2R0LA

Short form hgfa with inhibitory fab75
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, immune system
molecule keywords antibody light chain
publication title Structural insight into distinct mechanisms of protease inhibition by antibodies.
pubmed doi rcsb
source organism Homo sapiens, synthetic construct
total genus 55
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r0lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r0lA01
2UUFB 4MPUA 3T2NA 2Y81A 4AYYB 5DKMA 1P2NA 5PTPA 1K1OA 1MTUA 1AMHA 3NPSA 2BDGA 3BIUH 3QGJA 1O36A 4K5ZA 1P2OA 3BV9B 4Q7ZA 1GI3A 2Z9IA 3P92A 4FU8A 3QTVH 4KP0A 1C5QA 5JYIA 3TJNA 1O33A 4Y10E 1H9LB 4XE4A 5CMXH 2WPMS 4IBLH 3FFGA 1O2ZA 5DP4A 1PPHE 3QZQA 2OTVA 3RXVA 1T8MA 1GHYH 1B0EA 1V6DA 2TRMA 3BTWE 3LGUA 4GHTA 1K21H 4FU7A 4YLQH 4DIHH 4I8GA 1D6RA 1BTXA 1MTNC 1ANBA 3RC6A 2GDDA 1QJ1B 1EJNA 1K1NA 4JCNA 2V0BA 4TY7A 5FAHA 5EXLA 2FO9A 1S82A 2CJIA 3GY8A 1ZTKA 1EZSC 2NU2E 4CRCA 2Z9JA 3A82A 3A8BA 1AU8A 3ZZ5A 1S0RA 1XVOA 4FUDA 5DGJA 1JWTA 1T31A 3P8FA 2BXTH 3V12A 4YTAA 4FUEA 2BLWA 2WUBA 1BHXB 4WH8A 4ABEA 2GCTC 1QNJA 4H42U 1OOKB 3K6YA 1YCPH 9LPRA 2CN0H 2J94A 4ZH8A 1GI9B 1FLEE 2ZA5A 1O5AB 1ZJDA 2EA3A 3M5LA 1GCDA 4GLYA 1MH0A 1ELVA 1FI8A 1V2JT 2RDLA 4B76A 2BD7A 4U2WA 2ILNA 1QL8A 5EPYA 3HGPA 1ETSH 1W8BH 5T6DA 3GCNA 2ALVA 1LHFH 2G5NA 3A7ZA 3BTGE 1JBUH 4Y11E 1GJ7B 1C2JA 3F9HA 4OS2A 2ESTE 3TH2H 3GY6A 3V7TA 1O39A 4AB8A 2R3YA 2FOEA 2PGBB 1GBFA 2BOHB 4A7IB 1BTYA 5CE1A 1C1UH 2VU8E 2FDAA 3L6PA 1K1JA 4FVBA 3ATKA 4JK5A 4VGCC 2FM2A 1TX8A 1ZMNA 1QRWA 2P3TB 1GMDF 1SOZA 1BZXE 1WU1A 5HYOA 1D3PB 2ZPRA 2C8ZB 1UK2A 2EI6A 4WF8A 1FY4A 4U01A 1KY9A 2PUXB 1O38A 2F9BH 2FX6A 2ZIQH 1IAUA 3C27B 1SGCA 4CR5A 4D7FA 4BAKB 2G5VA 3BTTE 4YOJA 2V3HH 3U8OH 1PYTD 3ATLA 2BYAX 1ETTH 3RXGA 1AN1E 2CHAB 3MH6A 1HAOH 5T6FA 3EYDA 4ZKOU 2C90B 2F3CE 2XNIA 2XW9A 2HNTE 4Y8ZA 2ZCLP 2FOFA 4TYDA 2A2XH 1VCQA 3V13A 2AYWA 2QGRA 1XUFA 1NFXA 3S7KB 1NZQH 4ZROA 3URCA 5EW2H 4B74A 2THFB 2P94A 1FAKH 1EZQA 3NZIA 1F0SA 3O8BA 5DPAA 2ALPA 1HAVB 3GOVB 1SLXB 1FN8A 2JKHA 5GCHG 3T62A 1SVPA 2BDAA 1DDJA 1O3NA 2G81E 1G37A 1TIOA 1UMAH 1LVBA 1SGDE 3BG4C 4AG1A 3DT0H 4FU9A 5C5NA 1PJPA 1TMTH 1WSSH 4WY3A 3RLWH 2VH0A 1BQYA 5FCKA 5JBBS 1C2MA 1MAYA 1O30A 3HPTB 1XXDA 1ELDE 1E36B 1FV9A 1VJAU 1O2SA 1PFXC 2AGEX 2UWLA 5F8XA 1O3JA 1AO5A 3L33A 1O2QA 5EQSA 1XKAC 3TNTA 1NRRH 1UTJA 2I6QA 3VXEH 2VGCC 1O3EA 3LT3A 2IOTA 1V2WT 1O2WA 2EEKA 3R0FA 3SV7A 1V2NT 1C1WH 1NRNH 4RN6A 5HM9A 1AY6H 1TOCB 3HK6B 1CU1A 4MNYA 2Z3EA 1GBIA 2GV7A 3CP7A 1P11E 1G3DA 5AVDA 5T6GA 1OWJA 1IHSH 1NT1A 1IOEA 1G2MA 1G9IE 1XUKA 8GCHG 1BJVA 3WY8A 1CGJE 1WCZA 3OY5U 3SNCA 1C2LA 1CHGA 1SFQB 3M61U 1FQ3A 1Q2WA 4D76A 3AASA 1MZDA 3E1XB 3MI4A 2ZC9H 2GCTB 1O5BB 3P95A 3DA9B 1O3AA 1CQQA 2GKVE 1VZQH 1C4U2 1NS3A 1C2IA 1ZOMA 1YPKH 1TOMH 2EC9H 5LPEA 2IJOB 2HVXA 2LPRA 2NU3E 1MD7A 2ZFSA 1Q3XA 2XWBI 1C1OA 3A85A 1IQMA 1FUJA 1UVSH 4XBBA 2OC7A 2FYRA 1XUIA 2A32A 3LC5A 3STJA 4K1EA 1P04A 1QY6A 1C9PA 1BRBE 3ZZAA 2O9QA 2HALA 3Q76A 4ZHMU 2FP7B 1IQGA 1VJ9U 3GCTF 3UIRA 2ZGBH 1QB9A 3SV6A 5F6MA 4NG9H 4AORA 1SLWB 1AE8H 4Y7AA 1G3CA 1DWEH 1MKWH 3S9BA 1SOTA 1EXFA 3JZ2B 4K8BA 5FPYA 1OX1A 3RU4D 1SB1H 1E37B 3UPEA 1QHRB 5GWZA 4VGCB 4KKDA 4DT7B 3FZZA 4B2AA 2J2UA 3ELAH 1TBQH 3SV2H 2ZZUH 3P8GA 4XFQA 1BTPA 2CF8H 3RXBA 1F0TA 3RXAA 2Z9GA 2BB4A 1BMLA 1GJBB 5A8XA 5JBCS 1L2EA 3TJVA 1D4PB 2ZFFH 1LVYA 2GP9B 3LGTA 3ATMA 1BMNH 3MU0A 5JBTA 2A4GA 2Z9LA 3L3TA 1YKTA 3VEQB 1GI2A 1LHDH 1PPGE 3QO6A 3LDXH 1GG6C 3ZVGA 3A8CA 1C1SA 3IWMA 3K6ZA 4NIXA 5TJXA 3P8OA 2G51A 1QR3E 1QBNA 2SNWA 3FP8E 3ZZBA 2FI3E 3VFEA 1QCPA 3T25A 4B2CA 2ZP0H 2QIQA 2RA0A 4NFEA 2R2MB 1K1PA 1LHGH 3QK1A 2H5CA 1F0RA 1UVUH 5FPTA 3ZV9A 5DP3A 5A8YA 4LK4A 5FPSA 4JYTA 4THNH 7KMEH 1A1RA 1TNHA 1CSOE 1HLTH 1DWBH 4MPWA 4X2YA 1PPEE 2CF9H 2HNTC 2ZGCA 3BG4B 4XBCA 4FUBA 2G8TA 4AFSA 5EG4A 3NKKA 1EAXA 3VB7A 1G2LA 2ANYA 4FVDA 3EA7A 4X8UH 5I25A 2P8OC 1JXPA 5IDKA 1HB0B 2A5KA 1AFEH 1K22H 1SI5H 2GMTC 1QL9A 2VGCB 1Z1JA 2AH4X 5A0CA 1WOFA 1GGDC 1TGCA 2HLCA 1EJMA 1HXEH 3RLYH 1TNJA 2B0FA 1A2CH 2P16A 4F49A 4FUIA 1HFDA 3F9FA 4X8TH 1QA0A 1RFNA 1FONA 1KXCA 1CBWC 3S9AA 1O2XA 2WYJA 3KNXA 1NFUA 3KQCA 1K1IA 1THSH 2VIQA 2W5EA 3RMMH 1GJDB 4X6NA 2ZTZA 3PROA 5I46H 1S6HA 1YGCH 4X2WA 4GHQA 3RMOH 3ATIA 5EXNA 5HGGA 3ODDA 1N1LA 1Y59T 5F03A 4WWYA 1BHXF 1GHVH 3GCHC 1SGIB 4INHA 2Y7ZA 2OINA 3A87A 1YPJH 3M36A 1PPZA 2ZDLA 1QURH 3VB6A 5LPRA 3FP6E 1A7SA 3CS7A 3D62A 1HJAC 4GCHF 3SJKA 1P0SH 1QJ7B 3PYHA 1MTWA 4GUXA 1NC6A 2FMJA 2GDEH 2HPQH 1O5FH 1EAIA 2WV4A 1LTOA 1A5HA 5T3HA 2OUAA 3KQEA 2FYQA 1GMHF 3A89A 1QB1A 1EB1H 1HUTH 1NN6A 1T7CA 1ELAA 2FESH 3NWUA 2ZF0H 2VH6A 3A84A 1AWFH 3LOXA 2ZFQH 3BIVH 5DP6A 2ANMH 2OD3B 2ZDKA 3MHWU 1BOQA 5EW1H 4HTCH 4DURA 5FCRA 2R0LA 1OPHB 5GXPA 2XBVA 3TGJE 3TNSA 3QUMP 4X2XA 3BTDE 1Y8TA 1QB6A 1P3EA 1C1QA 4AN7A 2R9PA 1O0DH 3S69A 1O32A 3RXQA 3GICB 3UFAA 1ANDA 1UJ1A 3GY5A 3MU8A 1PYTC 4GPGA 3S7HB 1LPZB 1W10U 1GG6B 3SNDA 2WPHS 1P09A 1CA0C 5ESTE 4RKOB 4TWYA 4ISOA 4IW4E 1MCVA 4CBOA 1OS8A 3T27A 1HNEE 3E91A 1Z7KA 5L2ZH 4CH8B 2XWAA 1ZYOA 1MMJN 3BTHE 1EZUC 4XSKU 2ZU5A 1DANH 1A0JA 1KLIH 1GBLA 1EP6A 4AOQA 1DXWA 2A0QB 2ZHQH 1EPTB 4HFPB 2J38A 1VITG 3OX7U 3VGCC 1TPOA 3EA9A 3RXTA 3SUGA 1L4ZA 4ISHH 1THRH 3NXPA 4MQAA 5EQQA 3RXLA 3S0NA 4X8SH 3SGQE 3MU5A 2Z6BD 2P8OB 1ACBE 3SQHE 2AGIX 5EGMA 4Q7XA 1FY1A 3FP7E 5FX6A 4DGJA 1SGFG 2GMTB 1ZHMA 2PR3A 3M5OA 1G3BA 1GBHA 1KXAA 1EUFA 1UK4A 1O37A 1EX3A 5IYTA 1GGDB 4INLA 2VJ1A 3ZZ4A 1ID5H 3MNXA 2GTBA 2EI7A 5HXFA 2VVVA 1Y3UA 1T4UH 2AS9A 1ANEA 3RP2A 2DE9A 1P03A 4IMQA 1OKXA 3AW0A 1KYNA 3LH1A 5BPEA 1MKXK 2PTCE 1Z8IB 2B7DH 1O3HA 2ZFTA 1EOLA 4UEHH 3TK6A 1DM4B 3RXSA 1DWDH 1DY9A 1THPB 1AKSB 3A7WA 1B5GH 1SGPE 1U6QA 1ZMLA 3GY7A 3GCHB 2BLVA 4JZDH 3A81A 3SJ8A 2SGFE 3UWJH 2BXUH 1KDQA 3MH5A 1Z8JB 4X1SU 2GCHF 2V3OH 3VPKA 1YPHC 1DE7H 5F8TA 1MTVA 4MNVA 4Z6AH 2KAIA 1HJAB 1RJXB 5DK1A 1UTLM 4E06H 3LGIA 1S85A 4H6SB 3EE0B 3ITIA 1TABE 1NRQH 2IN2A 4WMEA 2BY6X 3MH7A 1JRSA 2QYIA 1DLEA 1CO7E 2STBE 1G32B 2WUCA 3O8CA 1FXYA 2BX3A 2Z3DA 2ULLA 2D8WA 5C1YA 4O3TA 1SC8U 2FOBA 4E05H 2A45B 1HXFH 4D7GA 3E16B 1LQEA 2ZFRH 3AAVA 4GSOA 1DSTA 3MO6A 2GZ8A 2ZG0H 1GMCF 3U8RH 2FZZA 3RXEA 1K2I1 3UOUA 2ANWA 3ZZCA 1D3QB 2QA9E 3ZVCA 1F5LA 1FIZA 3SUEA 1GBTA 1XUHA 1XXFA 3E6PH 1P10A 3UNQA 4O9VA 1T8OA 1FMGA 1O3CA 1YPEH 1SLUB 1MBQA 5LH8A 4Y8YA 1O2YA 1SGRE 2RA3A 1GHAF 5CHAC 2OC8A 2PKAA 2G00A 1V2ST 1O3IA 2FS9A 2ASUB 3LGVA 2BHGA 3SU6A 2Y82A 4FXGH 1GMDG 3OYPA 2JETC 4I31A 1TPPA 1D3TB 4KGAA 4KTUA 3SU5A 1TPSA 3BEFB 3TGKE 1L1JA 3RXRA 1H1BA 1ABIH 1T32A 3P17H 2Z3CA 1ZMJA 4DVAU 1O3KA 1C5UA 3R3GB 2ZU1A 3SV9A 3O8DA 4Y0YE 3TK9A 4Y6DA 5C67A 2W3KA 4OS7A 4QT8C 1GBJA 2BDYA 4Y71A 4A1TA 1O5EH 2H9EH 1GI4A 1ELGA 2D2DA 1SPJA 2ZKSA 1UCYH 3T5FH 4BOHA 3A7TA 2ZU3A 1AZ8A 3KCGH 1AZZA 4ZAEA 4IN2A 1CHOF 4Y76A 3ZYEA 2A7JA 2QF3A 3ZVBA 3EA8A 2BQWB 3MWIU 4IN1A 4JMYA 4CHAC 2B5TB 1J17T 1K9OE 4CRAA 3A7YA 4XBDA 3M3TA 2Q6DA 4ISNA 1OP0A 7GCHF 3E8LA 3SOSA 2VNTA 4D9RA 3SHAH 1AVGH 1GI0A 2PKSC 2H1UA 2OLGA 1O2MA 1O2KA 1XKBC 2FS8A 5DP8A 1TMUH 3UR9A 3CENA 1HCGA 1CE5A 1UHBA 1OYQA 1DSUA 1BRCE 2ODQA 5EXMA 2R0KA 3SGBE 3RXPA 4ZXXH 4AGKA 4ABJA 1CGIE 3AW1A 3FAOA 8ESTE 2ZHWH 1MD8A 3RXCA 3OU0A 1V2RT 1NY22 1O2LA 2H6MA 2XCNA 2ZDNA 3LONA 1F0UA 1AVWA 1DUEA 2PLXA 2F9VA 1HAXB 5F8ZA 1MAXA 3M35A 3ZZDA 2P3FH 1DITH 2OBOA 1EATA 4ABFA 4ZKRU 1W7GH 5BRRE 3VB5A 2GZ9A 4BTUB 2W26A 2G55A 4UFFH 1YF4A 1ELBA 1MTNB 5B6OA 1C1PA 4Q80A 5TCCA 3RXJA 2KAIB 1CA8B 4AYVB 5J4SA 2DE8A 2CGAA 4B75A 1TALA 2F9UA 1GCTC 3M7UA 2FX4A 1RIWC 3GCOA 1TNLA 3W94A 4ZUHA 4AB9A 5EOKA 3ATWA 1DOJA 2BZ6H 5FBEA 2O8UA 2DUCA 4AG2A 1C2GA 1FY3A 3PB1E 3GCTG 1VCWA 2WPJS 4ISIH 1DPOA 1NM6A 4Y79A 5AFZH 4BXSA 1DICA 4NWKA 1Y3WA 1TGSZ 1BBRH 1P3CA 1FZZA 3P8NA 1KTSB 1PPBH 4BXWA 5CHAB 3U69H 3DFJA 3KEEA 2ZPQA 1NU7B 1XUGA 4I8LA 1AUTC 1SG8B 3SU3A 1DVAH 4J2YB 4ZHAA 2JETB 2ZWLH 2Y5HA 1VITH 2AFQB 3PMJA 2GD4B 1A4WH 2ZI2H 4X6MA 1UTQA 3SNEA 1Y5UT 2TPIZ 1V2PT 4MPVA 1S81A 3Q00A 4K8YA 1LPKB 4ZMAH 3A80A 1FNIA 1GBCA 2TGPZ 4ZHLU 1J14A 4OS5A 1RRKA 4I33A 2HNTF 5E0JA 3TVJB 3SNAA 2Z9KA 1BITA 1EAUA 5GPIB 3LU9B 1EOJA 2QF0A 4FUJA 4A6LA 1GHWH 1EQ9A 1S6FA 2XYAA 1V2KT 2BM2A 1Z6JH 3MOCA 1SGQE 4NSVA 1GHXH 2ANKH 1JMOH 1W12U 2J9NA 2P95A 1MU8B 3CS0A 2Q6GA 2AIQA 2IPHA 5ETXA 3GISB 1XX9A 1Z6EA 1V2VT 4ZXYH 5JB8S 1Y3YA 1TNGA 3RXUA 1D6WA 1GHBF 1GJ9B 1ETRH 4LZ1H 1TNKA 1WV7H 1N6XA 4NA9H 3QX5H 3E90B 5HM2A 3SJ9A 2PKSB 1L1GA 2JH0D 1W11U 3GYMA 1P02A 1WUNH 1SMFE 1O3GA 3U1JB 1XMNB 4ABHA 2NU0E 3HKJB 3PLPA 2ZTYA 5GIBA 3M7QA 4Q2KA 3ZVFA 1QRZA 1G36A 2ZHEH 1HAYB 1GI5A 3LJOA 3ZZ3A 2XTTB 3O8RA 1YCPM 3SU4A 1YBWA 1F7ZA 2FOMB 1P2MA 2VWNA 4NFFA 5DP9A 1GBDA 2OBQA 3D49H 4BNRA 1TPAE 3KN2A 1P2IA 4UDWH 3ZVDA 3UTUH 3MTYA 1W3CA 3PM3A 1LHCH 1O31A 3ESTA 4AFQA 3UQVA 1NRSH 4RSPA 1DY8A 8KME2 3OSYA 4DCDA 1H9IE 1MTSA 1BMMH 1BTWA 1NRPH 1S5SA 4OS6A 1TQ0B 2BLQA 3M5NA 3GY4A 3B23B 4RKJB 3BF6H 4JYVH 4TY6A 1P9UA 1HGTH 3V0XA 2BVXH 1UTNA 2FXRA 1OXGA 4DW2U 1JIRA 2A4QA 1YCPK 4DIIH 1ZPZA 4A1XA 4A1VA 5A0BA 1GL1A 3M3SA 7ESTE 1GCTB 1P01A 1SFIA 6GCHF 1RIWB 4MVNA 3M7TA 1GVZA 1YPHE 1AHTH 1AUJA 2FODA 1GJ5H 4GCHG 2VIVA 3SU2A 2AMQA 1TX7A 1OP2A 2OQ5A 1A5GH 2A31A 2WV5A 4SGAE 1J15A 3UY9A 3A7VA 3ZZ9A 1O3FA 2EI8A 3I29A 4WMFA 1GVLA 3RC4A 1GDQA 2ZO3H 4DG4A 1N6YA 1VCPA 2UUYA 2VVUA 2W7UA 2FIRH 4JZFH 1BBRE 2PV9B 5L2YH 1LVMA 1F2SE 1C1MA 2J92A 1BTHH 1KTTB 3UUZA 6CHAC 1GI6A 2HWLB 3RU4E 2XRCA 1W14U 4CRDA 5A09A 2NWNA 1C5PA 3PWBA 1CGHA 1O2PA 4Z0KA 3HATH 1HAPH 1GJ8B 1ZPCA 1A46H 2UWPA 4GAWA 4NZQA 1SBWA 1C2EA 2P93A 5AF9H 1IQEA 3PO1C 1MQ5A 2K1QA 1O2GH 4NIWA 3SJOA 1LVOA 1S84A 3SU0A 3SV8A 1C5SA 4LZ4B 1O2VA 1KXBA 1HAHH 4O97A 5GJ4B 1MZAA 5EPNA 1OP8A 5E2PA 2QY0B 3LH3A 2SGDE 2NU4E 1W0YH 5SGAE 2BD5A 4TPIZ 5FBIA 1DLKB 1C2FA 2RCEA 3RM0H 1ZHPA 4B1TA 2Z94A 3BSQA 2F83A 4K1SA 1IQNA 2HRVA 4MG3A 1C5YB 4CRFA 3MO9A 4YO9A 2ZGHA 1QJ6B 3SQEE 4DY7B 2F9NA 1K28D 1GBKA 4K69A 1HPGA 3QDZB 1O3MA 3TIUA 2BD9A 1XVMA 1JRTA 2ZHDA 1HAZB 1G3EA 2VB0A 1RS0A 1INCA 2FLRH 1GL0E 1A3EH 5J4QA 3PV4A 1P12E 2TBSA 2ZCHP 5GDSH 3D23A 3MH4A 3U98H 2BY9X 1FAXA 4X1QU 3RXKA 2ZDMA 1ESBA 1UTPA 3I77A 3ODFA 4YZUA 5C1UA 3RXFA 1LDTT 1MU6B 1B0FA 1O2IA 1OWDA 4HGCA 3UNRA 2BY8X 1GDUA 1TX6A 1S0QA 1C1NA 4MNXA 4IMZA 3TH4H 2CXVA 1ZLRA 1ZSKA 1EP5A 4WVPE 1T8NA 4WXIA 2W7SA 4ABIA 3HGNA 1QFKH 1NFYA 3SORA 3T28A 4TPYA 1C5MD 3I78A 3H7TA 1W7XH 2O8WA 2VIWA 1ZRKA 2UUKB 1C2HA 1H9HE 1DWCH 2HGTH 1UVPA 2Y5GA 1C5OH 3ZV8A 2XC0A 1KLTA 4JZEH 1J8AA 3RM2H 1GHZA 4ABGA 4F4OC 3M37A 3LJJA 1BUIA 1W0ZU 1E0FD 2BD3A 4NIYA 1L4DA 4AFZA 5EU8A 2STAE 4NSYA 1A61H 2ZDAH 3DD2H 4AFUA 1IQLA 5A0AE 1AI8H 5JBAS 2P3UB 2BVRH 4NZLA 1SLVB 4WJG2 1Y5AT 2FPZA 1LHEH 3U9AH 2C8YB 2BMGB 2BDBA 2GCHG 2P59A 4YT6H 2C4FH 1CBWB 2WPLS 3LPRA 3RXHA 1KLJH 1IHTH 4B73A 2ZTXA 3T29A 2GGVB 1NFWA 3F68H 2JH6D 4JYUH 3UREA 3BEIB 4MTBA 1HAVA 1Y3VA 2TGAA 2Y6TA 1O2HA 1TGTA 3SI3H 3ZZ6A 1YPLH 1UO6A 3TH3H 1FDPA 2SGEE 4LOYH 1ZR0A 1AWHB 1GI1A 1O2JA 1P2QA 3LGYA 2ODPA 2O8TA 4CR9A 2VIOA 4KTSA 3PMBB 4XOJA 2OC1A 1GBMA 1MKWK 4R8TB 3QN7A 2VWMA 1QBOA 6CHAB 1ZTLA 1YPGH 3B8JA 3LIWA 3NUMA 2PFEA 4WXVA 1TRNA 2C93B 2XC5A 4K1TA 2RG3A 4ESTE 1GMCG 2BD8A 3VB3A 3ZVEA 3GDSA 2ZDVH 2O8MA 3EDXB 3PO1B 2OQUA 4D9QA 1CT2E 4X1RU 4BAHB 3MNBA 1LKAA 4X8VH 4NIVA 2XBXA 1C5ZB 4M7GA 3MMGA 1AB9C 1YPMH 1TNIA 2F9OA 1GHAG 1SGFA 3PTNA 1P05A 1BRAA 3A86A 1V2QT 1Z8GA 1OWEA 1GI8B 1QQUA 1O3BA 1GI7B 5DP7A 3DHKH 5K0HA 4I8JA 2QN5T 2OCVB 4K60A 3BTQE 1ELCA 2AEIH 4CRGA 1ARBA 3E0PB 1Z1IA 2G4UA 2A2QH 1CA0B 1L1NA 4I8HA 1IQFA 4UE7H 1GJCB 2ZEBA 1N8OC 1MQ6A 2BQ6B 2A7CA 3KL6A 3GY2A 4ABAA 2GT8A 1YLCA 4IS5A 2WYGA 4ISLA 2BZAA 1MCTA 1C4Y2 5AHGH 3SBKA 1DT2A 3P6ZB 2D1JA 1NPMA 3BN9A 1RGQA 1SGYE 4YT7H 1CHOG 3IITA 1A3BH 3TU7H 3N7OA 4BAQB 3VGCB 3BTEE 1YC0A 1C5VA 1PPFE 1O2TA 3A7XA 2Z7FE 4ZKSU 1NO9H 1HV7A 1W13U 4OS1A 1K1MA 4A5TS 3FANA 3E0NB 2W3IA 1KSNA 2G4TA 2BTCE 7GCHG 3UQOA 6ESTA 4MPXA 2CV3A 4AX9H 5TCAA 1SL3A 1F5KU 1AQ7A 1FY5A 1P2KA 2ZFPH 1RTKA 2B9LA 2XC4A 2ZECA 1EAWA 1CT4E 1EJAA 4JZIA 3A83A 1HIAA 4X0WU 4BAMB 1UK3A 1LO6A 1NU9A 2TGDA 2FI4E 4B2BA 1BTZA 3AAUA 3TK5A 2BOKA 4BTIB 1WQSA 1L0ZA 3T26A 3TPIZ 1FY8E 5E0GA 4BTTB 4OGXA 3MU1A 1O5DH 1AGJA 2QV1A 2SGAA 2AMDA 3GYLB 1WQVH 1VGCC 3EQ0H 4LXBH 4XDEA 2CMYA 3RC5A 4J1YA 4K3JA 2SNVA 1RTLA 1O5GH 2UUJB 4TWWA 5DG6A 2HPPH 1SHHB 1UTKA 2FEQH 1QA7A 5A8ZA 2XCFA 1UVTH 3ZZ8A 1O35A 1J16A 1PQ8A 4Y7BA 1X7AC 1IQKA 4I32A 1BIOA 3PTBA 1JOUB 1C5RA 2C8WB 4OS4A 3SW2B 2WINI 1ZGIA 3NCLA 1EKBB 1OWKA 4FUCA 3ENSB 2GZ7A 3SGAE 1TGNA 1BCUH 4X1PU 2H2ZA 3FZDA 1AE5A 1KDQB 3UR6A 4D8NA 3F6UH 1V2MT 2QXHA 4UD9H 3KIDU 4R0IA 4YESB 4H6TA 4CRBA 2BY7X 1ESAA 1AD8H 9ESTA 1QBVH 1AIXH 1EZXC 1AB9B 3U1IB 3QZRA 7LPRA 3UOPA 4YLUA 5GCHF 1Y3XA 1E34B 2Q6FA 1SGNE 1ZTJA 1F5RA 1OWIA 2UWOA 1ZJKA 5C3NA 1V2OT 1A5IA 1J9CH 1YP9A 3MFJA 1ZSJA 2PHBA 3SUDA 2PWXA 4PROA 1C5TA 1NROH 1FPHH 3OY6U 1HJ8A 1O3PB 4CREA 1FPCH 2NU1E 5H4IB 1UTMA 3M3VA 2J95A 2TGTA 1TONA 4FUHA 1BDAA 1LPGB 4Y0ZE 1T8LA 3QTOH 3TGIE 2GX4A 3DUXH 1N8OB 3SO3A 2XBYA 2H9TH 4ZKNU 1NTPA 3RXOA 1ZPBA 3BG8A 3RDZA 1PQ5A 1P57B 4O3UA 4X1NU 4A92A 1C4V2 3LKWA 3LC3A 1TBZH 1Z71A 4X2VA 2V35A 2BVSH 3SI4H 2ZNKH 3VB4A 1DXPA 8GCHF 4AZ2B 2PKAB 1MKXH 1HBTH 1RXPA 3PMAB 1XM1A 1C9TA 2HOBA 1YYY1 2ZQ1A 1GWAA 1LMWB 4U30A 2D26C 1TAWA 1KXEA 4KELA 1D9IA 1GHBG 5ESBA 3STIA 3TITA 2VIPA 2LNCA 2R3UA 3U8TH 1UCYE 2ZU4A 1PPCE 3AVZA 2QAAA 2BLOA 2AMPA 2GV6A 2PW8H 4INKA 3RU4T 1VR1H 2A4OA 5EODA 1AFQC 4O03A 3V3MA 3GDUA 3BTKE 1BA8B 3RXMA 2A5IA 1RTFB 4CHAB 3F9EA 1BT7A 1P2JA 2O8LA 1HRTH 1TRYA 1TA6A 2FTLE 2SFAA 4MLFB 1WTGH 2FWWA 3H5CB 4JK6A 3PMHB 1HAIH 1LCYA 3EAJA 2SGQE 1ARCA 1HIAB 1C2DA 4WMDA 1PQAA 3SZNA 1TE0A 3OTJE 2VINA 2BDHA 3B9FH 3H7OA 2QXGA 1SHYA 1VGCB 1Z8RA 2PTNA 8LPRA 3NK8A 1OSSA 2AERH 2BX4A 1HYLA 2AIPA 3RUOA 5JPMH 1FJSA 1QGFA 4BAOB 1KIGH 4X6PA 4U32A 2WPKS 1SGEE 1DX5M 1ZSLA 1DS2E 1B7XB 2QCYA 1IQHA 3G01A 2C8XB 1EPTA 5L30H 1FN6A 1CT0E 4E7NA 1QQ4A 3FVFB 4CBNA 2BY5X 2A4RA 2PSXA 1SR5C 1TWXB 5DP5A 1KXDA 3URDA 1H8DH 1ORFA 3GY3A 1UHBB 2A7HA 3E3TA 6GCHG 3VXFH 3QLPH 2FOHA 1MBMA 5DJ7A 5C1XA 1EPTC 4SGBE 3SNBA 1HJ9A 3MU4A 4DOQA 1BMAA 1TLDA 3K9XB 2VIDA 1GJ6A 3SHCH 1SQAA 1V2UT 1GBAA 1C5WB 4ABBA 2QXIA 2XXLA 3ZVAA 1DUAA 2PSYA 1D3DB 2OP9A 3BTME 2F9PA 3Q3YA 2Y7XA 2Y80A 1C1RA 2FLBH 2C3SA 2ZU2A 1H8IH 1QRXA 5DO4H 1SSXA 4MNWA 4ABDA 1TBRH 1FIWA 3PLKA 4NCYA 3EGKH 4E7RG 1GBBA 1WBGB 2XBWA 4IC6A 4B71A 4NGAH 1O2OA 3RXIA 4CH2B 5K7RA 2FOAA 4IC5A 1ELFA 3MNSA 1ZGVA 2H5DA 4H4FA 2BD2A 5HMAA 4HI3A 1AKSA 3M5MA 5ABWA 1MUEB 2V6NA 4BANB 1TGBA 1GMHG 4IGDA 4NWLA 3MNCA 2PGQB 2YOLA 2ZQ2A 3DFLA 3HKIB 1QL7A 5FHTA 4I7YH 3C1KA 5FX5A 1ZZZA 1C5NH 4NA8A 4X6OA 1WYKA 4Y8XA 1GVKB 3TLOA 1H4WA 4FUFA 6LPRA 4FUGA 2ODYB 1TB6H 1C1TA 1E35B 3SJIA 1XUJA 2PUQH 1PQ7A 1SQOA 1TYNA 4YOIA 2VWLA 1IQJA 1EASA 3K65B 1HDTH 1UCYK 5E2OA 5JB9S 1E38B 3KGPA 4UFEH 3PLBA 4DJZB 5C20A 2R2WU 1ESTA 1T4VH 2FTMA 3D65E 1V3XA 4GVUA 2TIOA 5G4BA 1ELTA 1O3OA 4I8KA 4WH6A 3JZ1B 2Y5FA 2QXJA 1SGTA 1TFXA 1OYTH 1ZHRA 3MO3A 3UNSA 2GVFA 3IG6B 1G30B 1P8VC 1JIMA 2OXSA 1P9SA 4UONA 1O3LA 1WTHD 1AFQB 1BB0B 2FOCA 1BJUA 3HK3B 1TMBH 1C2KA 2BDIA 3SN8A 5LPFA 1OWHA 2H9HA 1C5XB 2ZGJA 5A2MH 1SQTA 1GJ4H 5FXLA 4YM9A 2BQ7B 2ZCKP 2GT7A 5C2ZA 3TJOA 1O2NA 1O34A 1KXFA 1GPZA 2JH5D 2M5TA 4OGYA 1UVOA 2BDCA 1C5LH 5JDUB 3KF2A 1RD3B 1O5CB 2VVCA 3MYWA 3W95A 4KTCA 3F1SB 1EB2A 1BTUA 2Q1JA 4K2YA 3UWIA 1ANCA 2SGPE 1M9UA 1LQDB 2G52A 2A5AA 1ABJH 3K2UA 3A8DA 1Y5BT 1DFPA 1ZRBA 1W2KH 1O3DA 2YNAA 1O2RA 3RMNH 1QTFA 2OC0A 1GBEA 2QC2A 1V2TT 4AGJA 3QGNB 1YLDA 1QIXB 2J34A 1HAGE 3BTFE 2AGGX 5L6NH 3S9CA 4JZ1A 1NESE 1V2LT 3ZYDA 3KQDA 3A88A 1Q31A 3Q77A 1F92A 1TQ7B 1CVWH 1A0HB 5C5OA 2I6SA 5LGOA 2B8OH 2BD4A 3SUFA 3GDVA 4HZHA 5E0HA 1YM0A 1C1VH 1TRMA 3LGWA 1IQIA 1S83A 4YOGA 3PWCA 1ELEE 2YNBA 3A8AA 3P70B 2WPIS 4MDSA 1A0LA 3Q3KA 3SU1A 3KQBA 1BBRK 2FOGA 2FI5E 2A1DB 2ZGXH 4Q7YA 3ZZ7A 1O2UA 1AVXA 1VITF 3RXDA 3Q3XA 3QWCH 1BRUP 1GJAB 1TA2A 3F9GA 4UFGH 5EQRA 1LKBA 3KHVA 1WAYB 3BEUA 2F91A 2VWOA 4NA7A 2ZHFH 4UFDH 5AFYH 1UTOA 5E8EH 2CHAC 1P06A 3TJUA 2J4IA 4ASHA 1GDNA 1K1LA 2ZPSA 3RMLH
chains in the Genus database with same CATH superfamily
4TT3D 2UUFB 4MPUA 3T2NA 2Y81A 2RFKC 4AYYB 5DKMA 1P2NA 5PTPA 1K1OA 1MTUA 1AMHA 3NPSA 2BDGA 3BIUH 3QGJA 3F3BA 1O36A 4K5ZA 1P2OA 3BV9B 4Q7ZA 1GI3A 2Z9IA 3P92A 4FU8A 3QTVH 4KP0A 1C5QA 5JYIA 3TJNA 1O33A 4Y10E 1H9LB 4XE4A 5CMXH 2LELA 2WPMS 4IBLH 3FFGA 1O2ZA 5DP4A 1PPHE 3QZQA 2OTVA 3RXVA 1T8MA 1GHYH 1B0EA 1V6DA 2TRMA 3BTWE 3LGUA 4GHTA 1K21H 4FU7A 4YLQH 3N99A 4DIHH 4I8GA 1D6RA 4ZCNA 1BTXA 1MTNC 1ANBA 2WHXA 3RC6A 2GDDA 1QJ1B 1EJNA 4RT1A 1K1NA 4JCNA 2L6OA 2V0BA 4TY7A 5FAHA 5EXLA 2FO9A 1S82A 2CJIA 3GY8A 1ZTKA 1EZSC 2NU2E 4CRCA 2Z9JA 3A82A 3A8BA 1AU8A 3ZZ5A 1S0RA 1XVOA 4FUDA 5DGJA 1JWTA 1T31A 3P8FA 2BXTH 3V12A 4YTAA 4FUEA 2BLWA 2WUBA 1BHXB 4WH8A 4ABEA 2GCTC 1QNJA 4H42U 1OOKB 3K6YA 1YCPH 9LPRA 2CN0H 2J94A 4ZH8A 1GI9B 1FLEE 2ZA5A 1O5AB 1ZJDA 2EA3A 3M5LA 1GCDA 4GLYA 1MH0A 1ELVA 1FI8A 2XOKD 1V2JT 2YMSB 2RDLA 4B76A 2BD7A 4U2WA 4I86A 2ILNA 1QL8A 5EPYA 3HGPA 1ETSH 1W8BH 5T6DA 3GCNA 2ALVA 1LHFH 2G5NA 3A7ZA 3BTGE 1JBUH 4Y11E 1GJ7B 1C2JA 3F9HA 4OS2A 4P02A 2ESTE 3TH2H 3GY6A 3V7TA 1O39A 4AB8A 2R3YA 2EY4C 2FOEA 2BOHB 1GBFA 2PGBB 4A7IB 1BTYA 5CE1A 1C1UH 2VU8E 2FDAA 3L6PA 1K1JA 1YWUA 3ATKA 4FVBA 4JK5A 4VGCC 2FM2A 4B6FA 1TX8A 1ZMNA 1QRWA 2P3TB 1GMDF 1SOZA 1BZXE 1WU1A 5HYOA 1D3PB 2ZPRA 2C8ZB 1UK2A 2EI6A 4WF8A 1FY4A 4U01A 1KY9A 2PUXB 1O38A 2F9BH 2FX6A 2ZIQH 1IAUA 3C27B 1SGCA 4CR5A 4D7FA 4F48B 4BAKB 2G5VA 3BTTE 4YOJA 2V3HH 3U8OH 1PYTD 3ATLA 2BYAX 1ETTH 3RXGA 1AN1E 2CHAB 3MH6A 1HAOH 5T6FA 3EYDA 1K0HA 4ZKOU 2C90B 2F3CE 2XNIA 2XW9A 2HNTE 4Y8ZA 4FOUC 2ZCLP 2FOFA 4TYDA 2A2XH 1VCQA 3V13A 2AYWA 2QGRA 1XUFA 1NFXA 3S7KB 1NZQH 4ZROA 3URCA 5EW2H 4B74A 2THFB 2P94A 1FAKH 1EZQA 3NZIA 1F0SA 3O8BA 3PRBA 3PV5A 5DPAA 2ALPA 1HAVB 3GOVB 1SLXB 1FN8A 2JKHA 5GCHG 3T62A 1SVPA 2BDAA 1DDJA 5EJ1A 1O3NA 2G81E 1G37A 1TIOA 1UMAH 1LVBA 1SGDE 3BG4C 4AG1A 3DT0H 4FU9A 5C5NA 1PJPA 1TMTH 1WSSH 4WY3A 3RLWH 2VH0A 1BQYA 5FCKA 5JBBS 1C2MA 1MAYA 1O30A 3HPTB 1XXDA 1ELDE 1E36B 1FV9A 1VJAU 1O2SA 1PFXC 2AGEX 2UWLA 5F8XA 1O3JA 1AO5A 3L33A 1O2QA 5EQSA 1XKAC 3TNTA 1NRRH 1UTJA 2I6QA 3VXEH 3WWFA 2VGCC 1O3EA 3LT3A 2IOTA 1V2WT 1O2WA 2EEKA 3R0FA 3SV7A 1V2NT 1C1WH 1NRNH 4RN6A 5HM9A 1AY6H 1TOCB 3HK6B 1CU1A 4MNYA 2Z3EA 1GBIA 2GV7A 3CP7A 1P11E 1G3DA 3F2FA 5AVDA 5T6GA 1OWJA 1IHSH 1NT1A 1IOEA 1G2MA 1G9IE 1XUKA 5C0UA 8GCHG 1BJVA 3WY8A 1CGJE 1WCZA 3OY5U 2KCPA 3SNCA 1C2LA 1CHGA 1SFQB 3M61U 1FQ3A 1Q2WA 3EE7A 5HIZA 4D76A 3AASA 1MZDA 3E1XB 1E79D 3MI4A 2ZC9H 2GCTB 1O5BB 2JIZD 3P95A 3DA9B 1O3AA 1CQQA 2GKVE 1VZQH 1C4U2 1NS3A 5EJZA 3DSPA 1C2IA 1ZOMA 1YPKH 1TOMH 2EC9H 5LPEA 2IJOB 2HVXA 2LPRA 2NU3E 1MD7A 2ZFSA 1Q3XA 2WSSD 2XWBI 1C1OA 3A85A 1IQMA 1FUJA 1UVSH 4XBBA 2OC7A 2FYRA 1XUIA 2A32A 3KYFA 3LC5A 4K1EA 1P04A 1QY6A 1C9PA 3STJA 1BRBE 3ZZAA 2O9QA 2HALA 3Q76A 4ZHMU 2FP7B 1IQGA 1VJ9U 3GCTF 3UIRA 2ZGBH 1QB9A 3SV6A 5F6MA 4NG9H 4AORA 1SLWB 1AE8H 4Y7AA 1G3CA 1DWEH 1MKWH 3S9BA 1SOTA 1EXFA 3JZ2B 4K8BA 5FPYA 1OX1A 3RU4D 1SB1H 5CHBA 1E37B 3UPEA 1QHRB 5GWZA 4VGCB 4KKDA 4DT7B 3FZZA 4B2AA 2J2UA 3ELAH 1TBQH 3F0OA 3SV2H 2ZZUH 3P8GA 4XFQA 1BTPA 2CF8H 3RXBA 1F0TA 3RXAA 1E1RD 2Z9GA 2BB4A 1BMLA 1GJBB 5A8XA 5JBCS 1L2EA 3TJVA 1D4PB 3N7EA 2ZFFH 1LVYA 2GP9B 3LGTA 3ATMA 1BMNH 3MU0A 5JBTA 2A4GA 2Z9LA 3L3TA 1YKTA 3VEQB 1GI2A 1LHDH 1PPGE 3QO6A 3LDXH 1GG6C 3ZVGA 3A8CA 1C1SA 3IWMA 3K6ZA 4NIXA 5TJXA 3P8OA 2G51A 1FX0B 1QR3E 1UW7A 1QBNA 2SNWA 3FP8E 3ZZBA 2FI3E 3VFEA 1QCPA 3T25A 4B2CA 2WV9A 2ZP0H 2QIQA 2RA0A 4NFEA 2R2MB 1K1PA 1LHGH 3QK1A 2H5CA 1F0RA 1UVUH 5FPTA 3ZV9A 5DP3A 5A8YA 4LK4A 4Q63A 5FPSA 4JYTA 4THNH 7KMEH 1A1RA 1TNHA 1CSOE 1HLTH 1DWBH 4MPWA 4X2YA 1PPEE 2CF9H 2HNTC 2ZGCA 3BG4B 4XBCA 4ACAA 4FUBA 2G8TA 4AFSA 3CNRA 5EG4A 3NKKA 1EAXA 3VB7A 1G2LA 2ANYA 4FVDA 3EA7A 4X8UH 5I25A 2P8OC 5HIYA 1JXPA 5IDKA 1HB0B 2A5KA 1AFEH 1K22H 1SI5H 2GMTC 1QL9A 2VGCB 1Z1JA 2J97A 1BMFD 2AH4X 5A0CA 1WOFA 1GGDC 1TGCA 2HLCA 1EJMA 1HXEH 3RLYH 1TNJA 4P00A 2B0FA 1A2CH 2P16A 4F49A 4FUIA 1HFDA 3F9FA 4X8TH 1QA0A 1RFNA 1FONA 1KXCA 1CBWC 3S9AA 1O2XA 2WYJA 3KNXA 1NFUA 3KQCA 1K1IA 1THSH 2VIQA 3KQ5A 2W5EA 3RMMH 1GJDB 3FOAA 4AC9A 4X6NA 3WWBA 2ZTZA 3PROA 5I46H 4TSFD 1S6HA 1YGCH 4X2WA 4GHQA 3RMOH 3ATIA 5EXNA 5HGGA 3ODDA 1N1LA 1Y59T 5F03A 2W6ID 4WWYA 1BHXF 1GHVH 3GCHC 1SGIB 4INHA 2Y7ZA 2OINA 3A87A 1YPJH 3M36A 1PPZA 3U28C 1COWD 2ZDLA 1QURH 3VB6A 5LPRA 3FP6E 1A7SA 3CS7A 3D62A 1HJAC 4GCHF 3SJKA 1P0SH 1QJ7B 3PYHA 1MTWA 4GUXA 1NC6A 2FMJA 2GDEH 2HPQH 1O5FH 1EAIA 2WV4A 1LTOA 1A5HA 5T3HA 2OUAA 3KQEA 2FYQA 1GMHF 3A89A 1QB1A 1EB1H 1HUTH 1NN6A 1T7CA 5KEDA 1ELAA 2FESH 3NWUA 1QZ8A 2ZF0H 2VH6A 3A84A 1AWFH 3LOXA 2ZFQH 3BIVH 5DP6A 2ANMH 2OD3B 2ZDKA 3MHWU 1BOQA 5EW1H 4HTCH 3GS9A 4DURA 5FCRA 2R0LA 1OPHB 5GXPA 2XBVA 3TGJE 3TNSA 3QUMP 5KGOA 4X2XA 3BTDE 1Y8TA 1QB6A 1P3EA 1C1QA 4AN7A 2R9PA 1O0DH 3S69A 1O32A 3RXQA 3GICB 3UFAA 1ANDA 1UJ1A 3GY5A 3MU8A 1PYTC 4GPGA 3S7HB 1LPZB 1W10U 1GG6B 3SNDA 2WPHS 1P09A 1CA0C 5ESTE 4RKOB 4TWYA 4ISOA 4IW4E 1MCVA 4CBOA 1OS8A 4XRNA 3T27A 1HNEE 3E91A 1Z7KA 5L2ZH 4CH8B 2XWAA 1ZYOA 1MMJN 3BTHE 1EZUC 4XSKU 2ZU5A 1DANH 1A0JA 1KLIH 1GBLA 1EP6A 4AOQA 1DXWA 2A0QB 2ZHQH 1EPTB 4HFPB 1E1QD 2J38A 1VITG 3OX7U 3VGCC 1TPOA 3EA9A 3PV2A 3RXTA 3SUGA 1L4ZA 4ISHH 1THRH 3NXPA 4MQAA 5EQQA 3RXLA 3S0NA 4X8SH 3SGQE 3MU5A 2Z6BD 2P8OB 1ACBE 3SQHE 2AGIX 5EGMA 4Q7XA 1FY1A 3FP7E 5FX6A 4DGJA 1SGFG 2GMTB 1ZHMA 2PR3A 3M5OA 1G3BA 1GBHA 1KXAA 1EUFA 1UK4A 2OK5A 1O37A 1EX3A 5IYTA 1GGDB 4INLA 2VJ1A 3ZZ4A 1H8ED 1H8HD 1ID5H 3MNXA 2GTBA 2EI7A 5HXFA 2VVVA 1Y3UA 1T4UH 2AS9A 1ANEA 3RP2A 2DE9A 1P03A 4IMQA 1OKXA 3AW0A 1KYNA 3LH1A 5BPEA 1MKXK 2PTCE 1Z8IB 2B7DH 1O3HA 2ZFTA 1EOLA 4UEHH 3TK6A 1DM4B 3RXSA 1DWDH 1DY9A 1THPB 1AKSB 3A7WA 5EJLA 1B5GH 1SGPE 1U6QA 3ZIAD 2PP6A 1ZMLA 3GY7A 3GCHB 2BLVA 4JZDH 3A81A 3SJ8A 2SGFE 3UWJH 2BXUH 1KDQA 3MH5A 1Z8JB 4X1SU 2GCHF 2V3OH 3VPKA 1YPHC 1DE7H 5F8TA 1MTVA 4MNVA 4Z6AH 2KAIA 1HJAB 1RJXB 5DK1A 1UTLM 4E06H 3LGIA 1S85A 4H6SB 3EE0B 3ITIA 1TABE 1NRQH 3OTPA 4RT0A 2IN2A 4WMEA 5F53A 2BY6X 3MH7A 1JRSA 2QYIA 1DLEA 1CO7E 2STBE 1G32B 1NBMD 2WUCA 3F0PA 3O8CA 1FXYA 2BX3A 2Z3DA 2ULLA 2D8WA 5C1YA 4O3TA 1SC8U 2FOBA 4E05H 2A45B 4B6EA 1HXFH 4D7GA 3E16B 1LQEA 2ZFRH 3AAVA 4GSOA 1DSTA 3MO6A 2GZ8A 2ZG0H 1GMCF 3U8RH 2FZZA 3RXEA 1K2I1 3UOUA 2ANWA 3ZZCA 1D3QB 2QA9E 3W1EA 3ZVCA 1F5LA 1FIZA 3SUEA 1GBTA 1XUHA 2KR7A 1XXFA 3E6PH 1P10A 3UNQA 4O9VA 1T8OA 1FMGA 1O3CA 1YPEH 1SLUB 1MBQA 5LH8A 3NRLA 4Y8YA 1O2YA 1SGRE 2RA3A 1GHAF 2L74A 5CHAC 2OC8A 2PKAA 2G00A 1V2ST 1O3IA 2FS9A 2ASUB 3LGVA 2BHGA 3SU6A 2Y82A 4FXGH 1GMDG 3OYPA 2JETC 4I31A 1TPPA 1D3TB 4KGAA 4KTUA 3SU5A 1TPSA 3BEFB 3TGKE 1L1JA 3RXRA 1H1BA 1ABIH 1T32A 3P17H 2Z3CA 1ZMJA 4DVAU 2HVYB 1O3KA 4Z1MD 1C5UA 3R3GB 2ZU1A 3SV9A 3O8DA 4Y0YE 3TK9A 4Y6DA 5CDFE 5C67A 2W3KA 4OS7A 4QT8C 1GBJA 2BDYA 4Y71A 4A1TA 1O5EH 2H9EH 1GI4A 1ELGA 2D2DA 1SPJA 2ZKSA 1UCYH 3T5FH 4BOHA 3A7TA 2ZU3A 1AZ8A 3KCGH 1AZZA 4ZAEA 4IN2A 1CHOF 4Y76A 3ZYEA 2A7JA 2QF3A 3ZVBA 3EA8A 2BQWB 3MWIU 4IN1A 4JMYA 4CHAC 3UAIC 2B5TB 1J17T 1K9OE 2V3MA 4CRAA 3A7YA 4XBDA 3M3TA 2Q6DA 4ISNA 1OP0A 7GCHF 3E8LA 3SOSA 5B6LA 2VNTA 4D9RA 3SHAH 1AVGH 1GI0A 2PKSC 2H1UA 2OLGA 1O2MA 1W0KD 1O2KA 1XKBC 2FS8A 5DP8A 1TMUH 3UR9A 3CENA 1HCGA 1CE5A 1W0JD 1UHBA 1OYQA 1DSUA 1BRCE 2ODQA 5EXMA 2R0KA 3SGBE 3RXPA 2YMSD 4ZXXH 4AGKA 4ABJA 1CGIE 2VBCA 3AW1A 3FAOA 8ESTE 2ZHWH 1MD8A 3RXCA 3OU0A 1V2RT 1NY22 1O2LA 2H6MA 2XCNA 2ZDNA 3LONA 1F0UA 1AVWA 1DUEA 2PLXA 2F9VA 1HAXB 5F8ZA 1MAXA 3M35A 3ZZDA 2P3FH 1DITH 2OBOA 1EATA 4ABFA 4ZKRU 1W7GH 5BRRE 3VB5A 2GZ9A 4BTUB 2W26A 2G55A 4UFFH 1YF4A 1ELBA 1MTNB 5B6OA 1C1PA 4Q80A 5TCCA 3SZEA 3RXJA 2KAIB 1CA8B 3SYJA 4AYVB 5J4SA 2DE8A 2CGAA 4B75A 1TALA 2F9UA 1SKYE 1GCTC 3M7UA 2FX4A 1RIWC 3GCOA 1TNLA 3W94A 4ZUHA 4AB9A 5EOKA 3ATWA 1DOJA 2K8IA 2BZ6H 5FBEA 2O8UA 2DUCA 4AG2A 1C2GA 1FY3A 3PB1E 3GCTG 1VCWA 2WPJS 4OM9A 4ISIH 1DPOA 1NM6A 4Y79A 5AFZH 4BXSA 1DICA 4NWKA 1OHHD 1Y3WA 1TGSZ 1BBRH 1P3CA 3FN8A 1FZZA 3P8NA 1KTSB 1PPBH 4BXWA 5CHAB 3U69H 3DFJA 3KEEA 2ZPQA 5HKKD 1NU7B 1XUGA 4I8LA 1AUTC 1SG8B 3SU3A 1DVAH 4J2YB 4ZHAA 2JETB 2ZWLH 3N7DA 2Y5HA 1VITH 2AFQB 3PMJA 2GD4B 1A4WH 2ZI2H 4X6MA 1UTQA 3SNEA 1Y5UT 2TPIZ 1V2PT 4MPVA 1S81A 3Q00A 4K8YA 1LPKB 4ZMAH 3A80A 1FNIA 1GBCA 2TGPZ 4ZHLU 1J14A 4OS5A 3WW7A 1RRKA 4I33A 2HNTF 5E0JA 3TVJB 3SNAA 2Z9KA 1BITA 1EAUA 5GPIB 3LU9B 1EOJA 2QF0A 4FUJA 4A6LA 1GHWH 1EQ9A 1S6FA 2XYAA 1V2KT 2BM2A 1Z6JH 2KCOA 3MOCA 1SGQE 4NSVA 1GHXH 2ANKH 1JMOH 2J98A 1W12U 2J9NA 2P95A 1MU8B 3CS0A 2Q6GA 2AIQA 2IPHA 5ETXA 3GISB 1XX9A 1Z6EA 1V2VT 4ZXYH 5JB8S 1Y3YA 1TNGA 3RXUA 1D6WA 1GHBF 1GJ9B 1ETRH 4LZ1H 1TNKA 1WV7H 1N6XA 2CK3D 4NA9H 2QF5A 3QX5H 3E90B 5HM2A 3SJ9A 1S6LA 3F2HA 2PKSB 1L1GA 2JH0D 1W11U 3GYMA 1P02A 1WUNH 1SMFE 1O3GA 3U1JB 1XMNB 3AK5A 4ABHA 2NU0E 3HKJB 3PLPA 2ZTYA 5GIBA 3M7QA 4Q2KA 3ZVFA 1QRZA 1G36A 2ZHEH 1HAYB 1GI5A 3LJOA 3ZZ3A 2XTTB 3O8RA 1YCPM 3SU4A 1YBWA 1F7ZA 2FOMB 1P2MA 2VWNA 4NFFA 5DP9A 1GBDA 4RI0A 2OBQA 3D49H 4BNRA 1TPAE 3KN2A 1P2IA 4UDWH 3ZVDA 3UTUH 3MTYA 1W3CA 3PM3A 1LHCH 1O31A 3ESTA 4AFQA 3UQVA 1NRSH 4RSPA 1DY8A 4ACBA 3OSYA 4DCDA 8KME2 1H9IE 1MTSA 1BMMH 1BTWA 1NRPH 1S5SA 4OS6A 1TQ0B 2BLQA 3M5NA 3GY4A 3B23B 4RKJB 3BF6H 2KZ4A 4JYVH 4TY6A 1P9UA 1HGTH 3V0XA 2BVXH 1UTNA 2FXRA 1OXGA 4DW2U 1JIRA 2A4QA 1YCPK 4DIIH 1ZPZA 4A1XA 4A1VA 5A0BA 1GL1A 3M3SA 7ESTE 1GCTB 1P01A 1SFIA 6GCHF 1RIWB 4MVNA 3M7TA 1GVZA 1YPHE 1AHTH 1AUJA 2FODA 1GJ5H 4GCHG 2VIVA 3SU2A 2AMQA 1TX7A 1OP2A 2OQ5A 1A5GH 2A31A 2WV5A 4SGAE 1J15A 3UY9A 3A7VA 3ZZ9A 1O3FA 2EI8A 3DSOA 3I29A 1GVLA 4WMFA 3RC4A 1GDQA 2ZO3H 4DG4A 1N6YA 1VCPA 2UUYA 2VVUA 2W7UA 2FIRH 4JZFH 1BBRE 5C94A 2PV9B 5L2YH 1LVMA 3VG8A 1F2SE 1C1MA 2J92A 1BTHH 1KTTB 3UUZA 6CHAC 1GI6A 2HWLB 3RU4E 2XRCA 1W14U 4CRDA 5A09A 2NWNA 1C5PA 3PWBA 1CGHA 1O2PA 4Z0KA 3HATH 1HAPH 1GJ8B 2AHME 1ZPCA 1A46H 2UWPA 4GAWA 4NZQA 1SBWA 1C2EA 2P93A 5AF9H 2IPQX 1IQEA 3PO1C 1MQ5A 2K1QA 1O2GH 4NIWA 3SJOA 1LVOA 1S84A 3SU0A 3SV8A 1C5SA 4LZ4B 1O2VA 1KXBA 1HAHH 4O97A 5GJ4B 1MZAA 5EPNA 1OP8A 5E2PA 2QY0B 3LH3A 2SGDE 3PRDA 2NU4E 1W0YH 5SGAE 2BD5A 3FKSD 4TPIZ 5FBIA 1DLKB 1C2FA 2RCEA 3RM0H 1ZHPA 4B1TA 2Z94A 3BSQA 2F83A 4K1SA 1IQNA 2HRVA 4MG3A 1C5YB 4CRFA 2KX4A 3MO9A 4YO9A 2ZGHA 1QJ6B 3SQEE 4DY7B 2F9NA 1K28D 1GBKA 4K69A 1HPGA 3QDZB 1O3MA 3TIUA 2BD9A 1XVMA 1JRTA 2ZHDA 1HAZB 1G3EA 2VB0A 1RS0A 1INCA 2FLRH 1GL0E 1A3EH 5J4QA 3PV4A 1P12E 2TBSA 2ZCHP 5GDSH 3D23A 3MH4A 3U98H 2BY9X 1FAXA 4X1QU 3RXKA 2ZDMA 1ESBA 1UTPA 3I77A 3ODFA 4YZUA 4XD7D 5C1UA 3RXFA 1LDTT 1MU6B 1B0FA 1O2IA 1OWDA 4HGCA 3UNRA 2BY8X 1GDUA 1TX6A 1S0QA 2F43B 1C1NA 4MNXA 4IMZA 3TH4H 2CXVA 1ZLRA 1ZSKA 1EP5A 4WVPE 1T8NA 4WXIA 2W7SA 4ABIA 3HGNA 1QFKH 1NFYA 3SORA 3T28A 4TPYA 1C5MD 2JJ1D 3I78A 3H7TA 1W7XH 2O8WA 2VIWA 1ZRKA 2UUKB 1C2HA 1H9HE 1DWCH 2HGTH 1UVPA 2Y5GA 1C5OH 3ZV8A 2XC0A 1KLTA 4JZEH 1J8AA 3RM2H 1GHZA 4ABGA 4F4OC 3M37A 3LJJA 1BUIA 1W0ZU 1E0FD 2XNDD 2BD3A 4NIYA 1L4DA 4AFZA 3H09A 5EU8A 2STAE 5FL7D 4NSYA 1A61H 2ZDAH 3DD2H 4AFUA 1IQLA 5A0AE 1AI8H 5JBAS 2P3UB 2BVRH 4NZLA 1SLVB 4WJG2 1Y5AT 2FPZA 1LHEH 3U9AH 2C8YB 2BMGB 2BDBA 2GCHG 2P59A 4YT6H 2C4FH 1CBWB 2WPLS 3LPRA 5C17A 3RXHA 1KLJH 1IHTH 4B73A 2ZTXA 3T29A 2GGVB 1NFWA 3F68H 2JH6D 4JYUH 3UREA 3BEIB 4MTBA 1HAVA 1Y3VA 2TGAA 2Y6TA 1O2HA 1TGTA 3SI3H 3ZZ6A 1YPLH 1UO6A 3TH3H 1FDPA 2SGEE 4LOYH 1ZR0A 1AWHB 1GI1A 1O2JA 1P2QA 3LGYA 2ODPA 2O8TA 4CR9A 2VIOA 4KTSA 3PMBB 4XOJA 4ASUD 2OC1A 1GBMA 1MKWK 4R8TB 3QN7A 2VWMA 1QBOA 6CHAB 2JDID 1WXRA 1ZTLA 1YPGH 3B8JA 3LIWA 3NUMA 2PFEA 4WXVA 1TRNA 2C93B 2XC5A 2K0QA 4K1TA 2QF4A 1MABB 2RG3A 4ESTE 1GMCG 4M9FA 2BD8A 3VB3A 3ZVEA 3GDSA 2ZDVH 2RDEA 2O8MA 3EDXB 3PO1B 2OQUA 4D9QA 1CT2E 4X1RU 4BAHB 3MNBA 1LKAA 4X8VH 4NIVA 2XBXA 1C5ZB 4M7GA 3MMGA 1AB9C 1YPMH 1TNIA 2F9OA 1GHAG 1SGFA 3PTNA 1P05A 1BRAA 3A86A 1V2QT 1Z8GA 1OWEA 2IJD1 1GI8B 1QQUA 1O3BA 1GI7B 2HLDD 5DP7A 3DHKH 5K0HA 4I8JA 2QN5T 2OCVB 4K60A 3BTQE 1ELCA 2AEIH 2W6JD 4CRGA 1ARBA 3E0PB 1Z1IA 2G4UA 2A2QH 1CA0B 1L1NA 4I8HA 1IQFA 4UE7H 1GJCB 2ZEBA 1N8OC 1MQ6A 2BQ6B 2A7CA 3KL6A 3GY2A 4ABAA 2GT8A 1YLCA 4IS5A 1WDIA 2WYGA 4ISLA 2BZAA 1MCTA 1C4Y2 5AHGH 3SBKA 1DT2A 3P6ZB 3OEED 2D1JA 1NPMA 3BN9A 1RGQA 1SGYE 3F2GA 4YT7H 1CHOG 3IITA 1A3BH 3TU7H 3N7OA 4BAQB 3OFND 3VGCB 3BTEE 1YC0A 1C5VA 1PPFE 1O2TA 3A7XA 2Z7FE 4ZKSU 1NO9H 1HV7A 1W13U 4OS1A 1K1MA 4A5TS 3FANA 3E0NB 2W3IA 1KSNA 2G4TA 5EIYA 2BTCE 7GCHG 3UQOA 6ESTA 4MPXA 2CV3A 4AX9H 5TCAA 1SL3A 1F5KU 1AQ7A 1FY5A 1P2KA 2ZFPH 1RTKA 2B9LA 2XC4A 2ZECA 1EAWA 1CT4E 1EJAA 2V7QD 4JZIA 3A83A 1HIAA 4X0WU 4BAMB 1UK3A 1LO6A 1NU9A 2TGDA 2FI4E 4YXWD 4B2BA 1BTZA 3AAUA 3TK5A 2BOKA 4BTIB 1WQSA 1L0ZA 3T26A 3TPIZ 1FY8E 5E0GA 4BTTB 4OGXA 2KM0A 3MU1A 1O5DH 1AGJA 2QV1A 2SGAA 2AMDA 3GYLB 1WQVH 1VGCC 3EQ0H 4LXBH 4XDEA 2CMYA 3RC5A 4J1YA 4K3JA 2SNVA 1RTLA 1O5GH 2UUJB 4TWWA 5DG6A 2HPPH 1SHHB 1UTKA 2FEQH 1QA7A 5A8ZA 1NBME 4FETA 2XCFA 1UVTH 3ZZ8A 1O35A 3UB0A 1J16A 1PQ8A 3DSGA 4Y7BA 1X7AC 1IQKA 4I32A 1BIOA 3PTBA 1JOUB 1C5RA 2C8WB 4OS4A 3SW2B 2WINI 1ZGIA 3NCLA 1EKBB 1OWKA 4FUCA 3ENSB 4Q4LA 2GZ7A 3SGAE 1TGNA 1BCUH 4X1PU 2H2ZA 3FZDA 1AE5A 1KDQB 3UR6A 4D8NA 3F6UH 1V2MT 2QXHA 4UD9H 3KIDU 4R0IA 4YESB 4H6TA 4CRBA 2BY7X 2QE7D 1ESAA 1AD8H 9ESTA 1QBVH 5DN6D 5IK2D 1AIXH 1EZXC 1AB9B 3U1IB 3QZRA 7LPRA 3UOPA 4YLUA 5GCHF 1Y3XA 1E34B 2Q6FA 3DCLA 1SGNE 1ZTJA 1F5RA 1OWIA 2UWOA 1ZJKA 5C3NA 1V2OT 1A5IA 1J9CH 1YP9A 3MFJA 1ZSJA 2PHBA 3SUDA 2PWXA 4PROA 1C5TA 1EFRD 1NROH 1FPHH 3OY6U 1HJ8A 1O3PB 4CREA 1FPCH 2NU1E 5H4IB 1UTMA 3M3VA 2J95A 2TGTA 1TONA 4FUHA 1BDAA 1LPGB 4Y0ZE 1T8LA 3QTOH 3TGIE 2GX4A 3DUXH 1N8OB 3SO3A 2XBYA 2H9TH 4ZKNU 1NTPA 3RXOA 1ZPBA 3BG8A 3RDZA 1PQ5A 1P57B 4O3UA 4X1NU 4A92A 1C4V2 3LKWA 3LC3A 1TBZH 1Z71A 4X2VA 2V35A 2BVSH 4DT4A 3SI4H 2ZNKH 3VB4A 1DXPA 8GCHF 4AZ2B 2PKAB 1MKXH 1HBTH 1RXPA 3PMAB 1XM1A 1C9TA 2HOBA 1YYY1 2ZQ1A 1GWAA 1LMWB 4U30A 2D26C 2LP6A 1YLNA 1TAWA 1KXEA 4KELA 1D9IA 1GHBG 5ESBA 3STIA 3TITA 2VIPA 2LNCA 2R3UA 3U8TH 1UCYE 2ZU4A 1PPCE 3AVZA 2QAAA 2BLOA 2AMPA 2GV6A 2PW8H 4INKA 3RU4T 1VR1H 2A4OA 5EODA 1AFQC 4O03A 3V3MA 3GDUA 3BTKE 1BA8B 3RXMA 2A5IA 1RTFB 4CHAB 3F9EA 1BT7A 1P2JA 2O8LA 1HRTH 1TRYA 1TA6A 2FTLE 2SFAA 4MLFB 1WTGH 2FWWA 3H5CB 4JK6A 3PMHB 1HAIH 1LCYA 3EAJA 2SGQE 1ARCA 3OE7D 2KFWA 1HIAB 1C2DA 3OEHD 4WMDA 1PQAA 3SZNA 1TE0A 3OTJE 2VINA 2BDHA 3B9FH 3H7OA 5C0TA 2QXGA 1SHYA 1VGCB 1Z8RA 2PTNA 8LPRA 3NK8A 1OSSA 2AERH 2BX4A 1HYLA 2AIPA 3RUOA 5JPMH 1FJSA 1QGFA 4BAOB 1KIGH 4X6PA 2KCAA 2WPKS 1SGEE 4U32A 1DX5M 1ZSLA 1DS2E 1B7XB 2QCYA 1IQHA 3G01A 2C8XB 1EPTA 5L30H 1FN6A 1CT0E 4E7NA 1QQ4A 3FVFB 2GJGA 4CBNA 2BY5X 2A4RA 2PSXA 1SR5C 1TWXB 5DP5A 1KXDA 3URDA 1H8DH 1ORFA 3GY3A 1UHBB 2A7HA 3E3TA 6GCHG 3VXFH 3QLPH 2FOHA 1MBMA 5DJ7A 5GNDA 5C1XA 1EPTC 4SGBE 3KYGA 3SNBA 1HJ9A 3MU4A 4DOQA 1BMAA 1TLDA 3K9XB 2VIDA 1GJ6A 3SHCH 1SQAA 1V2UT 1GBAA 1C5WB 4ABBA 2QXIA 2XXLA 3ZVAA 1DUAA 2PSYA 1D3DB 2OP9A 3BTME 2F9PA 2WZQA 3Q3YA 2Y7XA 2Y80A 1C1RA 2FLBH 2C3SA 2ZU2A 1H8IH 1QRXA 5DO4H 1SSXA 4MNWA 4ABDA 1TBRH 1FIWA 2KCYA 3PLKA 4NCYA 3EGKH 4E7RG 1GBBA 1WBGB 5DSFA 4HG6A 2XBWA 4IC6A 4B71A 4NGAH 1O2OA 3RXIA 4CH2B 5K7RA 2FOAA 4IC5A 1ELFA 3MNSA 1ZGVA 2H5DA 1SQRA 4H4FA 2BD2A 5HMAA 4HI3A 1AKSA 3M5MA 5ABWA 1MUEB 2V6NA 4BANB 1TGBA 1GMHG 4IGDA 4NWLA 3MNCA 2PGQB 2YOLA 2ZQ2A 3DFLA 3HKIB 1QL7A 5FHTA 4I7YH 3C1KA 5FX5A 1ZZZA 1C5NH 4NA8A 4X6OA 4F55A 2WPDD 1WYKA 4Y8XA 1GVKB 3TLOA 1H4WA 4FUFA 6LPRA 4FUGA 2ODYB 1TB6H 1C1TA 1E35B 3SJIA 1XUJA 2PUQH 1PQ7A 1SQOA 1TYNA 1YY3A 4YOIA 2VWLA 1IQJA 1EASA 3K65B 1HDTH 1UCYK 5E2OA 5JB9S 1E38B 3KGPA 4UFEH 3PLBA 4DJZB 5C20A 2R2WU 1ESTA 1T4VH 2FTMA 3D65E 1V3XA 4GVUA 2TIOA 5G4BA 1ELTA 1O3OA 4I8KA 4WH6A 3JZ1B 2Y5FA 2QXJA 1SGTA 1TFXA 1OYTH 1ZHRA 3MO3A 3UNSA 2GVFA 3IG6B 1G30B 1P8VC 1JIMA 2OXSA 1P9SA 4UONA 1O3LA 1WTHD 1AFQB 1BB0B 2FOCA 1BJUA 3HK3B 1TMBH 1C2KA 2BDIA 3SN8A 5LPFA 1OWHA 2H9HA 1C5XB 2ZGJA 5A2MH 1SQTA 1GJ4H 5FXLA 4YM9A 2BQ7B 2ZCKP 2GT7A 5C2ZA 3TJOA 1O2NA 1O34A 1KXFA 2J98B 1GPZA 2JH5D 2M5TA 4OGYA 1UVOA 2BDCA 2F4LA 1C5LH 3MQKC 5JDUB 3KF2A 1RD3B 1O5CB 2VVCA 3MYWA 3OAAD 3W95A 4KTCA 3F1SB 1EB2A 1BTUA 2Q1JA 4K2YA 3UWIA 1ANCA 2SGPE 2YMSC 1M9UA 1LQDB 2G52A 2A5AA 1ABJH 3K2UA 2JJ2D 1KMHB 2EQNA 3A8DA 1Y5BT 1DFPA 1ZRBA 1W2KH 1O3DA 2YNAA 1O2RA 3RMNH 1QTFA 2J5UA 2OC0A 1GBEA 2QC2A 1V2TT 4AGJA 3QGNB 1YLDA 1QIXB 2J34A 1HAGE 3BTFE 2AGGX 5L6NH 3S9CA 4JZ1A 5KECA 1NESE 1V2LT 3ZYDA 3KQDA 3A88A 1Q31A 3Q77A 1F92A 1TQ7B 1CVWH 1A0HB 5C5OA 2I6SA 5LGOA 2B8OH 2BD4A 3SUFA 3GDVA 4HZHA 5E0HA 1YM0A 1C1VH 1TRMA 3LGWA 1IQIA 1S83A 4YOGA 3PWCA 1ELEE 2YNBA 3A8AA 3P70B 2WPIS 4MDSA 1A0LA 3FO8D 3Q3KA 3SU1A 2M2AA 3KQBA 1BBRK 2FOGA 2FI5E 2A1DB 2ZGXH 4Q7YA 3ZZ7A 1O2UA 1AVXA 1VITF 3RXDA 3Q3XA 3QWCH 1BRUP 1GJAB 1TA2A 3F9GA 4UFGH 5EQRA 1LKBA 3KHVA 1WAYB 3BEUA 2F91A 2VWOA 4NA7A 2ZHFH 4UFDH 5AFYH 1UTOA 5E8EH 2CHAC 1P06A 3TJUA 2J4IA 5T1VA 4ASHA 1GDNA 1K1LA 1VKYA 2ZPSA 3RMLH
chains in the Genus database with same CATH topology
2UUFB 4MPUA 3T2NA 2Y81A 4AYYB 5DKMA 1P2NA 5PTPA 1K1OA 1MTUA 1AMHA 3NPSA 2BDGA 3BIUH 3QGJA 1O36A 4K5ZA 1P2OA 3BV9B 4Q7ZA 1GI3A 2Z9IA 3P92A 4FU8A 3QTVH 4KP0A 1C5QA 5JYIA 3TJNA 1O33A 4Y10E 1H9LB 4XE4A 5CMXH 2WPMS 4IBLH 3FFGA 1O2ZA 5DP4A 1PPHE 3QZQA 2OTVA 3RXVA 1T8MA 1GHYH 1B0EA 1V6DA 2TRMA 3BTWE 3LGUA 4GHTA 1K21H 4FU7A 4YLQH 4DIHH 4I8GA 1D6RA 1BTXA 1MTNC 1ANBA 3RC6A 2GDDA 1QJ1B 1EJNA 1K1NA 4JCNA 2V0BA 4TY7A 5FAHA 5EXLA 2FO9A 1S82A 2CJIA 3GY8A 1ZTKA 1EZSC 2NU2E 4CRCA 2Z9JA 3A82A 3A8BA 1AU8A 3ZZ5A 1S0RA 1XVOA 4FUDA 5DGJA 1JWTA 1T31A 3P8FA 2BXTH 3V12A 4YTAA 4FUEA 2BLWA 2WUBA 1BHXB 4WH8A 4ABEA 2GCTC 1QNJA 4H42U 1OOKB 3K6YA 1YCPH 9LPRA 2CN0H 2J94A 4ZH8A 1GI9B 1FLEE 2ZA5A 1O5AB 1ZJDA 2EA3A 3M5LA 1GCDA 4GLYA 1MH0A 1ELVA 1FI8A 1V2JT 2RDLA 4B76A 2BD7A 4U2WA 2ILNA 1QL8A 5EPYA 3HGPA 1ETSH 1W8BH 5T6DA 3GCNA 2ALVA 1LHFH 2G5NA 3A7ZA 3BTGE 1JBUH 4Y11E 1GJ7B 1C2JA 3F9HA 4OS2A 2ESTE 3TH2H 3GY6A 3V7TA 1O39A 4AB8A 2R3YA 2FOEA 2PGBB 1GBFA 2BOHB 4A7IB 1BTYA 5CE1A 1C1UH 2VU8E 2FDAA 3L6PA 1K1JA 4FVBA 3ATKA 4JK5A 4VGCC 2FM2A 1TX8A 1ZMNA 1QRWA 2P3TB 1GMDF 1SOZA 1BZXE 1WU1A 5HYOA 1D3PB 2ZPRA 2C8ZB 1UK2A 2EI6A 4WF8A 1FY4A 4U01A 1KY9A 2PUXB 1O38A 2F9BH 2FX6A 2ZIQH 1IAUA 3C27B 1SGCA 4CR5A 4D7FA 4BAKB 2G5VA 3BTTE 4YOJA 2V3HH 3U8OH 1PYTD 3ATLA 2BYAX 1ETTH 3RXGA 1AN1E 2CHAB 3MH6A 1HAOH 5T6FA 3EYDA 4ZKOU 2C90B 2F3CE 2XNIA 2XW9A 2HNTE 4Y8ZA 2ZCLP 2FOFA 4TYDA 2A2XH 1VCQA 3V13A 2AYWA 2QGRA 1XUFA 1NFXA 3S7KB 1NZQH 4ZROA 3URCA 5EW2H 4B74A 2THFB 2P94A 1FAKH 1EZQA 3NZIA 1F0SA 3O8BA 5DPAA 2ALPA 1HAVB 3GOVB 1SLXB 1FN8A 2JKHA 5GCHG 3T62A 1SVPA 2BDAA 1DDJA 1O3NA 2G81E 1G37A 1TIOA 1UMAH 1LVBA 1SGDE 3BG4C 4AG1A 3DT0H 4FU9A 5C5NA 1PJPA 1TMTH 1WSSH 4WY3A 3RLWH 2VH0A 1BQYA 5FCKA 5JBBS 1C2MA 1MAYA 1O30A 3HPTB 1XXDA 1ELDE 1E36B 1FV9A 1VJAU 1O2SA 1PFXC 2AGEX 2UWLA 5F8XA 1O3JA 1AO5A 3L33A 1O2QA 5EQSA 1XKAC 3TNTA 1NRRH 1UTJA 2I6QA 3VXEH 2VGCC 1O3EA 3LT3A 2IOTA 1V2WT 1O2WA 2EEKA 3R0FA 3SV7A 1V2NT 1C1WH 1NRNH 4RN6A 5HM9A 1AY6H 1TOCB 3HK6B 1CU1A 4MNYA 2Z3EA 1GBIA 2GV7A 3CP7A 1P11E 1G3DA 5AVDA 5T6GA 1OWJA 1IHSH 1NT1A 1IOEA 1G2MA 1G9IE 1XUKA 8GCHG 1BJVA 3WY8A 1CGJE 1WCZA 3OY5U 3SNCA 1C2LA 1CHGA 1SFQB 3M61U 1FQ3A 1Q2WA 4D76A 3AASA 1MZDA 3E1XB 3MI4A 2ZC9H 2GCTB 1O5BB 3P95A 3DA9B 1O3AA 1CQQA 2GKVE 1VZQH 1C4U2 1NS3A 1C2IA 1ZOMA 1YPKH 1TOMH 2EC9H 5LPEA 2IJOB 2HVXA 2LPRA 2NU3E 1MD7A 2ZFSA 1Q3XA 2XWBI 1C1OA 3A85A 1IQMA 1FUJA 1UVSH 4XBBA 2OC7A 2FYRA 1XUIA 2A32A 3LC5A 3STJA 4K1EA 1P04A 1QY6A 1C9PA 1BRBE 3ZZAA 2O9QA 2HALA 3Q76A 4ZHMU 2FP7B 1IQGA 1VJ9U 3GCTF 3UIRA 2ZGBH 1QB9A 3SV6A 5F6MA 4NG9H 4AORA 1SLWB 1AE8H 4Y7AA 1G3CA 1DWEH 1MKWH 3S9BA 1SOTA 1EXFA 3JZ2B 4K8BA 5FPYA 1OX1A 3RU4D 1SB1H 1E37B 3UPEA 1QHRB 5GWZA 4VGCB 4KKDA 4DT7B 3FZZA 4B2AA 2J2UA 3ELAH 1TBQH 3SV2H 2ZZUH 3P8GA 4XFQA 1BTPA 2CF8H 3RXBA 1F0TA 3RXAA 2Z9GA 2BB4A 1BMLA 1GJBB 5A8XA 5JBCS 1L2EA 3TJVA 1D4PB 2ZFFH 1LVYA 2GP9B 3LGTA 3ATMA 1BMNH 3MU0A 5JBTA 2A4GA 2Z9LA 3L3TA 1YKTA 3VEQB 1GI2A 1LHDH 1PPGE 3QO6A 3LDXH 1GG6C 3ZVGA 3A8CA 1C1SA 3IWMA 3K6ZA 4NIXA 5TJXA 3P8OA 2G51A 1QR3E 1QBNA 2SNWA 3FP8E 3ZZBA 2FI3E 3VFEA 1QCPA 3T25A 4B2CA 2ZP0H 2QIQA 2RA0A 4NFEA 2R2MB 1K1PA 1LHGH 3QK1A 2H5CA 1F0RA 1UVUH 5FPTA 3ZV9A 5DP3A 5A8YA 4LK4A 5FPSA 4JYTA 4THNH 7KMEH 1A1RA 1TNHA 1CSOE 1HLTH 1DWBH 4MPWA 4X2YA 1PPEE 2CF9H 2HNTC 2ZGCA 3BG4B 4XBCA 4FUBA 2G8TA 4AFSA 5EG4A 3NKKA 1EAXA 3VB7A 1G2LA 2ANYA 4FVDA 3EA7A 4X8UH 5I25A 2P8OC 1JXPA 5IDKA 1HB0B 2A5KA 1AFEH 1K22H 1SI5H 2GMTC 1QL9A 2VGCB 1Z1JA 2AH4X 5A0CA 1WOFA 1GGDC 1TGCA 2HLCA 1EJMA 1HXEH 3RLYH 1TNJA 2B0FA 1A2CH 2P16A 4F49A 4FUIA 1HFDA 3F9FA 4X8TH 1QA0A 1RFNA 1FONA 1KXCA 1CBWC 3S9AA 1O2XA 2WYJA 3KNXA 1NFUA 3KQCA 1K1IA 1THSH 2VIQA 2W5EA 3RMMH 1GJDB 4X6NA 2ZTZA 3PROA 5I46H 1S6HA 1YGCH 4X2WA 4GHQA 3RMOH 3ATIA 5EXNA 5HGGA 3ODDA 1N1LA 1Y59T 5F03A 4WWYA 1BHXF 1GHVH 3GCHC 1SGIB 4INHA 2Y7ZA 2OINA 3A87A 1YPJH 3M36A 1PPZA 2ZDLA 1QURH 3VB6A 5LPRA 3FP6E 1A7SA 3CS7A 3D62A 1HJAC 4GCHF 3SJKA 1P0SH 1QJ7B 3PYHA 1MTWA 4GUXA 1NC6A 2FMJA 2GDEH 2HPQH 1O5FH 1EAIA 2WV4A 1LTOA 1A5HA 5T3HA 2OUAA 3KQEA 2FYQA 1GMHF 3A89A 1QB1A 1EB1H 1HUTH 1NN6A 1T7CA 1ELAA 2FESH 3NWUA 2ZF0H 2VH6A 3A84A 1AWFH 3LOXA 2ZFQH 3BIVH 5DP6A 2ANMH 2OD3B 2ZDKA 3MHWU 1BOQA 5EW1H 4HTCH 4DURA 5FCRA 2R0LA 1OPHB 5GXPA 2XBVA 3TGJE 3TNSA 3QUMP 4X2XA 3BTDE 1Y8TA 1QB6A 1P3EA 1C1QA 4AN7A 2R9PA 1O0DH 3S69A 1O32A 3RXQA 3GICB 3UFAA 1ANDA 1UJ1A 3GY5A 3MU8A 1PYTC 4GPGA 3S7HB 1LPZB 1W10U 1GG6B 3SNDA 2WPHS 1P09A 1CA0C 5ESTE 4RKOB 4TWYA 4ISOA 4IW4E 1MCVA 4CBOA 1OS8A 3T27A 1HNEE 3E91A 1Z7KA 5L2ZH 4CH8B 2XWAA 1ZYOA 1MMJN 3BTHE 1EZUC 4XSKU 2ZU5A 1DANH 1A0JA 1KLIH 1GBLA 1EP6A 4AOQA 1DXWA 2A0QB 2ZHQH 1EPTB 4HFPB 2J38A 1VITG 3OX7U 3VGCC 1TPOA 3EA9A 3RXTA 3SUGA 1L4ZA 4ISHH 1THRH 3NXPA 4MQAA 5EQQA 3RXLA 3S0NA 4X8SH 3SGQE 3MU5A 2Z6BD 2P8OB 1ACBE 3SQHE 2AGIX 5EGMA 4Q7XA 1FY1A 3FP7E 5FX6A 4DGJA 1SGFG 2GMTB 1ZHMA 2PR3A 3M5OA 1G3BA 1GBHA 1KXAA 1EUFA 1UK4A 1O37A 1EX3A 5IYTA 1GGDB 4INLA 2VJ1A 3ZZ4A 1ID5H 3MNXA 2GTBA 2EI7A 5HXFA 2VVVA 1Y3UA 1T4UH 2AS9A 1ANEA 3RP2A 2DE9A 1P03A 4IMQA 1OKXA 3AW0A 1KYNA 3LH1A 5BPEA 1MKXK 2PTCE 1Z8IB 2B7DH 1O3HA 2ZFTA 1EOLA 4UEHH 3TK6A 1DM4B 3RXSA 1DWDH 1DY9A 1THPB 1AKSB 3A7WA 1B5GH 1SGPE 1U6QA 1ZMLA 3GY7A 3GCHB 2BLVA 4JZDH 3A81A 3SJ8A 2SGFE 3UWJH 2BXUH 1KDQA 3MH5A 1Z8JB 4X1SU 2GCHF 2V3OH 3VPKA 1YPHC 1DE7H 5F8TA 1MTVA 4MNVA 4Z6AH 2KAIA 1HJAB 1RJXB 5DK1A 1UTLM 4E06H 3LGIA 1S85A 4H6SB 3EE0B 3ITIA 1TABE 1NRQH 2IN2A 4WMEA 2BY6X 3MH7A 1JRSA 2QYIA 1DLEA 1CO7E 2STBE 1G32B 2WUCA 3O8CA 1FXYA 2BX3A 2Z3DA 2ULLA 2D8WA 5C1YA 4O3TA 1SC8U 2FOBA 4E05H 2A45B 1HXFH 4D7GA 3E16B 1LQEA 2ZFRH 3AAVA 4GSOA 1DSTA 3MO6A 2GZ8A 2ZG0H 1GMCF 3U8RH 2FZZA 3RXEA 1K2I1 3UOUA 2ANWA 3ZZCA 1D3QB 2QA9E 3ZVCA 1F5LA 1FIZA 3SUEA 1GBTA 1XUHA 1XXFA 3E6PH 1P10A 3UNQA 4O9VA 1T8OA 1FMGA 1O3CA 1YPEH 1SLUB 1MBQA 5LH8A 4Y8YA 1O2YA 1SGRE 2RA3A 1GHAF 5CHAC 2OC8A 2PKAA 2G00A 1V2ST 1O3IA 2FS9A 2ASUB 3LGVA 2BHGA 3SU6A 2Y82A 4FXGH 1GMDG 3OYPA 2JETC 4I31A 1TPPA 1D3TB 4KGAA 4KTUA 3SU5A 1TPSA 3BEFB 3TGKE 1L1JA 3RXRA 1H1BA 1ABIH 1T32A 3P17H 2Z3CA 1ZMJA 4DVAU 1O3KA 1C5UA 3R3GB 2ZU1A 3SV9A 3O8DA 4Y0YE 3TK9A 4Y6DA 5C67A 2W3KA 4OS7A 4QT8C 1GBJA 2BDYA 4Y71A 4A1TA 1O5EH 2H9EH 1GI4A 1ELGA 2D2DA 1SPJA 2ZKSA 1UCYH 3T5FH 4BOHA 3A7TA 2ZU3A 1AZ8A 3KCGH 1AZZA 4ZAEA 4IN2A 1CHOF 4Y76A 3ZYEA 2A7JA 2QF3A 3ZVBA 3EA8A 2BQWB 3MWIU 4IN1A 4JMYA 4CHAC 2B5TB 1J17T 1K9OE 4CRAA 3A7YA 4XBDA 3M3TA 2Q6DA 4ISNA 1OP0A 7GCHF 3E8LA 3SOSA 2VNTA 4D9RA 3SHAH 1AVGH 1GI0A 2PKSC 2H1UA 2OLGA 1O2MA 1O2KA 1XKBC 2FS8A 5DP8A 1TMUH 3UR9A 3CENA 1HCGA 1CE5A 1UHBA 1OYQA 1DSUA 1BRCE 2ODQA 5EXMA 2R0KA 3SGBE 3RXPA 4ZXXH 4AGKA 4ABJA 1CGIE 3AW1A 3FAOA 8ESTE 2ZHWH 1MD8A 3RXCA 3OU0A 1V2RT 1NY22 1O2LA 2H6MA 2XCNA 2ZDNA 3LONA 1F0UA 1AVWA 1DUEA 2PLXA 2F9VA 1HAXB 5F8ZA 1MAXA 3M35A 3ZZDA 2P3FH 1DITH 2OBOA 1EATA 4ABFA 4ZKRU 1W7GH 5BRRE 3VB5A 2GZ9A 4BTUB 2W26A 2G55A 4UFFH 1YF4A 1ELBA 1MTNB 5B6OA 1C1PA 4Q80A 5TCCA 3RXJA 2KAIB 1CA8B 4AYVB 5J4SA 2DE8A 2CGAA 4B75A 1TALA 2F9UA 1GCTC 3M7UA 2FX4A 1RIWC 3GCOA 1TNLA 3W94A 4ZUHA 4AB9A 5EOKA 3ATWA 1DOJA 2BZ6H 5FBEA 2O8UA 2DUCA 4AG2A 1C2GA 1FY3A 3PB1E 3GCTG 1VCWA 2WPJS 4ISIH 1DPOA 1NM6A 4Y79A 5AFZH 4BXSA 1DICA 4NWKA 1Y3WA 1TGSZ 1BBRH 1P3CA 1FZZA 3P8NA 1KTSB 1PPBH 4BXWA 5CHAB 3U69H 3DFJA 3KEEA 2ZPQA 1NU7B 1XUGA 4I8LA 1AUTC 1SG8B 3SU3A 1DVAH 4J2YB 4ZHAA 2JETB 2ZWLH 2Y5HA 1VITH 2AFQB 3PMJA 2GD4B 1A4WH 2ZI2H 4X6MA 1UTQA 3SNEA 1Y5UT 2TPIZ 1V2PT 4MPVA 1S81A 3Q00A 4K8YA 1LPKB 4ZMAH 3A80A 1FNIA 1GBCA 2TGPZ 4ZHLU 1J14A 4OS5A 1RRKA 4I33A 2HNTF 5E0JA 3TVJB 3SNAA 2Z9KA 1BITA 1EAUA 5GPIB 3LU9B 1EOJA 2QF0A 4FUJA 4A6LA 1GHWH 1EQ9A 1S6FA 2XYAA 1V2KT 2BM2A 1Z6JH 3MOCA 1SGQE 4NSVA 1GHXH 2ANKH 1JMOH 1W12U 2J9NA 2P95A 1MU8B 3CS0A 2Q6GA 2AIQA 2IPHA 5ETXA 3GISB 1XX9A 1Z6EA 1V2VT 4ZXYH 5JB8S 1Y3YA 1TNGA 3RXUA 1D6WA 1GHBF 1GJ9B 1ETRH 4LZ1H 1TNKA 1WV7H 1N6XA 4NA9H 3QX5H 3E90B 5HM2A 3SJ9A 2PKSB