2R0IA

Crystal structure of a kinase mark2/par-1 mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
316
structure length
300
Chain Sequence
b'PHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVAPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase MARK2
publication title Crystal structure of a kinase MARK2/Par-1 mutant
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transferase
total genus 92
structure length 300
sequence length 316
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2r0iA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2r0iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2r0iA01
1NV8A 2W1CA 4U43A 3NUYA 2XYUA 4EBVA 4C61A 1PMEA 3ALNA 5HE3A 2GQSA 4X2NA 3LQ8A 2XK4A 4BICA 4FSMA 3MPTA 4MF0A 4CFWA 4QTEA 3ODZX 3P4KA 4EOKA 3G9LX 1CSNA 2DHYA 5CI6A 3W2QA 3MS9A 3EQFA 1VG5A 3FC1X 3KRRA 2X6DA 1OL1A 5AX3A 5FP6A 4FEWA 4WNKA 3UMXA 4C4IA 1OM1A 1O6LA 1PKDA 4PQNA 5FDPA 3V6SA 5IA0A 2E9VA 2LVPC 2C69A 2WU6A 3OP5A 2ZV7A 3W8LA 4FSZA 5HCYA 3VW6A 4F1MA 2H6DA 3HYHA 4HNIA 2VTLA 1EFUB 5C4LA 3R8LA 1U54B 4AGDA 4Z3VA 2PZYA 3EMGA 4E6DA 1GZOA 4PRJA 4FT9A 4KIQA 4PDOA 3OXIA 5ACKA 3VS7A 4TKSA 3ORLA 3TWJA 4E4MA 2PE0A 3GU5A 1O9UA 3POZA 5CVGA 4CRSA 2HW7A 4CZTA 4FTIA 4S34A 2XNMA 5AR8A 1UKIA 4B8LA 5A4EA 3WYXA 5KMOA 3P08A 4V0GA 3JYAA 5DH3A 3V3VA 1UNLA 2ITVA 3LFAA 4RLKA 1GIJA 3FZTA 1UNGA 2JY6B 3L9PA 3QZIA 1Z57A 4DBGB 4JIAA 5EOBA 2XKFA 4EH8A 3M42A 4O2PA 1DV0A 5DBXA 3I7BA 4A07A 2CNQA 3KULB 3LAUA 4PPCA 5HVYA 3ZSGA 3TM0A 3RBWA 3F3ZA 3QQUA 4GS6A 4IIRA 4OTGA 4QP1A 5AP5A 4DFLA 5AAFA 3FQSA 2YCQA 2VTNA 4D4YA 3SKCA 4YZNA 2WQBA 5CAQA 3TNIA 3E64A 3K3IA 3V5QA 2QLUA 1LP4A 3D7TB 4FTAA 3D0EA 3TNQB 1P2AA 3TJCA 3VVHA 3CD3A 4N6ZA 2MROB 2NRUA 4AG8A 5ANGA 3OT3A 4FKRA 4OR5A 2W1EA 5ANJA 3V5LA 1MRYA 1AGWA 2DKLA 2Z7QA 1JQHA 3VBTA 4DH1A 4GVAA 5DR6A 4CQGA 2OI4X 4IEBA 4E5WA 2Z7LA 2R0UA 4FL2A 4J71A 3ZCLA 5J7BA 3MIAA 4C37A 3E5AA 3IONA 5FP5A 4UWYA 5CF6A 4G31A 4AAAA 5LVOA 3R1YA 1H26A 4IZ7A 5EYKA 2HY0A 1Y57A 4O96A 2XRWA 2WKMA 2W9FB 2JITA 2XRUA 5J87A 2MGWA 1UWHA 2IO6A 3OCSA 1OBGA 3C4CA 2OF4A 3QLFA 4F65A 5HE2A 2PPQA 2PL0A 3ACJA 4AN3A 1Q4LA 5I3OA 5HESA 2BTSA 3KRJA 4FI1A 4LQMA 3G0FA 3R0TA 5LOHA 4AW5A 1GY3A 4K2RA 3E8EA 3LJ1A 4OAVB 4EZ7A 4MXAA 4KWPA 5IA2A 3NYVA 3UQFA 5E8TA 4KKEA 4FTTA 4RIXA 3DLSA 5AR5A 3QQKA 1P3QQ 4M3QA 4PP7A 1TQIA 1QPCA 3FZ1A 5E7RA 3U54A 3E21A 3MB7A 5M55A 5HIEA 4Z55A 1HT2E 4XNEA 4M7IA 5TOZA 2HOGA 2IZRA 4FV2A 3THBA 3WF7A 3SGCA 5AP6A 5G1XA 1KV1A 4NWMA 2WMAA 2BTRA 2VN9A 2YM6A 3EIDA 4P7EA 4DEHA 3MYGA 2QI8A 3QQFA 5HEZA 2R4BA 4FZDB 3UGCA 4BCIA 4ACGA 4F1OA 4NSTA 4PMPA 4EJ7A 2VWVA 3O7LB 2CWBA 4XBRA 3JUHA 4ERKA 4ZJVA 4RJ5A 2A1AB 3OCGA 1OECA 3Q52A 3UG2A 5DR2A 4FSWA 4UYNA 4AE6A 5CQUA 5C03A 4Q9SA 3NIEA 2QU6A 3ZOSA 2CLXA 3UODA 5M4FA 4F2LA 2Y0AA 5L3AA 5CNNA 4C57A 5L8LA 3LQ5A 2CKPA 3VUDA 3AC8A 4IW0A 1FVRA 3HMMA 5FXRA 4JNWA 5CS6A 2OLCA 3BEAA 2NNWB 1T6OA 1DI8A 5A4LA 2XNEA 5E8ZA 3BBZA 1V92A 1BUHA 4I5MA 3E63A 4QP2A 4XG4A 4KSPA 3P86A 5HLPA 5K5XA 2Y4IB 4C4FA 5JQ5A 3KXNA 4FG7A 2PUPA 4F63A 3O71A 5H9BA 4EH3A 5BX0A 4WG4A 4MTAA 3FPQA 4O2ZA 3C0GA 1JOWB 1OI9A 2QODA 3OCBA 4Q7JA 3H4JA 4GYGA 4K33A 4U6RA 4YMJA 3RHXA 3RPYA 2BZKB 5AIRA 2YEXA 5EM5A 2BROA 1TVOA 3A7GA 4UXLA 5J7HA 3R8UA 2WHBA 1Q99A 1IAJA 4FSRA 2VGOA 3BYSA 4O0WA 3FJQE 2C3JA 2VX3A 4JAJA 5ANIA 3MWUA 1Q41A 3ID6C 5AV4A 2OSCA 4XV9A 2YLFA 4AXAA 4J52A 4ZJIA 3PVGA 1M17A 4CT1A 2CCIA 3KY2A 4AWIA 3H9OA 4U9AA 4JR7A 3UVRA 5BYYA 4ZP5A 3WZDA 3IDPA 3I6WA 2WZJA 3L8XA 5TO8A 3HRBA 1HCKA 5ANDA 3WF6A 3NYOA 3LFSA 1JSVA 3QTXA 4XUFA 3TV4A 5AP4A 4RWKA 1W7HA 2BVAA 1QMZA 4M13A 3UJGA 2BHEA 3A7HA 1GNGA 2WMQA 1SM2A 4L52A 4B4LA 4O82A 1JKKA 5IEXA 1R0PA 2UW5A 4IZ5A 3V5PA 4O27B 4C2WA 3PIYA 4PY1A 3UDBA 2L4FA 2YFXA 3VBWA 4BGQA 2F7ZE 2C6OA 3MW1A 2G2IA 2EJSA 2CGUA 5GINE 3RPVA 5IH4A 1H0WA 3LCTA 1YWRA 3DBCA 3EN5A 2GNGA 3FI2A 3H0ZA 1Q02A 1FGIA 2IZSA 3D9VA 4ASZA 3KREA 4HYHA 4B9DA 4IJ9A 4O7ZA 4IWOA 1OL2A 1HOWA 5BVWA 3KK9A 1OMWA 4CMOA 3FMMA 4FT7A 4KINA 5DMZA 4IHPA 5J5SA 4BHNA 3QRKA 3MFSA 4BZOA 5EW9A 4DN5A 4U41A 3PIZA 1M14A 2OIQA 4H36A 3U51A 3ORKA 4Q9ZA 5CU6A 3BHYA 4G17A 2JY5A 3TL8A 4GIHA 1XBBA 3EOCA 1LEWA 3AQVA 4RA4A 3JPVA 4U45A 1IG1A 2V62A 2VD5A 4M69B 3ZRKA 2KTYA 2HXQA 4X2GA 3R9DA 2QOOA 5DN3A 1J1CA 3ZM9A 2LVAA 4EWHA 2ZB1A 3KFAA 3KN6A 3MI9A 3O50A 1NXKA 1SVHA 3ULZA 1VEKA 3RMFA 2OIDA 2HW6A 2R5TA 5M07A 2QHOB 1RQQA 2B1PA 3KXHA 4R5SA 3TZ7A 3ZZEA 4O7WA 5CSPA 2VO0A 1JBPE 2Q0BA 3UO5A 4FNZA 5J95A 4IWDA 3S1HA 4WRGA 4BDAA 4OW8A 4KNBA 3MFUA 5IKWA 4FKOA 3KRWA 3ZFYA 2AC3A 1TQMA 4IC7A 1U46A 2R3MA 3GENA 4EH6A 2CKQA 1PMNA 2ZJWA 2C3IB 4O0YA 4IM2A 4W4WA 4JDKA 3FL5A 2I7QA 3AT3A 3QQLA 4H3BA 4BYIA 4CRLA 3SG8A 2PE1A 5FBOA 4F0GA 2FUMA 2Z02A 4TT7A 5JT2A 2Z2WA 2QG5A 3CCNA 4F7JA 4ARKA 5CANA 5IQHA 2PZIA 2QOIA 4JQ8A 5LCKA 4KKHA 3L8VA 1YQJA 4EOSA 2R3GA 3QKKA 3R2YA 5JFWA 3I81A 2XKDA 3PJCA 4K77A 4AUAA 2C6TA 4TYGA 3TNPC 3F2AA 3ZSHA 4C59A 4DH8A 4EONA 2WMVA 3WARA 2WMBA 4D2TA 4F9BA 2ERZE 4FVPA 4YP8A 3EKNA 4QMOA 3QUEA 5AR7A 3WYYA 3R71A 4YBKA 3K54A 4FG9A 5HG9A 4JDHA 3BGPA 2KNZA 3L9MA 4U40A 4BBFA 3IW5A 3F5PA 3VUKA 2IJMA 3LMIA 3OUNB 4P2KA 4KBCA 5FM2A 4CKIA 5FGKA 4FKUA 2WQOA 4ACMA 3D4QA 4PX6A 4A7CA 4FKPA 3R8MA 1JSTA 2QONA 2WD1A 3SOCA 4NM5A 5AA9A 1YLAA 1URCA 4F09A 5BMSA 3KEXA 4IVAA 4NCTC 3LCVB 2JKKA 3ZBXA 4JAIA 2H9VA 1O6KA 3COKA 3LJ2A 4BBMA 4BDEA 5EG3A 5BUJA 5J9LA 4EOJA 4C58A 3RP9A 4YJTA 4CCBA 5D10A 2W1ZA 4OTIA 4I0RA 5IQAA 2XK8A 2HZIA 5CU2A 3UP7A 1BLXA 2OO8X 3PUPA 2GPHA 4Z9LA 5TE0A 2YM7A 3IW8A 3G90X 3QRTA 2E2BA 4CYJA 2IPXA 4F9WA 4HEOA 4AA4A 3MMPA 3C1XA 3CQWA 3DU8A 2SRCA 2QR7A 4PDPA 3FMNA 4IZYA 5EW3A 3NCZA 1PXOA 2MJ5B 5KUPA 4ZY5A 3W2RA 5M51A 4FT5A 3WIKA 4FEUA 4DINA 4YPDA 2O63A 2A27A 4XOZA 3H9RA 3JVRA 4PPAA 2CCHA 1PXKA 2HZNA 4ENYA 2X8IA 4ORKA 2OZAB 3OF0A 5LVMA 5EDRA 4C4EA 3FI8A 4FBXA 3UVQA 4BKZA 2XJ0A 1U59A 3EYHA 4LFIA 3E3PA 4L67A 4PL5A 3M11A 4D1XA 4CQEA 3LQ3A 3PA4A 2JAMA 2QOBA 3KQ7A 3VHKA 3W33A 2OH0E 3PRFA 4J7BA 4AZEA 2OJ9A 4JRVA 5EDQA 4BL1A 5A4TA 2OOAA 5AUWA 5JRQA 2BHHA 3MIYA 3P7CA 3WILA 4L6QA 3NVMB 3HRCA 3LVPA 1NA7A 4XBUA 4BTJA 3NRMA 3OW4A 3O8TA 4C34A 4WIHA 3GLFE 2UZOA 4X21A 3Q53A 1K3AA 1OKWA 4DEAA 1NVRA 5HBEA 3EFKA 5J8IA 1V0OA 2WB8A 2F7EE 4MD9E 4M97A 3PLAE 2ITOA 3HEGA 3PVWA 2VV9A 4CV8A 3EN7A 1M2QA 4KIPA 3R8PA 4HCTA 1JKTA 2WGJA 2F2CB 3GCPA 2XS0A 4NKAA 3C5UA 3EQDA 3C51A 1OITA 2JC6A 2C5XA 3F61A 3OWPA 3LW0A 2C6MA 4FZAB 4IVBA 4TYHA 2WMTA 4M8TA 1B39A 1DS5A 4TL0A 4I6FA 4O1OA 3K3JA 4QPMA 4DH5A 3QQHA 3ZLYA 3NDMA 2YZLA 5BMMA 1WVXA 1B38A 2EU9A 3NUUA 1KE9A 3FXWA 5A6NA 3TUDA 4D2VA 5E4HA 2DNAA 1E1XA 1H24A 4BCQA 5CAOA 3R7UA 4LG4A 2PVLA 4C4JA 5EI2A 2C5VA 3ENHA 4BWXA 1PXIA 5DT3A 3S00A 2J50A 5E1EA 3DFAA 1BI7A 4E3CA 4DC2A 3Q96A 4X3FA 3UOHA 3R7EA 4CG9A 4U3YA 3RJCA 4CFNA 5DFLA 2VTRA 2WTIA 2PY3A 3IOKA 4IAAA 3O2MA 1OPLA 4DEBA 5L6OA 4HGTA 4OBOA 3DB8A 5B2MA 3CS9A 4XS2A 4XV2A 4GVJA 5A46A 2C5NA 4QO9A 2C6KA 2NPQA 4IDTA 2CSNA 4DF3A 2RL5A 3CPBA 1OKYA 2B55A 4GIIA 4Y85A 3JS2A 4E1ZA 2BAKA 2OICA 3DKFA 4BKYA 3ALOA 1QL6A 3NW6A 4PP9A 4WBOA 3TKUA 2B7AA 4AT4A 4JBVA 3DNEA 5AAGA 4WKQA 4FE2A 2X2MA 3LMGA 4IAFA 1TKIA 4NT4A 1W82A 5B2LA 2IZTA 4QPSA 4AOJA 5HCXA 1KWPA 3HUCA 4IB5A 4EOOA 5CF8A 4TWCA 3P5KA 4DITA 2P4IA 4R7HA 1YVJA 3FZOA 3D2KA 4J97A 2B9FA 3AG9A 5C1QB 4EHEA 4RC4A 4I94A 3AMBA 3BE2A 3I6UA 3SD0A 3V04A 3QHRA 4ZLYA 4FKJA 3CP9A 4MBJA 4RIWA 4NFMA 5CYIA 4HNFA 5AUXA 5HICA 4E5BA 5BYLA 2CPKE 4RC2A 2YDJA 3DQWA 4G34A 4XX9A 5D1JA 1KE5A 2C0TA 3G9NA 4GRBA 4IACA 4NCTA 4QMLA 4YLLA 4BIDA 1L8TA 2OKRA 5GHVA 4V01A 3IG7A 3NSZA 3DBFA 4KS8A 5CI7A 1KE7A 2H8HA 5E8VA 5L6WL 2JNHA 1Q8YA 4WHZA 2X7GA 4WOVA 4ZTSA 1A06A 4FT0A 3GQIA 2QURA 4O0VA 4W4YA 3QRUA 5IUIA 4C36A 5BUIA 2ITQA 4JX3A 3AC1A 3UPZA 2ZM1A 3FBVA 4NM3A 4RIOA 1J7UA 1WBOA 4PMSA 2WEVA 4AF3A 1G8SA 1R4GA 4KB8A 4DT8A 3CR0A 1E1VA 3GLGE 3NMUF 3N4VA 4O7SA 5LVPA 4LOQA 4CFFA 4FYOA 4QMXA 3LE6A 3DT1A 3LCUA 1PXNA 3MV5A 3TCPA 1J91A 4B6LA 1VJYA 2JGZA 2QU5A 2XNPA 3AD4A 2ZTDA 5FDXA 1DO0A 1NV9A 3IQ7A 2IW6A 1PJKA 5H8BA 2J0LA 5EQEA 4EOQA 2ITNA 3POOA 4ITHA 4D4SA 4DTAA 5KMKA 3PSDA 2UW7A 3FYJX 3D2IA 3BYMA 4MHAA 3TNWA 3Q6UA 4JS8A 4X0MA 2J0KA 4ZTRA 1CKIA 4GUBA 4DBXA 3UIBA 3PXQA 4FVRA 4A9RA 5CF5A 1XJDA 4RQKA 4CXAA 4IAIA 4JX7A 4XV3A 4BDCA 5HO7A 3R6XA 4G5PA 4ZJJA 3W2OA 1VZOA 3AT4A 2WTWA 2R0IA 3RHKA 4BTMA 2W05A 2XMYA 3CXWA 3Q4ZA 4XEYA 4J1RA 4XG7A 4ZSEA 5JSMA 3C50A 2W17A 4J8NA 3ULIA 4EOPA 1QPDA 4WG3A 3OC1A 1T43A 1DAYA 2I0YA 5HNBA 1R0EA 2W1IA 1Q3DA 3TZ9A 4IFGA 4FV9A 3GP0A 4AT3A 4L3PA 3A7IA 3A7JA 4PTCA 4EJNA 5BVFA 2GSFA 4MF1A 2BPMA 3SXFA 4E73A 4O84A 4QYEA 4WBBB 4DGOA 4FUYA 2VWWA 3L9NA 5HIBA 5L2QA 5I9XA 3A60A 3O7LD 3HRFA 5KMLA 2C0IA 3QGWA 3MH0A 3BLQA 4RC3A 3UZPA 3TKHA 2R3QA 3IW4A 4LL5A 1PXMA 3OROA 1Q8WA 2JBPA 3TNHA 3ZO4A 2VTOA 4U8ZA 4RT7A 4U79A 3ZLWA 3NUNA 5IQDA 1JKSA 4CLIA 2BCJA 4YTFA 3RPOA 2YISA 1J7LA 5FM3A 4CFXA 3VRYA 4D2PA 3LIJA 4EK6A 3QA8A 1YWVA 1Q61A 1YXXA 5CEQA 5T6KA 1PW2A 3IK3A 4HCVA 4PNIA 1PXJA 3CC6A 2R3KA 5T3QA 1M52A 2C6LA 1VDLA 2BMCA 4JR3A 3BCEA 4ZY4A 2W1FA 3S95A 4KABA 4ZAUA 2CJMA 3SHEA 4R5YA 3VUMA 3LCOA 4GCJA 4GFMA 3EZRA 4FV0A 2A2AA 3LOKA 4IX4A 4IMYA 3GGFA 1WIVA 3MBLA 4IXPA 5CTPA 3GU6A 4GU9A 3ZONA 2LVNC 3BI6A 3LFBA 5CVFA 2DAGA 2JDVA 1WVWA 2VTPA 3O96A 4X3JA 1CKPA 5I9YA 5I4NA 4FIEA 4FIHA 1U4DA 4DLIA 3R73A 1MP8A 3GNIB 1Q8TA 4NJ3A 2CHLA 3DKCA 4G3DA 4D2SA 5LJJA 3RZBA 5DNRA 4CCUA 1BI8A 3R7OA 4EKKA 1XH8A 4F0IA 4A06A 3I1AA 5IQGA 2R3PA 3WZUA 3COIA 4R3CA 3H3CA 3QYZA 4L00A 4O0UA 3ZO1A 4NW6A 3PIXA 1ZMVA 3EN6A 2WAJA 5ACBC 5E8SA 3FXZA 3ZYAA 3DDQA 1YXTA 3TG1A 4XRLA 2V7OA 5FRIA 3NNUA 4OTHA 3DQXA 3FSKA 2XIRA 1H25A 3QYWA 4H1MA 4XP3A 2IWIA 2WTJA 3NNWA 3GLIE 3Q9YA 4JI9A 3QXPA 4NM0A 3K5UA 2J6MA 3ELJA 4MQ1A 1ZY4A 4C38A 2BDWA 3FKOA 3UQGA 3F5XA 4DGNA 3CIKA 3A99A 1Y6AA 5M44A 1WZYA 4FZ6A 4FTUA 2XCHA 2Y4IC 3QZGA 4FV1A 5AWMA 5I3RA 4JXFA 1WBVA 3O8PA 5DT0A 1WGNA 1YKRA 3ZUTA 3FE3A 3I7CA 4ZLZA 2Q83A 5L8JA 3FZPA 1ZMWA 3D83A 2EKKA 5CSWA 1YHSA 2BFYA 5IUGA 4DGLC 3UYTA 2XYNA 3R1SA 4F7LA 4QOXA 4A4LA 4U3ZA 1CKJA 1OB3A 2XBAA 4DBNA 2GHGA 5CT0A 1FINA 5F20A 2EXMA 5KBQA 1OL7A 2JZ1A 1P14A 5H2UA 3VBXA 4UN2B 4ZS0A 1H28A 4Y46A 4EQCA 3QHWA 5KHXA 4F08A 1Q3WA 3NYNA 3UOLA 4BKJA 3REPA 2X7FA 4WNOA 3KC3A 2G2HA 2PVMA 3E8CA 3QGYA 4W9WA 4FMQA 5AV2A 4FGBA 1VQ1A 4I21A 5FG8A 4RQVA 4WRSA 4IVCA 4L9IA 1UVRA 4CG8A 3A2CA 3TZ8A 4PWNA 4M84A 4J98A 4I5PA 3KA0A 3RNIA 5LCJA 5I9VA 1PY5A 1OIQA 4QYFA 4KIOA 1ZYDA 3ORTA 4QMPA 4XYFA 4FR4A 4BF2A 3KXGA 3Q4UA 5B0XA 2BR1A 1PYEA 1BYGA 3Q32A 3W2CA 3KULA 4IX5A 5FXSA 5HBJA 3GOPA 3UQCA 4JQEA 5K4IA 4XP0A 1OAIA 4NU1A 2WMXA 4ZTLA 2R2PA 2ITWA 5IH5A 1F5QA 3ERKA 4DG2E 4R78A 3FQHA 3DK3A 2OWBA 4BDDA 3DY7A 3K9PA 2BIKB 3D7TA 4ZTQA 1G3NA 3FLWA 3RAHA 3W2PA 3OBJA 3FDNA 5JN2A 3S0OA 1G3IA 3NYXA 4IB0A 1H01A 5HLWA 2BZHB 3NNVA 2UZVA 4FTQA 2XH5A 4TYIA 3PA3A 4E93A 3QU0A 2J9MA 2QQ7A 3OTVA 4FX3A 4ANBA 4ANNA 3NR9A 1TR8A 1VEGA 3NS9A 3FXXA 3OVVA 4USDA 1F0QA 2O3PA 4YURA 4FK3A 4UALA 4ZMFA 3OW3A 3HMIA 2WELA 3HGKA 3BE9A 3FZSA 4RSSA 3FMHA 5DFPA 4I22A 2ZAZA 2AUHA 3QL8A 5KMNA 2JFMA 1OVEA 2WQNA 3E7OA 3PWDA 4DFXE 4F99A 2GTMA 3HUBA 2EB2A 4U81A 5AP0A 5AUTA 3DAJA 1GOLA 1VEJA 2WNTA 3ATSA 1CMKE 5CSVA 4I92A 3V6RA 4QMQA 4RGJA 4FSUA 5KX8A 5BYZA 5IMEA 3TUCA 3IECA 3FEGA 5CSXA 5I9UA 4BWKA 4FSYA 1Q8ZA 4KS7A 3DZOA 3FMEA 4WA9A 3BV2A 5EHYA 2ZM3A 4DFZE 2UZWE 3HX4A 3MGYA 3GCUA 4IAZA 5TF9A 4AT5A 4MXYA 4EK8A 4QMNA 3LHJA 2J4ZA 4WUAA 2WFYA 1XH7A 2ZDTA 2ITZA 2AYPA 5AV0A 4E8AA 2W9ZB 4FGRA 4YO4A 1SYKA 4JQ7A 3QLGA 4DCAA 4UBAA 5L4QA 4MX9A 3MSSA 4G3FA 5A3XA 2EXCX 5L8KA 3U55A 5M08A 5KZIA 4FV5A 4X6QC 4KA3A 1DM2A 4NW5A 4TXCA 5FUTA 4A4OA 3SQQA 4C2VA 1XQZA 2A0CX 2BZIB 2JKQA 4BCNA 2BRHA 2BKKA 5F95A 3FWQA 5JMSA 4ZLOA 2GNHA 1YDTE 4CEGA 4Q2AA 4BCOA 4YR8A 1OL6A 3EWHA 2JAVA 3KMUA 4KKGA 3SDJA 3PY1A 2BRGA 1IM2A 2OGVA 2RG6A 4HZSA 1WVYA 2ZDUA 4RPVA 3IGGA 5DHJA 1YHVA 3FKLA 1VYZA 5BUEA 4G3EA 1M7QA 4FSNA 3RK9A 3F92A 1RE8A 2KULA 3DJ5A 2C5OA 1IXSA 4L7FA 3VS1A 4HVSA 3IO7A 1B6CB 1MQBA 4YC8A 4MWIA 2I0VA 2OJIA 2X6EA 1JR3E 2YM5A 2WOTA 2G2FA 3L8PA 4RVLA 3VS3A 3MJ1A 4ZTMA 3OOMA 4BFMA 5HQ0A 3IGOA 4QQTA 3B2TA 2ONLC 3HP2A 5EQYA 2QKWB 1P4FA 2W06A 2YLEA 4FODA 1YI4A 2ACXA 3JXWA 1FMOE 2ZTCA 2OK1A 3T8OA 2WO6A 3TV7A 4R7IA 3ZS5A 3W8QA 2XBJA 4D9TA 4EEVA 4G5JA 1KOAA 3F9NA 4FKWA 3V8SA 2BRBA 2XZSA 3AOXA 3P78A 1SMHA 3MVHA 4JVGA 4C0TA 4IADA 3OXTA 3DK6A 1GIHA 2QD9A 3B89A 4NK9A 4WT6A 5LWNA 4F7NA 1NW1A 1F3MC 1QCFA 2YWPA 4ZEGA 3ZXZA 3PSCA 4YJUA 3Q4TA 4WSQA 4C3FA 4CMUA 3K2LA 4I4EA 2CNUA 2FSMX 3M2WA 4HVDA 3UZRA 2WIHA 2PSQA 1OZ1A 3OTUA 4PL3A 1W98A 1YXVA 4JBOA 2VZ6A 4QT1A 4XP2A 4WUNA 2OXDA 3A4PA 3RPSA 3F5GA 3N4UA 2JEDA 3ENMA 4APPA 4MQ2A 4Y95A 5DI1A 1UU7A 2O8YA 3ZM4A 4CYIA 4QMZA 4HW7A 1AD5A 3G6HA 4B99A 2GFSA 1XH5A 4R71A 4BDBA 2ZOQA 1MRVA 5C4KA 4ZY6A 5AR4A 5GZ8A 4L8MA 3VBQA 4HYSA 2YM8A 4MXZA 3ZRMA 2XKCA 3PP1A 5J1WA 3FYKX 4O22A 4BCKA 4M66A 2BRNA 3P7BA 5E8XA 2V5QA 2O25A 2CKEA 4PDSA 4QMYA 4RMZA 3ZFMA 5ETFA 1G5SA 1U5RA 3FL4A 1NVQA 4C3PA 5JKGA 4NIFB 4GUEA 1WBWA 3MY1A 5EFQA 4UN0C 3DXPA 4II5A 4GU6A 4GFOA 4AZVA 2XK6A 3AD6A 2UZDA 3ACKA 1OPJA 1I09A 4MCVA 2BILB 3BHTA 4ZXTA 3F5UA 4BN1A 3CY3A 4O7NA 4ENXA 3FAAA 2F2UA 4C02A 4E26A 2FB8A 2P55A 2W1HA 4M69A 3U9CA 4PDYA 4UWBA 2VTSA 4BTFA 3ZEWA 3UYSA 3GB2A 4G3GA 2WTKB 3GQLA 2ZYBA 4QP4A 1WBNA 3EQGA 3UZTA 4H05A 2ITPA 3D7ZA 5E92A 3EFLA 2QC6A 3DBEA 5E9EA 1YXSA 1K9AA 5KBRA 1XO2B 3HL7A 1HJPA 4QMVA 5DRDA 3TT0A 2LGCA 1GZKA 2EKFA 1QPEA 3F3UA 1P4OA 3QALE 3Q9WA 1UKHA 2OW3A 4P5QA 4AZSA 5DE2A 3DLZA 4W9XA 4Y83A 3SXSA 1PKGA 3UO4A 4I5CA 4X2FA 2VWBA 4OT5A 2VWIA 2LAVA 2DAMA 5JGBA 3A62A 3FC2A 4ZMEA 3PY3A 3QTWA 4L3LA 3FPMA 5DGZA 4ASXA 5CF4A 3LFQA 1R39A 2XJ2A 4E6AA 1PXPA 3ZMMA 2HWOA 4N70A 5BVNA 5LMBA 2X1NA 2PU8A 3K9OA 4D58A 1KV2A 4AW1A 4AFEA 5KMJA 4F64A 3R04A 4XG2A 3KVWA 4DE4A 3MY5A 3HA8A 3OD6X 4FKGA 5AR2A 4NJDA 4EHZA 5CASA 4C4HA 3PVBA 4BGGA 4KBAA 3SW4A 4H3PA 3E87A 3NUSA 4AFJA 4ALUA 3PWYA 5TKDA 5K5NA 4AA5A 3CLYA 4KIKA 2OO9A 4EC8A 3ZDIA 4JJRA 5LMKC 2JDOA 2DS1A 4QQCA 3FSFA 2Z60A 3AMYA 3LFCA 4CVAA 4GT3A 3RZFA 5K3YA 5HLNA 2PMNX 2PZRA 3FZRA 4U44A 3OWLA 5M4CA 2J5FA 1ZXEA 4D55A 4C8BA 5IU2A 3NPCA 3TACA 4NL0A 4PL4A 4Q5HA 2X4FA 4HPUE 2VX1A 2X8EA 2YN8A 3GXLA 4NKSA 1Q5KA 1V1KA 1YXUA 4FIFA 3RGFA 4BB4A 3ZTXA 4Y8DA 2VRXA 3QKMA 4C35A 1NY3A 1L3RE 5CU3A 4TWPA 2WIPA 2BKZA 4JG6A 5CEOA 3LXLA 2IG7A 5KZ0A 4I0SA 2I6LA 2BDJA 1H1SA 4R3PA 5C01A 1FPUA 1WCCA 5D7AA 4ANQA 3H30A 3KF7A 1U5QA 2V7AA 1Q62A 2R7IA 4FNWA 1RW8A 1OKZA 2XEYA 3OCTA 5E91A 3BYOA 3BWJA 3FV8A 4G3CA 2X9EA 3C0HA 4PTEA 4X7QA 3RKBA 1BX6A 2C3LA 5DEYA 5L2IA 4NFNA 3EFWA 2GHMA 3BHHA 4JG7A 4JLCA 4IX3A 2GQGA 1REKA 2CGXA 2VTAA 4OUCA 5EI6A 5KKRB 1ZV1A 1FMKA 4HGLA 3TUBA 3GC7A 5A54A 3DGKA 3EL8A 4HVHA 2RFDA 3LFNA 4HJOA 5E8YA 1G41A 4QYYA 2RIOA 5LVNA 3G6GA 5IQBA 2PWLA 5EI8A 2W4OA 1SNUA 1OKVA 2XNBA 5A9UA 3QTRA 4S2ZA 4PTGA 4DG3E 5BVOA 3D5VA 2Y4PA 4QP9A 2O64A 2JY7A 2X8DA 4J99A 5IEYA 5IISA 1GZ8A 4EUTA 5A4CA 4IE9A 3DTCA 5HD7A 2QOFA 4F6WA 2PE2A 4ACDA 4AW2A 3HV3A 4D5KA 4UMRA 1MRUA 4AW0A 3NAXA 4FA2A 4XJ0A 2QKRA 3HA6A 3CY2A 3T3VA 1Y8YA 1LPUA 3KB7A 3WF8A 5HU3A 4AOIA 4FKTA 3G2FA 5CSHA 2WTVA 3IW7A 2GS7A 3CJGA 3GCSA 5AADA 4YHTA 5IQEA 3VBVA 2QSFX 3FHIA 1REJA 2EVAA 4OTDA 4Y5QA 3V01A 5CAPA 4GJ3A 2LVOC 4ZSLA 5L2WA 4IANA 4E20A 5E1SA 4D1ZA 2CDZA 4GKIA 1YOJA 5KMMA 1PMUA 5HKMA 4QMMA 3ZSIA 5J9ZA 4BI1A 4ERWA 1H1WA 2XK7A 3NWWA 4O83A 3JY9A 2H5XA 3QQJA 3UPXA 3ZLSA 3PJ2A 3I79A 1URWA 4O0SA 3COHA 1KUTA 1M2PA 4DA5A 5IF1A 3GU7A 3FLQA 2OXYA 3UIUA 4C33A 2E9UA 1UU8A 3MFTA 5JZNA 4EOMA 3N9XA 4YLKA 3QTIA 4FG8A 3QTUA 4TYEA 4QP8A 3VQHA 4AP7A 3HP5A 4RIYB 4YZBA 3VUIA 2QOCA 5HTIA 2XVDA 5A14A 2HXLA 3PY0A 4M15A 4F6UA 2CGWA 5AP1A 4EH5A 3R83A 5M09A 1MUOA 1ZOHA 4FZFB 4EQMA 5KE0A 4MK0A 4YJVA 2P2HA 2OJGA 3SRVB 4AN2A 4DEGA 4YJNA 3F66A 4ZK5A 1FOTA 4KRDA 3UBDA 3ZC6A 5EDPA 3N4TA 4FTNA 5LXMA 4X6RA 4YU2A 1ERKA 3WF9A 4N4SA 2IVTA 4ONAA 3A8XA 2OBJA 2OJJA 3LCSA 3MH1A 4QP7A 4DCEA 2C1BA 3ZEPA 3R63A 4OBPA 4CFUA 2XNGA 3O8UA 4DFYA 2E9NA 3O17A 5AV3A 4FV8A 3CGFA 1T45A 2IVSA 2Y6OA 3UIMA 5FD2A 3ORXA 3OOGA 4UMPA 4BC6A 3PE2A 3I60A 3LJ0A 2EWAA 2UW4A 2PMOX 3KMWA 3JR1A 4CV9A 1A9UA 2XIXA 4N6YA 4OBQA 4EL9A 3EH9A 3ZRLA 5K4JA 4TWNA 4E5AX 4O21A 2GNFA 2JKOA 4L46A 2OH4A 5M56A 2WEIA 4YJSA 1ZLTA 4FNXA 3D15A 5HE0A 3TEIA 4IM0A 4YJRA 3R1NA 4DAWA 3WZKA 3UO6A 5JH6A 3OZ6A 5CEKA 4FZ7A 2UZNA 3G15A 4M67A 3R01A 3OG7A 4V05A 5D7VA 4FV3A 3SOAA 3ETAA 3TZMA 4P4CA 3UNJA 5ANKA 4TY1A 5J79A 2ZMDA 4EYJA 4MD7E 4ZZNA 5D9HA 4G6LA 2W1DA 2JIUA 2X4ZA 1JAMA 2GFCA 2WOUA 2VX0A 3IOPA 3LXKA 3QCSA 2W0JA 1YW2A 4MNFA 3HLLA 2IW9A 3BIZA 1ATPE 4FKQA 3IKAA 5AP7A 5IEVA 5HE1A 4HPTE 3UNKA 3BEGA 4NTSA 4QMWA 1E9HA 4K6ZA 4MNEB 3Q5ZA 4Q5EA 4I0TA 4KUJA 4O0TA 4GH2A 2QOHA 2VUWA 4YPSA 4MBLA 2F4JA 2XEZA 4ANLA 3ZBFA 5EM8A 4LOPA 2EXEA 3BU3A 5DIAA 1H27A 4YSJA 3NIZA 4OTFA 3E62A 4H58A 2J0JA 2FGIA 4RRVA 3U6IA 4O7LA 3AXWA 2ITUA 3LFDA 4BDJA 4LYNA 5CZIA 4FICA 3DTWA 4PPBA 3ORMA 4EH7A 2O2UA 2H34A 1BL7A 4KD1A 4JDJA 2GNIA 1C7YA 4MD8E 3E46A 3C4XA 4BCJA 4JG8A 2UVYA 2XK3A 4UWCA 2W7XA 5GIPE 4BY9E 3R00A 5JQ8A 2W5HA 2PVFA 3VW8A 3PG1A 2BAQA 3PJ3A 3W2SA 2L2DA 4FOBA 4H3QA 4PUZA 5AM6A 5AP3A 2UVXA 3RALA 3UMWA 4O7RA 3AC2A 1A5TA 2X81A 3COMA 4YNOA 2NRYA 4FF8A 2UW0A 3F7WA 3EN9A 3FKNA 3G33A 4L44A 4YBJA 4R3RA 3RI1A 2C4GA 2CNVA 3DB6A 1H0VA 2V55A 2HENA 4X2JA 4B8MA 1WGLA 3F88A 4GK3A 1KSWA 3CPCA 4XRJA 4LGHA 5EH0A 3VNTA 2JKMA 4RX7A 2BWEA 5F1ZA 5DOSA 2Z7RA 3GFEA 3RM6A 5AFVA 3NEWA 1J7IA 1YI3A 5FTGA 3OWJA 2ITYA 3FUPA 4L43A 3VRZA 1S9IA 4ALVA 2DI0A 3GBZA 3VO3A 5HX6A 3PLSA 4EKLA 2HAKA 3NVKI 2ITXA 3SV0A 4O38A 2WXVA 2OU7A 3OT8A 2YA9A 2H96A 4XG9A 3E7VA 3VAPA 2B9IA 2IW8A 4C3RA 1ND4A 2HZ0A 4TWOA 4I41A 1XWSA 1OIUA 3I5NA 2VGPA 2VO3A 1BVSA 3G5DA 1BMKA 4M68A 3DAKA 4ZTNA 4AQCA 5DG5A 3UNZA 4EH9A 3BU6A 5DPVA 5AA8A 5JFSA 4FV7A 4CKRA 1UWJA 3Q4CA 5CNOA 3RINA 1K2PA 4BI0A 2XF0A 3ZUUA 4E6CA 2QO9A 3C0IA 5C9CA 4O81A 2B54A 2RSVA 3O51A 5AM7A 2X2KA 4ZSJA 3SAYA 2OJFE 1ZY5A 2JP7A 3OFMA 2XIKA 1XH9A 2GDOA 2B3TA 2VWUA 3E8DA 2XNOA 4YZDA 3ZH8A 4AN9A 1OGUA 3AGLA 3QCYA 4YC3A 3M1SA 4USFA 3P9JA 4AX8A 2V22A 4ZS4A 3QX2A 2JIIA 4RZWA 5D12A 2UW8A 5I0BA 1Q24A 3QRJA 4GV1A 4BIBA 2JY8A 3MA3A 4G9CA 3E8NA 4C4GA 5IA1A 4BCFA 1OQYA 3DA6A 3QXOA 3TIZA 2UW9A 1OL5A 3KL8A 3V5JA 3VS4A 4J96A 3ZLXA 5CU4A 1NVSA 3BKBA 3E93A 4BTKA 4I6BA 5BVDA 5DR9A 3DBDA 4LUDA 5ITAA 2YABA 3EQRA 3KRXA 5BNJA 2R3HA 3BLHA 3KU2A 3T9IA 4RWLA 4U42A 3U87A 3CSVA 2GS6A 2J0IA 2YCRA 4OAUC 3KMMA 5JK3A 3TDWA 3QRIA 2GNJA 5FLFA 2HCKA 5FQDC 3LMHA 3CGOA 2YIQA 4F1TA 4YTCA 3LXNA 1E94E 3S4QA 2YERA 2VTIA 3VHEA 2W4KA 3QD0A 1Y8GA 2R64A 3MJ2A 3I0QA 1F4IA 5HG5A 4LMNA 1X8BA 2K9DA 1ZWSA 3TTJA 1AQ1A 3G0EA 1PHKA 3QD4A 1JNKA 1YRPA 3LPBA 3L1SA 3MH3A 3PP0A 5BQ0A 5HZNA 5FEEA 5ANEA 1H8FA 5K9IA 2PHKA 3PXRA 1XHAA 2XM9A 1XH4A 3PZEA 3SC1A 1FVVA 1LUFA 5CWZA 4FSTA 2BFXA 3T6PA 1OBDA 1Z5MA 2UZTA 2G15A 3ITZA 5FTOA 4BHZA 3WE8A 4MEDA 4DT9A 3QAME 4O1PA 3DXNA 4QTBA 3DJ7A 5HG8A 3W10A 3UP2A 2RRUA 5CXZA 4U97A 2HWJA 2BZJA 4WP2A 1YOMA 3PXYA 3ZC5A 3Q3BA 3MA6A 1ZZLA 3W16A 3U6JA 2F49A 2AC5A 1IA9A 2HK5A 4E4LA 3VJOA 2ZVAA 4DEIA 2WQMA 5CEPA 2EUFB 2C6IA 3UIXA 3HAMA 3Q9XA 1Y91A 3EYGA 4FOCA 4GT5A 1H1RA 4EOLA 2VTHA 2YAKA 2QOLA 3Q60A 4QNYA 4A9TA 1RDQE 3BQRA 1U54A 5K0XA 2CMWA 3EZVA 4CFVA 4QRCA 2ZB0A 2FA2A 5DVRA 5ETCA 2C6EA 3NNXA 2OOBA 2DAKA 1KOBA 4H39A 2XJ1A 4IB3A 4AZWA 5IDNA 3SLSA 3GU8A 4FL1A 2X0GA 5AX9A 4V0GB 3P7AA 4QYHA 4RLLA 4OGRA 3AT2A 4F4PA 2YDKA 1T46A 2PTKA 3FY2A 3C9WA 5HX8A 4O7VA 1UU9A 4BWPA 4GG5A 1DAWA 1ZYSA 3ATTA 4DFUA 2XB7A 1ZYCA 3R9NA 1ZYLA 3QUPA 4FTMA 4EWQA 2YJSA 2B52A 3R7YA 4IWPA 3EN4A 2J51A 2QO7A 3AMAA 2GS2A 5ICPA 5G6VA 5CZHA 3GOKA 3QTQA 3CQEA 4FIGA 4QMUA 5CX9A 5EW8A 1J3HA 4S30A 4F6SA 1IEPA 1WAKA 1A48A 3NW5A 2WTDA 3Q5IA 3JVSA 4WO5A 1APME 2XKEA 3CE3A 4CTCA 3VC4A 2PYWA 2QHMA 4FTCA 5CXHA 4B7TA 3MPAA 3UC4A 5GZAA 1QPJA 4FYNA 4BR3A 2ERKA 1PGYA 4K9YA 4GT4A 3ORZA 4F9YA 1DO2A 3MN3A 4OTPA 4BZNA 3QTSA 5HD4A 5GZ9A 5EKNA 4FTLA 5M4IA 3AD5A 4OTRA 3RCJA 3HV7A 2YIRA 5IMXA 2I1MA 5DLSA 4BDKA 3VJNA 4E4NA 3MTFA 4JBQA 4A9SA 2XP2A 4AA0A 4YTHA 3LFEA 2PVRA 3BLRA 1PRYA 4BDFA 4ASDA 3TI1A 3II5A 3NLBA 5IG1A 3RTPA 2V0DA 1STCE 1H08A 3U8WA 4L53A 5EKOA 3MDYA 1PXLA 4U7ZA 3H0YA 4UEUA 3ZZWA 4DH7A 2R3LA 2C68A 3B8QA 1SVEA 1ZMUA 3CTHA 4UY9A 2PK9A 4USEA 4RIXB 4ACCA 4DEEA 3BBTB 2WTKC 4EK3A 4HVIA 4G1WA 2VTTA 3VUGA 5B7VA 2KNAA 3ODYX 5KO1A 4LMUA 1IR3A 1LEZA 2Y9QA 4YZCA 4CD0A 5F94A 4XV1A 4CLJA 4YZ9A 4NTTA 5HTCA 3PPKA 2R3IA 3UVPA 3R7GA 4O0XA 4GW8A 4LL0A 4LV5A 4YGAA 5EK7A 2WU7A 1ZZ2A 3VUHA 5IPJA 2ETKA 3W32A 3Q2MA 3HECA 3QCQA 2PVHA 5CQWA 4D4VA 2J2IB 4ANOA 1WFCA 2UV2A 3GC9A 4YUQA 4H1JA 2KHHA 2ZMCA 3U4WA 4ACHA 5ANOA 4ITJA 2QNJA 4YHFA 4MKCA 3DPKA 3RAWA 2YITA 1SVGA 1IASA 3I5ZA 2YZAA 1R78A 2C6DA 2QLQA 3PXZA 4HGSA 2J7TA 4LGDA 3R22A 1ZOEA 4RVKA 3VIDA 1JLUE 4KAOA 4LOOA 2X39A 4RX9A 5DT4A 1VYWA 5L2TA 3FMJA 2VAGA 3GC8A 4IQ6A 3F2NA 3NUPA 4YO6A 4AGWA 5M06A 3D5WA 4DYMA 4J53A 2CN5A 4UV0A 3UOJA 2Q0NA 4MXXA 4O7TA 4R8QA 4K0YA 4IDVA 4K8AA 3KCFA 4A4XA 4O91A 1XB2B 2WPAA 3MH2A 4TN6A 1PMVA 2UVZA 4RX5A 3QQGA 3SW7A 1JVPP 1UA2A 4ZIMA 3I4BA 4BBEA 3CTQA 3FMKA 4LUEA 5FBNC 4BI2A 4I93A 4YHJA 5HO8A 3V8WA 3VUTA 5EQPA 1GIIA 4CSVA 3DKOA 1TTEA 4I3ZA 3T9TA 5AR3A 5H8GA 4S33A 3CBLA 3RAIA 4B0GA 4CZYB 5AUUA 3QA0A 3Q2JA 2L4EA 2C30A 4AZTA 2QCSA 5M57A 3PPJA 4K11A 3SXRA 4BYJA 5FTQA 4EOIA 2P0CA 4BCGA 1S9JA 2BAJA 2QHNA 3OHTA 3EB0A 1PF8A 5C27A 4I24A 4XMOA 1WJ7A 5CVHA 2OF2A 3EQIA 5HBHA 1SNXA 3QX4A 2B0QA 3IDBA 4G16A 4EHVA 3BRBA 3F69A 3KRLA 5HCZA 5FEDA 1FVTA 5AIKA 4Z7HA 3E88A 5M4UA 4WG5A 2J5EA 3MY0A 4QD6A 1BKXA 3ROCA 3VQUA 5K0KA 4UB7A 2C47A 1RJBA 3DBQA 4YNEA 4CZUA 3KCKA 5KKRC 4FTRA 5JFVA 4MH7A 1NT2A 2Z8CA 4FTOA 2O65A 4IJPA 4R1VA 3A7FA 1ZAOA 5FWKK 4TRLA 4DGMA 4FK6A 4JBPA 3DV3A 2RKUA 4ZTHA 3SG9A 2J90A 3C13A 3BHVA 3H9FA 1V0PA 2I0HA 4NM7A 4N0SA 2XK9A 1HCLA 2W5AA 4XLVA 3OUKA 2R9SA 5F4NA 3TV6A 3BBWA 4UZHA 3L9LA 4IAKA 5I9ZA 5AUZA 3R2BA 1H07A 4RFMA 2WMUA 3PZHA 4FIIA 2ZV9A 3BV3A 4OTWA 3WE4A 2FSTX 4YC6A 3V8TA 3RK7A 1TQPA 4ITIA 3Q6WA 1DI9A 3DAEA 2G01A 3EL7A 3HV4A 3OY1A 4RG0A 4FVQA 4QTAA 4U5JA 3WOWA 4U0IA 2OFVA 5LQFA 3LXPA 2VWYA 3OEZA 2RF9A 3U4UA 5IH6A 3F2RA 4ZSAA 1W84A 3HKOA 3SX9A 3V51A 3PYYA 3KGAA 5DYJA 2NO3A 4ID7A 5HTBA 3DJ6A 4QNAA 2C0OA 1Q8UA 2CGVA 4QTDA 3HV5A 4HYUA 4JRNA 4XG3A 3VS5A 4NIFA 3UG1A 3BYUA 5C26A 4EH4A 4ALWA 3PG3A 3QZFA 4YZMA 3CJFA 2GCDA 2A4LA 4ZZOA 3AC4A 3NX8A 4F70A 3QBNA 4FKVA 3UE4A 4UMUA 2QG7A 2R3FA 2RGPA 2X7OA 1H4LA 2UZUE 4WSYA 5HU9A 2CKOA 4O86A 3OY3A 2R3JA 4D2WA 5JEBA 1XKKA 2YIYA 4DTBA 1OIYA 2PZPA 4D0XA 5A4QA 5HORA 3FLZA 3OMVA 5FXQA 4GJ2A 2YIWA 3TN8A 2JFLA 4FKLA 3ORNA 4W8EA 3R8VA 4D9UA 3K5VA 4G6OA 3H10A 3BX5A 3RPRA 2R3NA 3MVLA 5CALA 2JBOA 2QOQA 3VS2A 3ET7A 2IVUA 3LKMA 2YM3A 3FI3A 3IDCA 4AGCA 2W99B 1JPAA 3PVUA 5I5ZA 1P5EA 3DKGA 3PTGA 4D1SA 3T3UA 3FQEA 4FTKA 4RFZA 4AE9A 4GK2A 4XLIA 4GMYA 4DGGA 2HIWA 4JL9A 1R1WA 4TZRA 3CD8A 4R1YA 4X3FC 2GQRA 4PNKA 3WZEA 1UNHA 2YDIA 1OPKA 4NH1A 2UZBA 2HELA 2ETMA 2XCKA 3PE1A 3O23A 3DOGA 4L45A 3BHUA 3GLHE 3LM5A 4A9UA 3QC9A 1UFZA 3DZQA 2DQ7X 4M0ZA 5AUVA 4GK4A 1W8CA 4KIKB 4BRXA 1G4AE 3C5IA 4D2RA 4CKJA 3VBYA 5GNKA 1GAGA 5HO6A 5JZJA 2PULA 3NUAA 4XG8A 1O6YA 2RG5A 3PSBA 4LRMA 1YOLA 4F9CA 2UZLA 1FGKA 4CT2A 2Z7SA 3BPRA 2UW3A 4O7YA 2OXXA 4QMTA 3LLTA 1FBNA 1YWNA 2DAIA 3C7QA 2WQEA 5AP2A 3TIYA 4F0FA 3ZFXA 2Y6MA 5IQFA 3TTIA 3FRHA 3L8SA 5IA5A 3KKVA 2PUIA 4HYIA 3V5TA 3F6XA 4LRJA 4GYIA 2ZV2A 3PXFA 2PMLX 4JIKA 2FSLX 5M53A 2ONLA 3PDTA 5CAUA 5TR6A 2NP8A 3VF8A 4BCMA 1YI6A 2X2LA 3QFVA 3O0GA 4FTJA 3HAVA 2GHLA 3R02A 4RFYA 4RJ6A 3F3TA 4FEVA 2XA4A 3PXKA 5JGAA 3U6HA 5H8EA 2WMRA 4XOYA 5GJFA 3QWJA 3R7IA 2YIXA 3UTOA 2KNVA 3GCQA 2MR9A 1KE8A 2UW6A 3LCDA 4LI5A 5AMNA 2XNNA 4FKIA 4QTCA 2I40A 3D5UA 3C4FA 1H1PA 3HMNA 3R21A 3GU4A 3EKKA 4Z16A 3QTZA 4BVUA 4L42A 2YM4A 3KF4A 2IZUA 4DTKA 4EORA 1Y6BA 3VULA 4R7BA 3NUXA 3KXXA 2GTNA 3ZO3A 4UZDA 3RCDA 2Y8OA 5KHWA 2VNWA 3PPZA 5CLPA 3A4OX 3KVXA 2DENA 1CUKA 1ZRZA 2VO7A 5DA3A 3EHAA 1MQ4A 3G51A 2PVKA 4QP3A 3R8ZA 4F7SA 3GVUA 3VF9A 2XIYA 4NYEA 4I5HA 2HWPA 1IAHA 2A19B 3I0OA 2PVJA 2VTMA 4EC9A 2OZAA 4HOKA 4QPAA 2FVDA 5HGIA 5BVEA 1UU3A 3R30A 4BDHA 3E92A 4AOTA 2GU8A 3FMLA 3A61A 3PFQA 3OS3A 3ANQA 4P5ZA 3EQPA 5HVJA 1KYIA 1VR2A 2RFSA 4EK4A 1SG9A 2VTQA 4YJQA 2BALA 3E3BX 3F3WA 4HCUA 4L01A 1I44A 5EYDA 3DXQA 1YDSE 4D5HA 1JSUA 3W55A 3FI4A 3LFFA 4FEQA 2VWXA 4AACA 2LBCA 4S31A 2CN8A 4HZRA 1AIPC 3EQBA 1LR4A 3GFWA 4BCHA 1GJOA 3RAKA 4EH2A 4EK5A 3ZUVA 2CP8A 2Y7JA 3P0MA 3F3VA 4KBKA 4LM5A 4O6EA 4D28A 4YJPA 3VN9A 4G3OA 3TJDA 3DK7A 3AC5A 3BGQA 3GI3A 1YHWA 4YTIA 3DS6A 2OFUA 5I9WA 4X2KA 5IQCA 3GCVA 4Y73A 4E7WA 2DYLA 2O0UA 4TYHB 4ZZMA 4E4XA 2QOKA 2PMIA 3CEKA 2R7BA 3RWPA 5EOLA 3KXMA 4E6QA 3ZO2A 2FSOX 2B53A 3MTLA 4JOAA 4TW9A 3MFRA 5ETAA 4RJ3A 2P2IA 2P33A 3KXZA 3PRIA 1KE6A 3HVCA 4FSQA 3WF5A 5E90A 4LRKA 2E9PA 3FLSA 4KRCA 2C3KA 4L3JA 4RIYA 4FL3A 3R28A 4EZ5A 4W4VA 5J9YA 3NCGA 5JFXA 2XUUA 1H00A 5EYCA 1ZYJA 5CU0A 4X3FB 5HVKA 2FH9A 4ZOGA 2LTUA 4XG6A 2G1TA 4G9RA 3BYVA 1Q97A 2BRMA 3SRVA 4RJ8A 4R6VA 3HMPA 4QQJA 4XH6A 4ZSGA 2JDSA 4Z7GA 2JZ0A 4EHGA 4DH3A 2W5BA 5JGDA 3C4WA 4W4XA 3MESA 3R9RA 2PUNA 1XXHE 5DEWA 2OZOA 3PJ8A 4I4FA 2YCFA 2JDTA 3A8WA 3KN5A 3AGMA 4IAYA 4QMSA 3B2WA 5GJGA 3GC0A 2IN6A 4IVDA 4P90A 2YCSA 3F82A 5LMKA 3MB6A 4EBWA 4TNBA 3CQUA 5GIOE 3CKXA 5IA4A 3TKIA 3DNDA 5HOAA 4MVFA 5B2KA 5L2SA 3OEFX 3RNYA 4I6HA 3S3IA 1QZEA 3Q04A 4DHFA 2UZEA 1SZMA 2G9XA 4FC0A 4L68A 2BDFA 2W4JA 4OTQA 1PYXA 3DFCB 3FMDA 1MN3A 5TT7A 5JRSA 4I20A 4DFBA 2J0MB 1JKLA 3DCVA 5AV1A 3NW7A 4RIWB 1WHCA 3TXOA 4J8MA 4I6QA 5A6OA 4N57A 1HQYE 2O5KA 5HNGA 1OKSA 4R77A 2X9FA 1JWHA 1XH6A 4DFNA 2JDRA 3N51A 4UYAA 3BU5A 5HHWA 2BUJA 2HZ4A 3GEQA 4I1ZA 5AUYA 3R1QA 5LVLA 5LMAA 4FNYA 2BWBA 2ESMA 4K1BA 2JIVA 4MBIA 2FO0A 2GNLA 3MPMA 4MWHA 4PMTA 3ZXTA 4QQ5A 4KSQA 3VS0A 5BPYA 3B8RA 4IM3A 2QVSE 3D94A 3Q9ZA 2I0EA 3FLNC 4FV6A 3MVJA 3EQCA 4CNHA 4RJ4A 4XCUA 1BL6A 1ZOGA 4CGAA 4WNPA 5L6PA 2W1GA 5IA3A 5LWMA 5CEIA 2HYYA 4PV0A 4WNMA 3UOKA 3SA0A 2ETRA 4GEOA 3ROYA 3NAYA 3GUBA 5CY3A 3ORPA 4MNEA 1UV5A 3WIGA 5ETIA 5FEQA 4BDGA 4IWQA 1EH4A 3P79A 4TNDA 5HIDA 3RWQA 4EQUA 5AEPA 1WBTA 4MAOA 2JLDA 4RBLA 3VS6A 4AU8A 5KMIA 1M2RA 3F7ZA 2QR8A 3R7VA 3R9OA 3ZHPC 4MXCA 2C1AA 1H1QA 4NEUA 3R9HA 3AC3A 4RZVA 5HI2A 3NZ0A 3LZBA 2JD5A 3P1AA 3QD3A 5CT7A 1G8AA 1M7NA 1CTPE 5EM6A 3ZDUA 3HV6A 2VU3A 2IVVA 2P3GX 2VTJA 3HZTA 3IPHA 5EHLA 3W18A 4APCA 4GEWA 1GO5A 2HY81 4FKSA 5LARA 4DG0E 2F9GA 4NZWB 5C8KA 3U9NA 4IC8A 2WMWA 4XHKB 4AZFA 2R3OA 4QP6A 2VO6A 2W96B 3QF9A 3FLYA 1W83A 2PZ5A 2YWVA 2XIZA 2RFEA 3OBGA 4IB1A 5J1VA 3S2PA 4W8DA 1YDRE 4G6NA 2YHVA 4TYJA 3GT8A 5T68A 4JDIA 4RA5A 2YACA 5GJDA 5CAVA 1OIRA 3TDVA 4UXQA 5D41A 3FRIA 4AGUA 4EYMA 4UX9A 3BGZA 4L7SA 1CDKA 3C4ZA 4FIJA 4I23A 1IRKA 4IH8A 2VNYA 4WD5A 3RVGA 4PMMA 4DLJA 4BCPA 2B9HA 4EI4A 5J5TA 4YSMA 4MYGA 4JT3A 2ZV8A 1WMKA 4BDIA 4CTBA 5BVKA 5IQIA 2PUUA 2XM8A 4OLIA 4M12A 5H3QA 3DDPA 3HMOA 4YJOA 2EB3A 3EJ1A 5HG7A 3W1FA 3BWFA 3QCXA 3IHPA 3BELA 3LCKA 4PF4A 4UMQA 4ANMA 2C5YA 4M0YA 4FUXA 5D11A 3KK8A 4RVTA 2WMSA 5KCVA 4IX6A 4GKHA 4CFMA 2REIA 2ZM4A 4OT6A 4V04A 4K18A 5EM7A 2PVYA 4F9AA 3FY0A 1Z9XA 4EZ3A 5AAEA 4D0WA 4D4RA 1ZARA 3P23A 1IFYA 1J1BA 2VWZA 3WBLA 2DUVA 3MVMA 4GFGA 4TTHB 4Y5HA 5E8WA 3LM0A 5F9EA 2BIYA 2LVQD 2UUEA 1HT1E 4UMTA 1GZNA 4S32A 2DAEA 1XBCA 2K0BX 2CLQA 4FT3A 5E8UA 4CMTA 3BQCA 4BGHA 2OG8A 3QKLA 1OTRA 1OUKA 4GL9A 4AS0A 4C7TA 5IZFA 2B4SB 2F57A 4IBMA 5AJQA 4RVMA 3RM7A 1CM8A 2E9OA 2GMXA 3C4EA 5JI2E 3QZHA 3PJ1A 3ZU7A 5EHOA 3LLAA 1OUYA 4FV4A 4RJ7A 4RWJA 1IA8A 3D14A 3IS5A 3OWKA 1WBPA 3ORIA 4MXOA 2DWBA 2YAAA 3PA5A 3UC3A 5KNJA 4LGGA 4GG7A 4YLJA 3HNGA 3CTJA 4EUUA 3HDNA 3QD2B 4FEXA 2FYSA 4QYGA 4DEDA 2ITTA 4O0RA 5HNIX 3ANRA 3NGAA 3SVVA 4RX8A 4G2FA 3EQHA 3WZJA 1W0XC 2QO2A 3EFJA 3JY0A 2WTCA 4Y72A 1R3CA 4M14A 5C8MA 4HVGA 2PVNA 3BZ3A 3FHRA 4J95A 3QC4A 4ANSA 4RWIA 2G3QA 5DWRA 5EYMA 5CEMA 1XR1A 4ASEA 4U80A 4HGEA 5CENA 5C8NA 5IDPA 4O6LA 5IUHA 2JUJA 3QUDA 3WI6A 3IW6A 4TPTA 2DZLA 5DRBA 3D5XA 4A9YA 1V0BA 4IFCA 2B9JA 3CKWA 4GSBA 2R3RA 2OIBA 4NUSA 3OXZA 4BZDA 2YJRA 1FQ1B 1WR1B 3HDMA 4IZAA 4LV8A 3V5WA 3VWAA 3RK5A 4BIEA 2F7XE 4C62A 1WBSA 3QWKA 2RFNA 4F1IA 1XBAA 1VEBA
chains in the Genus database with same CATH superfamily
4GKJM 5HE3A 4FSMA 3AOEA 3G9LX 5CI6A 3FC1X 5FP6A 4WNKA 2LVPC 5HCYA 1EFUB 4R3DA 4ITQA 3EMGA 1GZOA 4FT9A 4DR6M 5CVGA 1UKIA 1TH3A 4B8LA 3WYXA 1PJTA 5A2QS 3V3VA 4B7FA 2ITVA 3FZTA 3QZIA 4JIAA 5EOBA 3M42A 4O2PA 1DV0A 4A07A 2CNQA 3QQUA 4OTGA 5AAFA 3FQSA 3TNIA 3V5QA 1LP4A 5BR8M 3TJCA 3VVHA 2MROB 2NRUA 3VBTA 2OI4X 2R0UA 3ZCLA 3E5AA 2FS1A 4AAAA 4O96A 5J87A 1UWHA 3ACJA 1Q4LA 5HESA 4JXJA 4AW5A 4K2RA 3E8EA 4EZ7A 5FTJA 5IA2A 1NJFA 5E8TA 4KKEA 4FTTA 3DLSA 1TQIA 3FZ1A 5E7RA 4XNEA 5TOZA 3SGCA 2HOGA 1KV1A 3MYGA 4FZDB 3UGCA 4F1OA 3O7LB 2CWBA 4ERKA 3JUHA 4RJ5A 3UG2A 5CQUA 3ZOSA 2CLXA 5L8LA 3VUDA 4JNWA 2NNWB 2XNEA 3E63A 4OW0A 3P86A 5K5XA 5JQ5A 4FG7A 4K33A 2YEXA 5J7HA 3BYSA 5ANIA 1Q41A 1NNJA 3L25A 3FTDA 2YLFA 4J52A 4ZJIA 3U6EA 2CCIA 4JR7A 3UVRA 2L6OA 4ZP5A 3WZDA 5ANDA 4RWKA 3GLIB 2BVAA 3A7HA 1GNGA 4B4LA 4B3RM 1JKKA 2UW5A 4BGQA 2L4FA 2YFXA 2EJSA 5GINE 5IH4A 1H0WA 1YWRA 2N35A 1Q02A 3KREA 4IWOA 1OL2A 5DMZA 4GH9A 5EW9A 4DN5A 3U51A 1M14A 4GIHA 1XBBA 4RA4A 2HXQA 3KN6A 1SVHA 5M07A 2Q0BA 3UO5A 4IWDA 4WRGA 4OW8A 4KNBA 3MFUA 3KRWA 4IC7A 1U46A 2CKQA 2ZJWA 2R44A 4IM2A 3QQLA 4CRLA 3SG8A 5FBOA 2Z02A 5EP2A 1PJQA 4KKHA 4EOSA 3PJCA 3TNPC 3ZSHA 3W0LB 4FVPA 5FTNA 3R71A 4YBKA 2CUZA 3SMSA 2KNZA 4NSOB 2RKOA 4G4RA 4P2KA 5FGKA 2WQOA 4CIZA 2QONA 1YLAA 1K3XA 3LCVB 3ZBXA 5J9LA 4EOJA 4CCBA 4I0RA 3UP7A 2GPHA 3QRTA 3G90X 4CYJA 4HEOA 3MMPA 3C1XA 4IZYA 5EW3A 3W2RA 4FT5A 4FEUA 2O63A 4XOZA 5LVMA 3OF0A 4FBXA 4LFIA 4DR1M 4PL5A 3LQ3A 2JAMA 2QOBA 2OH0E 4J7BA 4JRVA 5EDQA 4JI5M 4L6QA 3NRMA 3OW4A 4P16A 4WIHA 3HKPA 5J8IA 4M97A 4QNRA 3Q8GA 2VV9A 3EN7A 3R8PA 3C51A 4AE6A 1OITA 2C5XA 4BDBA 4IVBA 3ZLYA 3NDMA 1WVXA 2EU9A 3TUDA 1H24A 3R7UA 2PVLA 4BWXA 5DT3A 3DFAA 1QAOA 4X3FA 3UOHA 3RJCA 5DFLA 2VTRA 8CATA 4XV2A 4GVJA 4QO9A 2NPQA 4Y85A 4E1ZA 4Z55A 1QL6A 3NW6A 4JBVA 3U60A 4IAFA 4NT4A 2F5NA 5B2LA 2IZTA 4QPSA 3HUCA 2P4IA 4R7HA 2YQZA 4EHEA 4RC4A 3BL7A 4FKJA 4MBJA 5CYIA 5HICA 4XX9A 1KE5A 4YLLA 2OKRA 3NSZA 2H8HA 5L6WL 4LJ9A 5FM2A 4CQGA 4WHZA 4WOVA 4O0VA 1IBMM 5IUIA 4C36A 5BUIA 4JX3A 3AC1A 2ZM1A 4KB8A 3CR0A 1E1VA 4LOQA 3MV5A 3AJIB 2QU5A 3AD4A 5FDXA 1DO0A 1NV9A 1YSYA 5EQEA 2ITNA 4D4SA 1HNWM 3BYMA 4JS8A 4EIWA 2MH8A 4DBXA 4CXAA 4BDCA 3R6XA 1VZOA 3AT4A 2XMYA 4XEYA 3C50A 4WG3A 3ZH9B 5HNBA 1Q3DA 4FV9A 3GP0A 3A7JA 4EJNA 2GSFA 4MF1A 2BPMA 3RE8A 4DGOA 4BJJA 4U8ZA 4CJ6A 3NUNA 3RPOA 1YXXA 3R8FA 4HCVA 5IREB 4ZAUA 2CJMA 3A42A 1WIVA 4S12A 3T38A 4IXPA 2JDVA 2VTPA 4X3JA 1U4DA 1MP8A 5KPTA 3R7OA 4DHIB 3I1AA 5IQGA 2R3PA 3QYZA 2WAJA 5E8SA 3FXZA 2XSZA 2V7OA 4OTHA 1H25A 3GLIE 4NM0A 3K5UA 1OJLA 5DT0A 2KA6B 1ZMWA 3D83A 5IUGA 4U3ZA 1CKJA 4DBNA 2JZ1A 3L27A 4Y46A 3QHWA 3KC3A 5FG8A 3SYKA 2ZBKB 1PY5A 1I4WA 1ZYDA 3KS8A 4BF2A 3Q4UA 3J81S 2BR1A 3Q32A 3UQCA 5FXSA 5HBJA 4XP0A 4NU1A 1E9SA 2WMXA 2R2PA 3FQHA 3DK3A 4O4BB 2BIKB 1PJIA 5JN2A 1G3IA 4IB0A 3HHZA 5HLWA 2BZHB 3NNVA 1OGYA 2A98A 2UZVA 4FTQA 4TYIA 3QU0A 4FX3A 4ANBA 1VEGA 1GJTA 3FXXA 5EXXA 3OW3A 3HMIA 3HGKA 4RSSA 1OVEA 3HUBA 5KX8A 3EIHA 3DZOA 4GITA 4DFZE 4AT5A 4FD2A 5TF9A 5AV0A 4YO4A 4UBAA 5ITXA 4XBOA 4MX9A 4G3FA 5L8KA 4X6QC 2FFJA 4A4OA 3SQQA 3RGSA 4YHHM 2A0CX 4L4UA 4CEGA 4Q2AA 1OL6A 2JAVA 3KMUA 4KKGA 3UJNA 3PY1A 1QVRA 5BUEA 3F92A 2C5OA 4L7FA 4HVSA 3IO7A 4O4DA 4B7GA 1SXJC 4PCZA 2OJIA 2G2FA 3L8PA 4RVLA 4ZTMA 2QPAA 3B2TA 3HP2A 1P4FA 1FMOE 2ZTCA 2OK1A 3T8OA 3TV7A 1KOAA 4FKWA 1SMHA 3MVHA 4IADA 3OXTA 3NFGB 2UUCM 3DK6A 4WT6A 4F7NA 1F3MC 1QCFA 3PSCA 3Q4TA 4DV5M 4WSQA 4I4EA 3M2WA 4HVDA 2WIHA 2VZ6A 3RPSA 3ZM4A 4QMZA 4B99A 2ZOQA 1MRVA 5C4KA 4HYSA 2YM8A 1J09A 4M66A 3P7BA 2CKEA 5ETFA 1G5SA 3FL4A 1QAQA 4II5A 4GFOA 3AD6A 3ACKA 4LZJA 4BN1A 4M69A 4UWBA 4BTFA 3UYSA 4QP4A 1N33M 5E9EA 1JB0F 5KBRA 4QMVA 5DRDA 3TT0A 1GZKA 2EKFA 2X49A 3QALE 3AOGA 1UKHA 1IY2A 3UO4A 4OT5A 4IBKA 5JGBA 3FC2A 5CF4A 5DGZA 4E6AA 3ZMMA 2HWOA 4AW1A 1OFHA 5KMJA 3MY5A 5AR2A 4EHZA 4C4HA 3PVBA 3SW4A 3E87A 3PWYA 4EC8A 3ZDIA 2APLA 5LMKC 2DS1A 3LFCA 3LQRA 3FZRA 2J5FA 3SAUA 2YN8A 3GXLA 2I7PA 1Q5KA 4NKSA 2QP9X 4BB4A 3ZTXA 1SXJA 4TWPA 2BKZA 2V1CA 3Q8XA 1WCCA 4FNWA 5E91A 3FV8A 3W68A 1DGBA 5DEYA 4NFNA 3BHHA 1ZV1A 2J7NA 1FMKA 3EL8A 4HJOA 1G41A 4QYYA 2RIOA 5IQBA 2PWLA 5EI8A 2H1RA 1R5LA 5A9UA 5IEYA 2Y4PA 4QP9A 5IISA 4EUTA 1KFVA 3HV3A 4D5KA 4DV6M 4FA2A 3KB7A 5HU3A 1ST4A 4NXMM 5CSHA 2WSCF 2GS7A 2QSFX 4Y5QA 5CAPA 2CDZA 1YOJA 5KMMA 5HKMA 3ZSIA 4I4LA 4XK8F 1TZDA 4DA5A 3GU7A 3MFTA 4EOMA 3N9XA 4TYEA 3HP5A 2QOCA 1R7RA 4M15A 4F6UA 2CGWA 5AP1A 4EQMA 4II7A 3F66A 1FOTA 3ZC6A 4FCWA 4FTNA 4X6RA 4YU2A 4ONAA 4DINA 2OJJA 3R63A 4OBPA 2XNGA 2E9NA 3O17A 1HNZM 5FD2A 4BC6A 3LJ0A 2PMOX 3JR1A 4CV9A 1A9UA 4TWNA 4NRWA 5M56A 4DAWA 5E6JA 1QZMA 5FLXS 5D7VA 5FTMA 3SOAA 3ETAA 3UNJA 5ANKA 2ZMDA 4G6LA 2JIUA 2X4ZA 2WOUA 3UK6A 3QCSA 1YW2A 4DDIA 3HLLA 3IKAA 5IEVA 3BEGA 4QMWA 4Q5EA 4MNEB 4KUJA 4O0TA 4GH2A 2QOHA 4YPSA 2XEZA 4LOPA 2EXEA 3BU3A 3E62A 4H58A 3U6IA 4BDJA 4LYNA 3DTWA 2O2UA 2H34A 3FUTA 1C7YA 2UVYA 5GIPE 2PVFA 3W2SA 2L2DA 4PUZA 3UMWA 2UVXA 4O7RA 3F7WA 4YBJA 3EN9A 3RI1A 4R3RA 2CNVA 3DB6A 1IQPA 4LGHA 1D0KA 3GFEA 1YI3A 3OWJA 4L43A 2HAKA 4O38A 3E7VA 2IW8A 1ND4A 2HZ0A 1OIUA 3I5NA 2VGPA 2VO3A 1BMKA 4ZTNA 5DG5A 3UNZA 4BJJB 2X0OA 4FV7A 4CKRA 1ZQ9A 4BI0A 3ZUUA 2QO9A 4KO8A 4O81A 2B54A 2OJFE 2JP7A 3W0NA 4LJ8A 4AN9A 2LHGA 3M1SA 3GLFB 3P9JA 2V22A 4BIBA 4C4GA 3TIZA 2UW9A 3V5JA 4I6BA 4LGYA 5BVDA 4O4FA 3DBDA 2R3HA 3KU2A 4DHJA 4U42A 2GS6A 2J0IA 5FLFA 5FQDC 3CGOA 2VTIA 1Y8GA 1F4IA 3TTJA 1PHKA 3LPBA 3MH3A 3L1SA 3PP0A 3L28A 5FEEA 1FVVA 2BFXA 1OBDA 2UZTA 3DXNA 3DJ7A 5CXZA 4U97A 3PXYA 3W16A 5KQ8A 4E4LA 2WQMA 3Q9XA 4O4CA 1H1RA 2YAKA 4QNYA 1U54A 2LNHC 2ZB0A 2FA2A 1I94M 4H39A 1KOBA 4FL1A 2X0GA 4XGIA 5AX9A 4V0GB 4RLLA 2PTKA 1UU9A 1NY5A 1ZYCA 3R9NA 1ZYLA 3QUPA 4EWQA 2J51A 4F6SA 4DR2M 5EW8A 2VIIA 1A48A 1WAKA 2WTDA 2PYWA 5F3WA 4BR3A 3VDPA 3MN3A 5GZ9A 5EKNA 5M4IA 3AD5A 4OTRA 3HV7A 5IMXA 5DLSA 4A9SA 2PVRA 3BLRA 1PRYA 4ASDA 3RTPA 2V0DA 1STCE 3MDYA 2C68A 5B7VA 2KNAA 4LMUA 1LEZA 4CLJA 4YZ9A 4LJ4A 4O0XA 4LL0A 4LV5A 3VUHA 5IPJA 3HECA 4D4VA 2J2IB 4H1JA 2QNJA 4LF4M 3DPKA 2UU9M 1R78A 2J7TA 4W5WA 2VAGA 4IQ6A 5M06A 4O7TA 2DHRA 1PMVA 2R6FA 4RX5A 3SW7A 1JVPP 1UA2A 4ZIMA 4BBEA 5FBNC 4YHJA 1GIIA 3T9TA 5AUUA 4S33A 3CBLA 4AZTA 2QCSA 5M57A 5C27A 4LF6M 4MM3B 5HCZA 1FVTA 4CZUA 2C47A 4FTRA 5JFVA 4IJPA 3C13A 1TH2A 1VLRA 2W5AA 2R9SA 5F4NA 1H07A 4RFMA 3WE4A 4YC6A 1TQPA 1GVNA 1DI9A 3EL7A 4QTAA 3KOXE 3HKOA 3V51A 5DYJA 2VQFM 4ID7A 4QNAA 4GIPA 4AG6A 3E4RA 3AFHA 3VS5A 4AXCA 5C26A 4EH4A 3QZFA 4YZMA 3VDUA 4ZZOA 2QG7A 1H4LA 2UZUE 3OY3A 4GHAA 2YIYA 4DTBA 4D0XA 2YIWA 4FKLA 3R8VA 3BX5A 2DXIA 3ET7A 3LKMA 4AGCA 1JPAA 3PVUA 5I5ZA 2XAMA 4D1SA 3T3UA 4XLIA 4TZRA 4PNKA 3WZEA 5FTLA 4NH1A 2XCKA 3GLHE 2ZAOA 4A9UA 3DZQA 5AUVA 4GK4A 1W8CA 4BRXA 3C5IA 5GNKA 5JZJA 2PULA 4XG8A 2OQ4A 3PSBA 1YOLA 3BPRA 5ITYA 4QMTA 1FBNA 2DAIA 3M0EA 3TIYA 4F0FA 3FRHA 3L8SA 3V5TA 2ZV2A 5CAUA 1YI6A 2X2LA 3QFVA 4FTJA 2GHLA 3R02A 2C9CA 3F3TA 3PFYA 5JGAA 1KSFX 2KNVA 3GCQA 2MR9A 1KE8A 2JA2A 4FKIA 3D5UA 3GU4A 1LTMA 4Z16A 4EORA 3KF4A 1Y6BA 2G5GX 2DWLA 3HZJA 3A98B 5EP3A 5KHWA 2VNWA 3PPZA 3HY5A 4NYEA 4I81A 2HWPA 4JI7M 2A19B 4EC9A 4HOKA 2FVDA 3OS3A 1JSUA 3AKLA 3LFFA 4AACA 4S31A 2CN8A 3EQBA 1IXZA 4BCHA 1GJOA 3F3VA 4O6EA 3VN9A 3AC5A 2OFUA 4DV7M 3GCVA 3CEKA 5EOLA 4E6QA 2B53A 4JOAA 4RJ3A 2P2IA 2P33A 3WF5A 1KE6A 2C3KA 4L3JA 4EZ5A 4W4VA 2Y21A 4NL4H 1ZYJA 5HVKA 2FH9A 3ILKA 3HMPA 4QQJA 4ZSGA 4EHGA 3C4WA 5EP1A 1XXHE 5DEWA 3PJ8A 2JDTA 4IAYA 5GJGA 4P90A 4TNBA 5JI3E 2KZSA 5L2SA 3OEFX 4DHFA 1QZEA 3HHXA 1SZMA 5IZ7D 1PYXA 1MN3A 5JRSA 1JKLA 5AV1A 2UUAM 4G4OA 4DFNA 3BU5A 4LF5M 4PMTA 4KSQA 4IM3A 3D94A 5FSWA 1BL6A 5L6PA 2W1GA 5LWMA 2M5ZA 4PV0A 4TNDA 4MAOA 2JLDA 1M2RA 3R7VA 4NXNM 1H1QA 3AC3A 3NZ0A 3LZBA 2JD5A 3P1AA 4PDGA 1CTPE 3HV6A 2VU3A 3C3EA 2HY81 5LARA 2F9GA 2FNAA 1W83A 2RFEA 5J1VA 4G6NA 2YACA 1OIRA 4REZA 4UX9A 3BGZA 4L7SA 3C4ZA 1IRKA 2VNYA 4DLJA 4MYGA 4JT3A 2UUBM 5IQIA 2XM8A 3DDPA 4DHZA 3EJ1A 3IHPA 3BOSA 3BELA 4PF4A 4M0YA 5D11A 4RVTA 1Z9XA 4D4RA 3SASA 1ZARA 2DUVA 3MVMA 4Y5HA 2BIYA 2LVQD 2UUEA 2OG8A 4AS0A 2Z4SA 1CM8A 2GMXA 3QZHA 2Z3XA 1OUYA 4FV4A 3D14A 3P5JC 1WBPA 4MXOA 4LGGA 4GG7A 1W5TA 4EUUA 3HDNA 4O0RA 4G2FA 3WZJA 3JY0A 2WTCA 4Y72A 4M14A 4ANSA 4RWIA 4U80A 5C8NA 4O6LA 5IUHA 2JUJA 3AL0C 2AEGA 2DZLA 5DRBA 1JQJC 2R3RA 4D80A 2J7OA 4IZAA 3V5WA 3RK5A 2RFNA 1VEBA 2W1CA 2Z7JA 3ALNA 2GQSA 4MF0A 1CSNA 3W2QA 1VG5A 3KRRA 5AX3A 5FDPA 3V6SA 5IA0A 1DGHA 2E9VA 1IN4A 3W8LA 4Y28F 3R8LA 1U54B 3ZCBB 4AGDA 4E6DA 3OXIA 4L6V6 3POZA 1O9UA 4CZTA 5DH3A 1UNLA 3LFAA 4NSRA 2JY6B 2L09A 4EH8A 3I7BA 3LAUA 3ZSGA 3RBWA 4QP1A 4DFLA 4D4YA 3C3DA 3K3IA 5KO3A 3TNQB 4N6ZA 4AG8A 4FKRA 2Z7QA 2Z7LA 3HX3A 4C37A 5FP5A 5EYKA 4IZ7A 2HY0A 2W9FB 4IJFA 3C4CA 2OF4A 4F65A 2PL0A 5I3OA 1GLNA 3G0FA 3NWLA 5LOHA 4KWPA 3J2PB 4RIXA 5HIEA 1HT2E 4FV2A 5AP6A 5G1XA 4BVUA 2WMAA 2BTRA 4DEHA 2QI8A 5HEZA 4ACGA 4NSTA 4PMPA 4EJ7A 2VWVA 4XBRA 5DR2A 2CKPA 1FVRA 5FXRA 3BEAA 5E8ZA 3BBZA 1V92A 4I5MA 1GABA 4KSPA 1IXSB 2Y4IB 2PUPA 4F63A 5H9BA 4MTAA 3C0GA 1JOWB 4GYGA 3RHXA 3A7GA 2WHBA 1Q99A 4O0WA 3FJQE 1PJJA 3ID6C 4AXAA 1M17A 3H9OA 5C18A 3LFSA 1JSVA 3QTXA 2WMQA 1R0PA 4O27B 2C6OA 3RPVA 3LCTA 3FI2A 3H0ZA 1HQCA 3D9VA 4HYHA 3HWSA 1OMWA 3FMMA 4KINA 3QRKA 4U41A 3PIZA 3SAVA 4H36A 4Q9ZA 3BHYA 3TL8A 1LEWA 3AQVA 1IG1A 2VD5A 5DN3A 1Q3CA 1J1CA 3ZM9A 4EWHA 3MI9A 4FJVA 2R5TA 4R5SA 3TZ7A 4O7WA 4FKOA 1TQMA 3GENA 2C3IB 3FL5A 3AT3A 4H3BA 3THGA 4F0GA 4GC9A 2QG5A 3CCNA 5CANA 2PZIA 2QOIA 2XKDA 4AUAA 4TYGA 4C59A 3WARA 4QMOA 3QUEA 4FG9A 4BBFA 3IW5A 3F5PA 4NRVA 2IJMA 3OUNB 4CKIA 4FKUA 3D4QA 4A7CA 4FKPA 3SOCA 5EXPA 4NM5A 4F09A 5BMSA 4BBMA 3COKA 3TE6A 4BDEA 5EG3A 4C58A 2HZIA 1E32A 1K82A 3IW8A 3CQWA 1PXOA 2MJ5B 5M51A 1NSFA 4PPAA 2CCHA 1PXKA 4ENYA 2X8IA 1T3TA 5EDRA 3FI8A 3UVQA 4D1XA 4CQEA 3PA4A 3VHKA 3KQ7A 3W33A 1JR3A 4BLCA 5AUWA 5JRQA 2BHHA 3MIYA 3WILA 3O8TA 4C34A 3HU2A 4DEAA 1L1ZA 3EFKA 2F7EE 2ITOA 3HEGA 4KIPA 4HCTA 2WGJA 2XS0A 3C5UA 3ZBFA 3OWPA 3F61A 4FZAB 3LW0A 2C6MA 2WMTA 1DS5A 4I6FA 4DH5A 5BMMA 1KE9A 3FXWA 5E4HA 2DNAA 1E1XA 4BCQA 1W5SA 4PD2A 3ENHA 2J50A 1BI7A 2XALA 3Q96A 2WTIA 2PY3A 3IOKA 4A3VB 1OPLA 4OBOA 3DB8A 3K8ZA 5B2MA 3I04M 5A46A 4IDTA 4DF3A 2BAKA 4PP9A 1XNQM 5HCXA 4IB5A 1YVJA 3D2KA 2V1UA 2B9FA 5C1QB 1D0MA 4RIWA 4DV2M 5BYLA 3ZQJA 4FWGA 2CPKE 3G9NA 4QMLA 4KODA 5GHVA 5CI7A 3DBFA 4KS8A 1KE7A 4ZTSA 3GQIA 4W4YA 4QHTA 1WBOA 1R4GA 3NMUF 3N4VA 4FYOA 4QMXA 1VJYA 4ANRA 2IW6A 5H8BA 4JI0M 4JN6A 2AQXA 3D2IA 4MHAA 3TNWA 3Q6UA 4X0MA 2J0KA 1CKIA 4GUBA 3UIBA 3PXQA 4A9RA 4IAIA 3W2OA 2R0IA 4BTMA 2W05A 3CXWA 4ZSEA 2W17A 3ULIA 4FW9A 1TF0B 2I0YA 1R0EA 3TZ9A 4AT3A 4L3PA 3A7IA 3DA1A 2UXBM 4PTCA 3TWKA 4FUYA 3O7LD 2C0IA 3QGWA 1NVMA 3MH0A 3TKHA 3K92A 3ZO4A 4U79A 2BCJA 4D2PA 2CV1A 5T6KA 3CC6A 1M52A 1VDLA 2BMCA 4JR3A 3BCEA 1ORYB 4R5YA 4GCJA 4FV0A 3LOKA 4IMYA 3GGFA 2LVNC 1WVWA 3O96A 1CKPA 5I4NA 2BJVA 3R73A 1Q8TA 2CHLA 3RZBA 4F0IA 1BI8A 1ZMVA 3EN6A 3U6MA 3TG1A 4XRLA 3LVWA 2X0QA 3DQXA 3L29A 2XIRA 3QYWA 2WTJA 3Q9YA 4JI9A 3QXPA 2J6MA 4MQ1A 1Y6AA 3NBIA 5M44A 4FZ6A 4LGMA 3O8PA 1LV7A 1WGNA 1YKRA 5L8JA 2BFYA 1DGGA 1DGHB 2XBAA 5CT0A 2QZ4A 5H2UA 4UN2B 5KHXA 3NYNA 4WNOA 2PVMA 4FMQA 3U5ZB 4JI3M 4I21A 1UVRA 4CG8A 4M84A 5LCJA 3LVVA 4XYFA 3KXGA 3J7AS 1PYEA 1BYGA 3W2CA 3GOPA 4JQEA 1OAIA 2ITWA 1F5QA 4DG2E 4FWHA 1G3NA 3RAHA 3OBJA 3S0OA 5KQDA 4E93A 2QQ7A 3H4MA 3V76A 1TR8A 3NR9A 3NS9A 1F0QA 2O3PA 4ZMFA 2UXDM 5KMNA 2WQNA 2EB2A 4U81A 2NQ8C 3CGWA 2WNTA 3ATSA 1FNNA 5CSVA 3V6RA 4RGJA 5IMEA 3TUCA 3IECA 2J5YA 4QEBA 1Q8ZA 4KS7A 2ZM3A 3MGYA 4EK8A 4QMNA 4MXYA 3LHJA 2J4ZA 4WUAA 2WFYA 4I6LA 2ITZA 3QLGA 5L4QA 5A3XA 3U55A 1J5EM 5M08A 5KZIA 1DM2A 2BZIB 4BCNA 2BRHA 1XNRM 4ZLOA 2WSEF 4BCOA 3SDJA 2OGVA 2RG6A 1WVYA 4RPVA 5DHJA 3FKLA 1MQBA 5KPZA 4YC8A 2I0VA 3MJ1A 5HQ0A 4QQTA 5ITUA 2WO6A 4R7IA 2BRBA 2XZSA 3AOXA 4NK9A 3GLIA 1NW1A 4ZEGA 4C3FA 4CMUA 2CNUA 3K2LA 3KDSE 3U6PA 1RU3A 3PNYA 3OTUA 1W98A 4WUNA 2OXDA 3F5GA 3N4UA 3ENMA 4APPA 4MQ2A 4Y95A 5DI1A 3CF2A 3B7QA 3ZRMA 2XKCA 4O22A 2O25A 4PDSA 3D8BA 3E9SA 5JKGA 2D7GA 4NIFB 4GUEA 4UN0C 2XK6A 3F5UA 2FB8A 4PDYA 1N36M 2VTSA 3GPXA 2WTKB 3GQLA 4G3GA 3UZTA 3EQGA 2ITPA 3DBEA 1XO2B 1VDDA 2CEAA 1PKGA 2LAVA 2XGNA 1PXPA 2PU8A 3KVWA 1Z5CA 4DE4A 4NJDA 4D82A 4KBAA 4M0WA 4AFJA 4ALUA 4KIKA 3RZFA 5K3YA 2PMNX 2PZRA 5M4CA 4D55A 1ZXEA 4C8BA 4NL0A 4PL4A 2X4FA 2VX1A 4FIFA 1L3RE 5CU3A 3FD9A 2IG7A 5KZ0A 2I6LA 3H30A 2R7IA 1OKZA 3C0HA 4PTEA 4X7QA 3RKBA 3U6QA 3GRUA 5L2IA 2GHMA 4JLCA 4IX3A 2GQGA 5KKRB 4OUCA 3GC7A 4HVHA 3LFNA 5LVNA 3G6GA 2YNMD 4PTGA 3D5VA 2O64A 2X8DA 4J99A 3DTCA 2PE2A 4ACDA 4AW2A 4UMRA 3NAXA 2QKRA 3HA6A 1Y8YA 1LPUA 3WF8A 4AOIA 4FKTA 3GCSA 5IQEA 4OTDA 5ITRA 4GJ3A 2LVOC 4IANA 4D1ZA 4QMMA 4BI1A 4BBAA 1H1WA 2XK7A 3QQJA 3UPXA 3I79A 1URWA 4O0SA 3COHA 3FKEA 1KUTA 5H37D 2OXYA 4C33A 5ITQA 2E9UA 1UU8A 4QP8A 3VQHA