2R0IA

Crystal structure of a kinase mark2/par-1 mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
316
structure length
300
Chain Sequence
PHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVAPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase MARK2
publication title Crystal structure of a kinase MARK2/Par-1 mutant
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transferase
total genus 92
structure length 300
sequence length 316
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2r0iA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2r0iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2r0iA01
4BTMA 3WE4A 4M7IA 4HEOA 3HZTA 3LQ8A 5AWMA 1G8SA 4E4LA 5M09A 2OOBA 4ANOA 3SQQA 2CKPA 5EM6A 5CYIA 4BCFA 2R0IA 3ORZA 3OWKA 2G2HA 4OR5A 2DWBA 3HRBA 2PZIA 4CG8A 2BCJA 1E94E 3QUEA 3ZFXA 4F7SA 2IWIA 4CFWA 5L2TA 3IG7A 3VBVA 4IMYA 3JY9A 5K0KA 2YJSA 3G9NA 4K33A 4IM2A 1ZY5A 3CTHA 4WRSA 5AR3A 2PE0A 2WTVA 3GGFA 4DG3E 4YZCA 4F9WA 5IA2A 4PPAA 1OGUA 1UV5A 4TXCA 3P78A 4F1MA 5K4JA 3V5WA 1G4AE 1ZMVA 5DFLA 4HVHA 1OPKA 3DZQA 1DS5A 1ZY4A 2Y8OA 3IOKA 3R30A 4FTKA 2JC6A 4PNIA 4YLJA 4K1BA 3RWPA 3SD0A 4LOPA 5HG7A 3ZLYA 5JT2A 1H27A 4XH6A 3U9CA 1FVVA 3OCBA 5EYMA 3LCDA 3CBLA 3EQDA 3QD0A 3R7YA 1IA8A 3COMA 2NNWB 1VR2A 1CKPA 4R71A 2Z8CA 2WQBA 3ORMA 1Q61A 3LQ3A 4F9CA 3NW7A 3ORKA 4K18A 4OBQA 2XP2A 4FA2A 4FVRA 4HGEA 2I40A 2IVSA 4HVSA 3OOMA 3MDYA 4NFMA 1WBPA 5AR8A 3F3UA 2W4JA 1PMNA 2W4OA 5DR9A 5AA8A 5TT7A 4QPAA 4C4JA 4L68A 1YDSE 1PXPA 2CCHA 2XIKA 3DY7A 3QXOA 3R2BA 4YJTA 3TT0A 2XK7A 4I5CA 4BYIA 3OMVA 2AC5A 2X7FA 3O51A 3EQIA 2RFDA 1KV2A 3GENA 4G3EA 2OOAA 2CN5A 4YC6A 1YI4A 2OH0E 5AR7A 2UVXA 3DGKA 3M11A 3KXMA 4QP9A 3HAVA 2XEZA 3LLAA 3QZIA 2QO2A 3GT8A 3HVCA 4K0YA 2OJJA 5J87A 3MJ1A 4CFXA 2DNAA 3K9OA 3QC9A 2PY3A 4KIQA 3KULA 4L9IA 4RZWA 1TQIA 5I9YA 4F65A 3K54A 4GJ3A 5IUIA 4MAOA 2YZAA 3R2YA 3OBJA 4QOXA 3ZSIA 1OUYA 1X8BA 2ITZA 4X2GA 4AE6A 2UUEA 4BDDA 2Z60A 5JGBA 1KSWA 3HGKA 3D9VA 2WU6A 2C3JA 3FLSA 3HV4A 2W9FB 4K77A 3DKGA 5KBQA 4I0TA 3C4XA 1PXIA 5FQDC 4X3FC 3R7EA 4D4SA 1AGWA 2YJRA 3AD6A 3R6XA 4RX9A 2B0QA 4H1JA 2QOCA 4IB5A 3R01A 1K3AA 4L44A 4XBRA 3V5LA 4D0XA 3MIAA 4X0MA 4IDVA 3QTQA 4BWPA 4EJ7A 4JRVA 5AMNA 4BKZA 3QYZA 4RX5A 2YA9A 2UZWE 2ZM4A 3UDBA 1SVGA 4EK5A 5A4TA 1YOJA 1Y8YA 3OCSA 4FIJA 1MQ4A 3PXYA 3LOKA 3IECA 2JY8A 4BGGA 3E3PA 5EQYA 1V92A 2ITOA 3BYMA 4L00A 5EW3A 4NIFA 4A07A 4MXZA 5ANJA 2GHMA 4E6QA 2PZRA 4I24A 2FUMA 2W7XA 3PXQA 4RWIA 3V5QA 1V0BA 4RGJA 2OIBA 4BDFA 3CPBA 5HX8A 4KD1A 2XNGA 2QU6A 4RVLA 3RAKA 4JBPA 3IW8A 3EQRA 5CXHA 5D11A 2EWAA 1CDKA 3F66A 2CP8A 3FZTA 4FV3A 2WMWA 4BCMA 5CU3A 3FJQE 5HVYA 3WYXA 4FT7A 2ZV8A 2OXYA 2G9XA 1XH7A 5FEQA 4TWCA 3L9MA 3DAJA 2XBJA 3DKCA 3MPMA 3ORXA 3ORTA 3DBFA 3F92A 3NPCA 3MVMA 1ZMWA 3ZZEA 4YZ9A 5BUIA 4EOSA 2OGVA 2HCKA 3VJNA 3MYGA 3PYYA 5J79A 3IW4A 3OY3A 4UZDA 3E8CA 5EI6A 4AUAA 3B8RA 3NW5A 4UWCA 2ZV9A 3RK5A 5AP1A 2YLEA 4AE9A 5L8LA 4FGRA 4HYSA 2ETMA 4TRLA 4IVAA 2CKEA 3H9RA 5CZIA 2X4ZA 5HG9A 2C6IA 3CQEA 5KMOA 2YAKA 1H01A 4XBUA 3RZFA 4IZYA 4XS2A 2C6TA 3CGOA 3Q2JA 1H0VA 4S31A 2X39A 3SG9A 3ZUVA 4FIEA 4DFLA 1IA9A 3CJFA 2F4JA 4L45A 5EDQA 5GHVA 3S2PA 3POOA 4UMQA 5AV1A 3UOHA 3VHEA 4U3YA 3L9NA 3VHKA 3DXPA 3MW1A 3NCGA 2A0CX 2O65A 3KXGA 3MY5A 4FKQA 3VQHA 4IQ6A 3Q4UA 4XG6A 2VTSA 4O7YA 3DZOA 3E7VA 3QC4A 4FTTA 4GK2A 1WVXA 4GIIA 4MXCA 4QT1A 3O8TA 4WUNA 3SC1A 4MVFA 3BHVA 2JIIA 3TJCA 2BROA 3R1NA 5CSVA 3MFTA 3OC1A 4O7NA 3OTUA 4DBGB 3AOXA 3ZYAA 2VTNA 3PZEA 4R6VA 5EHYA 5AX9A 4FEQA 2C1AA 4C7TA 1VEGA 2F7ZE 3VUDA 4ITHA 4TL0A 3OUNB 2YIQA 4M13A 2B55A 4ZJJA 3GC7A 5FBNC 3R8PA 4GU6A 4KKHA 1HT1E 3CLYA 3RVGA 1ZXEA 2XK8A 5IA5A 4A06A 2MGWA 4QYEA 1HCKA 2GPHA 3LFFA 4JIKA 2VRXA 2PVJA 4D1SA 4FTLA 5LXMA 2XKFA 4RVKA 3FE3A 4ZXTA 3FQSA 2B9FA 3O71A 3A61A 4IE9A 1APME 4EBWA 3BU3A 4U41A 4LI5A 3U8WA 5BYYA 3RK7A 1YWRA 4IM0A 4XG7A 3R8ZA 5CEOA 5IH6A 3H30A 4GS6A 4RT7A 4ANQA 4X3FB 2QC6A 5C4KA 5HG5A 1YWVA 3KN6A 4BDBA 4U45A 1XKKA 2WMTA 4DEAA 5KNJA 3EN9A 3HP2A 5K0XA 1PXOA 2YABA 4O0YA 2O5KA 3CGFA 2CLXA 3LAUA 1OL1A 1Q3DA 3SKCA 2XUUA 3OCGA 5IEVA 1UU9A 3QQGA 5EYDA 4FTIA 3WF5A 5DN3A 5AP0A 5EKOA 4CZUA 4PMSA 1DI8A 5KMJA 2Z7LA 4FIGA 4CYJA 5LJJA 3KB7A 3NAYA 2H9VA 3DB6A 2UZLA 3QCXA 4CEGA 5CEKA 4R3RA 1Q8WA 2V0DA 4AQCA 4ZSLA 5DPVA 4ERKA 2XK3A 2JBPA 4E20A 2QG5A 1U4DA 5DE2A 1JPAA 5DNRA 4RRVA 3ALNA 1WFCA 2VWZA 1O9UA 2WOTA 3PRIA 5K5XA 4XG8A 2GNHA 4RIWB 2BZKB 3H3CA 2PPQA 4FZ6A 5L8KA 2PMOX 4NU1A 3EWHA 4RC3A 3ZSGA 1OI9A 2UZDA 4FEUA 3D14A 5J9LA 4PP7A 3COHA 5ANOA 3SX9A 3GCSA 2QHMA 3W2PA 4DINA 2FSOX 2W99B 3Q9ZA 5EM7A 4ENXA 5LVMA 3RKBA 4ACCA 5GIPE 5IH5A 2QODA 3QL8A 3LKMA 4TWOA 3DFAA 3ROYA 2DKLA 4U80A 4Q9ZA 4BI1A 3OT3A 1EFUB 5EW8A 5ACBC 1H1PA 2ERKA 4IADA 4FNZA 1E1XA 4BCHA 3DFCB 3D2KA 4FTRA 4I3ZA 4M69B 5EH0A 1PMEA 2NRYA 3E62A 3NNVA 4MXAA 4F7LA 2Z7QA 5CAVA 3L1SA 3ZM4A 2FH9A 5DRDA 3SLSA 3U51A 4QNAA 2V55A 3CE3A 1J91A 3F69A 3BLRA 3ZTXA 3I4BA 3ZFMA 2G01A 3CEKA 5GINE 5H8BA 2PHKA 4C4FA 2X2KA 3TNWA 5BUJA 5DFPA 5B2LA 2A1AB 2OLCA 4KSPA 1Q24A 3EFLA 3RK9A 4AACA 2YISA 3UG1A 2E9OA 4M14A 2P4IA 2XNEA 3R9DA 3AT4A 1GOLA 3KK9A 4QMXA 4C58A 3BWJA 4EK3A 2CPKE 2R9SA 5I9XA 4WHZA 2VN9A 3MTLA 2PZ5A 4HGTA 2JEDA 3MFSA 1WBOA 3IS5A 4TZRA 2HWPA 4GKHA 4FUXA 2VTPA 4V05A 4RVMA 5ACKA 4TYIA 5BVNA 3EN6A 2C30A 2JIVA 3E92A 3AC1A 4X21A 4BCGA 2P0CA 3PSBA 4KA3A 4DN5A 4HW7A 4OAVB 4FKPA 3E64A 4E4MA 5LMAA 4YMJA 1OZ1A 2X1NA 5D12A 3DLZA 4IW0A 1TR8A 1XO2B 1JLUE 2ERZE 5H9BA 4DAWA 4FSZA 3CSVA 3E46A 4C37A 2J6MA 3WILA 4AWIA 1HJPA 1UU8A 3C0GA 3P86A 3Q4ZA 4H3BA 2PE2A 4UMUA 4BCOA 3VRYA 3DBQA 4FYOA 3FSKA 2EXMA 5GZ9A 4Z7HA 3BKBA 4J8MA 3R71A 3WIKA 3WYYA 2BALA 4PTCA 4V0GA 3MTFA 3OWPA 1FMOE 2QI8A 5GJDA 4HCVA 4GK3A 4RIOA 5CWZA 2XIXA 4PPCA 2BAKA 3G5DA 4R3PA 3C0IA 3QQLA 3ORPA 3MIYA 4IB1A 3UVQA 3P7CA 4ANSA 3TIZA 4IJPA 4DFYA 2UZVA 3ZS5A 2LVPC 4H1MA 4E6AA 4OTPA 1HT2E 2BFXA 2W9ZB 5CF6A 3DDPA 1OL5A 3KGAA 2XZSA 4ZTSA 1IEPA 3VN9A 4QMMA 3TWJA 3N4TA 1OB3A 5EHOA 4AAAA 3O0GA 3ID6C 3DOGA 3Q52A 2V7AA 4JQ8A 4V0GB 4Z16A 5TE0A 4FYNA 3KREA 4FTCA 4QYHA 3SG8A 4U79A 2RL5A 3FZOA 4U44A 5E90A 1CTPE 5HE1A 4DLJA 3F5XA 5KKRC 3LJ0A 4U5JA 5FD2A 2YAAA 4G17A 3CR0A 4QP2A 2CGWA 4YTHA 3MI9A 2WQNA 3ORNA 3QQFA 5HO7A 4DFBA 4G34A 5D7VA 4ARKA 4ZTQA 4BWKA 5HTIA 5CT7A 4JG7A 4MXXA 1OIUA 2G3QA 3GLHE 2JGZA 3UQCA 4YJRA 4YPDA 2F7XE 4FKSA 5I5ZA 4QTCA 3QTWA 4I94A 4JAIA 3EQHA 5DGZA 3C4FA 3FAAA 2EUFB 2HELA 3VO3A 4B4LA 5E8TA 1OITA 3SA0A 4I92A 4FSRA 4R5SA 5C03A 3LCVB 1Y8GA 2Z7SA 3Q04A 4AU8A 2DAKA 4J53A 4F7NA 4WA9A 5FWKK 4R78A 3S4QA 4EOPA 4WP2A 1LEWA 1YI3A 4EONA 4L52A 3TNPC 4ZK5A 2X7OA 4AZFA 2X6EA 4EH8A 4C4EA 3QTRA 1BI7A 2IW8A 3B2TA 2ITXA 2VTHA 4FV4A 1URWA 4IX5A 5CXZA 4DFNA 4H39A 4GSBA 1YXUA 3KEXA 4FKGA 4PL3A 3AT3A 3LVPA 3SOCA 2VTAA 4MD7E 2QURA 2J7TA 3BQCA 3PRFA 3QTZA 4L53A 3EL7A 5FGKA 3PJ8A 3FI2A 4IX4A 5AP6A 5I3OA 1KE7A 3ZHPC 5J9YA 3GB2A 2RRUA 1ZOHA 1FBNA 5T68A 2I0HA 1KV1A 2YDIA 4GIHA 4CZTA 1H26A 3QLFA 3AQVA 2VGOA 3GU5A 2X8EA 4ZSEA 3S3IA 4AN9A 5LQFA 4IAIA 1CKIA 4JBQA 1SNXA 2J50A 2X4FA 4G16A 2PUIA 5CT0A 2DENA 2GU8A 3PG3A 3BZ3A 2H34A 3H0YA 3ZEPA 1PRYA 2WXVA 3IQ7A 4QMLA 1P5EA 2ACXA 4TPTA 3OZ6A 4AA4A 3FEGA 3ERKA 1BVSA 3C0HA 2PSQA 2WMBA 4JIAA 4O27B 4XLIA 4AZTA 4C0TA 3AC4A 3L9LA 1F5QA 2KNZA 4LUEA 4FT0A 3NNWA 4A4OA 3QGWA 2UW7A 1YWNA 4UMTA 5HNBA 4R7BA 4FBXA 1VYZA 5J9ZA 3Q96A 5CAUA 4DG0E 3KRWA 2BWEA 4GEWA 1SZMA 4FKWA 5DYJA 4CRLA 3FI3A 4HVIA 4IAKA 3L8PA 4PWNA 5FEEA 3LMHA 2BIKB 3U55A 4GT5A 2XRUA 2XYUA 3QA0A 4FV5A 5FRIA 1QL6A 3ULZA 2QLQA 3GP0A 4FC0A 4WG3A 4FSMA 2BILB 2OIDA 4C2WA 4PMTA 2WO6A 2JDSA 4UYNA 5AP2A 4O6EA 3ZCLA 3IOPA 5L2SA 4HNFA 4HYIA 5IQBA 3R02A 5CEQA 1JWHA 3IK3A 4CFMA 1JR3E 3EYGA 3C4ZA 3MFRA 2X9FA 2FVDA 4M12A 2XKDA 4H3PA 3RPOA 4ZSGA 5AR4A 5IEXA 2GDOA 2ZAZA 2Z7RA 3PIZA 4FV0A 1Y91A 4F6WA 1FGKA 4U9AA 4N0SA 5E8ZA 3TZMA 5I4NA 2VX0A 3R9NA 3EH9A 2YIRA 5A6OA 3FRIA 3KXZA 5B0XA 3UYTA 3KVXA 3JXWA 3QHRA 4ZZNA 5GZ8A 5IUHA 3TTIA 5KKRB 4KBCA 4X2JA 5LOHA 2IVUA 3ORLA 3OCTA 4BN1A 5J5SA 3OS3A 3UQGA 5A4CA 3FY2A 3AC3A 2Z2WA 3KK8A 2KNAA 3ZUUA 4DEEA 2R3IA 2I1MA 5BVKA 2DI0A 3RM6A 1GO5A 4O2PA 4MCVA 3ZRMA 5KHWA 4FTUA 2ZDTA 4EH6A 3DTCA 3FL5A 3OFMA 3QD4A 4MBJA 2GQSA 4XRLA 2QNJA 2R3JA 5EYCA 4ZEGA 3RI1A 2FA2A 1Q41A 5IUGA 1PXNA 3LXNA 4LQMA 3KC3A 5HCYA 5H8EA 5JGDA 3GUBA 1C7YA 3Q60A 3LM5A 4RPVA 3MFUA 4ID7A 2FGIA 3T8OA 1OKSA 2X7GA 4TYGA 3KMUA 4AXAA 1Q8ZA 2DAEA 3LXKA 2HZ0A 3ELJA 3PPZA 3BYUA 4MX9A 3CXWA 3RP9A 4RIYA 3ZC6A 4CQGA 3W2QA 3EHAA 3QRUA 2PWLA 3L8VA 3QUPA 5AAGA 4AP7A 1UKHA 2IZUA 5AIRA 4BICA 2WKMA 3PY1A 1GIJA 4GMYA 4I6HA 5F4NA 3ZFYA 1B39A 5JN2A 5K4IA 4BVUA 2ITUA 4DH7A 2CWBA 4L7SA 1M2PA 4ZP5A 1U54B 2B3TA 4DEDA 4AGWA 1KUTA 3PSCA 2G2FA 5C26A 2UV2A 1FQ1B 2EXCX 4OT5A 1SG9A 2UW0A 2JY5A 2O2UA 4N4SA 3FKOA 3T9TA 1W82A 3IO7A 2R7IA 3EOCA 3ZH8A 4J95A 4CV9A 2CNUA 2EVAA 3FPQA 1SMHA 3C50A 1M2RA 2CGXA 4FL2A 4Q2AA 2BRGA 3DKFA 3DNDA 3KRXA 1Q02A 4V04A 2R0UA 4FG7A 5F20A 5KZ0A 4M15A 1DM2A 1R0PA 5LMKC 4XLVA 2OSCA 2J0IA 3I6WA 3I60A 3ZSHA 1WZYA 4JS8A 4F1OA 3W2RA 3DJ6A 1OMWA 4F70A 4U7ZA 3WBLA 2YIWA 4FTMA 4M8TA 4BDAA 1W0XC 2PZYA 2X0GA 3R8UA 3HRFA 2GSFA 3LCUA 4EEVA 2V22A 4YZNA 5CSXA 1S9IA 1YDRE 4AGUA 2JAMA 4OTIA 3HP5A 3O17A 3O23A 1BMKA 4UMRA 4QMUA 2WHBA 1KE9A 3LFSA 3MGYA 4EOJA 4FV6A 4J1RA 3DDQA 1HOWA 4FT3A 3JYAA 1S9JA 2GTMA 2ZM3A 3KXHA 4JG8A 4ZOGA 3UP7A 2R3HA 3ITZA 5EG3A 3PVGA 2V7OA 5JRSA 4AFJA 3TV4A 3E3BX 4ZTHA 5GJFA 5HORA 2G2IA 3PE2A 4UMPA 2OFVA 1WBWA 4FNYA 5CVFA 3PDTA 2I0EA 2ETKA 2C5YA 4TY1A 3V5PA 1OM1A 2UZOA 5E92A 2W1FA 3T3VA 2C1BA 3NIEA 4F09A 4PDPA 3HKOA 4R7IA 4ANLA 3BPRA 4K9YA 3ZC5A 2JZ1A 4G1WA 3VUHA 5KO1A 3C4EA 3IPHA 4F9BA 4O7SA 3G0FA 4EOMA 5IQCA 4G5JA 1JOWB 1J1CA 2Y6MA 4IXPA 1KE8A 5G6VA 1T6OA 2YEXA 4HVGA 4RJ7A 3THBA 2P2HA 2GNLA 4DHFA 5I9VA 4W4VA 2OICA 2EU9A 1WR1B 4APCA 5GNKA 1TQMA 2BRBA 2ZMCA 4GJ2A 4WOVA 4JG6A 3RM7A 4LGDA 4BIBA 5IMXA 2WNTA 5EDPA 4KS8A 3VUGA 5IMEA 3R83A 3ZXTA 1Q62A 2BMCA 3KFAA 1R39A 4DITA 3BHHA 3CY2A 4GVJA 3CPCA 1UFZA 3QALE 3Q4TA 4B6LA 1H0WA 4EKLA 1XH4A 4UN2B 1UWJA 1H25A 3QKKA 4FKOA 4QMYA 4QP6A 3U6HA 3FL4A 1R0EA 2YCSA 4PTGA 2PVKA 4JDJA 4FI1A 4BBMA 1IFYA 3DK3A 3HECA 3AXWA 1GZKA 3V5JA 1E9HA 4NZWB 3ZBXA 4XG2A 4Y5QA 3SV0A 2E9VA 4MD9E 2XH5A 1PYEA 2WB8A 3ZO3A 1Q8YA 1IAJA 3TUBA 4EWQA 4M97A 3BBTB 3JUHA 2IN6A 3AG9A 2OH4A 3K5VA 3KY2A 4QMSA 3W1FA 2WTIA 3CC6A 5CTPA 3QLGA 4O0XA 5EM8A 4S30A 3KU2A 4JQ7A 5BVWA 2C6LA 5JKGA 3OT8A 3PY0A 3UIUA 5IEYA 4G3DA 3KMMA 4BCQA 5KBRA 3UVRA 2C69A 3EFKA 3A62A 2I0YA 3FHIA 4P4CA 5LVNA 1BL7A 5HTBA 3MH3A 4ZTMA 1H1WA 2GNJA 2Y9QA 5HQ0A 2RKUA 4OTFA 4FK6A 4L43A 2R4BA 4ALUA 2DHYA 2DAGA 3G90X 1TQPA 5IDPA 3MY0A 3UNKA 4QRCA 3ZMMA 2BAJA 4PRJA 2X2LA 3LZBA 4YSMA 4EUUA 4QPSA 4F4PA 3TIYA 1OBDA 4N70A 3LHJA 1KYIA 3VNTA 3HMMA 2F2UA 3QF9A 5F94A 3KCKA 3NUPA 5CLPA 4M66A 5CEPA 4EC8A 5A6NA 3TV6A 4F6UA 2VWWA 3G2FA 2JFLA 3PXFA 4NEUA 4WO5A 4IC7A 4XHKB 2YWPA 3VJOA 4I5PA 4PDSA 2WQEA 3ZONA 1A9UA 3IGOA 3MVHA 2IVTA 3BLQA 2A2AA 4LRJA 5GIOE 3OG7A 3QWJA 5HLNA 2BHEA 4V01A 5L2WA 3TL8A 4IWQA 3EYHA 4G2FA 4RC2A 3OW4A 3CQUA 4I4EA 1WAKA 3DBDA 3UNZA 4D2TA 3EQFA 1VEKA 3MH2A 4RQKA 4BI2A 1R1WA 3OTVA 4FTOA 4KIKB 5GZAA 2WPAA 2PVRA 4BDGA 2L4FA 2VO3A 1BI8A 3LFDA 3FYJX 4C3RA 4USFA 2JAVA 3FLNC 1YOLA 4ITIA 5ANKA 4O7WA 3A7IA 3SDJA 1OECA 4CT2A 4EQUA 2DZLA 4I6FA 4YZMA 1PHKA 4AZSA 4YBJA 2KULA 5FM2A 4AS0A 4O86A 5IQDA 3FKLA 4RJ6A 5ETIA 3FZRA 3HL7A 3R9HA 2XNOA 1H00A 3U6JA 4D9TA 2ZDUA 3AGMA 3VS5A 4MQ1A 4JOAA 2HOGA 4F0GA 3R00A 4YTIA 4XP2A 3VS0A 4J71A 2JBOA 4L8MA 4KNBA 4D2SA 2IPXA 2X9EA 2B1PA 3AT2A 4MTAA 4C4IA 4BB4A 4I21A 4P5ZA 4U97A 4TYHB 3VC4A 2ZM1A 3WF7A 3B2WA 5KE0A 4Y83A 3WARA 5LVPA 4ZTNA 4AT3A 3FRHA 1M17A 2UVYA 1AIPC 4GVAA 2MJ5B 4NJDA 1ZOGA 2XS0A 4BKYA 2JZ0A 3I7CA 3RMFA 1JKLA 5IA3A 5J1WA 5H3QA 2X2MA 4P7EA 5B2MA 3TM0A 4W9WA 3VUTA 1QPEA 3QXPA 2RIOA 3P79A 4EHVA 4RMZA 4WIHA 1GZNA 2O8YA 3W2OA 4E7WA 1G3NA 2AC3A 4BCPA 1P14A 4APPA 2R7BA 3BQRA 3S1HA 4AZEA 1YVJA 4ZJIA 3ODZX 4YR8A 4XJ0A 2WELA 5AUTA 5ICPA 1VDLA 4O82A 2Y7JA 2UZTA 1MRUA 2XKEA 3SXRA 2ZTDA 4W4WA 5L4QA 1VYWA 1VJYA 2W1DA 4CYIA 2J5FA 5HI2A 4IZ5A 4EHZA 4FKIA 5HICA 4ZMFA 3UP2A 4ZLZA 4IM3A 5DEWA 1Q8UA 1Q4LA 3R28A 1A06A 3RHKA 5KMNA 4NCTC 3NCZA 2W5HA 3BE2A 4KB8A 4QO9A 2CHLA 3KF7A 4J7BA 4X3FA 2Y4IC 4HPUE 5E8XA 4DF3A 3KCFA 4GT4A 3EN7A 3FLWA 4DGGA 3CD3A 3VBYA 4NM5A 3F9NA 3N9XA 3UNJA 4IWDA 2OO8X 1BLXA 3BV2A 4YLKA 5CAOA 4DA5A 1E1VA 1PXLA 3GCPA 5L2QA 1QZEA 1XBBA 3W32A 4AW1A 3QD3A 1BKXA 1FGIA 3ANQA 4F6SA 4GG7A 5KX8A 4X2NA 5M56A 4FEWA 1J3HA 2WMSA 1PXJA 3PXRA 4DCEA 4DEGA 3DXQA 4CTBA 1FVRA 2QD9A 4CKRA 2IG7A 2BZJA 4GRBA 2CN8A 3LPBA 2CMWA 4FIIA 4WG4A 4EJNA 2O25A 5IA0A 2B9IA 4XRJA 2GHLA 4D0WA 3BI6A 4JQEA 2QOFA 3PVBA 3F3ZA 2B52A 2WTJA 3QWKA 3HMNA 5CF4A 4RIWA 5BX0A 3DNEA 4K8AA 4LMNA 2OKRA 1G41A 1IRKA 5CSWA 3B8QA 5KMIA 2OZOA 3SW7A 3ETAA 5KMMA 4YGAA 5TO8A 3C4WA 3LJ1A 2OIQA 4J98A 3RZBA 2AYPA 4EH7A 4BDHA 4EYJA 5JMSA 3M1SA 3JPVA 2WAJA 5HESA 4BZDA 1M7QA 1BUHA 1OKVA 1ZYCA 4YJSA 4DTAA 3BEGA 4WRGA 3D5XA 5M4IA 4ENYA 2XJ2A 1IASA 4XG9A 2HY0A 3WI6A 4YJPA 4M69A 5IISA 5KUPA 2OJ9A 4KABA 4E4NA 5TF9A 3E8EA 3BIZA 5CQWA 1ZZLA 5EDRA 2BDFA 4ZZMA 4X3JA 2HK5A 3GOKA 4JJRA 2C5XA 3Q9YA 3PFQA 3TNIA 4ZAUA 4GFGA 2XB7A 4AA0A 1ZYSA 4L7FA 2YFXA 3O96A 1CMKE 1Y57A 4FR4A 3NS9A 4G6NA 4TW9A 3CKXA 3AD5A 2LTUA 2QHOB 3R9OA 3WZJA 4C4GA 2EB3A 4ITJA 3E21A 3R8MA 4YO4A 2PVMA 2R3RA 2QSFX 2BZHB 4UALA 3H4JA 4D2WA 2QOKA 4G6OA 5BVEA 4KAOA 4ZSAA 4USDA 2YCRA 3OROA 4QMNA 4E93A 2UVZA 3SAYA 3OHTA 4RWJA 5JSMA 4C38A 3HMPA 5LCJA 4N6ZA 4XP0A 4MHAA 5A54A 3AMBA 2XA4A 5ANGA 3GLGE 2HAKA 3PXZA 3AC8A 3HA6A 4HZSA 1WIVA 2WZJA 1Z5MA 1OTRA 2G1TA 2B9HA 3MB6A 1LEZA 3FWQA 3ZOSA 4RG0A 4Y85A 4DGOA 2WMUA 4R5YA 3ORIA 2OWBA 4BWXA 4QQTA 5IU2A 3ZEWA 4IAFA 5HNGA 4YURA 4IJ9A 5HVJA 2HZNA 2ZJWA 5AUZA 1UKIA 3LFBA 2F2CB 4UEUA 2E2BA 4YHFA 3GC8A 2WTWA 3EQBA 2XJ0A 4IZ7A 4MNFA 4R3CA 5B2KA 4D55A 3MY1A 5C01A 1JAMA 1SM2A 3MMPA 5LWNA 3F2AA 3P7BA 3FI4A 4LGHA 2PMNX 2CSNA 3LCKA 3V04A 2BPMA 3NX8A 4CLIA 3D5VA 4S34A 1WMKA 3QX4A 5LMBA 2W17A 3ENHA 2BRMA 1K2PA 4IB3A 4BFMA 2GCDA 2E9NA 3DBEA 1LPUA 2IO6A 3Q9XA 5BMMA 2V62A 3FBVA 5E8UA 4GT3A 4Y5HA 3WF9A 5AUWA 1QPJA 4XEYA 3AC2A 4ZY4A 4FK3A 3UMXA 2KNVA 3CP9A 4W8DA 4CKIA 5B7VA 3UTOA 2BKKA 2WMAA 2GNFA 3FPMA 3UC4A 3RNIA 4GV1A 4TT7A 5E1SA 4Q7JA 3R7UA 1M7NA 4KIPA 3OUKA 2WMRA 5HVKA 4ANBA 4OGRA 3OVVA 2P3GX 1VEBA 3I6UA 4LV5A 4FL3A 4RZVA 3HV7A 4U42A 3W8QA 2PVFA 3D83A 1VEJA 1NVRA 3HUBA 3KL8A 3OF0A 4X6RA 5AUXA 3TKHA 3ZRLA 1KE6A 1P2AA 3NRMA 3F5GA 3PP0A 4FEXA 1OKZA 4KRDA 3TZ7A 1OKYA 3ET7A 1XXHE 5A46A 3OXTA 4MXYA 3EFWA 5DOSA 4QTBA 1V1KA 3TACA 3L8XA 5IA4A 2VAGA 2V5QA 4YJUA 2GFSA 3CCNA 3GC0A 3QQKA 4GL9A 2WGJA 1MQBA 2CGUA 2PUUA 3I1AA 4C62A 5FG8A 1JSTA 5HKMA 1W8CA 3PIXA 5HIBA 4NK9A 4BI0A 3GCQA 4CLJA 3BCEA 4GH2A 3RCDA 3FV8A 3T9IA 3E8NA 2BTRA 2YZLA 4JNWA 3BYOA 2LVQD 4F0IA 3CQWA 3O7LB 5C1QB 3LJ2A 4BIEA 2C6EA 2QVSE 5CU4A 4UY9A 4ORKA 2WEVA 3RHXA 3Q9WA 4R1VA 1DO0A 2OI4X 4JBOA 3E87A 4D58A 3FY0A 3WZUA 3MA6A 1P3QQ 3BHTA 1OVEA 2UW4A 2YCQA 4AT4A 4GKIA 3VUMA 3H10A 3F61A 2HWJA 3RPYA 1PKGA 3MA3A 4AN2A 5JQ5A 4O7LA 3FI8A 4QP8A 3B89A 2B4SB 4NTSA 3MH1A 3ZLWA 1Q8TA 3FMMA 1O6KA 3EJ1A 4MXOA 2QONA 2H96A 4W4YA 3V6RA 5DG5A 2PU8A 2R3GA 2MR9A 2WMXA 3V01A 1ZLTA 5H8GA 5FBOA 4X2FA 5AUYA 2C4GA 2GS6A 5DIAA 3UC3A 2I0VA 1YQJA 3QYWA 3COKA 2LGCA 1QPCA 3P7AA 2JKQA 4MWIA 4D4RA 5JEBA 3NW6A 3UZTA 4QTEA 4EH4A 4DEHA 3NNXA 3JVSA 4PPBA 3ZO2A 3II5A 4IFCA 4KBAA 5F95A 4O1OA 2ITYA 1Q99A 2ONLC 2QOLA 4A9UA 4DFUA 3IW7A 3DV3A 5D1JA 4H36A 4LRKA 1T43A 1R4GA 2PULA 2C0OA 3G6HA 2C3LA 4G9CA 3RAWA 4DC2A 3HA8A 4RIXB 2HENA 4AZWA 4DEBA 1PW2A 5FTQA 4I22A 2R3PA 5BPYA 5HLWA 4WG5A 3GFWA 1R78A 2WU7A 4LUDA 4E5BA 3RALA 2BZIB 4J96A 5E8YA 5I3RA 5E8VA 4YHTA 3T6PA 3GVUA 3SGCA 4OUCA 3M42A 3KMWA 3PA3A 4O0UA 4BBEA 3FMNA 4FTAA 1I09A 2C0TA 3FC2A 2OXXA 4BC6A 4FOCA 2JUJA 2J0MB 3I5ZA 1FVTA 4XV9A 2ZV2A 3FZ1A 4RA4A 5AFVA 5HNIX 2GHGA 4WNOA 4B99A 3DPKA 1RE8A 2Y6OA 1ZRZA 2XEYA 4S2ZA 1H08A 3MN3A 1P4FA 5TKDA 4B8LA 4EC9A 4FKTA 1UNGA 2GMXA 5J7HA 1XBAA 2C3IB 5CY3A 3ZDIA 3ZLSA 5DRBA 5CU0A 3W16A 2YM6A 4XMOA 4GYGA 4L3JA 1GY3A 4WNMA 3TI1A 2I7QA 2E9UA 3GU4A 3NGAA 3GU8A 1H8FA 1TVOA 5BNJA 3FMLA 1ZYLA 4AZVA 3JY0A 3PUPA 1A48A 3QTUA 3GCVA 3BRBA 4M68A 4RX8A 3PTGA 2DS1A 2L4EA 3F5UA 4O7RA 4ZS0A 4PNKA 2WIHA 3U54A 4DGMA 2VWUA 2PVYA 2O64A 5JH6A 3C5IA 3DQXA 2HXLA 2RFSA 3MBLA 2OK1A 1FOTA 2J9MA 4PL4A 4EZ3A 2W5AA 4O7ZA 1A5TA 3TDVA 1G3IA 1YXXA 4O0VA 2C5VA 4O6LA 5DVRA 3ZXZA 4NKSA 3FMJA 4OTHA 4EQMA 3R7IA 3CTQA 2LVOC 1HQYE 2XF0A 1XJDA 3L8SA 4A7CA 3OBGA 2XM8A 3DBCA 4MYGA 4Q9SA 5CX9A 5FLFA 4CCUA 4ZJVA 5AV4A 2H8HA 1B6CB 3TUDA 1QCFA 4O83A 2YM8A 1PF8A 2YHVA 1F3MC 3FMHA 4FODA 4IIRA 4GFOA 4ASEA 4D5KA 4QPMA 4F08A 1NT2A 2E9PA 3KRLA 3F3VA 3GXLA 3NAXA 3SRVB 2XK6A 4JBVA 4EK6A 3FDNA 3A7GA 1NA7A 4QP4A 4AGCA 1O6LA 4IEBA 3EN5A 4ZLYA 1PXMA 4O7VA 4GG5A 4ZTRA 4I5HA 1UWHA 3DJ5A 5G1XA 4Y95A 1JSVA 1PMVA 1ERKA 4G5PA 5AP4A 5I9ZA 3TJDA 3MVLA 3R7OA 3RAIA 3TN8A 2Q83A 4LV8A 2XNMA 2BRHA 4GK4A 2XCHA 3FZSA 3A7FA 4G9RA 3NVMB 3PSDA 3DK7A 1OL6A 4XCUA 5AR2A 5M44A 5DLSA 4YBKA 4UXQA 2BR1A 2OF2A 4ACGA 4X6QC 5K3YA 5A14A 4FTQA 3VIDA 5K9IA 3PVWA 2VU3A 5LVOA 5HO6A 1U54A 4ZSJA 3IKAA 4RLLA 3QKMA 3W18A 4U8ZA 3N51A 1H1QA 5FP5A 5CVHA 4AA5A 4I5MA 3P9JA 3IDCA 2C6MA 2JKMA 2QLUA 2WQOA 4Z3VA 1AQ1A 5CAQA 2OZAB 5HBJA 5M07A 3EFJA 4JX3A 4IH8A 4TTHB 3OP5A 4BDKA 5I0BA 1I44A 4YC3A 2W4KA 2J5EA 4H58A 4U40A 5AV2A 4QP7A 4YLLA 2OG8A 5J95A 4AW5A 5TR6A 5ETFA 4W8EA 3VBWA 4JVGA 5CI7A 1SYKA 2DAIA 4AT5A 1OIQA 4C34A 5L3AA 1XR1A 5A3XA 4WUAA 1PMUA 2JIUA 2OU7A 5E1EA 4LMUA 4MNEA 4DH1A 4GW8A 3HV6A 5H2UA 2VD5A 1WVWA 2ITQA 3LM0A 3Q32A 5BYLA 3NDMA 2J90A 1ZYDA 4I1ZA 4JXFA 2O0UA 5LVLA 3P1AA 1RJBA 1O6YA 5JGAA 3RPRA 4ACMA 2HW6A 2WEIA 1DAYA 3EIDA 3OEZA 5JZNA 3RJCA 2YITA 4JR3A 3W33A 3GU6A 4RVTA 2XIYA 5AP7A 2YM4A 5AJQA 4ZY6A 1MUOA 4IWOA 3QCQA 1VG5A 4O84A 3C51A 3TNQB 5CF8A 3MVJA 4PMPA 3JVRA 3R7VA 3VAPA 4BL1A 4IBMA 2EXEA 4J99A 3BEAA 3COIA 2ZTCA 5DEYA 4BZOA 1H1RA 3TV7A 3R1QA 3DJ7A 3M2WA 3DQWA 3GLFE 2HWOA 1XH8A 3MV5A 4IB0A 4MNEB 3VF8A 4BIDA 1ZARA 1GZOA 2HZ4A 2WMVA 4L6QA 3U9NA 3LLTA 5F9EA 4DT9A 4FSWA 1YHSA 2F49A 2BDJA 2RG6A 3MSSA 4PDOA 4DEIA 4F99A 3PA5A 4M0YA 2PUPA 2CJMA 1G5SA 4IAAA 4JT3A 2PZPA 3MJ2A 5D9HA 5LWMA 2JDOA 3PJ2A 4E26A 4HCTA 1J1BA 3VBQA 4NKAA 4XUFA 4L3LA 3UBDA 3TUCA 2QCSA 4I20A 4HYUA 3DAKA 3BHYA 5AP3A 1YXTA 2R64A 1HCLA 1CSNA 4C3FA 5IPJA 4XG4A 4ACHA 3LW0A 4FG8A 3K5UA 4EBVA 3NSZA 1UA2A 4ZZOA 1JSUA 4OLIA 2EB2A 1LP4A 5L6OA 3KRJA 3V3VA 1H24A 2IVVA 2VWYA 3FYKX 2G15A 1UVRA 2Q0NA 5HIDA 4PF4A 3G33A 3R0TA 1WGNA 4OBPA 4FG9A 3PPKA 4KIOA 5C27A 3UYSA 5IQAA 4O81A 2W1IA 3I7BA 4K2RA 2RFNA 1JKTA 1QMZA 2B53A 2NPQA 1W98A 2XMYA 2YLFA 4IVDA 4MBLA 4MBIA 3F7ZA 4YHJA 3IW6A 5HCXA 1WJ7A 3BLHA 3RCJA 5EQPA 3N4UA 3WOWA 4WNPA 3V8WA 3GOPA 4NL0A 4FV1A 5JZJA 3HAMA 4BZNA 5E9EA 1ZOEA 4E4XA 4EI4A 2QHNA 3EMGA 2J0JA 4NH1A 1XHAA 2VX3A 4FIFA 4UV0A 4A9TA 4D28A 2F57A 3OEFX 4TWNA 3PE1A 3R04A 5HU9A 4FZDB 2C6KA 1YXVA 2ZVAA 3W10A 3TZ8A 4EL9A 3V8SA 1MP8A 1JQHA 2MROB 4PQNA 4RSSA 2PL0A 3A2CA 5HE2A 5C8NA 3AD4A 5CEMA 2VTQA 5L2IA 3H0ZA 4IAYA 4B9DA 3JR1A 3MB7A 5M06A 2YDJA 3TXOA 4M67A 4GFMA 3VS6A 4FV2A 2A19B 2Y0AA 5AP5A 4BCIA 5K5NA 2PTKA 3C4CA 1R3CA 4IACA 2IZSA 5E4HA 4OTDA 4RJ5A 4XV3A 3VS3A 4PTEA 4EH3A 2QOIA 4DTKA 4O0SA 1OKWA 2QOOA 3PWDA 4TYJA 2PVNA 4NT4A 1BYGA 1DV0A 3UVPA 4OTQA 1G8AA 5T3QA 1V0OA 4FV9A 5LMKA 2OJFE 4LL0A 5ETCA 3LCOA 4TNBA 2ZB1A 2UW9A 3R73A 1NV8A 4RFYA 4G3OA 4H3QA 4HZRA 2J2IB 3UIMA 3RINA 4BRXA 2K0BX 4D9UA 3R1YA 1GNGA 1YKRA 2VUWA 4EUTA 3C9WA 3UOJA 4E6DA 2LBCA 3LIJA 4I23A 4ZIMA 3KKVA 3W2CA 3TEIA 1NY3A 2VWVA 3QZGA 4BCKA 2BDWA 3HEGA 2BTSA 3HX4A 3I0QA 3I5NA 3QGYA 4BDEA 4BF2A 2R3KA 1OAIA 1Y6AA 4ASDA 2ZOQA 1K9AA 4BTKA 5CSHA 4ASZA 2IZRA 4MH7A 4YNEA 2VNYA 1WGLA 5JFSA 2BKZA 2LAVA 3OW3A 5FDXA 3NUSA 4YC8A 5IQFA 2ITVA 5DR2A 2BAQA 2JDVA 4NUSA 2OBJA 4KIKA 2JP7A 1TKIA 4IC8A 3HV3A 3A99A 3ACJA 5EI8A 3VS2A 1IG1A 1YW2A 3DT1A 4BBFA 3KXNA 4C02A 4D5HA 2XNBA 3C7QA 4IX3A 2UZNA 2VTIA 5E7RA 5EHLA 1XB2B 2EKKA 1F4IA 4LYNA 4NSTA 3LXPA 1BL6A 4ONAA 4XV1A 5CVGA 5AA9A 1UU7A 4OBOA 1UNLA 1CM8A 2HZIA 2W1ZA 2BRNA 3FXWA 4QYFA 4M0ZA 3PG1A 4WSYA 4F1TA 3IDBA 4O91A 3UIBA 4EOLA 4FE2A 3TDWA 5DT4A 5FTOA 1W7HA 5M53A 2QR8A 2W1GA 4RJ4A 1DAWA 1KE5A 2RG5A 3DU8A 4JX7A 4M84A 1IR3A 5AAFA 4CRSA 5IA1A 3BGPA 2NRUA 5AX3A 4CGAA 2VWXA 3U4UA 3GQIA 5HLPA 3NNUA 2UW3A 4TYHA 1IXSA 5JRQA 5L6PA 3DXNA 2J51A 5TOZA 4USEA 3VWAA 3NMUF 4I4FA 4O0RA 2GS7A 3UQFA 4QMOA 3POZA 2C47A 4I0SA 4QQ5A 4CQEA 1JKSA 1TTEA 3U4WA 4L42A 2HXQA 2HYYA 5AIKA 5HEZA 4AOJA 4NW5A 3WF8A 4N57A 4YNOA 3VUIA 4DGLC 3MESA 4I6QA 3CJGA 3F3TA 3KULB 4G6LA 1MRVA 5DWRA 2J4ZA 4C4HA 3EQGA 2H6DA 1YXSA 3PXKA 4CV8A 3FMKA 3UG2A 5C8KA 2JDTA 2O3PA 4PL5A 2YERA 3FQHA 4DFZE 3FQEA 2QKRA 2VWBA 1XH9A 4FKJA 4NW6A 3S0OA 3DCVA 2VTLA 2B9JA 4RFZA 4ZTLA 3GQLA 4AN3A 5L6WL 4R8QA 3ZUTA 3ZBFA 2YWVA 3PY3A 2NP8A 5J8IA 5CENA 4G3FA 4LOOA 4WD5A 3GLIE 4Y73A 1U5RA 3UJGA 2VTTA 5AV3A 1Q5KA 3UO6A 4Z7GA 5M57A 4G3GA 3PP1A 4OTGA 4QTDA 5D7AA 3UOLA 5FXQA 1KOAA 4JDIA 3EZVA 4KRCA 2OFUA 2RSVA 4QYYA 4YP8A 5J5TA 3E7OA 2XM9A 2ZYBA 3UOKA 1FMKA 4E6CA 4F0FA 3D15A 2R3LA 1STCE 3QQHA 2XKCA 5GJGA 4AX8A 2JD5A 4NIFB 1WBTA 4L46A 2ESMA 5D41A 2JLDA 2UW5A 1JVPP 2CNQA 4EQCA 1GJOA 4H05A 4WKQA 4RQVA 4J97A 2QR7A 2WTDA 4Q5EA 3Q3BA 4CVAA 2YM3A 3SXFA 4RBLA 4ALWA 1M52A 3R8LA 3IHPA 5FDPA 2CCIA 5JFVA 1NW1A 2VO0A 5C4LA 3LFAA 4U0IA 4MWHA 3WF6A 4RFMA 4DCAA 3BX5A 1JNKA 4O7TA 2FYSA 3ZZWA 5ANDA 3A4OX 2PE1A 4A4XA 3TG1A 1WBSA 5AEPA 4FSQA 1OUKA 5BQ0A 3LE6A 3LXLA 4NM3A 3NUNA 5EKNA 4DH5A 4D2RA 2YM7A 3V51A 1JBPE 1ZZ2A 2X81A 4W4XA 1OPJA 3EL8A 4DBNA 5LARA 3Q53A 3R7GA 4PMMA 2PYWA 4AF3A 5CS6A 3UO5A 5AM7A 1L8TA 4FNXA 2R2PA 3D2IA 2GQGA 3C13A 3ROCA 1NV9A 1V0PA 3DKOA 3IDPA 4FSYA 2IZTA 4QMPA 3QBNA 3RTPA 4Z55A 5CZHA 4EZ5A 4EHEA 2VTJA 4D1XA 4IANA 4JR7A 4X7QA 3MH0A 2XCKA 4CD0A 3DAEA 2VTMA 3WZDA 4C2VA 3I79A 2DUVA 2QU5A 4AW2A 5HE0A 3UZPA 3VRZA 3QAME 1LR4A 5A4QA 1ND4A 5DR6A 2QOQA 2YACA 4YZDA 4B0GA 2EJSA 3VW8A 4C57A 3FLZA 2FSMX 4IWPA 4E5AX 3NZ0A 4UXLA 3LFQA 1ZAOA 2C5NA 3GNIB 5M55A 3UODA 3NYOA 4FKLA 4CKJA 2VX1A 5M4FA 3E63A 2R3MA 3RWQA 1OL2A 2KTYA 1YLAA 5AUUA 2XK9A 1GZ8A 4FTJA 5IKWA 1SVHA 2W05A 4XOZA 5DBXA 3TTJA 3A4PA 3QCYA 4MKCA 3LMGA 4D4YA 2H5XA 4QD6A 5M4UA 3GI3A 5IQGA 1NVQA 3BGZA 4HVDA 5FP6A 3VF9A 3F2RA 4Q5HA 5A4LA 2K9DA 4C3PA 3QUDA 3WIGA 4KUJA 1XQZA 3RPVA 2JKOA 3UE4A 5A4EA 2YM5A 4ZMEA 2PVLA 4C35A 4JL9A 5JQ8A 3G6GA 3KVWA 5CI6A 2Y4PA 1Y6BA 2WTKC 3PLAE 4EYMA 3ZM9A 5CEIA 5JI2E 3E5AA 4Y8DA 4JDHA 5E8SA 3WE8A 2XVDA 4NM7A 3K9PA 5HBHA 1EH4A 4CMOA 3W8LA 4LRMA 4CFFA 2WMQA 4EOOA 4U43A 3NUAA 4CFUA 2FSTX 5HD4A 1UU3A 3ALOA 3HUCA 4NWMA 5EI2A 1YI6A 1OBGA 3AC5A 3NVKI 2ZMDA 3SXSA 4YU2A 5IDNA 4QTAA 3GBZA 3SVVA 3O7LD 3ODYX 3FUPA 4FL1A 4FKRA 3FMEA 4JDKA 4KKGA 3TZ9A 2CGVA 4HJOA 3QTXA 4NCTA 4KBKA 3L9PA 4JI9A 4BGQA 4ZY5A 5BVOA 4F2LA 5FEDA 1NVSA 4FSNA 3O50A 4B7TA 3VULA 4IFGA 4NJ3A 1GAGA 5BVDA 2CKQA 4IAZA 2JKKA 3K3IA 5M4CA 4O22A 3I0OA 2YIXA 1Q97A 5DA3A 3W2SA 2CNVA 3DA6A 3QRIA 1WCCA 2W06A 4HYHA 3KQ7A 3EQCA 4DYMA 3A7HA 4F7JA 2GNGA 3VBXA 4ZS4A 3G51A 4UWBA 3R22A 3SHEA 3BYSA 4II5A 3ZDUA 4O38A 4I6BA 4TYEA 2W0JA 4NM0A 4U6RA 3O8UA 4J52A 3VS7A 4ACDA 3A8WA 3NUUA 4TWPA 5IQHA 3REPA 3BGQA 4P90A 2Y4IB 4XV2A 2F7EE 2PK9A 2VTOA 1OIRA 3QRTA 1J7UA 5HG8A 5DT0A 3F82A 4EHGA 2VNWA 3G0EA 3NYNA 4YO6A 4AGDA 2XNPA 4G31A 5IH4A 3O2MA 4E3CA 2CKOA 4BCNA 3EKKA 2NO3A 2PMLX 1FINA 3MWUA 3E88A 4FGBA 1CKJA 4BCJA 4DE4A 4FT9A 1GIIA 2HY81 4GEOA 3QZHA 4A9RA 3PLSA 1U5QA 3O8PA 4EH9A 2AUHA 2VO6A 3QD2B 4HNIA 3VVHA 5IG1A 2HW7A 1GIHA 4HOKA 3H9FA 3K2LA 5HE3A 4ZLOA 3AMYA 5E8WA 3OOGA 3D7ZA 4AFEA 3Q4CA 2ITNA 4FNWA 4F1IA 4FVQA 3A8XA 3ZRKA 3NYVA 3ZLXA 1PXKA 1Z9XA 1YHVA 4E8AA 3UPZA 4E1ZA 5AV0A 2GTNA 2QG7A 1QPDA 3D94A 4BHNA 2W1CA 1M2QA 2PMIA 3FSFA 4IDTA 4TKSA 3LFEA 3C5UA 5CU6A 5EM5A 3PA4A 3CKWA 3N4VA 4X2KA 2WQMA 2QOHA 4YPSA 5HGIA 1YDTE 3T3UA 1H28A 1RQQA 3QA8A 1PYXA 3HLLA 3OY1A 4G3CA 4K11A 5CSPA 3RBWA 3FMDA 1J7LA 2C6OA 1AD5A 3Q5IA 2DYLA 5HU3A 3FC1X 4FIHA 4BGHA 1P4OA 2XK4A 4S32A 4UWYA 4DT8A 5AR5A 3F3WA 4OTRA 1YOMA 3Q5ZA 1ZMUA 1XBCA 3HRCA 3ANRA 2IJMA 2RFEA 4YJNA 3V6SA 5ANIA 3P0MA 1YRPA 4RIXA 2W5BA 3PPJA 2VTRA 2WTKB 5DT3A 4MK0A 3ZO4A 4F9YA 5IQIA 3BE9A 5DMZA 4QYGA 3QCSA 1OIYA 4QMTA 4YJVA 2ITWA 4PX6A 4GUBA 3RNYA 4AOIA 1OQYA 3CY3A 4HCUA 4QMQA 1NXKA 2XBAA 1FPUA 2UZUE 4HPTE 4MD8E 5T6KA 4DH3A 2IW6A 4FSTA 4LL5A 1XH6A 4AW0A 5HIEA 4A4LA 1VQ1A 3KA0A 5HCZA 4C8BA 2X8IA 4FUYA 2R5TA 4BDJA 2XNNA 2DQ7X 5IQEA 4PY1A 2BFYA 4DH8A 3S00A 4U3ZA 2X6DA 4CNHA 4MEDA 4KWPA 4AOTA 4FVPA 5EOLA 3ZU7A 4A9SA 2RF9A 3UMWA 2C3KA 2JDRA 4P5QA 2O63A 2HIWA 1ATPE 3HYHA 2QO9A 4RLKA 1M14A 4N6YA 3CTJA 4FF8A 1RW8A 2UZEA 5EOBA 5HX6A 4EZ7A 2P55A 3OXZA 1L3RE 5HTCA 4DTBA 5CAPA 2PUNA 1PGYA 2OXDA 2UZBA 5KCVA 2B54A 4CG9A 1MN3A 4QMWA 3F6XA 3LQ5A 1W83A 4CMTA 4FZAB 3FXZA 3DTWA 1VZOA 4FEVA 2L2DA 5LCKA 5IF1A 2FB8A 3G15A 2JNHA 5HZNA 4ANNA 4U81A 2UW6A 2YCFA 4EOIA 3CD8A 2GFCA 3FHRA 4WNKA 4ANMA 4OT6A 2XIRA 2GQRA 4NFNA 4DBXA 3F88A 4UB7A 5EK7A 2BHHA 4XG3A 4A9YA 4CFNA 3TCPA 3TKUA 2BWBA 4CTCA 3D7TA 4FZ7A 3E8DA 4MQ2A 4L3PA 5AUVA 5CASA 1JKKA 3HMIA 2OO9A 4MF1A 4YJOA 5I9UA 3BYVA 1ZWSA 3F7WA 4RC4A 3EZRA 4DG2E 3G9LX 3D0EA 4YJQA 4D1ZA 2C5OA 2XJ1A 2YN8A 2XRWA 4TNDA 2VWIA 4Y46A 5CQUA 2Q0BA 3SRVA 1UNHA 3R8VA 2Z02A 1REJA 4RWLA 3NWWA 3PJ1A 2YDKA 2VO7A 2P33A 4PP9A 1W84A 3FZPA 5KZIA 3UIXA 4C61A 5L8JA 2LVAA 4S33A 3H9OA 4QP3A 4BHZA 5BYZA 2W96B 4QQJA 3HV5A 4RWKA 1DO2A 4EOQA 4UBAA 5F1ZA 1XWSA 1H4LA 2VV9A 4Y72A 3BU5A 4J8NA 4QNYA 3D7TB 4GU9A 4PUZA 2WD1A 4IHPA 3VUKA 5FUTA 3NYXA 4KINA 3QQUA 2WTCA 2A4LA 4DLIA 4L01A 3FKNA 3F5PA 3D5UA 4XX9A 3ACKA 4UX9A 4OTWA 3D5WA 2I6LA 3BWFA 4GYIA 4I0RA 3NIZA 2J0KA 2JY7A 2F9GA 5CF5A 1T46A 1H07A 3LFCA 3CIKA 3JS2A 5HHWA 3QX2A 3UZRA 1OL7A 3UO4A 2VGPA 1Z57A 3A60A 4QQCA 4DGNA 3P23A 4YSJA 3KN5A 3S95A 4YTCA 5JK3A 3PVUA 4LOQA 4YTFA 2OZAA 2ONLA 3OXIA 3R1SA 1BX6A 3R63A 5J1VA 4C36A 2IW9A 3WZKA 2R3NA 4CT1A 2ITTA 3LMIA 3RAHA 1U46A 4O2ZA 3V5TA 4IVBA 4RX7A 2WOUA 3AMAA 3DLSA 3LCTA 3HNGA 2XIZA 4CMUA 3W55A 2FO0A 3BV3A 3EQPA 4F9AA 2LVNC 3IONA 1ZYJA 3PWYA 2WIPA 4W9XA 3LFNA 4D2VA 5AADA 2SRCA 4OAUC 5C9CA 3ATTA 4FOBA 4RJ3A 3EKNA 4YZBA 3NEWA 4P2KA 3VBTA 4EH2A 4KSQA 5CNOA 3FXXA 4BDIA 1URCA 4JAJA 2XYNA 4IX6A 5M08A 3PIYA 3QU0A 3MS9A 3QRKA 1REKA 4EK8A 4BKJA 4GUEA 5KMKA 3VS4A 1F0QA 4PDYA 5EW9A 3ENMA 3GFEA 3Q2MA 5IZFA 3GU7A 3WZEA 3TNHA 3I81A 2J0LA 4QP1A 4FV7A 1LUFA 3MPAA 4BYJA 4MF0A 1IAHA 2REIA 2VZ6A 3E93A 3R9RA 2OJGA 4XOYA 4O0WA 2FSLX 5EFQA 4O21A 4ASXA 5HO8A 4WBOA 3QKLA 3ATSA 5ANEA 4FX3A 2WFYA 3QTIA 4I41A 5BMSA 3QHWA 1IM2A 5DI1A 4NYEA 3F2NA 1DI9A 3HDMA 4K6ZA 3KF4A 5KMLA 3BU6A 2UW8A 3P5KA 3CS9A 4NTTA 4O0TA 4JRNA 2CLQA 4BTJA 3Q6WA 4B8MA 2P2IA 4LM5A 5CALA 1MRYA 3P08A 3VQUA 4EORA 5I9WA 4O96A 5CNNA 5JFXA 3TKIA 4UYAA 4FT5A 1WBVA 2CDZA 2OW3A 3MPTA 4XYFA 3BHUA 4RJ8A 4ALVA 2ITPA 5FXRA 2RGPA 3FLYA 4JLCA 4KS7A 2BUJA 3IW5A 1KWPA 4BR3A 5HD7A 2W1EA 2BIYA 1WVYA 2ETRA 4XNEA 3UPXA 4F64A 4HGSA 3OD6X 5AM6A 4KKEA 4QMZA 3GCUA 3BELA 5DHJA 4FMQA 3PJ3A 3RGFA 3PZHA 4AG8A 4EOKA 4RIYB 1H1SA 3R21A 2JFMA 2QO7A 4IZAA 4O1PA 4R77A 2QOBA 3BBWA 3PJCA 3V8TA 4D4VA 4IVCA 3SW4A 4ERWA 4BY9E 2ZB0A 3NLBA 4R1YA 2R3FA 4EK4A 2GNIA 2BVAA 4WBBB 1XH5A 5JFWA 4YUQA 1B38A 3KRRA 4E73A 1PY5A 4D2PA 3D4QA 1U59A 3KXXA 4QMVA 1SNUA 3K3JA 4Z9LA 5FXSA 3QQJA 2ZV7A 2QKWB 2EKFA 3DK6A 4RA5A 4R7HA 4CZYB 4LG4A 3A7JA 4FTNA 4EKKA 1RDQE 2W1HA 4FV8A 1KOBA 4HGLA 3C1XA 4OW8A 1WBNA 4CCBA 2OJIA 3Q6UA 4I93A 2JITA 3ULIA 3GC9A 4PV0A 4EWHA 3LCSA 5HOAA 3DB8A 3NUXA 4FKVA 2DAMA 1YHWA 5AAEA 1PJKA 1ZV1A 4FKUA 2B7AA 3FLQA 2X8DA 5FTGA 4E5WA 5C8MA 4DFXE 2GS2A 2KHHA 5CANA 2R3OA 5KHXA 5EQEA 5ITAA 4XP3A 5D10A 2QQ7A 2PVHA 3AGLA 2OF4A 3EN4A 3HMOA 3QZFA 3QTSA 5FM3A 4FZFB 4GCJA 1OPLA 4UZHA 3U6IA 3NR9A 4CXAA 4FICA 3U87A 3VS1A 3IGGA 5ETAA 3EB0A 4F63A 3DS6A 5BVFA 3SOAA 3GEQA 1CUKA 4CFVA 3RPSA 4CSVA 2C0IA 5EYKA 5E91A 1SVEA 5J7BA 3BBZA 2R3QA 3OWJA 4L67A 1Q3WA 1J7IA 5M51A 1T45A 5A9UA 5CU2A 2JY6B 4C33A 4UN0C 5DH3A 3QRJA 4BTFA 3OWLA 4BDCA 2A27A 4C59A 3VW6A 4WSQA 3QFVA 2C68A 3NUYA 4EH5A 4WT6A 2C6DA 4M3QA 1WHCA 2YIYA 4LGGA 5HBEA 3UGCA 4TN6A 4FSUA 3HDNA 4LFIA 3ZO1A 5BUEA 3P4KA 1PKDA
chains in the Genus database with same CATH superfamily
4M7IA 4HEOA 2JA2A 1G8SA 4E4LA 2OOBA 3SQQA 5EM6A 3OWKA 2DWBA 1E94E 3QUEA 3ZFXA 2IWIA 3VBVA 2N35A 4K33A 4IM2A 1ZY5A 5AR3A 2WTVA 3GQ5A 1OGUA 1UV5A 4TXCA 3V5WA 5DFLA 3DZQA 3IOKA 4BB9A 2Y8OA 5CT7A 3ZLYA 1FVVA 3OCBA 3EQDA 3NBIA 3R7YA 1IA8A 1VR2A 4HVSA 3OOMA 3FTDA 4LZZA 5DR9A 5TT7A 2CV0A 4C4JA 1YDSE 2CCHA 4YJTA 3FD9A 2XK7A 3EQIA 2RFDA 1QUTA 2OH0E 4QP9A 3KXMA 2XEZA 4CFXA 3QC9A 4KIQA 4RZWA 1TQIA 4QOXA 1OUYA 2ITZA 4X2GA 2Z60A 2WU6A 3HV4A 5FQDC 3R7EA 4X3FC 1AGWA 3AD6A 4HLQA 3C58A 4EJ7A 4RX5A 2YA9A 2UZWE 3UDBA 1SVGA 4EK5A 5A4TA 1QQWA 3PXYA 5GKNA 4MXZA 2FUMA 4RGJA 2OIBA 2QU6A 3RAKA 5D11A 4AXCA 2WMWA 3IG8A 5CU3A 3FJQE 3UJNA 2OXYA 2G9XA 3DBFA 3F92A 3MVMA 1ZMWA 3ZZEA 4PDGA 2OGVA 3PYYA 3E8CA 3RK5A 2CKEA 5CZIA 2X4ZA 3CQEA 5KMOA 4XS2A 3Q2JA 1H0VA 4S31A 2X39A 3ZUVA 1IA9A 2F4JA 5EDQA 3UOHA 3L9NA 3VHKA 3MW1A 3MY5A 3VQHA 4GK2A 3E7VA 4MXCA 4GIIA 3O8TA 2BROA 4O7NA 1VEGA 2F7ZE 3SASA 4M13A 3CLYA 2XK8A 5IA5A 4DV4M 4JIKA 4FTLA 2XKFA 4RVKA 3FQSA 3O71A 4IE9A 1VLRA 5IH6A 7CATA 4GS6A 4ANQA 2QC6A 2XANA 5C4KA 2XAOA 2WMTA 3CGFA 2CLXA 3SKCA 3OCGA 5EYDA 5AP0A 4CZUA 4PMSA 5KMJA 4CYJA 5LJJA 4CEGA 4ERKA 3SYLA 4E20A 2JBPA 5DNRA 2GNHA 4LV7A 4G4RA 3H3CA 2PPQA 5L8KA 3U6CA 5J9LA 3QL8A 4TWOA 3ROYA 3ML1A 5EW8A 4BCHA 5EH0A 2NRYA 2FH9A 5DRDA 4IBBA 5B2LA 2OLCA 1Q24A 3RK9A 4QMXA 4C58A 2R9SA 4WHZA 3MTLA 2PZ5A 4HGTA 3MFSA 3GLHA 4TYIA 4LJ9A 4X21A 4HW7A 4YMJA 3DLZA 4IW0A 4FSZA 4C37A 3WILA 4AWIA 1PRBA 3DBQA 5GZ9A 4Z7HA 4M0DA 2BALA 3MTFA 2QI8A 4RIOA 2XIXA 3UVQA 3P7CA 3TIZA 2UZVA 2LVPC 2BFXA 4ZTSA 3WHLA 3DOGA 4QYHA 4II7A 5HE1A 5KKRC 3LJ0A 4U5JA 2DHRA 3CR0A 4QP2A 3QQFA 4G34A 4ZTQA 2JGZA 4YJRA 3QTWA 1OITA 3SA0A 2Z7SA 2DAKA 3S4QA 4EOPA 1YI3A 4EONA 2HKJA 3B2TA 4DFNA 3KEXA 4FKGA 4PL3A 4MD7E 2QURA 2J7TA 3PRFA 5FGKA 4IX4A 5AP6A 3ZHPC 1ZOHA 1FBNA 4CZTA 3QLFA 3AQVA 3GU5A 2X8EA 1CKIA 4JBQA 1SNXA 3PG3A 3BZ3A 3WHKA 1P5EA 2ACXA 4TPTA 4C0TA 4AZTA 1F5QA 1YWNA 4R7BA 5J9ZA 5CAUA 4FKWA 1XWIA 4HVIA 4IAKA 3L8PA 5FEEA 4PD2A 2XRUA 4FC0A 1NSFA 2WO6A 3ZCLA 5L2SA 4HNFA 3R02A 1JR3E 3EYGA 4KODA 3RPOA 2R65A 4FV0A 4F6WA 3W0RA 1LTMA 3TZMA 3EH9A 2YIRA 3FRIA 3KVXA 4ZZNA 2R4EA 5LOHA 2IVUA 3UQGA 3FY2A 3AC3A 3KK8A 3RM6A 2D7GA 3U5ZA 2ZDTA 3SMPA 2OPFA 2GQSA 5IUGA 1PXNA 3LXNA 3KC3A 5HCYA 3LM5A 3TWKA 3ELJA 4MX9A 1PJIA 3W2QA 5AIRA 5F4NA 5KPTA 3ILKA 2EXCX 2UW0A 2JY5A 3FKOA 3ZH8A 1XMOM 4J95A 1SMHA 4Q2AA 3DKFA 5F20A 5KZ0A 4XLVA 1DGHB 4M8TA 4BDAA 1W0XC 2PZYA 2X0GA 3HRFA 4JN6A 5CSXA 3HP5A 4B3MM 3LFSA 4EOJA 4FT3A 3JYAA 4JG8A 2ZM3A 4ZOGA 2R3HA 3ITZA 4AFJA 4PT5A 5GJFA 3TV4A 5HORA 3LVVA 2ETKA 2C5YA 2W1FA 3T3VA 4PDPA 3HKOA 5IQCA 1J1CA 4KT0F 2GNLA 2OICA 5GNKA 2VIIA 4WOVA 3SFZA 3J7BA 4DITA 3CY2A 3CPCA 3OTOM 1XH4A 1UWJA 3QKKA 4DUZM 3DK3A 3B7ZA 1IAJA 4EWQA 4M97A 5CTPA 3CC6A 5JKGA 4LJ5A 3OT8A 3PY0A 3KMMA 2C69A 4P4CA 2XSZA 3MH3A 4OTFA 1I4WA 4ALUA 3UNKA 4PRJA 2X2LA 4EUUA 1KYIA 3KCKA 5CLPA 4F6UA 3PXFA 4IC7A 4XHKB 2WQEA 2IVTA 5HLNA 3OW4A 4RQKA 1R1WA 2QENA 2PVRA 2L4FA 4USFA 3FYJX 3FLNC 5ANKA 4O7WA 3SDJA 4EQUA 4I6FA 4AS0A 2KULA 4O86A 1QAQA 4RJ6A 4L15A 1QZMA 1H00A 3AGMA 4L16A 4JOAA 4F0GA 3BL7A 5FTMA 4QHSA 4L8MA 4J71A 3LQRA 1N78A 4MTAA 4P5ZA 4U97A 1IXSB 2ZM1A 3WF7A 4BKYA 1AIPC 2JZ0A 3I7CA 3QXPA 2O8YA 2AC3A 4BCPA 1P14A 4APPA 4ZJIA 4YR8A 5ICPA 1VDLA 3PXGA 3SXRA 2ZTDA 2W1DA 5HI2A 4FKIA 5HICA 1Q8UA 1Q4LA 4J7BA 4HPUE 4GT4A 3CD3A 3VBYA 4NM5A 3UNJA 4YLKA 3GCPA 5L2QA 1XBBA 4AW1A 3ANQA 4F6SA 4B3RM 5KX8A 5M56A 1J3HA 3PXRA 2QD9A 2BZJA 4GRBA 3PFIA 5IA0A 2B9IA 3QWKA 3HMNA 5BX0A 2OKRA 3B8QA 5KMIA 3C4WA 2OIQA 4J98A 2AYPA 4YJSA 4ZPXA 1IASA 4XG9A 2HY0A 4YJPA 5IISA 2WSCF 2OJ9A 3KXEC 5EDRA 4X3JA 3TNIA 4ZAUA 1L1TA 4AA0A 4TW9A 2LTUA 2QHOB 4YO4A 4ITJA 2QSFX 4D2WA 3H4JA 4KAOA 2UVZA 3OHTA 4XP0A 4MHAA 4HZSA 1Z5MA 3ZOSA 3DA1A 3UMMA 3ZEWA 4IJ9A 5HVJA 2ZJWA 1UKIA 4YHFA 1JAMA 3P7BA 3FI4A 3LCKA 2XGNA 3QX4A 5LMBA 3B7NA 1LPUA 2IO6A 5BMMA 3FBVA 4GT3A 4FK3A 4W8DA 2BKKA 2WMRA 2P3GX 1VEBA 4RZVA 3VONA 2PVFA 4X6RA 2ZBKB 3GQ3A 3L27A 2DVWB 1OKZA 3TZ7A 4MXYA 1V1KA 5IA4A 4YJUA 2GFSA 2LHCA 2WGJA 4C62A 2PUUA 5FG8A 1JSTA 5HIBA 2J7NA 3FV8A 4JNWA 3BYOA 3CQWA 3LJ2A 5CU4A 4ORKA 4JBOA 3WZUA 4QDEA 4GKIA 3H10A 3FUXA 3FTFA 3MH1A 3FMMA 1O6KA 3EJ1A 2PU8A 2MR9A 3V01A 5H8GA 5FBOA 4X2FA 2GS6A 5DIAA 2I0VA 1YQJA 2LGCA 3TPZA 2JKQA 4IFCA 4KBAA 4O1OA 5EXPA 4DFUA 3IW7A 4H36A 2CRUA 2PULA 1R4GA 2C0OA 4G9CA 4RIXB 4AZWA 4I22A 5HLWA 5BPYA 3T6PA 3KMWA 3FMNA 2OXXA 3I5ZA 3FZ1A 5AFVA 4AKHA 2Y6OA 3MN3A 5TKDA 4EC9A 2Y21A 2C3IB 4WNMA 3GU4A 3NGAA 3GU8A 1TVOA 1ZYLA 3LW5F 3JY0A 4RX8A 3PTGA 5JH6A 4GMQA 3MBLA 2OK1A 2J9MA 2W5AA 1A5TA 2L7HA 4ANRA 4NKSA 4OTHA 3CTQA 2XF0A 3U6LA 3TUDA 1F3MC 4GFOA 1Z5AA 3KRLA 3GXLA 1NA7A 4QP4A 4AGCA 1O6LA 4AXEA 4ZTRA 4I5HA 3DJ5A 5I9ZA 4G5PA 5DLSA 4UXQA 2BR1A 5K9IA 4D82A 3CF0A 3QKMA 3N51A 4AA5A 3P9JA 4Z3VA 2C6MA 5HBJA 4JX3A 4TTHB 5I0BA 2XLJA 4YC3A 4FWGA 2W4KA 2APLA 5J95A 4YLLA 3KOYE 4KLNA 1PMUA 2JIUA 1DGHA 4LMUA 5H2UA 4I1ZA 1IN6A 1PJSA 2O0UA 1RJBA 2FS1A 1O6YA 5EP1A 2HW6A 3RJCA 2XIYA 2YM4A 4IWOA 3TNQB 4BL1A 2ZTCA 3DJ7A 1OIZA 4EIWA 4BIDA 5F9EA 2RG6A 4PDOA 1G5SA 4IAAA 3A45A 3VBQA 3TUCA 4HYUA 5IPJA 4EBVA 4ZZOA 1JSUA 1GABA 2EB2A 2VWYA 1UVRA 1WGNA 3PPKA 5C27A 4O81A 1QMZA 2B53A 1W98A 4YHJA 5HCXA 2ZANA 3F7ZA 3IW6A 5EQPA 3WOWA 3V8WA 3GOPA 4NL0A 4MGKE 5JZJA 4BZNA 1ZOEA 3EMGA 1XHAA 5HU9A 3W10A 3TQSA 4EL9A 3V8SA 4PQNA 5HE2A 2PL0A 5C8NA 3AD4A 4IAYA 3TXOA 2Y0AA 5K5NA 4LF4M 4RJ5A 4PTEA 4EH3A 4O0SA 1OKWA 2QOOA 2OJFE 5FTJA 2UW9A 4HZRA 2J2IB 3UIMA 4D9UA 2VUWA 4GC9A 3QYEA 2X49A 4BF2A 4ASDA 2ZOQA 4RKUF 5CSHA 4ASZA 3B7QA 1WGLA 3OW3A 4YC8A 4NUSA 2OBJA 3VS2A 3UDSA 4NOOB 2BJVA 3C7QA 5E7RA 5EHLA 1F4IA 4LYNA 4OBOA 1UNLA 1CM8A 2W1ZA 2BRNA 4M0ZA 8CATA 4EOLA 5M53A 3V5QA 2QR8A 2RG5A 4CGAA 1IXSA 5JRQA 5TOZA 3NMUF 1PJQA 1QDRA 3UQFA 4QQ5A 2C47A 2HYYA 5HEZA 3WF8A 3HJSA 3CJGA 1MRVA 4C4HA 3UG2A 2O3PA 3L26A 2VWBA 3DCVA 4ZTLA 2B9JA 3HJ8A 2NP8A 4LOOA 4WD5A 4Y73A 1U5RA 5AV3A 4Z7GA 4QTDA 5D7AA 4KRCA 2RSVA 3FTCA 3E7OA 3UOKA 1FMKA 2XKCA 5GJGA 4AX8A 2JD5A 4NIFB 1V34A 1EIJA 5D41A 2UW5A 2CNQA 1GJOA 4H05A 4J97A 5FDPA 3SXFA 4RBLA 1M52A 2I7NA 4LY6A 2VO0A 3LFAA 4RFMA 2X0PA 3BX5A 1JNKA 3PNYA 2FYSA 3A4OX 2PE1A 1WBSA 1OUKA 3LE6A 3LXLA 5EKNA 4DH5A 1JBPE 3UO5A 4FNXA 5ITQA 5ITYA 3QBNA 4EZ5A 4JYAM 2XCKA 4CD0A 2DZOB 2VTMA 3WZDA 3I79A 2DUVA 3VRZA 1LR4A 2QOQA 5EP3A 4IWPA 3NZ0A 4UXLA 5M55A 4CKJA 2R4JA 2XK9A 1GZ8A 4FTJA 3A4PA 4MKCA 4D4YA 2H5XA 3GI3A 3F2RA 4DR5M 4C3PA 3WIGA 1XQZA 5A4EA 2PVLA 4C35A 3G6GA 2Y4PA 5CEIA 4FD2A 1EH4A 3AOEC 4LRMA 4U43A 4CFUA 2FSTX 1UU3A 3HUCA 2YR0A 4DHIB 1QUSA 1R2ZA 3SVVA 3FUPA 4KKGA 3QTXA 5BVOA 4F2LA 5FEDA 4FSNA 4LF7M 4O22A 2YIXA 4QNRA 3EQCA 3A7HA 3G51A 3R22A 4O38A 3VS7A 3NUUA 5IQHA 3BGQA 4P90A 4XV2A 3QRTA 1J7UA 5HG8A 3F82A 2VNWA 5IT9S 2XNPA 5IH4A 2CKOA 4FGBA 1CKJA 3QZHA 3O8PA 2VO6A 3VVHA 4HOKA 3OOGA 4F1IA 4E8AA 4E1ZA 3D94A 4BHNA 3C5UA 4WW0A 4G3CA 4K11A 3RBWA 4FIHA 2XK4A 1TFFA 3HRCA 4YJNA 3P0MA 4RIXA 5DT3A 4F9YA 4QYGA 3QCSA 1OIYA 3RNYA 4PX6A 4GUBA 3CY3A 1FPUA 2XBAA 3U6PA 4AW0A 4A4LA 3KA0A 5HCZA 2DQ7X 5IQEA 4PY1A 3S00A 4U3ZA 4CNHA 4MEDA 2IEWA 4TUWA 3UMWA 1ZAEA 1M14A 1L2CA 3CTJA 4FF8A 1RW8A 3UDZA 1JR3A 2B54A 4CG9A 1W83A 4CMTA 2UW6A 4EOIA 2GQRA 4DBXA 5EK7A 3E8DA 4L3PA 5CASA 3EZRA 4DG2E 2C5OA 2YN8A 4CFVA 5CQUA 1UNHA 4RWLA 3NWWA 2YDKA 3UIXA 4I8OA 4C61A 3H9OA 4OVZB 4BHZA 4QQJA 4PDIA 4JI6M 3D7TB 1KFVA 4GU9A 2WD1A 5FUTA 3QQUA 4DLIA 3F5PA 3D5WA 4I0RA 3TWLA 2J0KA 4P17A 1H07A 1T46A 3JS2A 5HHWA 1D2NA 3UO4A 2VGPA 4DGNA 5JK3A 2ONLA 2R3NA 3RAHA 4R3DA 4RX7A 3VDUA 4CMUA 3W55A 1ZYJA 1IN4A 3PWYA 4YZBA 5C18A 2R18A 5CNOA 5LMNM 5M08A 4IX6A 4EK8A 3VS4A 4PDYA 3ENMA 3GFEA 3I81A 1LUFA 4MF0A 1IAHA 3TL4X 1G8PA 4O0WA 5EFQA 3QHWA 1IM2A 3F2NA 1DI9A 2KRUA 5KMLA 3P5KA 4BTJA 4LM5A 5CALA 3P08A 5CNNA 5JFXA 2O01F 5FXRA 4JLCA 4KS7A 1KWPA 5HD7A 2ETRA 3UPXA 4HGSA 4QMZA 3GCUA 4FMQA 4AG8A 4RIYB 4R77A 3BBWA 2R3FA 1XH5A 3U6EA 3KXXA 3K3JA 3EIEA 4RA5A 4R7HA 4CZYB 4HGLA 3C1XA 1WBNA 3Q6UA 3ULIA 3GC9A 3DB8A 3NUXA 4FKVA 1YHWA 1XMMA 3LVWA 2B7AA 3FLQA 1XMLA 5FTGA 2KHHA 2JXNA 5D10A 5IWAM 3AGLA 3U6IA 1IQPA 3VS1A 3IGGA 3GEQA 1CUKA 2C0IA 2R3QA 5M51A 1T45A 4NSOB 4C33A 2A27A 3QFVA 2C68A 2FE8A 4WT6A 2C6DA 1WHCA 3DGKA 5AWMA 3HZTA 5M09A 5CYIA 3ORZA 4OR5A 3HRBA 2CE7A 3JY9A 5K0KA 2PE0A 4DG3E 4F9WA 4F1MA 1G4AE 1OPKA 4CIZA 3R30A 4B7GA 4PNIA 4K1BA 4LOPA 1H27A 4XH6A 5EYMA 3CBLA 3QD0A 2WQBA 4R7GA 2XP2A 4FA2A 4FVRA 2IVSA 1PMNA 5AA8A 4L68A 3TT0A 3DY7A 3R2BA 2WSEF 2X7FA 2CN5A 5AR7A 1YI4A 2UVXA 3M11A 3GRRA 3HVCA 3MJ1A 2DNAA 3K9OA 4L9IA 3K54A 5IUIA 2YZAA 3R2YA 3OBJA 3ZSIA 4AE6A 1X8BA 5JGBA 4K77A 5AAEA 2C3JA 3FLSA 3SC3A 1Q3BA 3C4XA 3UK6A 3R6XA 4H1JA 2QOCA 4XBRA 4GKJM 3QTQA 4JRVA 1MQ4A 5EQYA 2ITOA 5EW3A 4NIFA 4RWIA 1V0BA 3CPBA 4KD1A 5EQTA 3IW8A 4RNAA 4AI6A 3F66A 3FZTA 4FV3A 4BCMA 2ZV8A 5FEQA 1JB0F 3L9MA 3HU1A 3DKCA 3L2AA 3ORXA 3OY3A 4AUAA 3NW5A 2ZV9A 5L8LA 4IVAA 4G4NA 5HG9A 4XBUA 3RZFA 2GNOA 4DFLA 3VHEA 4UMQA 4IBIA 2O65A 4IQ6A 4XG6A 2VTSA 4QT1A 3BHVA 2JIIA 3R1NA 2UXBM 3AOXA 5EHYA 4R6VA 5AX9A 4FEQA 2C1AA 4C7TA 3VUDA 4ITHA 5FBNC 3R8PA 4A06A 2MGWA 2VRXA 4D1SA 3AL0C 1G59A 3A61A 4EBWA 4U41A 4LI5A 5BYYA 3RK7A 5HG5A 4BDBA 4GRIA 1XKKA 4DEAA 5K0XA 1PXOA 1OL1A 5IEVA 3QQGA 4JXJA 4FTIA 3WF5A 3GLGB 5EKOA 1DI8A 2YNMD 3DB6A 1QDTA 5DPVA 1U4DA 3ALNA 3PRIA 2BZKB 4FZ6A 3VK8A 3EWHA 4RC3A 1OI9A 2UZDA 4DINA 3W2PA 2QHMA 3RKBA 4ACCA 5GIPE 2QODA 1N77A 4DR2M 4BI1A 1H1PA 4M69B 4I3ZA 1PMEA 3NNVA 4MXAA 5CAVA 4HL4A 3L1SA 5FTKA 4QNAA 3F69A 3ZTXA 3I4BA 3ZFMA 5GINE 3CEKA 2X2KA 3KS8A 1KSFX 3HHWA 4AACA 2YISA 3UG1A 4WURA 2E9OA 4CHTB 4DV1M 1GOLA 2CPKE 5I9XA 1XXHB 3IS5A 4GKHA 4V05A 4RVMA 2C30A 2JIVA 2P0CA 3PSBA 5D12A 1XO2B 2ERZE 3CSVA 3E46A 3C0GA 3Q4ZA 3P86A 4H3BA 2PE2A 4J8MA 4PTCA 1GL6A 4GK3A 2BAKA 3C0IA 4DFYA 4H1MA 3KGAA 1IEPA 3N4TA 3O0GA 1XNRM 4V0GB 4Z16A 2C5RA 4FYNA 3KREA 4FTCA 3SG8A 4U79A 2RL5A 3FZOA 5E90A 3F5XA 2BNKA 5FD2A 4G17A 4DFBA 2WQNA 4YY3M 4BWKA 5HTIA 2G3QA 3GLHE 5KQ8A 1J7KA 3UQCA 4YPDA 2F7XE 4FKSA 4QTCA 4JAIA 3FAAA 2HELA 3VO3A 4IJEA 4AU8A 5FWKK 4L52A 4ZK5A 2IF8A 2C9CA 1BI7A 2VTHA 4GSBA 3AT3A 2VTAA 3BQCA 3QTZA 4OX9M 3EL7A 3PJ8A 1W5TA 5J9YA 3GB2A 5T68A 1H26A 4ZSEA 3S3IA 2X4FA 5CT0A 2GU8A 3H0YA 1PRYA 2KEBA 3FEGA 1BVSA 3C0HA 2AQXA 3AC4A 3QGWA 2UW7A 4UMTA 2UXDM 5DYJA 3FI3A 4PWNA 3LMHA 2BIKB 2XYUA 3SAVA 2QLQA 4WG3A 2F5NA 2OIDA 4C2WA 4PMTA 5AP2A 4O6EA 1FNNA 5CEQA 3IK3A 2QPAA 3C4ZA 4MGHA 1RU3A 4M12A 4ZSGA 3HJQA 2Z7RA 1T3TA 3U60A 4BLCA 2VX0A 3R9NA 5B0XA 3UYTA 3JXWA 3QHRA 5GZ8A 2WSFF 3OCTA 4BN1A 5J5SA 3OS3A 2V1UA 4DR1M 1GO5A 4MCVA 5FTNA 3QD4A 5EYCA 4ZEGA 1IY1A 2FA2A 3I01M 3GUBA 3Q60A 3T8OA 2X7GA 4TYGA 4BJJB 3KMUA 4AXAA 2HZ0A 3BYUA 5BPVA 4RIYA 3ZC6A 4CQGA 3L8VA 5AAGA 4AP7A 2WKMA 4GMYA 4I6HA 5JN2A 1B39A 4DH7A 4L7SA 1M2PA 2UV2A 2O2UA 4CV9A 2CGXA 2UUBM 1Q02A 5LMKC 2J0IA 3I6WA 4DR7M 4JS8A 3DJ6A 4F70A 4AXFA 3LCUA 2V22A 4YZNA 3W0QA 1YDRE 5IZ7D 2JAMA 4UMRA 3MGYA 2Z3XA 3UP7A 3LMMA 2XFSA 2V7OA 3E3BX 2G2IA 4UMPA 2OFVA 4X62M 2C1BA 3NIEA 4K9YA 2JZ1A 4G1WA 4O7SA 2CV2A 5G6VA 2YEXA 4HVGA 4RJ7A 4APCA 1WR1B 1TQMA 4GJ2A 3RM7A 4BIBA 5IMEA 5EDPA 2L7IA 2VDBB 3BHHA 4GVJA 3GPUA 1UFZA 1ST0A 4MUQA 4B6LA 4EKLA 5E26A 1H25A 4QOZC 2YCSA 4JDJA 3HECA 4XG2A 4Y5QA 3SV0A 2WB8A 3JUHA 4QMSA 2WTIA 4O0XA 5EM8A 5KPRA 3KU2A 4JQ7A 3UIUA 3EFKA 2Y9QA 4FK6A 4L43A 1L1ZA 2VF7A 4FWDA 3NFGB 2BAJA 3LZBA 4QPSA 3TIYA 4N70A 3HMMA 2F2UA 3QF9A 5CEPA 2JFLA 4WO5A 3VK7A 5GIOE 3OG7A 3KS4A 2BHEA 4V01A 3TL8A 3CQUA 1WAKA 4RF0A 3GLIB 3EQFA 3MH2A 3RGPA 2VO3A 3LFDA 1BI8A 4ITIA 3D8BA 3A7IA 1PHKA 5FM2A 5EJCA 2XNOA 3U6JA 4JI2M 4YTIA 3VS0A 4KNBA 2IPXA 2X9EA 2B1PA 3AT2A 4BB4A 1IY2A 3B2WA 5KE0A 5LVPA 1V33A 4ZTNA 4AT3A 3FRHA 1M17A 2UVYA 4GVAA 2MJ5B 2XS0A 5B2MA 1HNWM 3P79A 1GZNA 4E7WA 1G3NA 2R7BA 4AZEA 1YVJA 3ODZX 2WELA 1MRUA 2XKEA 3HY5A 4W4WA 1VJYA 4EHZA 4B3SM 4ZMFA 3UP2A 4ZLZA 4IM3A 5DEWA 3RHKA 5KMNA 4NCTC 1G8JA 3EN7A 4DGGA 4IWDA 5CAOA 4DA5A 3QD3A 3GLGA 4GG7A 4X2NA 4DEGA 4CTBA 2IG7A 4WG4A 3LPBA 4EJNA 4XRJA 4D0WA 4Z8XA 3PVBA 2WTJA 5EP4A 1FJGM 4LMNA 1IRKA 3SW7A 5KMMA 3LJ1A 3M1SA 1OKVA 4DTAA 3WI6A 4M69A 5TF9A 3E8EA 4ZZMA 4JJRA 2C5XA 3Q9YA 4GFGA 2XB7A 1ZYSA 3NS9A 4C4GA 3E21A 2QOKA 4ZSAA 3AKKA 4DHJA 4C38A 1XXHA 5ANGA 2XA4A 2WZJA 2B9HA 4R5YA 5HNGA 4YURA 2HZNA 3LFBA 2F2CB 2WTWA 2XJ0A 3MY1A 5C01A 1SM2A 2CSNA 2BPMA 3D5VA 1WMKA 4BFMA 3Q9XA 2V62A 1QPJA 3AC2A 4ZY4A 3UMXA 3CP9A 3FPMA 4GV1A 3R7UA 3OUKA 5HVKA 4ANBA 4OGRA 3OVVA 3I6UA 4LV5A 4U42A 3HV7A 3W8QA 3KL8A 5AUXA 3ZRLA 1KE6A 4D81A 3PP0A 3F5GA 3ET7A 2VAGA 3CCNA 3GC0A 1MQBA 5HKMA 4CLJA 3BCEA 3E8NA 2BTRA 4F0IA 4UY9A 2WEVA 3RHXA 1DO0A 4NRWA 2OI4X 3E87A 3F61A 3RPYA 4AN2A 5JQ5A 3FI8A 4NTSA 4W4YA 2H96A 5AUYA 3U61B 3UC3A 2QCUA 3QYWA 1NY6A 1QPCA 3UZTA 3M6AA 1TDHA 4DEHA 3ZO2A 2A5YB 2ITYA 1Q99A 2QOLA 4A9UA 3G6HA 3RAWA 2HENA 2R3PA 4WG5A 4YHTA 1W2CA 1I09A