7YA 3R4DB 1FAYA 1IKQA 2QDNA 5BNNB 1VP6A 1OOPC 4AVBA 2DFCA 1UMZA 5DUWA 5FO7B 3L2YA 5FO8B 2YV8A 2DVAA 3WQ1A 3NKGA 1IOAA 1RUE1 2ZTNA 1RUI2 3MPPG 4KU8A 1JOJA 4WVVA 4X8NA 4Y1YA 2XBO2 1BEV2 2HYKA 1SCRA 2PAEA 2D6NA 4HPKB 5JI9A 5IK4A 4JQRA 4RQPB 2VOXA 2RM21 1VBA2 3GBGA 1OMIA 1Q43A 3WV6A 1VRH1 3ILFA 1HQLA 2RMU1 4JDOA 5DZFA 4YSFA 1BMV2 2VOKA 1Q8QA 1A3KA 2D3RA 4HK8A 2YROA 1RINA 3ZFGB 2BEOA 4B8EA 2JICA 4P9IA 1DQ6A 2ZGRA 3NL1A 2WZR3 1RUOA 1SLIA 3T2TA 1MQTA 1AR73 4L97A 5BNPB 1QJU3 1Q56A 1R082 2E63A 4K6BA 2OPKA 1XU2A 2DURA 4AFMA 4B4QA 2WSVA 4K3UA 4W6WA 1PNGA 2HWC3 1XXNA 5KHJA 4XMIA 1ZZ6A 2HWF3 5GZDA 5F1RA 4TYSA 1VBD2 2R063 3MIHA 5JOYA 2R0FA 4HKWA 4BHPA 5FMOS 2XJQA 1JBCA 1PVC1 4LBQB 4UW5A 5HCBA 3ZFFC 4DFSA 5I8YA 4GB31 4CEYC 1DU3D 4AI2A 5C8CC 4Q4W2 5DDJ1 2NYYA 1HV0A 5BNOA 1ULEA 4Q4X2 4BYYA 4R9CA 3MW4A 5KXBA 2CGPA 3GHMA 1W6OB 4GIQA 1SEFA 5EYXA 4KWJA 4A7ZA 4EWDA 2IFWA 4AXOA 5T3NA 2CAVA 1EPZA 4YGEA 1TME2 4OHWA 1GZWA 2X29A 1V9U2 1ZZBA 2WS91 4JRAA 4Q4V1 1ND3B 1YI7A 1H8VA 2VECA 3JBG3 1QHDA 1XNDA 2GZWA 5FAXA 4XJ9A 4L99A 3ZXGA 1LEMA 4Q1RA 3OGGA 2HWE2 4A3XA 5GZCA 2E7TA 4Y5Z0 4CDXC 3SISA 1MEC1 4PLMA 3WW4A 4YZ5A 4FOWA 4YYOA 4XZPA 2BNOA 3VBHB 3LKJA 3IIAA 1HIXA 3O0XA 3PVBB 4LR4A 3PHMA 1AR63 1ULDA 2R043 1PGW1 5T52A 5CU1A 4LO8A 2PHRA 1QQP3 5JPMB 4O9EA 3IMNA 3V56A 2A6XA 2A75A 2RJKA 4R9AA 3RMXA 2OVUA 3H3UA 4Q1PA 1SDWA 1SLAA 3ZFEC 1Q3EA 3AKPA 2W68A 5FMOL 2V5YA 1KFUL 2OYZA 2BWCA 1RUF3 4KGGA 2GC0A 3TBDA 2ZGOA 2Z79A 2AGSA 4CDWB 4DY3A 1Y9QA 3AYAA 1C1FA 2GNMA 1AR91 3PVNA 4FO9A 2ET1A 1JUHA 1PIV1 1CAVB 4CP2A 2D6LX 3VBOA 3C3VA 1BBT2 1YWKA 3M3QA 2VUJA 3VZJA 4PIZA 2WKKA 3THPA 3E97A 4PBPA 4LE4A 1GQGA 1ZRCA 1O5UA 1RHI3 3ZO0B 2GNBA 3VBSB 4CDQA 2IXJA 3USUA 3IPVA 1O3RA 1DGWX 3D8CA 5FBZA 3AKTA 3B7MA 1QJX3 1REFA 4L9BA 2CTVA 4CDUC 2DCYA 4M3CF 2HWC2 4F7ZA 1SLCA 2GMMA 1VJ2A 1EYBA 2WT1A 3M2MA 4HN1A 5JIUA 4AVCA 4UXAA 3W9AA 1TMF1 1ZZ7A 3W59A 3I59B 4A7YA 1HXS1 1SACA 3WP6A 1GZ9A 3WHUA 5FQ0B 2WNUC 3WG4A 4YARA 2ZGSA 4HSJA 1N1VA 2BQPA 2BW8A 1AVBA 3LA2A 3KGZA 4XTMA 3ZXDA 5H9RA 1ULFA 1VAMA 1C1LA 3ASIA 4WZFA 5T55A 3OBRA 1RUG1 1ASJ1 1F8VA 1QH6A 4TSVA 2EVXA 5LRRA 3TNQA 4XIOA 4MXWB 1VAVA 1UAIA 5CFCC 1N3PA 3OY8B 3ZXEA 5TSWA 3RI8A 2A6WA 5I0TA 3B9CA 1R1A3 1SBDA 1DGLA 5I8SA 4UBGA 1AR62 2R042 2JG8A 2WL1A 5K7PA 3UJOA 1QOOA 5EV7A 5BYNA 5ACA1 1GZCA 1FXZA 2W39A 3GALA 3IDCB 5IUQA 3VKNA 1BVP1 2ZMNA 2SBAA 1X7NA 1W6NA 3VDDB 2YZ4A 2FZ1A 3I2DA 4XBNA 3HT2A 4AEDA 4M3CB 3SITA 1RUI1 3H50A 1DYKA 2K2SA 2CAUA 3E6DA 1C8M3 5CB7A 4ASLA 5I8TA 1I6XA 2MHFA 1DZQA 2PELA 3KZ4C 1WD4A 1U12A 2WFF1 2GC2A 3MZHA 4HVQA 1QXJA 4I3GA 4JGZA 4N43A 1J1LA 4IV1A 4FAGA 5CG8A 3VGIA 1RUE3 1O5LA 1OOPB 4MGYE 3OD0A 2IXKA 1AX2A 2MEV1 3KMHA 1S0DA 4HKLA 2JG9C 5J98B 2EF6A 2RM23 4RHV1 1LOBA 2I45A 4MSVA 4IV1C 5FOJB 5K0UC 2B42B 1VRH3 3WQ7A 3MF9A 1H0BA 3PVEA 1QJX2 3KCXA 4H3WA 4Y26A 1CAWB 2DV9A 4D7TA 1PNFA 1WUVA 3PMEA 3FJSA 3AMHA 4AGRA 1KXGA 1W2UA 2EALA 3DV8A 1UIKA 1RMU3 1BVVA 3DL3A 4XFFA 1RVF1 2VVEA 1RUC3 2VW1A 1Q5OA 3VLBB 1LTEA 2G9FA 2D43A 2RJLA 4UW3A 1LECA 1DQ2A 4HK9A 5GLVA 3JD73 5J48A 2WNEA 2EA7A 3J26N 2JECA 3TN91 5BNNA 4GMP0 1X82A 4RA0A 3PVOA 3KGLA 1LU2A 1PVC3 5IT6A 3RPQA 1WMFA 4GB33 1ULCA 1FOD1 2P3IA 5DDJ3 3AFGA 3RQ0A 4GH4C 5L19A 2A6ZA 1CAUB 3ZSLA 5HCAA 1DDLA 1OQDA 1Z7S1 3EQEA 4Y1ZA 3V64A 3I54A 4HPKA 3ZFFB 2RS11 4CEYB 1O4ZA 5SV8A 4RQPA 4ASMB 5C8CB 1WW5A 2PHWA 2WS93 1YJLA 2FHRA 2NP0A 2UURA 1LU1A 3AMQA 3MW3A 4DMIA 5DUVA 4L8QA 2ZAAA 4B7EA 1AXYA 2RR11 2VY0A 4YM3A 3H0OA 1H2NA 1GANA 1MEC3 2HWD1 2ZGMA 3OJBA 5EJ3A 1IKPA 4GXLA