2R073

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r07300
1PGW2 2HWE2 2X5IA 5ABJC 5AC93 1VRH1 1AL21 1PVC2 1HQNA 4IV1B 1NG0A 5D8AC 1PO22 2RMU2 4YVWA 1AL23 4CEWB 1V9U1 3HAGA 4Z92B 1V9U3 4N43C 4QPIA 3VBRA 1ZBA3 3VBSA 5GKAC 4JGYC 2HWC1 2R041 4GB31 4CEYC 2GH8A 2PLV2 1BMV2 3ZFEA 1COV1 2R043 1RUJ3 5A32A 1COV3 4RR3A 3ZXAC 2XBO2 4CDQA 1NCQB 1EAH2 1QJY2 2WFF2 3JBG2 1PO12 1RUC2 1C8M2 5CFDB 1AR82 2RS32 1R1A1 1RUE1 1SMVA 3CJIC 1K5MC 1R1A3 1PIV2 1BEV3 2RS51 2BPA2 4LLFA 1R091 4SBVA 3ZFGC 2RS53 5ABJB 1ND3C 1VBB1 1VBB3 1NA1A 1AR71 1AR73 4QPGA 5D8AB 2BBVA 1AL0G 5BNPC 1NY72 4JGZC 2WZR1 4N43B 1RMU2 5BNOA 4RHV2 2WZR3 4FSJA 4CEYB 1RUG1 3DPRC 1M06G 5CFDA 1RUG3 1RUD1 5A33A 1RUD3 4Q4X1 4Q4X3 2HWD3 5DDJ2 1RVF2 3ZFFC 4CDUC 1PGL1 1RUI3 2R071 5L7OA 3VBOA 4RS5C 3CJIB 4WM8C 1VB4A 1K5MB 5D8AA 1HRI1 3ZFGB 1ZBE2 5CFCC 1ND3B 1AYN1 1QJX1 2R062 4GH4C 1AYN3 1B35C 1H8TB 4WM7C 1VBA1 1BBT1 1VBA3 5K0UA 3VBFC 5BNPB 4JGZB 1X36A 3FBMA 4EJRA 4Q4Y1 1HXS1 1TME2 1AR91 3DPRB 1V9U2 1HXS3 1QJU1 1ZBA2 1AR93 1QJU3 4N53C 1RUJ2 1MEC3 4FTEA 1COV2 1FPN1 3ZFFB 4YVSC 4CDUB 1FPN3 4RQPA 4IV3B 2MEV1 4RS5B 1VBC1 1FMD2 1H8TA 2MEV3 1VBC3 4WM8B 1RUF2 1FOD1 2RR11 1FOD3 2RR13 4CDWC 4JGZA 4Q4V1 1R1A2 1BEV2 1HRV1 5CFCB 4Q4V3 1HRV3 2RS52 4GH4B 1A6CA 1EV11 3JB8A 1B35B 4WM7B 1EV13 3VBHC 1VRH3 1TMF2 3VBFB 4CDXA 3ZFFA 1F8VA 5AC91 4IV3A 5FOJB 4N53B 1POV1 3NAPC 4WM8A 3VBUB 5ACA1 1POV3 5ACA3 5C4WA 2HWC3 2RS12 4GB33 1RUD2 4YVSB 1RUH2 2HWD2 1R081 4AEDA 4IV1A 5BNNC 1RUI2 1RHI1 4CDWB 1RHI3 1MQTC 1ND2C 1RUE3 4CEWA 1D4M1 1OOPC 1WCDJ 4PDWC 1R093 4N53A 5J98B 3VBUA 3VBHB 1AYN2 3VDDC 1VBD1 1VBE1 1VBA2 3TN92 2HWB1 1QQP1 1NCQA 1VBE3 2HWB3 1ASJ2 3NAPB 4JGYB 3LOBA 2HWF1 5C9AC 1PGW1 2HWF3 2HWE1 4Q4W2 4Y4YA 2HWE3 1MEC2 5C8CC 2WS91 5BNNB 1FPN2 5ABJA 2WS93 1PVC1 2RMU1 1PVC3 2R073 1MQTB 1FOD2 1VB2A 2RR12 1BMV1 1OOPB 4BCUA 2PLV1 4PDWB 4FTBA 1HRI3 4N43A 5JZGC 4Q4V2 2PLV3 2VQ0A 2X5IC 4JGYA 4CEYA 1QJX3 3VDDB 5AC92 1AR61 1EAH1 1QJY1 2WFF1 1AR63 1EAH3 1QJY3 1VRH2 3JBG1 2WFF3 2QQPA 1PO11 1RUC1 3JBG3 1BBT3 1OHFA 4FTSA 1C8M1 1PO13 1CJDA 1AR81 2RS31 4QPIC 1AL22 3VBRC 3VBSC 1GFF2 1PIV1 4Q4Y3 5J96B 2FZ1A 4GMP0 1PIV3 5C9AB 3ZFEC 3CJIA 2IZWA 4RR3C 1K5MA 4CDQC 2HWC2 2R042 4GB32 3ZFGA 5C8CB 2BUKA 1ND3A 4NWWA 3VDDA 2TBVA 1NY71 1RMU1 4RHV1 1RMU3 5BNPA 3J8F1 5JZGB 1RUE2 3J8F3 2X5IB 1IHMA 4Y5Z0 3DPRA 1R092 1AYM1 1CD3G 5C9AA 1AYM3 1NA1C 5DDJ1 1RVF1 5DDJ3 4QPGC 2DF7A 2WLPA 1VBB2 1RVF3 2GSYA 1AR72 4CDUA 1HX6A 1VBE2 3JD71 4QPIB 2HWB2 5BNOC 1Z7S1 3JD73 1Z7S3 4RS5A 3ZFEB 2WZR2 3S6PA 1ZBE1 4RR3B 4CDQB 1RUG2 3IDEA 2R061 5JZGA 2R063 5CFCA 4Q4X2 2BFUL 4GH4A 1R083 5L7OC 1B35A 2WS92 3VBOC 4WM7A 1PGL2 2FZ2A 2R072 1TME1 3VBFA 1TME3 1ZBA1 2ZTNA 1HRI2 1D4M3 4RFT0 1RUJ1 1NA1B 4QPGB 1NOVA 1VAKA 1QJX2 5K0UC 5FMOS 1C8NA 1AR62 4YVSA 5LK7B 1FMD1 5BNOB 1VBD3 1BBT2 1FMD3 1RUF1 1QQP3 1RUF3 3M8LA 1RB8G 1BEV1 4Q4Y2 5A33B 1HXS2 1AR92 2RM21 1QJU2 4CDWA 2RM23 1DDLA 1NCRC 4RQPC 5L7OB 1TMF1 3VBOB 1H8TC 1TMF3 1AUYA 3VBHA 1PO21 2MEV2 1PO23 1VBC2 2RMU3 2ZAHA 1ND2B 1X33A 3J8F2 2RS11 1HRV2 3NAPA 2RS13 1OPOA 1RUH1 2XBO1 2BFUS 2HWD1 1AYM2 5K0UB 1RUH3 2XBO3 1EV12 4CDXC 1RUI1 1W39A 4YVWC 4IV3C 5BNNA 1RUC3 1C8M3 3JD72 1AR83 2RS33 2XPJA 1Z7S2 5C4WC 1MQTA 1ND2A 1NCRB 5ACA2 4RQPB 1OOPA 4PDWA 4AEDC 4IV1C 3TN91 1R082 3TN93 1ASJ1 5FMOL 1ASJ3 1QJZA 4CEWC 4RHV3 1RHI2 4NWVA 4Q4W1 2Y26A 3VBUC 1D4M2 1MEC1 4Q4W3 2WWSA 2ZZQA 4CDXB 1E57A 1NCRA 4GMP1 1NCQC 1POV0 4YVWB 5C8CA 4GMP3 1VBD2 3VBRB 3VBSB 1QQP2 3JB4C 5C4WB 5CFDC 5A32B 1ZBE3 2RM22 2HWF2 4AEDB 1F2NA
chains in the Genus database with same CATH superfamily
2X5IA 3I2KA 3LZZA 4BQ2A 1VRH1 3AKSA 2G9GA 5DUXA 2Q8CA 2YBKA 5A1AA 3D82A 4M4RA 3I2DA 5DZFA 4HETA 4PBPA 2VNGA 5F3CA 3UJQA 1LGBA 2P5BA 3AKRA 3T09A 1OFSA 4YW1A 3CKHA 3TEZA 1PO22 2RMU2 2WNOA 1JN2P 3RJ2X 2GN3A 3VHNA 1RITA 1V9U3 4IEWA 1KDMA 2IFWA 4QPIA 1LECA 5E88A 3VBRA 3UT0A 2D3PA 3AZXA 4F3JA 1PX3A 3ZFEA 5CG9A 2R1DA 3VZMA 3J26N 4YZ5A 5BNQA 1CAWA 2I07B 3ZXAC 2K2SA 5IK4A 1IPJA 3HT1A 2WQZC 3GF6A 4HK8A 4BDVB 3MW3A 5IK7A 1JHJA 1GQPA 3KQRA 2WFPA 3I3EA 2NM1A 1DQ0A 2CDOA 1V6JA 2PHXA 2G1MA 5FO9B 5FBZA 1AR82 3HNBM 2TEPA 1W6QA 1R1A1 5FRAA 4OQ8A 1D2SA 3AMNA 4XDPA 3R0RA 4UFMA 5IK5A 3M7AA 3U1XA 5DAPA 4MGYE 4UFKA 4AI2A 2W39A 4QXHA 5ABJB 4IESA 1GOHA 1OLME 2B39A 2DFCA 3B94A 2Q8DA 1UZWA 4HFSA 4A6SA 1VMFA 3AZYA 4ASMB 1NA1A 5L73A 4JRAA 4FO9A 4GALA 1AR73 4YM1A 4CCLA 2HYKA 2XJVA 2J1AA 3I2HA 2RG4A 3BODA 1TVGA 5BNPC 2VUAA 1UY0A 4JGZC 2WZR1 3M1HA 3JU9A 3LFMA 2VZQA 3WW3A 2KM2A 4MGTA 5CFDA 4OHZA 2XLGA 3C8XA 2QCSB 5IUQA 4W4ZA 5I8SA 5A33A 1RUD3 5FZ7A 4B1LA 4MZUA 5KXEA 4OFGA 5IFPA 1LAJA 1W2UA 2CY6A 3IMMA 3L2YA 3ZSLA 1DF0A 2Y6LA 3CMGA 5LA9A 2R071 4DO0A 2EXKA 1HB3A 2WNVB 4JRLA 1W3VA 5FO7B 5L7OA 4OYUA 1OURA 4EWDA 1KDKA 1Y9MA 2BERA 4BQ4A 1OA4A 2XKOA 4WM8C 3ZYRA 1K5MB 2QNKA 1GZCA 1YQ5A 5FPZA 5FXWA 2AENA 3ZFGB 5EJ1B 3VD7A 4UBGA 3UGFA 3OSDA 3N7JA 4AL9A 3BVCA 1LGCA 4FPCA 3V0AA 1ND3B 4FFGA 2IXCA 5FXVA 4CU7A 2G19A 4META 2GU9A 3C7GA 4WM7C 4NHXA 5LA0A 5A7SA 5FP4A 1OSGA 5FP7A 5FZGA 1W2NA 4YG0A 3WP6A 4XAEA 1DGLA 5FKCA 2JDNA 1YYNA 3FBMA 3MGUA 4L2NA 2C6SA 4RGAA 4EJRA 1Y43B 4Q4Y1 1O8SA 4B7KA 1NE4A 1KS4A 2GNMA 4CUAA 1V9U2 1JZ3A 2VUDA 2VMHA 2ZACA 3LEKA 5CADA 5K7PA 3WLUA 3AJYA 1UWWA 4QQPA 4JZRA 3BIWE 3IPVA 3AZZA 2Z2SB 4AHZA 1FPN1 5FP8A 3ZFFB 3W9AA 4ATEA 4CDUB 2AACA 3ACIA 4I30A 1YCIA 1AHSA 4IV3B 1W6PB 1AJOA 4RS5B 4DUVA 1BCXA 1FMD2 4KL1A 2E26A 4AGVA 2W5FA 4PLNA 2VZ3A 2H0BA 3BTAA 3N9QA 5CYYA 3ZXEA 2VO5A 4CDWC 4JGZA 4Q0QA 4H3WA 3N7MA 1HRV1 5CFCB 2K0GA 4LBQA 3WD5A 4Q4V3 2UURA 3SMHA 4YGCA 3D8CA 3SLIA 3ETQA 1A6CA 5FR3A 4NPRA 3VD5A 1B35B 2WABA 2VZTA 1JHNA 1RXFA 1EV13 3NJVA 4WVVA 1XOYA 3PVNA 3VBHC 1VRH3 1YI9A 1K42A 4XFAA 4NRPA 2Z4FA 3ZSEA 4E4ZA 1W8NA 2JKXA 2P6HA 1XNAA 4QGNA 4RN5A 1H1IA 3VL8A 1IGOA 1RC6A 3LA2A 1D0GA 3VHPA 3BN6A 4XW3A 5FOJB 4I02A 4QX2A 2VMDA 3K2OA 4UF0A 4WM8A 1ZRIA 2D7FA 5DAWA 5BY5A 3OCPA 5LWBA 3VKNA 1ULOA 4IE6A 3USUA 1C1FA 1RUD2 3S5AA 1UX7A 2WO2A 2YROA 1DGWA 2GC3A 5EWSA 5IK8A 3NJYA 2DCYA 1U5IA 3KGZA 3MPBA 4XF1A 1F15A 1Q8SA 4LJHA 1YFYA 3W58A 1C57A 1UO9A 5LBCA 1A78A 1ZZ7A 2YUEA 3MO4A 4FOWA 3WDXA 3O14A 2IXIA 3CIHA 5FLIA 1FV2A 3C7EA 3LFIA 2RJ2A 2W68A 4NRQA 3RGBA 3U07A 1MS1A 1H2MA 1G9DA 1LR5A 1OBNA 1WCKA 2ADEA 2C4XA 1W0OA 1DBNA 4KWUA 2JD4A 5J98B 1LCLA 4HL0A 1AX2A 4I09A 4BA6A 5JCTA 2P4EA 4LORA 5DAQA 5FY0A 1OLRA 1UF2C 1SCRA 2VNRA 4C1XA 1OUXA 4K1ZA 5SV5A 2ZOEB 1VBD1 3AYDA 5JOWA 1ULGA 2Q0AA 1IOAA 1QQP1 2W9XA 2UYBA 3JXSA 5T5PA 1VBE3 2DCKA 2JE8A 3BALA 4FP3A 3I2OA 2LTNA 3ZYGA 1TQ5A 3AP9A 5J1XA 3I8TA 3TB0A 4XHXA 1FNZA 1H4GA 5T3NA 4NPLA 3VHRA 1AXZA 2E33A 1ZREA 4DS0A 2VOTA 5JIUA 2HWF3 3A22A 5A7OA 5A3MA 3TEXA 2E53A 5C8CC 4OUEA 2WS91 3URFA 5BNNB 4XBLA 1JZ8A 5ABJA 5IVFA 5IHRA 3OF1A 4CZSA 1YFWA 1Y9GA 5T50A 1J84A 1PVC3 4QQ2A 2Z42A 2V5YA 2R073 2MNGA 4BK5A 1N1TA 3ATGA 5KHGA 4DXRA 2VTFA 3MPPG 1H30A 1VB2A 3SKVA 3W20A 4F8AA 1MS8A 2IXLA 2F6BA 5F6KA 4PDWB 5A3WA 2ZGQA 4F83A 1C3HA 4Q4V2 2D44A 4AI1A 2XG3A 4RD7A 4JGYA 2W1SA 4N7UA 1OQEA 1GYKA 3F95A 2DVAA 5KC6A 5JXHA 4FPEA 2RDRA 4XJWA 1X50A 1AZDA 1PZ9A 1EAH1 2X29A 5GZEA 1UYPA 4PF1A 1QJY3 1VRH2 1XU1A 4XXPA 2WFF3 5IVYA 3VDCA 1VRBA 1RUC1 3JBG3 4JTNA 4RFRB 1Q43A 1PO13 1CJDA 4OZXA 3OGGA 1P8JA 4Y20B 5FWEA 4QM8A 3POSA 3VBSC 1SLIA 1PIV1 2ZX0A 3ALQA 2WNVA 3CHXA 4Q4Y3 2FZ1A 4GMP0 4P9JA 2A3XA 4YPJA 1HJGA 1IS3A 5HV4A 1QF3A 1K5MA 5FTTC 2QDNA 1W90A 3ZFGA 3NJZA 4X6QB 5A6QA 4AVVA 5T55A 1ENXA 2FCVA 2XJTA 3MLLA 2JX9A 3V0BB 2JXAA 2ORXA 4C91A 1ND3A 3R4DB 2BNNA 4YW5A 3T2TA 4EROA 1URXA 5F39A 2JG9C 4KI5M 2E7AA 4RHV1 3I3BA 4FPHA 5FY7A 4HKLA 3WZ1A 4HN0A 1SG3A 2XKPA 5JZGB 3WG2A 4BMBA 4IEXA 2JG8C 5LASA 3P5BA 3WP5A 3OGVA 4Q8KA 1H4HA 3O7OA 4YLZA 3FLRA 5JMCA 5LRSA 4XE9A 4BLIA 4NMIA 3ZYJB 1RVF1 5DDJ3 3LKJA 2DF7A 3UETA 1UKGA 4BISA 2ZEXA 1GICA 2DURA 4R9DA 4MXWB 5JI7A 3E5UA 4CDUA 4DQAA 1VBE2 2AC1A 3IT8A 4LTAA 4QXCA 4CU8A 1Q5OA 2W87A 3AZWA 2OQ6A 3JD73 1W6PA 3CO2A 4RS5A 2WZR2 3S6PA 1HB1A 1TNFA 2D5HA 4RR3B 2BQPA 1UOFA 4FOQA 3IDEA 4CPBA 5J7MA 3OUHA 2WQ4A 4COYA 2VOXA 5CEHA 4LR4A 5CFCA 3W5MA 3Q8EA 4QQOA 2CGPA 3FHIB 1BVVA 5I8YA 1B35A 3VBOC 2DVDA 1Q3EA 4CCDA 1LHOA 2EXJA 2R072 2WQ8A 3ACGA 3BOWA 5FZ6A 5I0RA 4KG8A 1ZBA1 2ZTNA 4PIZA 3LDRA 3ZN4A 4EN7B 4HZFA 1GP6A 1X9PA 2Y34A 3PIJA 5EJ3A 3NQHA 2WN2A 1RUJ1 2D6KA 1JZ7A 4B1MA 2DUOA 5FY1A 1O5UA 1VAKA 1WLWA 3AMQA 1MS3A 2WA3A 5K0UC 5F37A 4ZZ5A 1C8NA 3OYWB 5LK7B 1WLDA 2Y64A 1IG3A 4ZPIA 1GP5A 4GULA 3RG0A 5BNOB 1VBD3 4YW7A 1JOBA 5DXDA 4B4PA 1QQP3 5FP3A 3AVSA 1MVEA 5FZMA 1RUF3 2Q4SA 4QX8A 3DCQA 2WNUC 4Q2FA 1RB8G 1ULDA 1V00A 3JUUA 1BEV1 4Q4Y2 1UOGA 5CBLA 4ZS2A 1EP0A 2XLFA 4LO5B 2P37A 1QJEA 2RM21 5FYUA 4XMAA 4AFAA 5I0TA 4PI0A 4X8PA 4YARA 3CLPA 4DPNA 1BJQA 4M3CB 3VDAA 3P1IA 5C3OA 1NCRC 4JDNA 3WW2A 3N9LA 2LS6A 3UL2A 4CCNA 5FZ1A 1W06A 3PL0A 1IQDC 5A7PA 1H8TC 1TMF3 2P34A 4HBNA 4V2WA 2YBPA 1AUYA 1PO21 4XTPA 1JYTA 2D97A 2ZAHA 3WG4A 3QLQA 4FVVA 1SPPB 4AQ2A 2D3RA 5A70A 3SISA 1HKDA 4L0PA 3GCXA 1UXZA 3GZEA 4SLIA 1O3TA 4MYEA 5HPOA 3I54A 3ZOIA 3K77A 1NUKA 4P08A 3OOXA 2ILMA 4MH0E 1H9PA 1HRV2 1VE0A 1WMDA 2RS13 3DEMA 3ZVXA 4AVBA 3OTFA 1TEIA 2CSGA 2XL9A 2HWD1 4K1YA 4JKMA 1RUH3 2PQSA 5FZOB 3ZN5A 4XJZA 1XU2A 3WDUA 1Z78A 2A70A 3VB9A 4CDXC 5FOBB 4P5YA 2DCJA 2GMMA 3HQUA 4YW4A 5CG8A 1I5ZA 5CNAA 2X09A 3MIDA 3PMEA 5DZGA 4NIHA 2YXSA 1SCSA 5BNNA 1RUC3 1GWLA 5FY9A 4D6QA 3BIEA 2VTXJ 2ERFA 3JD72 4HN1A 3VV1A 3J7MA 1PZ8A 3POYA 4FFIA 3WOGA 2YGMA 2JJ6A 4FCAA 3OGRA 1ALYA 1QXRA 3R05A 1ND2A 5C3QA 1WCQA 3LIGA 1YQ8A 4AGGA 3KWVA 1XYOA 1YRZA 3OBTA 4E8DA 4PDWA 5FK7A 2WYSA 5A1FA 2VULA 1CGPA 4XHBA 5FZ8A 1PK6B 2BNOA 5T52A 3J9SA 3MI8A 3TN93 3I3MA 3BCWA 1UNBA 5FZEA 1W9WA 4ZXKA 5E89A 3O1SA 1ASJ3 1O59A 2VECA 1XJAA 3UGHA 3WSOA 5CISA 4CEWC 4RHV3 1GMMA 1UZYA 3RPQA 2WT2A 4Y20A 2VOVA 4ET7A 4MXVA 1VAMA 5EIYB 2XGXA 3INAA 1N3QA 3PJQA 1XE8A 1N3OA 1MEC1 3GNEA 3B5LB 2B45X 4NRMA 1XSQA 2WWSA 5A7WB 4DEQA 1HV0A 4O65A 1NCRA 4BIFA 4GMP1 2W94A 4ZU5A 1NCQC 1DYKA 4LITA 4Y1UA 3NNLA 4LE3A 1GOGA 4O7XA 3V0BA 4XCBA 1VBD2 3CZUA 3NNGA 4UOJA 3VBRB 1FXZA 1QQP2 2EICA 3IAQA 4J1XA 4MGZE 1DGRN 2R30A 1GNHA 4G3YC 4XILA 1X7NA 4GJYA 5C4WB 4QDRA 1Q8PA 1IZ3A 5K8SA 4D94A 1CAWB 3CBNA 1W28A 4JDMA 2DDUA 1A8DA 1JUIA 1QIQA 2JDKA 3MV01 2B46X 5FZ9A 1YI7A 4UI9L 4CU9A 4IV1B 4LKDA 3ZDVA 3MIBA 2IXKA 2VH9A 2OX0A 2YHJA 1OKOA 3ILNA 4UFHA 1KS5A 2IFRA 5J09A 4H7LA 4XFGA 2GNBA 3NNJA 3AYEA 1US3A 3I7DA 3TRSB 3D3AA 1DZRA 4C0BA 4KBBA 2D3SA 5D8AC 2XVKA 4C1WA 1V9U1 4MXWA 1S0DA 4AW7A 4PIXA 4Z92B 1NXD1 4QHOA 1ZBA3 2Y0IA 5GKAC 5C33A 2JDMA 1HV1A 3POWA 4YG6A 1CZTA 2HWC1 3H7YA 4MV2A 1W9SA 2GH8A 2Y6GA 3BUCA 3N9OA 2BVBA 1RUJ3 5A32A 1COV3 2NQYA 4RR3A 1J1TA 1G9BA 5FXZA 4JKKA 1US2A 2ZHLA 1EAH2 2ZX1A 1EPWA 2DU1A 1OQ1A 3B00A 4QT6A 3WXPA 3AP7A 4J1WA 4KWKA 1RUC2 4MHRA 3VN4A 1ULPA 3HBZA 5CFDB 2WR9A 3LF7A 2WDBA 4X6RB 3CJIC 4LIVA 3Q9OA 1ZX5A 1RUOA 3RYRA 2HBTA 1PIV2 1BEV3 2WIIB 4LLFA 1R091 2JDAA 2Y60A 4XDOA 3K51A 2QVSB 3M3EA 5DUUA 2O14A 2J1RA 1FV3A 2Y6HA 1CR7A 1VBB3 2BYVE 1AR71 2BP6A 2KXLA 4OI4A 3KS7A 2ZEZA 2R0FA 1XNTA 5IFTA 3WNLA 4GIQA 4PLOA 1Q8QA 1L3JA 4YGBA 3GYDA 1IS6A 1G86A 4GAZA 2ID4A 5C3PA 4I01A 5BNOA 2GMEA 4RHV2 4EYUA 3X29B 1OA3A 3DKQA 4L9BA 3DPRC 3ROUA 3PUQA 1M06G 1IG0A 2DWRA 1RUG3 1RUD1 2KR2A 4P9LA 1OD3A 3DF0A 4ZY9A 1XYNA 3GHMA 1ZNPA 2H6CA 3T1LA 2HWD3 3N9MA 2VVFA 2B9VA 1RVF2 5L9RA 5A3NA 1GNZA 3NRUA 3WY6A 2WSUA 2VG9A 4YSFA 5HBAA 4Y3OA 3MEPA 3PUSA 2J42A 3PVBB 4DINB 4ZU4A 1LOEA 4UW3A 5BPXA 1VB4A 3BOPA 5D8AA 2XWJB 4BE3A 3IPVB 3DYOA 1SPPA 2XLAA 4DY3A 2DUQA 3N9NA 2Q1MA 5CKQA 4NAMA 4GA9A 2W3JA 1CAXA 1V6MA 1QJX1 1PHMA 3NO8A 4Q1PA 4GH4C 1QOSA 2EIBA 4QXBA 2I2SA 2OYZA 1KJRA 1QWRA 1JUHA 3KZ4C 5FDBA 1ACCA 4AEJA 3ES4A 4ES8A 2WT0A 1VBA3 2NPIA 3PTRB 4ISQA 4PT6A 4XUOA 2OPWA 3SNMA 3O1PA 1OT5A 4LBQD 4OQ9A 5BNPB 4JGZB 1CONA 5HCHA 3O1TA 3ZSJA 4CUCA 1C4RA 1ENSA 4QX1A 2XHKA 2ZGTA 4PJYA 4E8CA 1OFNA 2ATFA 4H7MA 2PQQA 3GALA 5FZLA 1HXS3 1ZBA2 5KXBA 2OQ7A 1YNAA 4MGIE 3SH5A 2ZGPA 1KRIA 5JXJA 2WYFA 4HOOA 2YC2A 1RUJ2 1MEC3 4LHNA 1COV2 3U37A 5BUVA 3NSTA 4CXYA 3B69A 4FTEA 1MS5A 4YVSC 4HPKB 5HCFA 3ZYIB 4LUMA 2CTVA 5FPAA 3AXDA 4XTMA 2RDSA 5CIRA 4R52A 4MGSA 4BJ0A 3T1MA 2MEV3 1PK6A 1VBC3 4WM8B 1YEWA 1REFA 3VKLA 4QX5A 3ZIWA 1FOD3 3B9IA 3LA7A 1HW5A 1QNYA 4OCTA 4Q4V1 1BEV2 1LHUA 1UPIA 4IEOA 2ADDA 3H3ZA 4WBBA 3TNPB 3H9AA 3FL7A 1EV11 2BW8A 3HPNA 4WM7B 1REEA 5CAZA 2VW1A 3M3QA 3VZOA 2IVJA 5HXMA 1AXKA 5TSWA 4E9KA 5A7WA 5I0DA 1ZZBA 3J7LA 3UJOA 3SKJE 1F8VA 2VZVA 3JQWA 4BB3A 3HJRA 1YFXA 4BMEA 3FHAA 1T6GC 2ZHKA 3RJRA 2QUOA 3RZLA 5F2WA 3DXTA 3OPZA 5IVCA 1KFXL 3ZXJA 3AYAA 1POV3 3QH6A 4NHKA 4XQWA 5ACA3 5C4WA 3THPA 2HWC3 3EB7A 1D7PM 1GR3A 5FPUA 2BGPA 2HWD2 1XNKA 3JQXA 4TN7A 5FZ4A 4IV1A 4EZ4A 3S0MA 3HD8B 3ZO0B 3ACHA 3BGAA 1BKZA 4AHWA 3K75B 2EXIA 1RTVA 4CDWB 1SDDB 3AYCA 4XACA 2GDFA 3SH3A 1FATA 1RHI3 2JWPA 4HK9A 5FY5A 1ODNA 2BWAA 2BZDA 2D6MA 2OZJA 2ZAAA 2IXHA 4QHZA 4XETA 1OOPC 3PUHA 4TTGA 2QFEA 1R093 1BHGA 1XE7A 3D4KA 4Z07A 4BHPA 3VBUA 2QQJA 4MO3M 2YU2A 3L9JT 4NR1A 3VBHB 5FWJA 2DVFA 5FFOC 4NPMA 3HQRA 1O3SA 1GZWA 1F5FA 4OHXA 2VMFA 1VBE1 1VBA2 4JX0A 3SQOA 5CU1A 1GANA 1LENA 2PFWA 2HWB3 4UT5A 2VNVA 3TOJA 4UWDA 2VXJA 3T2PA 4V2VA 3RZMA 4W6YA 2YYOA 4JGYB 4R4XA 4XIOA 3IDAA 2ET1A 4D8MA 4IETA 3KSCA 1YWKA 4LBOA 2HWF1 5C9AC 5H9SA 2KD7A 3KM5A 1WCSA 4JKLA 1JODA 4I0WB 2ES3A 5BV6A 2HWE3 2VUJA 1MEC2 5I0SA 4HKOA 4URTA 3RMYA 4N90A 1UX6A 5FPVA 4I3GA 4N9HA 1QNWA 2ZHMA 2A73B 1G6NA 1PVC1 1OF3A 2FMDA 2VVDA 2XQRA 4NHYA 4Y4RA 4CCCA 2UWAA 2J1TA 3BB6A 4MADA 1W99A 4Q0PA 4YGDA 5F6LB 1F31A 2V4VA 1UL9A 1FOD2 5JOZA 2YU1A 5CVRA 4LA2A 1DQ2A 5LB6A 3U11A 1BMV1 5KHKA 4FTBA 2PLV3 3J7NA 1UPSA 3DGTA 1DU3D 3IIAA 1N1SA 4A7YA 1QJX3 4W50A 1QJY1 3KVAA 3RFRA 3ORJA 1I5PA 2WFF1 1AR63 2A3YA 3JBG1 1H6YA 3H1MA 2QQPA 4ZZ8A 4QXKA 4FPJA 1PO11 1W04A 2XL7A 4CUGA 2FDGA 4FTSA 1C8M1 2AYHA 5A6ZA 3GBFA 2ZPXA 4L8QA 3VZLA 5J96B 5J36A 4K8FA 1OC1A 4WV8A 1CAVB 5FKBA 4LEJA 2RDQA 3U0ZA 2J1UA 5FYIA 4CDQC 2HWC2 5C8CB 3R4SA 2BUKA 1O5LA 5HCBA 1W05A 3OD4A 5F3IA 3OUJA 4NWWA 2XVLA 1N3PA 3MLJA 1L7RA 2E51A 4IEQA 4CPBD 1DGRA 1RMU3 1ZZCA 3OBRA 5BNPA 3OUIA 2OZ6A 1DQ5A 3VZJA 5DMYA 3ZYBA 4UFIA 1PMHX 1U5XA 2G4IA 4KNCA 4YRDA 1CIYA 1R092 2EIDA 1J83A 2GALA 3PURA 3UKTA 3ZMNA 5C9AA 5DDJ1 2XR4A 3QBQA 4K3UA 2WLPA 4QPGC 3SCHA 4BQXA 4Q0UA 2QQLA 2GSYA 2CGNA 4GZ9A 4Q5OA 1AR72 4LK7A 3ST7A 1HB4A 2C5DA 3IBMA 3T2QA 1YQ6A 3MW2A 4HPKA 3JD71 4AHYA 2HWB2 3BYWA 5GLTA 4EV0A 1S4CA 2J1EA 3GZTB 3QH7A 1JW6A 1Z7S3 4QB1A 1APNA 1XE0A 4WZCA 1ZBE1 1AX1A 4R9BA 2R1BA 1FI2A 1Q8OA 2BTVC 4HG6B 5FQ0B 1OXCA 1ENRA 1NLSA 2VQAA 3WDWA 2JECA 2VBBA 2R063 3PTYA 2CGOA 1ZRDA 3LDBA 4BU2A 3WW4A 1JZ5A 2XJSA 4KWLA 1LOFC 1UD1A 1V6KA 2LM3A 1Q56A 2C24A 1CESA 2JG9B 4GXLA 4WM7A 3TBDA 3AMMA 4Q27A 4LT5A 3E5QA 1VPHA 5FV3A 3ZMOA 1CIWA 3PUAA 1TME3 3WNOA 2JG8B 3POGA 3WX5A 2GP5A 3Q8BA 3MV11 2V09A 1Z0HA 1UMZA 1W8HA 5F5QA 4EWEA 3RI8A 5BYNA 4XFIA 4ZU7A 1CPNA 2XJPA 1QJX2 4GD4A 4E4SA 4CU6A 5FMOS 1SHWB 3PU3A 4E27A 1AR62 1XB9A 5G04L 2EAAA 2CHHA 1ZRFA 5FZIA 4FPYA 4LIUA 4UYBA 1PM7A 2PYTA 5FJHA 4Z2AA 1RUF1 5L36A 1IKPA 5F3GA 1ODMA 4LK6A 4CDWA 3E5XA 4YZ3A 3HBKA 5HCAA 5IVVA 2W47A 1UY3A 1DDLA 4XDQA 3GBWA 2R0HA 2FDJA 4RQPC 1DLLA 1ULCA 2Q8OA 1WW7A 3H7JA 4AAPA 1TMF1 2VZPA 3LWCA 5EHDA 3VBOB 4QX3A 4LBKA 4BLJA 2MHFA 4LHKA 3MZHA 3M3CA 2ZCWA 4R8HA 3VBHA 2CWMA 1J3QA 4S2FA 3UV9A 1DG6A 4NE9A 5L9BA 4E4HA 4YZ1A 1W8TA 2ZEYA 1ND2B 1LHVA 1W6NA 3FUOA 4UW5A 2HEYF 4XJUA 3LEMA 5JVVA 4AGRA 2TNFA 4BXSV 4GWIA 4UAPA 5EPAA 3A4UA 1CX1A 2IXJA 2RS11 3FN9A 5I91A 3WUCA 3BTZA 1E5HA 1RUH1 2LW8A 4IGQA 4LO8A 4M0HA 3HNYM 4XF3A 3G7DA 4DFSA 5C8WA 3M2MA 2XBO3 3PVEA 4XPVA 5K0UB 4BH9A 1EV12 1DHKB 1JU4A 3VKOA 1YIPA 5E16A 1RUI1 4AWDA 2UY9A 3NKTA 1GQGA 3N36A 4Y22A 4YVWC 4IV3C 1E5SA 5GM0A 3WEZA 3UGGA 2VNOA 3AK0A 4COWA 1C8M3 1MPXA 1X8MA 3HN1A 2C0ZA 3T0AA 1Z7S2 5L19A 2P17A 3U10A 1PNGA 2ZS6B 2GN7A 2A3WA 4S2DA 1O91A 4XC9A 2UWCA 2CAVA 1NCRB 4R9AA 2A5ZA 1W2TA 3VLBB 4BZ4A 4XBQA 4HSJA 2VUCA 4KG0A 4QDSA 4AEDC 2AR6A 1NZCA 2VMGA 4I0AA 1XNBA 3TN91 2ZXQA 4OLLA 1UOJA 1H9WA 3IAPA 2RJLA 3SEEA 1ASJ1 2FCUA 5EXOA 3WG3A 3FE5A 3ECQA 5K9YA 1GU3A 2ZJCA 4CP9B 4E2QA 2BU9A 3CEWA 4NWVA 1ZYBA 2XUEA 4FOYA 5IYYA 2Y26A 2AUYA 2BOIA 4Q4W3 4E2GA 3AKTA 4XUTA 4FQ4A 3OPTA 5KHJA 3WQ1A 4RYDA 3I59B 4UFJA 1CAVA 2BRTA 1RJ7A 4W6WA 4CDXB 1E57A 1WMXA 2ZMKA 1CPMA 4A3XA 4CRQA 3FBYA 2LROA 1PNFA 1POV0 4C90A 5C8CA 3HMYA 2YGLA 3WNPA 4CP2A 3PU8A 1UZZA 4XQDA 2FMYA 5FMDA 1JZ6A 3DYPA 3JB4C 4MOAA 2W2IA 3RMXA 3TYJA 3UYJA 2DBIA 2W52A 1U0AA 1LESA 2WKKA 5A32B 4A7ZA 3GJAA 4URAA 1ZBE3 4TLGA 4GQ7A 1CZSA 2E7QA 2A75A 3O0XA 3LPGA 4JDOA 2HWF2 5FZCA 1C28A 3IDCB 3IN9A 2IVIB 3MLKA 4GKYA 5DAVA 4WVWA 3T08A 4O61A 5AC93 1FT9A 2BJSA 3RZHA 1G9CA 5FZKA 3V64A 2CNAA 4KMQA 5T5LA 1PVC2 1HQNA 3NV4A 4YVWA 4CEWB 1AL23 4HVOA 4NIIA 2VXRA 4XFFA 4N43C 4KU7A 3VBSA 2NZ9A 2FHRA 1OH3A 2UWBA 1SEFA 1UYYA 4CEYC 3S57A 1BMV2 5EJZB 4P9IA 3WF1A 4ZHNA 1COV1 2R043 4GKXA 4NVPA 3ZIXA 2XBO2 4PIYA 1WA6X 4M3CE 1NCQB 2QQOA 5FQ0A 3S30A 3KV5A 3T2OA 1QJY2 3NMBA 1DQ4A 1SLAA 1TZOA 2WFF2 3EO6A 3IB3A 4IGPA 5FYTA 5C71A 4H2AA 3JBG2 5JPNB 1NQDA 1KXGA 1PO12 5FYYA 3EYPA 1LODA 4AI0A 4ARXA 1LHWA 1C8M2 2OIIA 3VZNA 2JG9A 4DOUA 4YWAA 2A6ZA 2RHPA 2BPA2 4DY5A 2RS53 4HVQA 3WT3A 4KBZA 3K46A 2JG8A 2GC2A 4KWJA 3AXEA 1VBB1 3ZPYA 5DG1A 1EYBA 2WRAA 1STMA 3HR9A 3VD3A 2DYCA 3PJYA 4UFLA 3I2FA 1JYCA 4B4QA 3LIHA 4A41A 5D8AB 3T30A 5A80A 2BBVA 5D1IA 1AL0G 2VZUA 4XYXA 3ZXDA 1SLTA 4OUSA 3U14A 3NWKA 2XH6A 2JICA 2WJSA 4UW6A 4FSJA 1CAXB 2DVGA 3EQEA 4LMFA 1RUG1 1ZZ8A 3CQOA 4CXXA 4OHYA 2SBAA 4OMDA 3B7MA 3WV6A 3ZXKA 2VQUA 3NJXA 5KHHA 2RDNA 1Y4WA 4Q4X3 4IGOA 4L92A 5GZFA 3H3LA 5DDJ2 3NL1A 1PGL1 4QPYA 1F4AA 1V6IA 3I97A 2VTXA 1RUI3 4XEZA 3VBOA 4M0NA 4HKWA 3ZDSA 4BIOA 3K4ZA 1D2QA 2QQKA 3CJIB 2VCMA 3ACFA 4XCAA 3OBZA 4BK4A 2VCBA 1KFUL 3Q8FA 3N4MA 5C5TA 3ZXLA 1VLNA 4NROA 1ZBE2 3U78A 1NQJA 2X8KA 5FYHA 2Q5TA 5FUPA 3N7KA 1REDA 4XJ8A 2ZABA 1AYN3 1O3RA 5JAXA 3H1WA 1W9YA 2Q8EA 1VBA1 3EBRA 2SLIA 4MGQA 1BXHA 3LSDA 4LOSA 4QM9A 5K0UA 1DLCA 3VBFC 5E8AA 1X36A 3T4HB 1WD4A 4ZKTB 4WVZA 1K45A 2QQUA 1HXS1 5D21A 2P3KA 3DPRB 5T5OA 4S2GA 1AR93 4HANA 2D6PA 2WNUA 3D5OA 4N7IA 1QJU3 1UCXA 4N53C 4D69A 4XMIA 1D0HA 4NHLA 1NLRA 2CV6A 2GNTA 4PI2A 1SBEA 4CXWA 2J1VA 4C8DA 2Z79A 4S2HA 4UBHA 5CKMA 1OVSA 3K4DA 2VCAA 3A21A 5JPMB 2BV4A 2WC2A 5FYSA 1YXWA 2MEV1 3ASIA 2NMNA 1VBC1 4DXZA 3MIEA 1H8TA 4MSVA 3WNMA 5LY1A 2X53S 1I9RA 1RUF2 1E5RA 1FOD1 3LAGA 3SEPA 1V0AA 4DNYA 3PUIA 2JEMA 2RR13 1HN1A 3FLTA 3LD8A 3MFCA 3ZR6A 1UAIA 3TEYA 1W2AX 1UMHA 2IUWA 2RS52 1MZ6A 2VVEA 3APBA 1IS4A 4CP9A 4I2OA 5JSPA 4GH4B 3DUIA 2Y38A 4YZ2A 1U12A 3FLPA 4FFFA 4J6GA 1NE6A 4MHUA 4PBOA 3WUDA 4CYDA 3VL9A 1UY1A 3O1UA 1MZEA 5B4XA 1TMF2 3I59A 1IKQA 2V72A 3KMHA 4QKNA 5E1RA 2ENRA 3GM8A 4P00B 4Y1VA 3I3QA 4CDXA 1IPSA 1BQPA 2BOJA 2P3YA 4Q26A 1UKRA 2GC1A 3WQBA 3Q8AA 2G9ZA 2ARAA 1POV1 3NAPC 4LNVA 2GZWA 2Y0OA 1GLHA 1K12A 3VBUB 5ACA1 4OI0A 3WF2A 3T0DA 3ITQA 2DUPA 2RS12 5J37A 4K8RB 1LKNA 1GZWB 4JVAA 4YVSB 1RUH2 1WLTA 1QH6A 5LEKA 2W08A 2W0XA 3H3UA 4OMCA 4ZXEA 1WCUA 2HEWF 1MS4A 2XJUA 3M3OA 5FYMA 4IEVA 5HXVA 4B7EA 2D6LX 1CVNA 1RUI2 5FY8A 2VD7A 3IDBB 1ZVFA 4Z82A 4XFCA 1RHI1 3KCXA 5GLWA 3BU7A 4KH9A 2C9KA 1MQTC 4NIDA 1BK0A 3ELNA 1BK1A 4LO7A 2JDYA 1D4M1 2D98A 4CEWA 2JE7A 1S0GA 4MLOA 3H8UA 1WCDJ 4HVRA 4DXSA 4N53A 3VGIA 5L9VA 1I6XA 1DQ6A 3D0JA 4ZONA 3VD9A 4INDA 4O9GA 5FZ3A 4BQ3A 1AYN2 2X05A 2B5HA 2VBPA 3ZYPA 2HKXA 2ZGLA 2P3IA 4RA0A 3VDDC 1VMJA 4CCEA 5FO8B 2VL4A 4LULA 2VOWA 3MDPA 1SACA 1F4HA 3AKQA 2HWB1 3TN92 1RUNA 3C7FA 1NCQA 3ZSKA 4WVMB 4ZS3A 4CCJA 5FZDA 2ZEWA 3LOIA 1ASJ2 2WA4A 3H8RA 1V6NA 1WMEA 2QQVA 1XNDA 4B4RA 2OPKA 3GXUA 1V70A 1OD5A 1QOTA 1UZ0A 3E6BA 3KF3A 2VU9A 4OULA 4Q0VA 4XXAA 3R6SA 2WNEA 1RJ8A 4BQWA 1LU1A 1MVQA 3LOBA 2UYAA 4D0QA 5KHIA 5DUWA 1PGW1 2A6WA 4IEZA 2HWE1 3RYKA 3KV9A 1PMJX 2HH9A 3R4UA 1QDCA 5LA2A 3OY8A 4ES9A 1KJLA 2VW0A 3LDKA 2K9ZA 5IWFA 3THTA 1YQ2A 2DTYA 4J25A 2BGCA 4Q8LA 3BI3A 2OKXA 5AVAA 4KGGA 4TZDA 1CJPA 3FUQA 2ET7A 4QB6A 2AGSA 3J4UH 5F9TA 5FPLA 2V4AA 2ARXA 2RR12 4LXLA 3O1RA 1OOPB 1WZXA 2OS2A 1IQAA 2PLV1 1MR5A 1MZ5A 2VQ0A 2X5IC 3DKWA 3WNNA 3KT4A 1X8EA 1LRHA 1JU3A 3NW4A 4XBNA 5LA1A 3HQXA 4AF9A 1AR61 2VAUA 2VJXA 4QGLA 4W6XA 5FXXA 1JYNA 4CCOA 4DUWA 1KQRA 4FT8A 4HXCA 3KHCA 5JLVA 1V6OA 2RS31 5F2SA 3T3YA 4NAOA 4QPIC 5JR7B 3VBRC 4P02B 1GV9A 1O8PA 2XB6C 3ZYFA 1UQXA 2P1BA 1GFF2 1YO8A 3AMHA 3RSJA 5CA6A 3M3IA 2XOMA 5JXIA 1JYVA 2ZMNA 1POQA 4CSWA 3ZFEC 5C9AB 1GZ9A 3CJIA 1R64A 1W8UA 2IZWA 3WF3A 2ZA9A 4NIGA 5C7GA 1W6OB 1QY4A 2W95A 1ZA7A 5GZCA 1OLQA 4AVTA 1B09A 4QX7A 3OPWA 3WP3A 3K48A 3DV8A 1S0EA 1WBLA 3AL5A 4CE8A 1WLCA 2QTWB 4RGGA 3VDDA 1GNYA 3GJBA 1NY71 3MHZA 3WCSA 5F1RA 2LALA 4BM8A 1RMU1 3WINE 3WQ7A 1NXMA 3A0KA 2F4LA 2LUWA 4PHZA 2VZSA 4AQTA 2WO1A 2PHDA 3IM0A 5ANNA 2A71A 1JXNA 2UU8A 3J8F3 4ORFA 5GJ6A 2CYFA 4Q29A 3DPRA 2WINB 1MS0A 5FJKA 3ABZA 1AYM3 1NA1C 2VR4A 5GLUA 2VM9A 2JIGA 2D6NA 2WO7A 5HI0A 1VBB2 4K6BA 1JBCA 1N1YA 3IZOA 3RRDA 1I3HA 3VDBA 2DFBA 3GHNA 4EE2A 2NP0A 4IDZA 1Y7BA 2GH2A 1HX6A 2R16A 2ZGUA 3KT1A 3LGRA 2VW2A 1Z7S1 2WBKA 3W21A 4XUPA 4R4ZA 3WDVA 2WZEA 4HMZA 4K7JA 4LO4B 1HIXA 1W6MA 1LNSA 1CAUB 1NX9A 1W8OA 1O4ZA 3ILRA 1T6BX 1RUG2 1UIJA 2BWCA 4CDQB 2R32A 3A7QA 2R061 4OZOA 4LKSA 2ZGSA 4YGEA 2O8OA 2OUHA 3O1MA 1WW6A 2Y33A 2YMZA 5DAXA 1LOBA 3HNMA 4GH4A 1XPWA 4EQVA 4PQQA 5L7OC 4UXAA 4PCRA 2CL2A 4QU1A 5B4NA 2FD8A 1PGL2 1C5HA 1XSRA 2BBAA 2ZZJA 2Z5WA 2ARCA 3ES1A 2EALA 3KCCA 1TME1 2YFZA 4BWOA 3ZPOA 2VMCA 3THCA 3PLQA 4N9IA 1RL3A 3BKZA 4IERA 2VC9A 1ZRRA 5AVPA 4XZUG 1WD3A 5A3UA 4D7YA 2NN8A 5DQ0A 2W91A 1D4M3 2B42B 4LBNA 4RFT0 5LBEA 4CCKA 4NO4A 3LEGA 3HT2A 1S55A 4G4FA 4LKEA 4QPGB 2ZGNA 1NOVA 4LUKA 5JOXA 1OVPA 3MIHA 4YM2A 1WBFA 1Y9QA 4AG4A 1Q8VA 5I0UA 4YVSA 1TNRA 2C9AA 4B29A 1W6NB 3AFGA 4XIKA 4FAHA 3UK9A 2J1SA 1FMD3 5I93A 3H1YA 3B9CA 2YFUA 2EIGA 1UU4A 1XRUA 2XJRA 3M8LA 2Q1ZB 4FFHA 1OQDA 1JZ2A 5FAXA 5JSOA 3POJA 4AR2A 3M4FA 4LHSA 1HXS2 1QJFA 2JE9A 3MBWA 4X8NA 2OXBA 1ZM1A 3VKFC 5A7NA 1AXYA 4LQRA 5JMOA 2YBSA 5EV7A 3A0NA 1O7FA 2ZGKA 2OUJA 4HLTA 4Z2WA 1YJKA 5LBFA 4Y22B 1W8FA 1S0BA 1G9AA 3O0WA 1D4VB 3EXUA 2QQNA 3BPSA 4TYSA 2E9QA 3Q8CA 5A6YA 3TNQA 2GNDA 1JS9A 1YHFA 2CWSA 3ZXFA 3GZAA 4XF9A 5JOYA 2MEV2 2RE9A 3A23A 1VBC2 5F5CA 1H6XA 3O1VA 3D0SA 5DABA 3AVRA 3OEBA 5LW9A 4WVMA 1VJ2A 1VIWB 2VE1A 4RSUA 1X33A 3J8F2 3LPFA 1K5JA 4I3PA 4P9GA 4Q1RA 1OPOA 1JZ4A 2WSVA 4AYUA 2BFUS 2XBO1 2W46A 1AYM2 1PZ7A 4Y1YA 1SBFA 4Y1XA 5FPXA 1O4YA 5DN2A 3AP6A 3FFQA 5A3PA 1ST8A 3DXUA 1U5YA 2WAOA 4JAAA 2B7YA 1SLLA 1MACA 4Y26A 3WHTA 3H8XA 1T2XA 5FBJA 3QOPA 4H14A 5EFUA 4EWAA 2RS33 2ETEA 3MYXA 3RNSA 3FHQA 4W65A 2ZGRA 2P3JA 1WGPA 4OVEA 4JV4A 1HQWA 2CAUA 2YC4A 4LPLA 5ACA2 3AP4A 3T0BA 4CP0A 4RQPB 5H9QA 1OOPA 4RL7A 2XQXA 1FNYA 3K3NA 2W92A 1PM4A 4U36A 3N3HA 2AEYA 5A7QA 3P3PA 3V56A 4AFBA 2E31A 3C7HA 3E6DA 3RI9A 5JXGA 1DP0A 1HN0A 4M3CF 5A3TA 1SQ4A 2B9UA 3O12A 1UU5A 4JCKA 3FJSA 5FZ0A 2PHLA 1LB2A 2O1QA 4AVAA 4EN9B 1RHI2 3UNPA 2JIJA 1H2KA 5FY4A 1BZWA 5JWPA 4XZPA 4PQ9A 2OVUA 3HIFA 3I4IA 4Q4W1 1D4M2 1SLBA 2FQPA 3E97A 4EN0A 4LBMA 5K4LA 4A6OA 1EUUA 3WHUA 3ZXGA 4AEMA 5KWRA 1DIWA 4XFBA 1W6OA 4YVWB 5IVJA 4NJ4A 4BQ1A 2E32A 3AL6A 3HOBA 1GUIA 3NV1A 4BYYA 3BPZA 2K46A 5T54A 3VBSB 4AI3A 3FC0A 5FCCA 1UU6A 2PHTA 1OH4A 4TWTA 4IUGA 4C0HA 2VBDA 1FYUA 1GBGA 1UYZA 3AKPA 4AEKA 4D3WA 4AEDB 4G9SB 1F2NA 3OG2A 5ERLA 1PGW2 5DUVA 5AC91 2HWE2 2OW4A 4QKDA 1LGNA 3CDZB 4ASKA 4QHBA 5ABJC 2PAKA 1AF9A 2V5DA 1DGWX 1VMHA 5FYVA 2YPDA 3RS6A 4D6SA 5C6CA 3POEA 1W3XA 1G8WA 1LTEA 2PA7A 2QDRA 4YW3A 1J58A 4COVA 1AL21 5F7UA 1NG0A 4I0BA 1JH5A 5IAVA 5GZDA 3HAGA 4M4PA 1XYPA 2YY1A 2QQMA 3H0OA 2XJQA 4JGYC 2YZ4A 5J48A 2PHWA 2O0OA 1ULFA 2R041 4GB31 2PLV2 5FUNA 5JR2A 2QBXA 5FP9A 1CAUA 4OHWA 4GWJA 4CDQA 3ZKUA 3HN3A 4QD2A 1S0IA 2WL1A 3F2ZA 3OGSA 4A45A 3I2IA 2VZOA 2DCZA 2Y6KA 1LOGA 3KF5A 1L7LA 3OB8A 4COUA 1GP4A 1RGSA 1E5IA 1ZZ9A 4LBLA 5FK8A 1DCSA 1XC6A 2VZ1A 2WNVC 5T5JA 1JTZX 3SHRA 2RS32 2YV8A 1RUE1 1SMVA 4AFDA 2NYYA 1K5MC 1R1A3 3B3QE 2RS51 3M70A 2JENA 1VAVA 4D7TA 4SBVA 5G05L 3S7IA 3UKNA 3ZFGC 4AXOA 1S2BA 2BEOA 2XUMA 4QX0A 4XUQA 3ZLIA 2W1UA 2PHFA 2DU0A 1LHNA 1RINA 1ND3C 3TEWA 1H1MA 2ZGOA 3RDIA 1NT0A 1LEDA 1OA2A 1KGYA 3IIIA 1M4WA 1UW8A 4O9EA 4QPGA 1ONAA 1DYOA 2FDKA 3N35A 4AK3A 2WO3A 4DB5A 5KR7A 3POBA 1NY72 4N43B 5LY2A 1RMU2 1KEXA 3GZUC 2WZR3 5AFBA 3UESA 4CEYB 1QMJA 2E63A 2QJVA 1VALA 2EIEA 3POIA 1G7YA 3J7HA 1JOPA 4P5HA 1YUDA 2GP3A 4Q4X1 5ANQA 1O6UA 2FBEA 3NV2A 2WN3A 2ZGMA 2R6QA 3RVHA 3ZFFC 4CDUC 5JSRA 4IL7A 4DMIA 3RZKA 3MFAA 3WR0A 1LOFA 1QHDA 1DZQA 1OKQA 4AE2A 1N47A 2W1QA 1PGSA 4RS5C 4BQ5A 5A6XA 2WNUB 5C5UA 5CZKA 1YLLA 2PHUA 2TUNA 3NNFA 5FREA 2GC0A 1SFPA 1HRI1 3L2HA 3WDYA 4QQLA 3WG1A 4MGKE 2F4PA 1HJFA 2QZ3A 3P6BA 4P9XA 5LRRA 5CFCC 4MG2A 1S2KA 1AYN1 1QOOA 4NIAA 3WNXA 2R062 4FI9A 2P6CA 1GSLA 3SC7X 1G9FA 1OLMA 1B35C 2D6OX 2R49A 2XXZA 1H8TB 1UOBA 2R7EB 3RWNA 2ZMLA 5JUVA 5EP9A 3H42B 1BBT1 2Z69A 3AMPA 4AI8A 5B2GB 3UKVA 3AM2A 4ONUA 2VMIA 4IQPA 5IATA 1UYXA 3O0VA 1ZZ6A 3OJBA 3I3DA 5I8TA 4YG3A 5IAXA 1IS5A 4DEVA 1H0BA 4CVUA 1TME2 2G9FA 1AR91 4K21A 3KGLA 1QJU1 1NZIA 1CN1A 2MPFA 5LZ6A 2ZKNA 4YNIA 1PMIA 4XF0A 2XMLA 1SFYA 4HT1T 2XVGA 3SCGA 1FPN3 5ISLA 3PNAA 4FPFA 4RQPA 3WW1A 3KVBA 3E6CC 3RWKX 1GKBA 2A1XA 2XDVA 1S0CA 3E1F1 3WNKA 1DZTA 2N7GA 5J3UA 3V65A 1A3KA 4JC1A 1MZFA 2X10A 2RR11 2J7MA 2WUHA 2GAUA 4FPKA 4U2AA 1R1A2 2JKBA 2P2KA 1BVP1 3KHBA 4L11A 4DRVA 1HRV3 2LRPA 4K40A 1XBFA 4LOTA 4Y33A 2C1FA 3JB8A 1N1VA 1NKGA 2D40A 2AH2A 3HWJA 3ETPA 2L9LA 4KU8A 4L97A 4B3NA 4A2UA 3DYMA 5EYYA 3VBFB 1XNCA 3KCYA 2UY8A 1V6LA 4TSVA 3ZFFA 1NAEA 4ISRA 3ZKYA 4IV3A 4D6RA 4LKFA 1XQNA 3FX3A 1AJKA 3AFKA 3MUZ1 1HB2A 2W1WA 5EYXA 1UZVA 3K4AA 4N53B 1GWMA 4IEUA 4GWMA 4HSLA 3THDA 4AI9A 3S5QA 4GB33 1A34A 2C26A 4QWNA 3BTYA 1WW5A 1R081 4AFMA 2VQTA 4AEDA 5BNNC 3NKGA 3MICA 3AX4A 3WP4A 3FWEA 4FAGA 4IEPA 3CU7A 3IWZA 5D2AA 3CZJA 5A3OA 1H2LA 1OMIA 4AAXA 5F5AA 3FMGA 1QGLA 2V73A 3CL1A 1ND2C 4B8EA 1QKQA 1LEMA 1RUE3 2KA3A 4KQ7A 5IJRA 5FLHA 5CB7A 3OY8B 1Y3TA 3PDQA 1ULEA 4PDWC 1WW4A 1SZBA 3ACLA 2Q1FA 4MVTA 4CP1A 1F9KA 4K20A 4YYOA 2BGOA 4NOTA 4JQRA 1OUSA 3FFZA 1UN1A 1HDKA 1GWKA 1QEXA 3C3VA 3PMSA 1QXPA 4TXWA 1UY2A 5LK5A 1CQ9A 1SDWA 3JCIA 5GLVA 5LATA 4A3ZA 4E4DX 3IKWA 5KC5A 5IVEA 3LEIA 3ZSMA 3AJZA 1O4TA 4A7KA 1JOJA 3NAPB 3EMRA 5DPNA 2D43A 3H50A 4COZA 3KB5A 1UXXX 2YPJA 4OHVA 3O5SA 2DBNA 4AQSA 3PIGA 3WDTA 3POFA 2DVBA 4Q4W2 3D6EA 1J1LA 2AEZA 4Y4YA 4NUBA 3RZZA 5KBFA 3NV3A 3VZKA 2YB7A 1W9FA 1SBDA 1FPN2 4CA9A 2DV9A 1CZVA 1W8WA 2WS93 3I2JA 1OF4A 2RMU1 5FPBA 3B93A 3C2UA 1F5JA 1MQTB 2PMWB 3RYPA 4IE7A 3VHOA 4LA3A 3MF9A 3EJKA 1UMIA 4FPOB 4BCUA 4XUNA 1OPMA 1W2OA 4EN8B 1HRI3 1PVXA 2RJKA 4N43A 4PF5A 5C3RA 2VGDA 5JZGC 2JD9A 2PTMA 5DG2A 5F8PA 5FZBA 4CEYA 1QXJA 1H1AA 5AFEA 4BXFA 3MIFA 3VDDB 3ZR5A 5AC92 1W9TA 1HQLA 3USSA 3W59A 1GQHA 4P9WA 3G6JB 3RZJA 2FDIA 4JHTA 1EAH3 5E6HA 4XABA 1H2NA 2PAEA 1YQCA 4W8JA 5IVBA 1BBT3 1OHFA 3KV4A 1TG7A 3WF4A 1AR81 3ON7A 3H8OA 1AL22 4TLFA 1BLZA 3RQ0A 3ZN6B 1QH7A 3OBAA 3RZGA 1UY4A 4K9SA 5FZFA 4LLOA 1PIV3 4ITCA 1SFNA 4NHMA 3PHMA 4ARYA 2FCTA 3T4VA 1LJ7A 4QQHA 4RR3C 3NVCA 4FXKB 4QAWA 5A1LA 2JDUA 2R042 4GB32 1J59A 3QCWA 4YW2A 4CUBA 1RXGA 2AREA 2QKDA 4ASLA 4M00A 5CKNA 2HEVF 3CJXA 2WT1A 2CU5A 2PHRA 5F3EA 5GLZA 5H9RA 1U5ZA 1YC61 1FAYA 4V1PA 2TBVA 3GGLA 4IXLA 4QKFA 1W6MB 1KITA 3DL3A 4Z1VA 4XF4A 1S1AA 2BVVA 1NLQA 3ZYHA 1AX0A 5F32A 3J8F1 4JQTA 1RUE2 1LOCA 2X5IB 4L99A 1IHMA 3HEIA 2ZKLA 4Y5Z0 2D93A 1IPKA 2J22A 1AYM1 2QQIA 2VPVA 2ZX3A 3ILFA 2ZX4A 1CD3G 2PN5A 4HONA 3QD6A 1WKYA 3SH4A 3TAYA 2RV9A 4QGMA 2QE3A 3ZM8A 3VUOA 4AHXA 1WMFA 1JI6A 1RVF3 4DIQA 2ARBA 4FOVA 2H0VA 2VMEA 5FUIA 3SITA 4F7ZA 2HBUA 4QPIB 1C5IA 1WWYA 5LEJA 5APAA 5BNOC 1ZRCA 1VP6A 4JHZA 3W5NA 3KD4A 1JYXA 1DYPA 4CCMA 3ZFEB 4IE4A 1EY2A 4LHLA 2JDPA 4QU2A 4DZGA 2DTWA 1JYWA 4CTEA 1W0PA 4NN0A 3LCPA 1I1EA 2WWJA 1FX5A 2A7AA 3AP5A 2IWGB 2VOKA 3S7EA 4XQ4A 5JZGA 4DXTA 4H55A 4XJ9A 2OT7A 4P14A 1RYYA 4Q4X2 1JYIA 4YFZA 4XJAA 1OI6A 2BFUL 1R083 1ENQA 2WS92 3LSEA 3N9PA 4OI1A 2QZ2A 1W6QB 2ZHNA 1JMUB 5FZHA 5LBBA 2FZ2A 3BTXA 1W03A 2EXHA 3VBFA 3OGJA 4EZHA 2IC1A 2WWUA 4YM0A 4YW6A 1W8ZA 2QQWA 3ME2A 1VR3A 2PELA 4IW3A 2WZ8A 1HRI2 3I49A 4FQZA 3N7LA 2WAAA 1NA1B 1CWPA 4LO6B 2HLEA 4PLMA 1TE1B 3AB0A 2PXJA 4OI2A 3U75A 2HJIA 4AZZA 5C3SA 3LB9A 1X82A 3I2GA 2EA7A 4LE4A 4P9YA 3OD0A 4YFWA 4EN6B 5F5IA 2E6VA 4MUVA 1FMD1 3O1OA 2YDEA 2ORZA 3TWIA 3LQCA 1BBT2 3MUY1 2JB8A 2CDPA 1YFUA 2A6VA 2DCTA 5JI9A 3GDBA 2EF6A 1NYWA 2YC0A 2I45A 3KV6A 5A33B 2YG0A 1AR92 4FP2A 1QU0A 1QJU2 1S2EA 2VZRA 3WQ0A 4FPGA 3WCRA 2RM23 5C70A 3QACA 2I74A 4AOCA 1YJLA 3OEAA 3WF0A 4KGQA 2XONA 2ZX2A 3JZVA 3KLSA 5FMCA 1WUVA 3B01A 1HLCA 5L7OB 3MW4A 4XFHA 1PK6C 3EHKA 3HVDA 2WZPP 3OYWA 1PO23 1GZTA 2RMU3 4AFCA 4BOWA 5FIXA 4Y24A 1L7QA 3V0AB 5LCWL 2Q30A 4BQYA 5H9PA 2D5FA 3DN7A 2NMOA 5FYCA 2FDFA 2A6XA 1WA4A 3CNAA 2GMPA 1X9TA 3NAPA 5GALA 5DZEA 3FZ3A 4YM3A 2ZBJA 4BPZA 5JDBA 3U4XA 4A42A 5FMBA 1F35A 1KD7A 1SLCA 1UIKA 5IT6A 1DFQA 4M3CA 5FYBA 2PAMA 4M01A 3U4SA 4AVCA 1W39A 3P3NA 5HV0A 4UW4A 1DQ1A 2WLQA 3KQ4B 1GOFA 4FBFA 3CF6E 5FZAA 1AR83 1XXNA 4LBJA 4AVSA 2XPJA 4OUMA 4QDQA 5KXCA 3C7OA 1J3PA 2Y6FA 4FPLA 2RVAA 2Y6JA 5C4WC 4E2SA 1LU2A 1MQTA 2B8MA 4IEYA 1RIRA 5FYZA 4IE0A 3VKMA 1A8MA 2VY0A 1K3IA 2A6YA 5FLJA 1LOAA 4A44A 4QKBA 3BU0A 3VD4A 4IV1C 1QDOA 3ZX7A 4QB2A 2EAKA 3K3OA 5SV8A 5KXDA 1CX4A 4FXGB 1R082 3KT7A 3LA3A 4N8MA 5FZOA 1H8VA 1J3RA 2BNMA 3LE0A 1MS9A 2H6BA 5M0TA 5FMOL 4Z8BA 3PVOA 4JTOA 4Y5TA 3IMNA 4LBQB 1QJZA 5IW0A 4A4AA 1W0NA 3NNMA 1R1ZA 2F17A 2BDRA 2XWBB 4Y1ZA 4XOGA 3ZN6A 3VBUC 4QMAA 2B4KA 3SCFA 4GWNA 5GZGA 2FDHA 4ATFA 2ZZQA 4XURA 4DUXA 1EUTA 2JDHA 4MX3A 2HYXA 1C1LA 3GCWA 2JB4A 1AVBA 3DECA 4Y5SA 4AQ6A 1EPZA 4GMP3 4QPWA 4DRRA 4R9CA 3B02A 4XAAA 5JIAA 3AZVA 1ZA4A 3GBGA 2NLRA 2O8QA 4UF0B 5BXXA 4YZ4A 4GJZA 1S0JA 3MIGA 4RGKA 2Y8KA 3ENRA 4Q0SA 2JDZA 2OA2A 4WZFA 5CFDC 3WVJA 4IE5A 3AC0A 5EZWA 3USUB 3SXWA 4XVHA 4D7SA 5A3LA 2VCCA 1BYHA 2XHNA 1PX4A 3MF6A 2AZ5A 5EQUA 1S0FA 2RM22 1YIFA 2E7TA 2EVXA 1O3QA 1LULA
chains in the Genus database with same CATH topology
2X5IA 3LZZA 1VRH1 3AKSA 2G9GA 5DUXA 3D82A 3I2DA 5DZFA 4HETA 4PBPA 2VNGA 3UJQA 1LGBA 3AKRA 1OFSA 4YW1A 1PO22 2RMU2 1JN2P 3RJ2X 2GN3A 3VHNA 1RITA 1V9U3 4IEWA 1KDMA 2IFWA 4QPIA 1LECA 5E88A 3VBRA 2D3PA 3AZXA 4F3JA 3ZFEA 5CG9A 2R1DA 3VZMA 3J26N 4YZ5A 5BNQA 1CAWA 2I07B 3ZXAC 2K2SA 5IK4A 1IPJA 3HT1A 2WQZC 3GF6A 4HK8A 5IK7A 3MW3A 3KQRA 2WFPA 2NM1A 1DQ0A 1V6JA 2PHXA 5FO9B 5FBZA 1AR82 2TEPA 1W6QA 1R1A1 5FRAA 1D2SA 3AMNA 3R0RA 5IK5A 3M7AA 4MGYE 4AI2A 2W39A 5ABJB 4IESA 2B39A 2DFCA 3B94A 4HFSA 3AZYA 4ASMB 1NA1A 5L73A 4JRAA 4FO9A 4GALA 1AR73 4YM1A 2HYKA 2XJVA 3BODA 5BNPC 2VUAA 4JGZC 2WZR1 3M1HA 3JU9A 3WW3A 2KM2A 5CFDA 4OHZA 2XLGA 2QCSB 5IUQA 5I8SA 5A33A 1RUD3 5KXEA 4MZUA 4OFGA 1W2UA 2CY6A 3L2YA 3ZSLA 1DF0A 2R071 2EXKA 2WNVB 5FO7B 4JRLA 5L7OA 4EWDA 1KDKA 1OA4A 2XKOA 4WM8C 3ZYRA 1K5MB 2QNKA 1GZCA 5FPZA 2AENA 3ZFGB 4UBGA 3N7JA 4FPCA 1LGCA 3V0AA 1ND3B 2IXCA 4META 2GU9A 4WM7C 1OSGA 4YG0A 3WP6A 1DGLA 1YYNA 3FBMA 3MGUA 4L2NA 4RGAA 4EJRA 5JOWA 1Y43B 4Q4Y1 4B7KA 1NE4A 1KS4A 2GNMA 1V9U2 2VMHA 2ZACA 5CADA 5K7PA 3WLUA 3AJYA 4QQPA 3BIWE 3IPVA 3AZZA 2Z2SB 4AHZA 1FPN1 3ZFFB 3W9AA 4ATEA 4CDUB 4I30A 1YCIA 1AHSA 4IV3B 1W6PB 1AJOA 4RS5B 1BCXA 1FMD2 4KL1A 4AGVA 4PLNA 3BTAA 2H0BA 3ZXEA 4CDWC 4JGZA 4Q0QA 4H3WA 3N7MA 1HRV1 5CFCB 2K0GA 4LBQA 3WD5A 4Q4V3 2UURA 3SMHA 4YGCA 3D8CA 3SLIA 3ETQA 1A6CA 4NPRA 1B35B 1JHNA 1EV13 4WVVA 3PVNA 3VBHC 1VRH3 1YI9A 4XFAA 3ZSEA 4E4ZA 4QGNA 1H1IA 3VL8A 1IGOA 1RC6A 3LA2A 1D0GA 3VHPA 4XW3A 5FOJB 4I02A 4WM8A 2D7FA 5BY5A 3OCPA 3VKNA 3USUA 1C1FA 1RUD2 2YROA 1DGWA 2GC3A 5EWSA 5IK8A 2DCYA 1U5IA 3KGZA 3MPBA 4XF1A 1Q8SA 1YFYA 3W58A 1C57A 1A78A 1ZZ7A 2YUEA 4FOWA 3WDXA 3O14A 2IXIA 5FLIA 1FV2A 2W68A 3U07A 1MS1A 1H2MA 1G9DA 1LR5A 1WCKA 1W0OA 1DBNA 2JD4A 5J98B 1LCLA 4HL0A 1AX2A 4I09A 4BA6A 5JCTA 1OLRA 1UF2C 1SCRA 2VNRA 4C1XA 4K1ZA 5SV5A 2ZOEB 1VBD1 3AYDA 1ULGA 2Q0AA 1IOAA 1QQP1 5T5PA 2UYBA 1VBE3 2DCKA 3BALA 4FP3A 2LTNA 3ZYGA 1TQ5A 3AP9A 3I8TA 3TB0A 4XHXA 1FNZA 1H4GA 5T3NA 3VHRA 1AXZA 1ZREA 4DS0A 5JIUA 2HWF3 5A3MA 2E53A 5C8CC 2WS91 3URFA 5BNNB 4XBLA 5ABJA 3OF1A 4CZSA 1YFWA 5T50A 4QQ2A 1PVC3 2Z42A 2V5YA 2R073 2MNGA 1N1TA 3ATGA 5KHGA 3MPPG 1H30A 1VB2A 4F8AA 1MS8A 2IXLA 2F6BA 5F6KA 4PDWB 2ZGQA 4F83A 1C3HA 4Q4V2 2D44A 4AI1A 2XG3A 4RD7A 4JGYA 4N7UA 1OQEA 1GYKA 5KC6A 2DVAA 4FPEA 4XJWA 1X50A 1AZDA 1PZ9A 1EAH1 2X29A 5GZEA 1QJY3 1VRH2 1XU1A 4XXPA 2WFF3 1RUC1 3JBG3 4JTNA 1Q43A 1PO13 1CJDA 4OZXA 3OGGA 4Y20B 4QM8A 3POSA 3VBSC 1SLIA 1PIV1 2ZX0A 3ALQA 2WNVA 4Q4Y3 2FZ1A 4GMP0 4P9JA 2A3XA 1IS3A 1QF3A 1K5MA 5FTTC 2QDNA 3ZFGA 3NJZA 4X6QB 4AVVA 5T55A 1ENXA 2XJTA 3MLLA 3V0BB 2JX9A 2JXAA 4C91A 1ND3A 3R4DB 2BNNA 4YW5A 3T2TA 4EROA 1URXA 2JG9C 2E7AA 4RHV1 4FPHA 4HKLA 3WZ1A 4HN0A 2XKPA 5JZGB 3WG2A 4BMBA 4IEXA 2JG8C 3WP5A 4Q8KA 1H4HA 3O7OA 4YLZA 3FLRA 5JMCA 5LRSA 4XE9A 4BLIA 3ZYJB 1RVF1 5DDJ3 3LKJA 2DF7A 1UKGA 1GICA 2DURA 4R9DA 4MXWB 5JI7A 3E5UA 4CDUA 4DQAA 1VBE2 3IT8A 4LTAA 1Q5OA 3AZWA 3JD73 1W6PA 3CO2A 4RS5A 2WZR2 3S6PA 1TNFA 2D5HA 4RR3B 2BQPA 4FOQA 3IDEA 5J7MA 2WQ4A 4COYA 2VOXA 4LR4A 5CFCA 4QQOA 2CGPA 3FHIB 1BVVA 5I8YA 1B35A 3VBOC 2DVDA 1Q3EA 1LHOA 2EXJA 2R072 3BOWA 5I0RA 4KG8A 1ZBA1 2ZTNA 4PIZA 4EN7B 3ZN4A 4HZFA 5EJ3A 1RUJ1 2D6KA 2DUOA 1O5UA 1VAKA 1WLWA 3AMQA 1MS3A 2WA3A 5K0UC 1C8NA 3OYWB 5LK7B 1WLDA 4GULA 3RG0A 5BNOB 1VBD3 5DXDA 4B4PA 1QQP3 1MVEA 1RUF3 2Q4SA 2WNUC 4Q2FA 1RB8G 1ULDA 1V00A 3JUUA 1BEV1 4Q4Y2 5CBLA 1EP0A 2XLFA 4LO5B 2P37A 2RM21 4XMAA 4AFAA 5I0TA 4X8PA 4YARA 3CLPA 4DPNA 1BJQA 4M3CB 1NCRC 4JDNA 3WW2A 3UL2A 1H8TC 1TMF3 2P34A 4HBNA 1AUYA 1PO21 4XTPA 2D97A 2ZAHA 3WG4A 3QLQA 4FVVA 4AQ2A 2D3RA 3SISA 1HKDA 1O3TA 4SLIA 4MYEA 3I54A 2ILMA 4MH0E 1H9PA 1HRV2 1WMDA 2RS13 3ZVXA 4AVBA 3OTFA 1TEIA 2XL9A 2HWD1 4K1YA 3ZN5A 1RUH3 4XJZA 1XU2A 3WDUA 1Z78A 2A70A 4CDXC 5FOBB 2DCJA 2GMMA 5CG8A 4YW4A 1I5ZA 5CNAA 3MIDA 3PMEA 5DZGA 2YXSA 1SCSA 5BNNA 1RUC3 2ERFA 3JD72 4HN1A 3VV1A 1PZ8A 3POYA 3WOGA 2YGMA 2JJ6A 4FCAA 1ALYA 1QXRA 3R05A 1ND2A 4AGGA 1XYOA 1YRZA 3OBTA 4PDWA 1CGPA 2VULA 4XHBA 1PK6B 2BNOA 5T52A 3J9SA 3MI8A 3TN93 3BCWA 4ZXKA 5E89A 1ASJ3 2VECA 4CEWC 4RHV3 3RPQA 1UZYA 2WT2A 4Y20A 2VOVA 4MXVA 1VAMA 2XGXA 3INAA 1N3QA 3PJQA 1XE8A 1N3OA 1MEC1 3GNEA 3B5LB 2B45X 2WWSA 1HV0A 1NCRA 4BIFA 4GMP1 4ZU5A 1NCQC 1DYKA 4Y1UA 4LE3A 3V0BA 1VBD2 3VBRB 1FXZA 1QQP2 4J1XA 4MGZE 1DGRN 2R30A 1GNHA 4G3YC 4XILA 1X7NA 5C4WB 1Q8PA 1IZ3A 5K8SA 4D94A 1CAWB 4JDMA 1A8DA 1JUIA 2B46X 1YI7A 4IV1B 3MIBA 2IXKA 2VH9A 2YHJA 3ILNA 1KS5A 2IFRA 5J09A 4H7LA 4XFGA 2GNBA 3AYEA 3I7DA 3TRSB 4C0BA 1DZRA 4KBBA 2D3SA 5D8AC 2XVKA 4C1WA 1V9U1 4MXWA 1S0DA 4AW7A 4PIXA 4Z92B 1NXD1 1ZBA3 2Y0IA 5GKAC 5C33A 3POWA 1HV1A 4YG6A 3H7YA 2HWC1 4MV2A 2GH8A 2BVBA 1RUJ3 5A32A 1COV3 2NQYA 4RR3A 1J1TA 1G9BA 2ZHLA 1EAH2 2ZX1A 1EPWA 2DU1A 1OQ1A 3B00A 4QT6A 3WXPA 3AP7A 4J1WA 4KWKA 1RUC2 3VN4A 5CFDB 3HBZA 4X6RB 3CJIC 3Q9OA 1ZX5A 1RUOA 3RYRA 1PIV2 1BEV3 2WIIB 4LLFA 1R091 3K51A 2QVSB 3M3EA 5DUUA 1FV3A 1CR7A 1VBB3 2BYVE 1AR71 2KXLA 4OI4A 3KS7A 2R0FA 4GIQA 4PLOA 1Q8QA 1L3JA 4YGBA 3GYDA 1IS6A 1G86A 4I01A 5BNOA 2GMEA 4RHV2 3X29B 1OA3A 4L9BA 3DPRC 3ROUA 1M06G 2DWRA 1RUG3 1RUD1 4P9LA 3DF0A 1XYNA 3GHMA 1ZNPA 2H6CA 3T1LA 2HWD3 2VVFA 1RVF2 1GNZA 3WY6A 2WSUA 2VG9A 4YSFA 5HBAA 3MEPA 4DINB 3PVBB 4ZU4A 1LOEA 4UW3A 5BPXA 1VB4A 3BOPA 5D8AA 2XWJB 4BE3A 3IPVB 2XLAA 4DY3A 2DUQA 2Q1MA 4GA9A 1CAXA 1V6MA 1QJX1 1PHMA 3NO8A 4Q1PA 4GH4C 1QOSA 2I2SA 2OYZA 1KJRA 1QWRA 1JUHA 3KZ4C 5FDBA 4AEJA 3ES4A 4ES8A 2WT0A 1VBA3 2NPIA 4ISQA 3SNMA 4LBQD 5BNPB 4JGZB 1CONA 3ZSJA 1C4RA 1ENSA 2XHKA 2ZGTA 4PJYA 1OFNA 2ATFA 4H7MA 2PQQA 3GALA 1HXS3 1ZBA2 5KXBA 1YNAA 4MGIE 3SH5A 2ZGPA 1KRIA 1RUJ2 1MEC3 4LHNA 1COV2 5BUVA 4FTEA 3NSTA 3B69A 1MS5A 4YVSC 4HPKB 5HCFA 3ZYIB 4LUMA 2CTVA 3AXDA 4XTMA 5CIRA 4R52A 3T1MA 2MEV3 1PK6A 1VBC3 4WM8B 1REFA 3VKLA 4QX5A 3ZIWA 1FOD3 3B9IA 3LA7A 1HW5A 1QNYA 4Q4V1 1BEV2 1LHUA 1UPIA 4IEOA 3H3ZA 4WBBA 3TNPB 3H9AA 1EV11 2BW8A 4WM7B 1REEA 5CAZA 2VW1A 3M3QA 3VZOA 1AXKA 5TSWA 4E9KA 1ZZBA 3UJOA 1F8VA 3JQWA 1YFXA 4BMEA 1T6GC 2ZHKA 3RJRA 2QUOA 3OPZA 1KFXL 3ZXJA 3AYAA 1POV3 3QH6A 4NHKA 4XQWA 5ACA3 5C4WA 3THPA 2HWC3 1GR3A 2HWD2 1XNKA 3JQXA 4IV1A 3S0MA 3HD8B 3ZO0B 1BKZA 4AHWA 2EXIA 1RTVA 4CDWB 3AYCA 3SH3A 2GDFA 1FATA 1RHI3 4HK9A 2BWAA 2D6MA 2OZJA 2ZAAA 2IXHA 4XETA 1OOPC 2QFEA 1R093 1XE7A 3D4KA 4Z07A 4BHPA 3VBUA 3L9JT 4NR1A 3VBHB 2DVFA 5FFOC 1O3SA 1GZWA 1F5FA 4OHXA 1VBE1 1VBA2 5CU1A 1GANA 1LENA 2PFWA 2HWB3 3TOJA 4W6YA 2YYOA 4JGYB 4R4XA 4XIOA 2ET1A 4IETA 3KSCA 1YWKA 4LBOA 2HWF1 5C9AC 5H9SA 3KM5A 1WCSA 4I0WB 2ES3A 5BV6A 2HWE3 2VUJA 1MEC2 5I0SA 4HKOA 4URTA 3RMYA 4N90A 1UX6A 4I3GA 4N9HA 1QNWA 2ZHMA 2A73B 1G6NA 1PVC1 2FMDA 2VVDA 2UWAA 3BB6A 4Q0PA 4YGDA 5F6LB 1F31A 5JOZA 1UL9A 1FOD2 5CVRA 4LA2A 1DQ2A 3U11A 1BMV1 5KHKA 4FTBA 2PLV3 1UPSA 3DGTA 1DU3D 3IIAA 1N1SA 4A7YA 1QJX3 1QJY1 2WFF1 1AR63 2A3YA 3JBG1 3H1MA 2QQPA 4QXKA 4FPJA 1PO11 2XL7A 4FTSA 1C8M1 2AYHA 3GBFA 2ZPXA 4L8QA 3VZLA 5J96B 5J36A 4K8FA 4WV8A 1CAVB 4LEJA 3U0ZA 4CDQC 2HWC2 5C8CB 3R4SA 2BUKA 1O5LA 5HCBA 3OD4A 4NWWA 2XVLA 1N3PA 3MLJA 4IEQA 2E51A 1DGRA 1RMU3 1ZZCA 3OBRA 5BNPA 2OZ6A 1DQ5A 3VZJA 1U5XA 2G4IA 4KNCA 4YRDA 1R092 2GALA 3UKTA 3ZMNA 5C9AA 5DDJ1 3QBQA 4K3UA 2WLPA 4QPGC 3SCHA 4Q0UA 2GSYA 2CGNA 1AR72 3ST7A 2C5DA 3IBMA 3MW2A 4HPKA 3JD71 4AHYA 2HWB2 4EV0A 5GLTA 3GZTB 3QH7A 1JW6A 1Z7S3 1APNA 4WZCA 1ZBE1 1AX1A 4R9BA 2R1BA 1FI2A 1Q8OA 2BTVC 5FQ0B 1ENRA 1NLSA 2VQAA 3WDWA 2JECA 2R063 3PTYA 2CGOA 1ZRDA 3WW4A 2XJSA 4KWLA 1LOFC 2LM3A 1UD1A 1V6KA 1Q56A 4GXLA 1CESA 2JG9B 4WM7A 3TBDA 3AMMA 4Q27A 4LT5A 3E5QA 3ZMOA 1CIWA 1TME3 2JG8B 3WX5A 2V09A 1Z0HA 1UMZA 5F5QA 4EWEA 5BYNA 3RI8A 4XFIA 4ZU7A 1CPNA 2XJPA 1QJX2 4E4SA 5FMOS 4E27A 1AR62 2EAAA 1ZRFA 5L36A 4FPYA 1PM7A 2PYTA 1RUF1 1IKPA 4CDWA 3E5XA 4YZ3A 5HCAA 1DDLA 4XDQA 3GBWA 2R0HA 4RQPC 1DLLA 1ULCA 2Q8OA 1WW7A 3H7JA 1TMF1 3LWCA 3VBOB 4BLJA 4LBKA 2MHFA 4LHKA 3MZHA 3M3CA 2ZCWA 4R8HA 3VBHA 2CWMA 1J3QA 4S2FA 3UV9A 1DG6A 4YZ1A 1ND2B 1LHVA 1W6NA 3FUOA 4UW5A 2HEYF 4XJUA 5JVVA 4AGRA 2TNFA 3A4UA 2IXJA 2RS11 5I91A 3WUCA 1RUH1 4LO8A 5C8WA 4M0HA 4XF3A 3G7DA 4DFSA 5K0UB 3M2MA 2XBO3 3PVEA 4XPVA 4BH9A 1EV12 1DHKB 3VKOA 1YIPA 5E16A 1RUI1 4AWDA 2UY9A 3NKTA 1GQGA 3N36A 4Y22A 4YVWC 4IV3C 5GM0A 2VNOA 3AK0A 4COWA 1C8M3 1X8MA 3HN1A 2C0ZA 5L19A 1Z7S2 2P17A 3U10A 1PNGA 2ZS6B 2GN7A 2A3WA 4S2DA 1O91A 2UWCA 2CAVA 1NCRB 4R9AA 2A5ZA 3VLBB 4BZ4A 4XBQA 4HSJA 4KG0A 4AEDC 2AR6A 1NZCA 2VMGA 4I0AA 1XNBA 3TN91 4OLLA 1H9WA 2RJLA 1ASJ1 5EXOA 3WG3A 3FE5A 3ECQA 5K9YA 2ZJCA 4E2QA 3CEWA 4NWVA 1ZYBA 4FOYA 2Y26A 2AUYA 4Q4W3 4E2GA 3AKTA 4FQ4A 5KHJA 3WQ1A 3I59B 1CAVA 1RJ7A 4W6WA 4CDXB 1E57A 2ZMKA 1CPMA 4A3XA 4CRQA 3FBYA 4C90A 1PNFA 1POV0 5C8CA 3HMYA 2YGLA 4CP2A 1UZZA 4XQDA 2FMYA 3JB4C 3RMXA 3TYJA 2W52A 1U0AA 1LESA 2WKKA 5A32B 4A7ZA 1ZBE3 4GQ7A 2E7QA 2A75A 3O0XA 4JDOA 2HWF2 1C28A 3IDCB 3IN9A 3MLKA 4GKYA 4WVWA 5AC93 1FT9A 1G9CA 3V64A 2CNAA 5T5LA 1PVC2 1HQNA 3NV4A 4YVWA 4CEWB 1AL23 4HVOA 2VXRA 4XFFA 4N43C 4KU7A 3VBSA 2NZ9A 2FHRA 2UWBA 1SEFA 4CEYC 1BMV2 4P9IA 1COV1 2R043 4GKXA 4NVPA 3ZIXA 2XBO2 4PIYA 4M3CE 1NCQB 5FQ0A 3S30A 1QJY2 1DQ4A 1SLAA 2WFF2 3EO6A 3JBG2 5JPNB 1NQDA 1KXGA 1PO12 4AI0A 1LODA 1LHWA 1C8M2 2OIIA 3VZNA 2JG9A 4DOUA 2A6ZA 2RHPA 2BPA2 2RS53 4HVQA 3WT3A 2JG8A 2GC2A 4KWJA 3AXEA 1VBB1 3ZPYA 5DG1A 1EYBA 3HR9A 2DYCA 3PJYA 1JYCA 4B4QA 5D8AB 2BBVA 5D1IA 1AL0G 4XYXA 3ZXDA 1SLTA 4OUSA 3NWKA 2XH6A 2JICA 2WJSA 4UW6A 4FSJA 1CAXB 2DVGA 3EQEA 1RUG1 1ZZ8A 4OHYA 2SBAA 3B7MA 3WV6A 3ZXKA 5KHHA 4Q4X3 4L92A 5GZFA 5DDJ2 3NL1A 1PGL1 4QPYA 1V6IA 1RUI3 4XEZA 3VBOA 4M0NA 4HKWA 3ZDSA 4BIOA 1D2QA 3CJIB 1KFUL 3N4MA 3ZXLA 1VLNA 1ZBE2 1NQJA 2X8KA 2Q5TA 3N7KA 1REDA 4XJ8A 2ZABA 1AYN3 1O3RA 5JAXA 3H1WA 1VBA1 3EBRA 2SLIA 1BXHA 3LSDA 4QM9A 5K0UA 3VBFC 5E8AA 1X36A 1WD4A 4ZKTB 4WVZA 1HXS1 2P3KA 3DPRB 5T5OA 4S2GA 1AR93 4HANA 2D6PA 2WNUA 3D5OA 4N7IA 1QJU3 1UCXA 4N53C 4D69A 4XMIA 1D0HA 4NHLA 1NLRA 2CV6A 2GNTA 1SBEA 2Z79A 4S2HA 4UBHA 5JPMB 2WC2A 1YXWA 2MEV1 3ASIA 2NMNA 1VBC1 4DXZA 3MIEA 1H8TA 4MSVA 2X53S 1I9RA 1RUF2 1FOD1 3LAGA 4DNYA 2JEMA 2RR13 3FLTA 3MFCA 1UAIA 3APBA 2RS52 2VVEA 1MZ6A 1IS4A 4I2OA 5JSPA 4GH4B 3DUIA 2Y38A 4YZ2A 1U12A 3FLPA 4J6GA 1NE6A 3WUDA 4PBOA 4CYDA 3VL9A 1MZEA 1TMF2 3I59A 1IKQA 5E1RA 3KMHA 4CDXA 2ENRA 4Y1VA 1BQPA 4Q26A 1UKRA 2GC1A 1POV1 3NAPC 4LNVA 2GZWA 2Y0OA 1GLHA 3VBUB 5ACA1 4OI0A 5J37A 2DUPA 2RS12 1LKNA 1GZWB 4JVAA 4YVSB 1RUH2 1WLTA 1QH6A 5LEKA 2W08A 2W0XA 3H3UA 4B7EA 2HEWF 5HXVA 1MS4A