2R0LA

Short form hgfa with inhibitory fab75
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody light chain
publication title Structural insight into distinct mechanisms of protease inhibition by antibodies.
pubmed doi rcsb
source organism Homo sapiens, synthetic construct
molecule tags Hydrolase, immune system
total genus 55
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r0lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r0lA01
3C1KA 1AGJA 1IQJA 3RP2A 5IYTA 1IQFA 2G4TA 2PKSC 3VB7A 1TAWA 2FS9A 1Y3WA 3KGPA 1Z8GA 1ORFA 4ISLA 2VWOA 4X2XA 5LH8A 1HCGA 1TB6H 1SGDE 2NU2E 2O8TA 1P01A 1G32B 1P2MA 2G52A 4E7RG 2C93B 4WMDA 5AFYH 1HAHH 4X1NU 4J2YB 3ATMA 1GMDF 2VIDA 1XVMA 2ZU5A 1CHGA 1DLKB 4SGBE 3VXEH 1SHYA 1IQGA 1OXGA 1GI5A 1EZQA 1BTPA 4H6SB 5GPIB 8GCHG 3P8NA 4AFQA 2PV9B 1F0SA 4O3UA 1AUTC 2TRMA 1EKBB 5JDUB 1CT2E 3ZVCA 3MOCA 4KP0A 4YZUA 3L3TA 2WPMS 1PQ7A 1DICA 4NA7A 4Q7YA 1ZMJA 2P94A 4UEHH 4XE4A 1CU1A 4AB9A 2RA0A 2TGDA 2Y5FA 1GI9B 4UD9H 1OYQA 2R2WU 1J8AA 5EXLA 5FHTA 3P8GA 1ZHRA 1HRTH 3ODFA 3AW0A 1GHBF 4CRGA 1P2IA 2TPIZ 3M5MA 4NIYA 4NFEA 1K28D 2NU3E 1SB1H 1C5RA 2HPQH 4VGCC 1KXBA 4X6NA 4YLUA 1TIOA 1TGBA 4BOHA 2Z6BD 3TJOA 1NS3A 4ZAEA 2BB4A 3CS7A 1Z71A 4ZH8A 1YPEH 4MNVA 3UREA 4DT7B 4QT8C 2FIRH 2FX6A 3S7KB 2EI6A 2H9EH 2AGEX 1V6DA 4Z0KA 3BN9A 1AE5A 1WCZA 3BSQA 3SZNA 2NU4E 4CH2B 1OS8A 3TGKE 3TIUA 1AVXA 1EAXA 3PMBB 3TITA 1YPMH 2DUCA 4ZXXH 2W5EA 1C5QA 3AW1A 1A3EH 1MBQA 2AYWA 4K8YA 4KGAA 2ZFFH 3ZYEA 1GBCA 4ABIA 1V2NT 1O2LA 4AG1A 1UCYH 2EI8A 1VCWA 2BYAX 5T3HA 1KLTA 1S84A 3PLKA 3QWCH 1JRTA 4TPIZ 3QDZB 1AKSB 5EQQA 2UUYA 4ABEA 1C5ZB 2VJ1A 1G2MA 3U98H 2ZFSA 5A8XA 2FX4A 1UCYE 3NWUA 4AOQA 4U01A 4B74A 4O9VA 2C3SA 2BD4A 4AFSA 1FY8E 4X8TH 2ZHQH 2PHBA 4YO9A 3RXFA 3SW2B 2OINA 4I8JA 2O8WA 2PUXB 3PTNA 2F3CE 1SGFA 1YKTA 2ZQ2A 1O3BA 4TY6A 2ZTZA 3RU4D 2VIWA 2GKVE 1O3AA 2BQ6B 1FXYA 5EPNA 5E8EH 1K1NA 1TWXB 4GCHF 1C5TA 1MTNB 2J2UA 4FUHA 4JZ1A 1FPHH 2Y81A 2TGAA 3SNEA 1W8BH 1C2HA 1W0ZU 3A8AA 4NWLA 2CMYA 4Q7ZA 1GJ5H 4ISOA 1FV9A 2XCFA 1TA6A 4ZUHA 1RIWB 4FVBA 1O5FH 3MTYA 5B6OA 2XW9A 2ZFQH 5AF9H 1CGHA 4AZ2B 1DE7H 5HMAA 4MNXA 1LKBA 2FLBH 3F1SB 3PLBA 1TNIA 3EA7A 5FPTA 3C27B 1OWJA 5EW1H 3A7VA 1LHCH 2J38A 1BBRK 1C1PA 4WMFA 3SUFA 1E36B 5AVDA 1AMHA 1KYNA 1O2NA 1YPJH 2A7CA 2TGPZ 4UFEH 4IC6A 3UIRA 1YCPH 1SFIA 5EGMA 3HKIB 1VGCB 3NK8A 1TOMH 1INCA 1T31A 4B75A 3SJOA 4UE7H 3O8DA 5F6MA 4RKOB 2ALVA 3PMAB 3MO3A 1LMWB 5DP3A 1CHOF 1JWTA 2PTNA 2ZCKP 1EJNA 2VVVA 1MZDA 2Y7ZA 4JZIA 6CHAB 2HNTC 1MTNC 1S6HA 1Y59T 3S9BA 2VIPA 1S83A 3RUOA 1K1LA 3PYHA 1GI1A 6GCHG 3H7TA 3HK6B 3QK1A 4X8SH 1OWEA 1P11E 2OBOA 3UWIA 1RIWC 1A7SA 2BOKA 1O34A 2BD9A 2J4IA 1Q31A 2FOGA 1VR1H 4X6OA 3RXDA 1AU8A 3ZVFA 2BD3A 1QA7A 5GJ4B 5GIBA 2OD3B 1DY8A 1Z8IB 4CRFA 1HGTH 1CO7E 1AFQB 3RLWH 3IITA 3IWMA 1DY9A 3CENA 4OGYA 3R3GB 4OS4A 2WPJS 1GJCB 3UR6A 1W12U 3QGNB 1HAPH 3GYLB 1F92A 5BRRE 2QXHA 2KAIB 3SOSA 1EUFA 2VU8E 2J95A 1LHEH 3ZZAA 2SNVA 1VGCC 2CJIA 4WJG2 3RXJA 1QJ7B 1ABIH 2ZU1A 3BEFB 4TYDA 3E91A 2P8OB 1LQDB 4CRCA 1PPZA 3K2UA 1GHYH 4Q7XA 1ELEE 1DUEA 3RXUA 1ESTA 4CH8B 3SI3H 2HALA 2BXUH 2ANYA 1C2GA 6CHAC 2UUKB 3EDXB 1BTHH 4DW2U 1F0TA 3GY3A 5AFZH 5A0CA 1O3GA 2FOFA 2I6QA 2BOHB 4OS5A 4WMEA 1O3JA 4FUJA 1GL0E 5C5OA 1BTYA 1O2OA 1TBQH 2B8OH 2IPHA 3OY5U 3M7UA 1BTZA 1GMHF 4A1XA 1T4UH 1WOFA 2A5KA 5HYOA 4YT6H 1LKAA 1UMAH 2P3TB 1BRCE 5A2MH 3LGVA 1KLIH 2WUBA 3DUXH 1GDQA 1IHTH 4DOQA 1DVAH 3VPKA 2ODPA 3ODDA 2FESH 5HM9A 3QN7A 4HGCA 1UCYK 1Y5UT 1GCTB 2XBVA 1DPOA 3LGIA 2ZEBA 1AFQC 4XOJA 1CT4E 3NCLA 1CSOE 3SU2A 3U1IB 1TQ0B 2ZCHP 1E35B 2XYAA 2GDEH 1GMDG 1PQ5A 3T25A 1NN6A 1LVOA 1SGYE 1UTMA 1GBFA 3GY8A 1ELDE 1J14A 3UFAA 1UK4A 4XSKU 1WTGH 2Z3CA 3KCGH 1ESAA 3MNXA 1UVUH 1T8OA 1T32A 1FMGA 4NIXA 5E2PA 4A5TS 2OC7A 1TNGA 3PM3A 1NRPH 1ARCA 1XUGA 3Q77A 1O2XA 4ISIH 1D6RA 1MQ5A 2H2ZA 2P8OC 4GSOA 1DWDH 1RJXB 4GHTA 2VIQA 3MMGA 1BHXB 1GHAF 2XNIA 2FPZA 1UTKA 3KHVA 2AIPA 1Q3XA 3QZQA 5JB9S 2QGRA 2UWOA 3OY6U 1VCPA 1MD7A 2PLXA 3LGWA 4NFFA 2ZGHA 1CGJE 1ZZZA 5C1XA 3CP7A 2FOHA 1LCYA 2F9BH 2AERH 1QJ1B 4CRDA 2K1QA 1ELFA 2FI4E 5EPYA 2BXTH 1H4WA 1ELCA 2OTVA 3HPTB 3ZZ5A 4KTUA 1FDPA 5I25A 3DA9B 1MMJN 1GCTC 4LOYH 1BMAA 1GBMA 4BAKB 1GGDB 3M36A 1O5DH 1GJAB 3URCA 1GJ7B 1SI5H 2GMTB 3RXOA 2ZDNA 4D9QA 1S0QA 4D7GA 1GMCF 1PPGE 2BY9X 1FY1A 2M5TA 1VJAU 1THPB 1TPOA 1TGSZ 3ITIA 4J1YA 4Y11E 4Y8XA 3RXEA 4NA8A 3UQOA 4B2BA 2ULLA 4I33A 5FXLA 1PJPA 3SBKA 3OYPA 2BDCA 1C1UH 1YCPK 1EOJA 1P8VC 1D3PB 5ESBA 1ETTH 4KTSA 2EA3A 4X2VA 1BB0B 2D8WA 1OWKA 4AGJA 1CA0B 1BTUA 3A83A 2ESTE 3MU0A 4GLYA 3L6PA 5EQRA 4K1SA 1TE0A 1RTKA 1YLDA 4AYYB 3A7TA 1J17T 1ELBA 1GVZA 2C4FH 3ATIA 4X1SU 1UK2A 3KQBA 4I32A 1HLTH 1THSH 4LXBH 1A0LA 2YNAA 3TH3H 3TH4H 1UO6A 4YTAA 2EI7A 1EX3A 1SVPA 4FUEA 3QTVH 2I6SA 1TRNA 1K9OE 3A80A 1QRWA 1IQLA 3O8BA 5CHAB 4FU9A 1FLEE 1W0YH 4A1TA 3JZ2B 1O39A 2Z3EA 4NSVA 2JH5D 1QRXA 1ANCA 2UUJB 4FVDA 3O8RA 1MQ6A 1GGDC 2BDGA 2A7HA 1P2NA 3GY6A 1ZOMA 1QA0A 2GMTC 2XRCA 5HM2A 2ZU3A 1HNEE 1BITA 2QYIA 4ESTE 3F6UH 3DFLA 1E38B 1GJ4H 1Z8JB 4WXVA 1IOEA 2BDAA 3LIWA 4NIWA 2A31A 1ZR0A 3BEUA 1ZPCA 4OGXA 3E16B 2A2QH 1O37A 1MTUA 2HNTE 1EXFA 3MWIU 1CA0C 1V2MT 2VGCB 5J4SA 1C2KA 2R0LA 5H4IB 4XBCA 3TGJE 2IN2A 2CF8H 1KDQA 4GAWA 4FXGH 3G01A 2SGPE 1Y5AT 4ABAA 4ABHA 4WWYA 1Y3XA 2LPRA 5AHGH 1QGFA 1NO9H 2AEIH 5EU8A 4DGJA 4CBOA 1LTOA 1L1JA 1GI4A 1HBTH 1SQAA 2G81E 1MUEB 2ZWLH 3LU9B 5CHAC 2KAIA 2SGEE 2TBSA 2FM2A 2EC9H 1TMTH 1DANH 1QCPA 4FUIA 2R0KA 1O2PA 3DHKH 3LPRA 1CHOG 2ZFTA 4INHA 3AASA 1EQ9A 1ETSH 1SBWA 1IQIA 2FI3E 4ABGA 1HAVA 3ZZ9A 2H9TH 1HXFH 1KSNA 1V2PT 1Z7KA 4JYUH 2ZO3H 1O3DA 3K6YA 1OKXA 1TABE 2XBWA 3M5LA 1V2TT 2NWNA 1F7ZA 1P2KA 3F9FA 1AFEH 2Y82A 1SLXB 5G4BA 3SHAH 1SFQB 3KNXA 5FCRA 1QFKH 1DITH 4MQAA 4ZKNU 3Q3YA 2VGCC 1O3KA 2VH0A 3LC3A 3E90B 3TNSA 3RXLA 3RXIA 4DIIH 1GDNA 1GBBA 1G3CA 1XXDA 1O35A 2W26A 3A89A 1RXPA 1G3BA 5JBAS 1ID5H 2XTTB 3OX7U 1O31A 1V2LT 3VGCB 2ZDVH 1BRAA 2ZI2H 4CR9A 1XXFA 1W10U 1DWCH 3D65E 3A88A 5F8TA 2BQ7B 3BG4C 3MO9A 2WPHS 2PKAB 2BDBA 1Y5BT 1NFUA 1C1WH 4NSYA 3M7TA 1UHBA 1ESBA 1Z8RA 1BRBE 5JYIA 2OLGA 3AVZA 1QQ4A 3RXTA 3SV2H 2ZTYA 5L2YH 4X1RU 1NFXA 3SUGA 1RD3B 2ZC9H 5L30H 4X6PA 1O3OA 3BTTE 3ZZBA 3FP7E 5GWZA 4UFDH 1TPAE 2ZU2A 4K69A 3ZVEA 1GMHG 1A46H 4ABFA 4O3TA 1X7AC 2FTLE 3M5NA 2P16A 3TVJB 3GY2A 1F5KU 2AH4X 3UPEA 9LPRA 2G51A 1P57B 1GBKA 1JBUH 5FBEA 2ZA5A 1WUNH 1FONA 3GYMA 2CV3A 1W3CA 1D3QB 4ZHMU 2HPPH 3ATLA 3MNSA 1GJBB 1O0DH 5CE1A 5PTPA 2ZHDA 1BRUP 3ZZ6A 1UVOA 3BTFE 3TGIE 2J92A 2JETC 2O9QA 3VGCC 1QTFA 5EQSA 2A5AA 3MYWA 3TU7H 4Y6DA 5DP9A 5DP5A 3F68H 3QLPH 2Y80A 1P2QA 1TBRH 1W11U 3B9FH 2PGBB 1V2OT 1Z1IA 3MFJA 5EG4A 1JOUB 1YGCH 1YBWA 2HRVA 3BTEE 4NIVA 3RMNH 3K65B 4DURA 3SI4H 1C5MD 1QY6A 2GGVB 1O5GH 3GCTF 3UOUA 3ENSB 2D1JA 2O8MA 1OP8A 1GHAG 1OOKB 3A85A 1BDAA 2P93A 1L1GA 1C1MA 2GD4B 4BTUB 1KY9A 1PQ8A 4O97A 4NWKA 4H6TA 2B5TB 1YPKH 1FIZA 1GJ9B 1BMNH 3SORA 4MDSA 2BZ6H 1G36A 3U69H 2XC0A 4KELA 1UVPA 3BTME 2ZPRA 1A5IA 3LJOA 2FXRA 1ZHMA 4THNH 1LHFH 3SGBE 1QNJA 1DUAA 1NPMA 1QQUA 3PMJA 2LNCA 1GDUA 1GBDA 1ZGVA 2ILNA 3Q3XA 4I8LA 1O2UA 3T26A 1SGRE 2P95A 1EAIA 2J94A 2FWWA 3EA9A 3PMHB 1TMBH 1WBGB 1DT2A 4YOGA 1C1TA 2J9NA 2NU0E 1SSXA 1IQNA 3TJUA 2BTCE 1GMCG 1O32A 2Z9JA 1J16A 1OPHB 1ZSJA 3EGKH 1C5WB 1V2VT 3M3SA 1C1QA 2AMPA 3SNBA 2BVSH 3H5CB 4R8TB 2BD7A 1Y3YA 2H5CA 2ASUB 1SGEE 3SU3A 1ELTA 3UNSA 2IJOB 5ETXA 4DIHH 1AHTH 3R0FA 2PFEA 3S0NA 2FP7B 2R9PA 3UUZA 2FDAA 5IDKA 1A61H 1D6WA 1HAIH 1CBWB 3ZYDA 2B9LA 1IQEA 4AORA 1OP2A 2CF9H 2ANWA 1SR5C 1MCTA 1LDTT 1MAYA 4K1EA 2QXJA 2VWNA 1FJSA 5DP4A 4JZFH 8KME2 5DPAA 1A0HB 1T8MA 1GI2A 3T5FH 3RMMH 1TGCA 4IW4E 4WH8A 1FAXA 3ATKA 3V12A 2R3YA 3MH4A 3V0XA 1DWEH 1HUTH 3VB4A 2Q6DA 2ZDLA 1O5EH 3ZV9A 2G8TA 2ZECA 1HIAB 2AMDA 4CHAB 5SGAE 1GL1A 1AB9B 2V3HH 1O2ZA 4A1VA 1ZSLA 1NESE 1GBIA 2A2XH 1V2JT 3UWJH 1IQKA 4JZEH 4ZKRU 3SJ8A 3U8OH 3S9CA 1F2SE 3SV9A 3MU1A 1O2VA 5EOKA 1KXCA 2GZ7A 3D23A 2F9NA 3BG8A 1A3BH 3ZZ4A 2G5NA 2ZF0H 4MPXA 3ATWA 1ARBA 3LJJA 2SGQE 2F9PA 1V2UT 1XUKA 1OWDA 3ZVGA 3TLOA 3MH7A 4JYTA 1DWBH 1NC6A 4K3JA 5T6FA 4E05H 4CREA 3RM0H 2W3KA 2H1UA 4X2YA 4BAHB 4FU7A 1CBWC 1KDQB 1C5YB 4H42U 1AIXH 3P8OA 1QB1A 5T6GA 2ZGXH 1SGQE 3PWBA 2TGTA 3E8LA 1A5GH 2C90B 2Z9LA 3RDZA 1SOZA 3A86A 2OC0A 1ZJDA 2AGGX 9ESTA 1O2RA 4CHAC 1SOTA 3HKJB 1AB9C 3GDUA 3RXMA 1XKBC 1F0RA 2A32A 4NZQA 1N6YA 2PKAA 1BOQA 2AMQA 3SNDA 3M35A 3NZIA 4X2WA 1UTOA 4AYVB 3GDVA 1HFDA 4TY7A 3BV9B 2HGTH 3EYDA 4YM9A 4PROA 2EEKA 1HAVB 1FY5A 3MI4A 1P10A 1Z6EA 1H8IH 4IGDA 1HJ9A 1DSUA 1YPHC 1NROH 5JBCS 4BAOB 1KIGH 4BTTB 1CT0E 5HXFA 3RC5A 1HAXB 2QF0A 1F0UA 3RC6A 3S7HB 1TNLA 1O2YA 1GI7B 1C1VH 3LH3A 3F9HA 3VFEA 1AQ7A 2QA9E 2ZGBH 3SV8A 5C1YA 5DP6A 5A0AE 1KXDA 1GG6B 1TALA 2PWXA 3E0PB 1ZPBA 4MPWA 1ZHPA 1TNKA 1O2QA 3RU4E 4K1TA 3OTJE 3UOPA 4Y7BA 1ZPZA 1C5VA 3JZ1B 4CBNA 2QF3A 1NFYA 1MTWA 1A4WH 1GBLA 1V2KT 3V13A 2BLOA 4ABDA 1XUFA 3ZZ7A 4DCDA 3TH2H 5ABWA 1Q2WA 3LGYA 1FNIA 5DJ7A 4IMZA 5C2ZA 1C2EA 2QY0B 3LH1A 6ESTA 1W13U 2WV4A 2YOLA 2G4UA 1UHBB 3GY7A 3GY4A 2BHGA 3P17H 3M37A 4MVNA 3A8DA 1O2SA 1NRSH 2FOAA 4JZDH 4KKDA 1G37A 1TPPA 3P6ZB 1D9IA 5EODA 1P9SA 3P92A 1S85A 1ANBA 4ZHAA 3TJVA 1SHHB 3M5OA 3EQ0H 3A84A 2HWLB 1PPFE 3B8JA 1FY3A 2BDYA 2TIOA 2BY5X 1MBMA 1PYTD 3KEEA 4Y7AA 3SV6A 1TONA 2D2DA 3E1XB 3K6ZA 3ZZDA 2OCVB 5E2OA 1UTJA 1LPGB 4FUBA 5C67A 3GICB 3PTBA 2ZHEH 5FBIA 1GG6C 2WUCA 2ODQA 1WQSA 1OX1A 4Q80A 1KTSB 4A92A 4IN2A 3F9EA 1N6XA 1O36A 1G3EA 4NA9H 1P2JA 1NZQH 1XM1A 5DP8A 2FYRA 3MU5A 2GV7A 1UVSH 1RS0A 1C4Y2 4A6LA 1QHRB 1JMOH 1JXPA 1VITH 2Z9KA 2B0FA 4IC5A 1YPGH 2BLQA 3DD2H 5CMXH 1T8NA 1P09A 3EA8A 2JKHA 5FPSA 2G00A 1BHXF 4H4FA 3GCTG 1P06A 3BTHE 1UTQA 3P70B 4MPUA 3WY8A 1Y3UA 3GDSA 3RXSA 3UQVA 1GI0A 2ZU4A 1LHDH 1C4V2 1P04A 2FOBA 2ZHFH 2C8YB 4I31A 4U32A 2WV5A 3Q00A 1K1IA 4BXWA 3QTOH 1KXFA 2HOBA 1DM4B 2H5DA 2GCTB 1NRRH 2BLWA 3M3VA 2BX3A 2ZPSA 3OU0A 1SMFE 5DO4H 3MNBA 1CGIE 4DY7B 1HIAA 2DE8A 3GCNA 1N1LA 2RG3A 4E7NA 1QL9A 2BDHA 2F91A 1K21H 1EJAA 2ZDKA 1W7GH 1Y3VA 3A7XA 1V2ST 2BY7X 3SJ9A 2QV1A 1TPSA 2GV6A 1ZMNA 4BAQB 1EZUC 2J34A 1BTXA 1C2DA 2OQUA 5TJXA 3M7QA 3T2NA 1HAOH 4NG9H 1AVGH 1FIWA 1AO5A 4F49A 1G9IE 3BF6H 1YF4A 3RXKA 1C4U2 1P02A 2GVFA 3RC4A 1XX9A 5JB8S 2AS9A 1ZTJA 3SJIA 1LQEA 3A81A 1O3NA 1A5HA 1XUIA 4YLQH 4MLFB 3O8CA 2B7DH 4Y8YA 3KQDA 2PR3A 1EASA 4IBLH 1O2IA 4X1QU 1ELVA 3LT3A 3MU8A 1WV7H 1TMUH 2NU1E 2Z3DA 3A8CA 4Y10E 1LHGH 2Z94A 1GI8B 4I8KA 3RXQA 1S82A 5J4QA 1DS2E 2GCTC 3FANA 2ZNKH 3NKKA 1GJ8B 3GCOA 3SJKA 1GBTA 1GHZA 2H9HA 1O3MA 5I46H 3BG4B 2BVXH 1T7CA 2AGIX 2P59A 1EAWA 5E0JA 3T27A 2BD5A 4JMYA 2FTMA 1AWHB 1GHXH 2THFB 2A7JA 1P2OA 1GBAA 2CXVA 3ZV8A 1K1OA 4HFPB 4HTCH 4LZ1H 3UNRA 1WYKA 2ANKH 3U9AH 1V2RT 2VWMA 2Z7FE 2FMJA 1C1SA 1BA8B 1WQVH 4GPGA 1UTLM 3CS0A 1W7XH 3NPSA 2ZG0H 1JIRA 1C2MA 4NCYA 3BTGE 5JBBS 3N7OA 1TFXA 2PSXA 1EB2A 3MU4A 3PO1B 1YPHE 1GBEA 1BZXE 1SC8U 2VVUA 2ZDAH 2W7SA 2XXLA 1C9PA 2A4RA 2V6NA 2A1DB 2YNBA 1S81A 1V3XA 1WSSH 1HYLA 3KQCA 4D76A 1AN1E 2STBE 5GCHF 1QR3E 2WYJA 2WPKS 1AY6H 4Y76A 1O3PB 1J15A 1THRH 3E6PH 4D8NA 2JETB 1CQQA 5T6DA 1LO6A 3STJA 2GCHF 1KTTB 2ZGCA 1TX7A 1O33A 4INLA 2AIQA 4F4OC 1MTSA 6LPRA 1BBRE 4IMQA 4FUFA 2ZP0H 1HB0B 2VB0A 1W14U 1OWIA 1B5GH 2ZFPH 4B2AA 1XKAC 1QBNA 3Q3KA 2OP9A 4NGAH 2ZKSA 3SV7A 1TRYA 2Y6TA 1P9UA 2WPLS 2ZZUH 5FCKA 1ZJKA 5DK1A 3ZZ3A 1K1PA 2A45B 1VJ9U 3SU0A 1SLWB 4LZ4B 3D49H 4OS6A 3PROA 1H9IE 3TK6A 2QN5T 3LKWA 2FI5E 2VH6A 1D3DB 3NUMA 1MTVA 3A7WA 1CVWH 1Z1JA 2W3IA 4Z6AH 4B73A 1DXWA 1C1NA 4Y0YE 1J9CH 2BM2A 4ISNA 1C9TA 2SGAA 4R0IA 3PO1C 2FOMB 4FUGA 3SU5A 3LDXH 1RRKA 5BPEA 4ZHLU 4GUXA 1CA8B 3VEQB 1G3DA 1V2QT 1O3EA 1RFNA 1ANDA 2RCEA 3F9GA 1NTPA 1K1MA 2RDLA 3HK3B 1ETRH 2OC1A 1HAYB 1GBJA 5GXPA 2QAAA 1GCDA 2V35A 1G2LA 1XMNB 5A0BA 2AFQB 4OS1A 2HVXA 1SLVB 2Z9IA 4WH6A 3KIDU 3SGAE 4B76A 1SQOA 1TNHA 4ZKOU 1Z6JH 1VCQA 3GOVB 3KQEA 3VB3A 3T62A 2F9UA 4DJZB 3ZZCA 1EOLA 4O03A 2XCNA 1SL3A 1EP6A 4BTIB 1MKWH 2R3UA 5LPFA 3QX5H 1F5RA 1HV7A 1E0FD 3D62A 1O2TA 1ZMLA 3SUDA 5C20A 4AX9H 1OSSA 1MU8B 1JRSA 4YESB 2WPIS 2FYQA 2PUQH 1BIOA 1TX6A 2OC8A 1ZTKA 1DOJA 2F83A 3URDA 4M7GA 5LPEA 3SNCA 3SQEE 1UTPA 3MH6A 2SGDE 1O2KA 3U1JB 2ODYB 3QGJA 1SGTA 1F5LA 3ZVDA 5JBTA 3BTKE 2VVCA 5GDSH 4BXSA 2O8LA 2Q6GA 1O5BB 1VITF 4YOJA 2DE9A 4YOIA 1AVWA 1C5UA 2STAE 4I8GA 2XC4A 1K2I1 3BIVH 4GVUA 1EP5A 1C2IA 1ELAA 1YM0A 1GI3A 3SO3A 1QJ6B 2BQWB 2XBXA 3A82A 1YCPM 3RLYH 1UTNA 1QBVH 1AWFH 2VWLA 2A4OA 1HAGE 5FAHA 4I8HA 3BTDE 2BX4A 3HGPA 1MKXH 1B0EA 4U30A 4ZROA 2O8UA 3M61U 4GHQA 2FS8A 8LPRA 4UFFH 1DX5M 2Q6FA 1T4VH 3EE0B 3MO6A 2ANMH 4XBDA 5F03A 2G55A 2F9OA 1PPCE 1HXEH 2BMGB 4I7YH 3LGUA 1G30B 1L4ZA 1TRMA 2QIQA 1BJVA 1BMMH 2GP9B 4BANB 4CRBA 3SGQE 2R2MB 2UWLA 4BNRA 5LPRA 2IOTA 1BJUA 1GBHA 1BMLA 3EAJA 7GCHF 1EATA 3QZRA 4WF8A 2GZ8A 1O3LA 2WYGA 1QB6A 1PPHE 1D3TB 2HNTF 4X0WU 1TYNA 3I77A 1A1RA 1A0JA 3RU4T 1SGNE 1DDJA 1O5AB 3A7YA 3TK5A 3QO6A 1YPLH 2BDIA 3HATH 3B23B 5F8XA 2Q1JA 2FOEA 1NU9A 3KN2A 3VB5A 5EXNA 4IN1A 1C5PA 1N8OB 4TPYA 1L4DA 2Y5HA 3PB1E 4MG3A 4BAMB 1QL8A 5C1UA 3DT0H 1YP9A 2SFAA 3AAVA 5C5NA 2ZTXA 1E34B 4ISHH 1EPTB 1B0FA 3PV4A 2FOCA 1VZQH 2FZZA 5F8ZA 3GISB 1SGCA 1TLDA 1NRQH 2C8ZB 2CN0H 1H8DH 1DXPA 4CR5A 4XDEA 4U2WA 1SGFG 1GJDB 1P05A 1ABJH 2D26C 4TWYA 1QL7A 3SNAA 1FN8A 3FP6E 1QRZA 3HGNA 3KF2A 1EB1H 1QURH 5JPMH 2BD2A 2XC5A 1O2WA 3TJNA 2XWBI 1U6QA 1O38A 1SGPE 2GDDA 1SLUB 3V3MA 4TWWA 1ZLRA 1C5SA 2G5VA 1AUJA 1O2GH 2GZ9A 3RM2H 1P12E 1KXEA 1PQAA 4XBBA 1NM6A 2VIOA 5DGJA 1D4PB 3BIUH 2BZAA 4RSPA 1FN6A 2GT7A 1P03A 2ZCLP 3SUEA 5FX5A 1PYTC 3FAOA 3BEIB 3RMLH 1O2MA 4K5ZA 5EXMA 1K1JA 3RXVA 4OS2A 4Y79A 4AN7A 1XVOA 4IS5A 1C5OH 1LVMA 3SU6A 4HZHA 5EW2H 1ACBE 2V3OH 2W7UA 2BY8X 4MNYA 1N8OC 1GJ6A 5FPYA 8GCHF 4WVPE 2BY6X 2SGFE 2ZFRH 1UJ1A 2ZHWH 3ELAH 4JK6A 3STIA 1EPTC 3UTUH 4FUDA 1ZRKA 2GT8A 1BUIA 4WY3A 1MKWK 1DSTA 4K2YA 5GCHG 3KL6A 3LC5A 7LPRA 2SNWA 3ZVAA 2PGQB 4OS7A 3RXPA 1P3CA 1YC0A 1MCVA 3TNTA 1SQTA 2GCHG 1MAXA 5A8ZA 3IG6B 1BTWA 3UR9A 5ESTE 1T8LA 3MHWU 2QXGA 3E3TA 5TCAA 1S6FA 4X6MA 4HI3A 1PFXC 3U8RH 1L0ZA 3LOXA 4B2CA 3PLPA 3H7OA 4SGAE 1O30A 3AAUA 4D7FA 1RTFB 4FU8A 2V0BA 3V7TA 3I29A 2RA3A 3A87A 4A7IB 4ABBA 1W2KH 1O2HA 2QCYA 3UNQA 3RXBA 3Q76A 1FI8A 1NRNH 1ZYOA 1DFPA 2XBYA 1FQ3A 2PW8H 4B1TA 1EZSC 1C5LH 1MZAA 1C2FA 2WINI 1C1RA 1CE5A 3RXGA 1EZXC 2Z9GA 3T29A 1MKXK 3L33A 2CHAB 3I78A 1QBOA 3GY5A 4MPVA 4Y8ZA 4UFGH 4MNWA 1XUJA 1TQ7B 2QC2A 2BLVA 2OBQA 1AKSA 1GHBG 2ZQ1A 3RMOH 4LK4A 1HAZB 1LPKB 1GVKB 4RN6A 1SPJA 3S9AA 5LGOA 4D9RA 1KXAA 1YYY1 4E06H 1NY22 2XWAA 4AFUA 3M3TA 1RGQA 4K60A 4Y71A 4ZXYH 4XFQA 2H6MA 1C5XB 2ZPQA 1SGIB 4DG4A 5C3NA 5A09A 1KLJH 2ZGJA 1JIMA 1FUJA 3FFGA 1NFWA 1RTLA 3LGTA 3RXCA 1ANEA 1QIXB 3OSYA 2A0QB 4WXIA 1OWHA 1B7XB 1WU1A 4RKJB 3E0NB 7KMEH 1O3FA 5E0GA 3ESTA 2P3UB 4ABJA 2F9VA 3S69A 1C2JA 1K22H 2FLRH 3GCHB 3FZDA 3RXAA 3NXPA 4B71A 1MU6B 4AFZA 1C1OA 2OXSA 2HLCA 2VNTA 1AD8H 2VINA 4FUCA 1O3CA 2Y7XA 3LONA 1GHWH 5L6NH 2CHAC 2FEQH 1LPZB 1TBZH 3BTQE 1P3EA 3DFJA 2VIVA 1GHVH 1VITG 2UUFB 1TOCB 4MTBA 3RXRA 1O3HA 1OYTH 3SHCH 1HDTH 3FZZA 2JH0D 1WAYB 1FAKH 4Q2KA 3VXFH 4JK5A 1IAUA 4AGKA 4INKA 1TA2A 2UWPA 2A4QA 1E37B 1PPBH 1L1NA 1S5SA 2PSYA 2Y5GA 3K9XB 4KTCA 2BD8A 5E0HA 1GI6A 1HJAB 1A2CH 2GTBA 5A8YA 1FPCH 5L2ZH 4GCHG 1XUHA 1IQHA 1BQYA 1ELGA 1AZ8A 2OUAA 1H9HE 1UK3A 1IHSH 1HPGA 1S0RA 1EPTA 2BVRH 1TX8A 3W94A 2ZIQH 3A8BA 1MD8A 4JYVH 3GCHC 2FODA 1V2WT 1O5CB 5K7RA 2C8WB 1LVBA 4UDWH 5HGGA 4X1PU 4ASHA 1C2LA 4NZLA 1ZSKA 3U8TH 6GCHF 2GX4A 1AI8H 3VB6A 3SQHE 4Y0ZE 1EAUA 4ZKSU 1LVYA 3ZVBA 1UVTH 1WTHD 7GCHG 3A7ZA 3ZZ8A 2PKSB 2A5IA 2PTCE 1NU7B 3TK9A 5K0HA 3TPIZ 4AG2A 3BTWE 2OQ5A 3FP8E 2ZDMA 1BCUH 3P8FA 1M9UA 3MNCA 5FX6A 2CGAA 1GPZA 1GWAA 1ZTLA 4YT7H 4X8VH 1DLEA 3W95A 2JH6D 4DVAU 4CRAA 2A4GA 4X8UH 1P0SH 1SG8B 3SU4A 1TGNA 1Y8TA 1TGTA 1OP0A 5DKMA 3PWCA 5TCCA 4K8BA 1EJMA 4ZMAH 2P3FH 1MH0A 1FZZA 1AE8H 4JCNA 3SU1A 1AZZA 1C5NH 1HJAC 1BT7A 1L2EA 1ZRBA 3UY9A 1QB9A 1TNJA 5DG6A 1O2JA 3SN8A 3FVFB 4UONA 3RXHA 1ZGIA 2ALPA 3P95A 3QUMP 5DP7A 1HJ8A 1H9LB 1YLCA 1NT1A 1BBRH 1H1BA 1O3IA 1GVLA 3T28A 2C8XB 2FO9A 4AB8A 7ESTE 3MH5A 8ESTE 1IQMA 2QXIA 1FY4A 1PPEE 4VGCB
chains in the Genus database with same CATH superfamily
3C1KA 1AGJA 1IQJA 3RP2A 5IYTA 1IQFA 2G4TA 2PKSC 3VB7A 1TAWA 2FS9A 1Y3WA 5HIZA 3KGPA 1Z8GA 1ORFA 4ISLA 2VWOA 4X2XA 5LH8A 2JIZD 1HCGA 1TB6H 1SGDE 2NU2E 2O8TA 3FKSD 1P01A 1G32B 1P2MA 2G52A 4E7RG 2C93B 4WMDA 5AFYH 1HAHH 4X1NU 4J2YB 3ATMA 1GMDF 2VIDA 1XVMA 2ZU5A 5HIYA 1CHGA 1DLKB 4SGBE 3VXEH 1SHYA 1IQGA 3MQKC 1OXGA 1GI5A 1EZQA 1BTPA 4H6SB 5GPIB 8GCHG 3P8NA 4AFQA 2PV9B 1F0SA 4O3UA 1AUTC 2TRMA 1EKBB 5JDUB 1CT2E 3ZVCA 3MOCA 4KP0A 4YZUA 3L3TA 2WPMS 1PQ7A 1DICA 4NA7A 4Q7YA 1ZMJA 2P94A 4UEHH 4XE4A 1CU1A 4AB9A 2RA0A 2TGDA 2Y5FA 1GI9B 4UD9H 2QE7D 1OYQA 2R2WU 1J8AA 5EXLA 5FHTA 3P8GA 1ZHRA 1HRTH 3ODFA 3AW0A 1GHBF 4CRGA 1P2IA 2TPIZ 3M5MA 4NIYA 4NFEA 1K28D 2NU3E 5C0TA 1SB1H 1C5RA 2EQNA 2HPQH 4VGCC 1KXBA 4X6NA 4YLUA 1TIOA 3FO8D 1TGBA 4BOHA 2Z6BD 3TJOA 1NS3A 4ZAEA 2BB4A 3CS7A 1Z71A 4ZH8A 1YPEH 4MNVA 3UREA 4DT7B 4QT8C 2FIRH 2FX6A 3S7KB 2EI6A 2H9EH 2AGEX 1V6DA 4Z0KA 3BN9A 1AE5A 1WCZA 3BSQA 3SZNA 2NU4E 2WPDD 4CH2B 1OS8A 3TGKE 1YLNA 2KCYA 3TIUA 1AVXA 1EAXA 3PMBB 3TITA 1YPMH 2DUCA 4ACAA 4ZXXH 2W5EA 1C5QA 3F2FA 3AW1A 1A3EH 1MBQA 2AYWA 4K8YA 5EIYA 4KGAA 2ZFFH 3ZYEA 1GBCA 4ABIA 1V2NT 1O2LA 4AG1A 1UCYH 2EI8A 1VCWA 2BYAX 5T3HA 1KLTA 1S84A 3PLKA 3QWCH 5EJLA 1JRTA 4TPIZ 5EJZA 3QDZB 1AKSB 5EQQA 2UUYA 4ABEA 1C5ZB 2VJ1A 1G2MA 3U98H 2ZFSA 5A8XA 2FX4A 1UCYE 3NWUA 4AOQA 4U01A 4B74A 4O9VA 2C3SA 2BD4A 4AFSA 1FY8E 4X8TH 2ZHQH 2PHBA 4YO9A 3RXFA 3SW2B 2OINA 4I8JA 2O8WA 2PUXB 3PTNA 2F3CE 1SGFA 1YKTA 3EE7A 2ZQ2A 1O3BA 4TY6A 2ZTZA 3RU4D 2VIWA 5GNDA 2GKVE 1O3AA 2BQ6B 1FXYA 5EPNA 5E8EH 1K1NA 1TWXB 4GCHF 4I86A 1C5TA 1MTNB 2J2UA 4FUHA 4JZ1A 1FPHH 2Y81A 2TGAA 3SNEA 1W8BH 1C2HA 1W0ZU 3A8AA 4NWLA 2CMYA 4Q7ZA 1GJ5H 4ISOA 1FV9A 2XCFA 1TA6A 4ZUHA 1RIWB 4FVBA 1O5FH 3MTYA 5B6OA 2HVYB 1WXRA 2XW9A 2ZFQH 5AF9H 1CGHA 3CNRA 4AZ2B 1DE7H 5HMAA 4MNXA 1LKBA 2FLBH 3F1SB 3PLBA 1TNIA 3EA7A 5FPTA 3C27B 1OWJA 5EW1H 3A7VA 1LHCH 2J38A 1BBRK 1C1PA 4WMFA 3SUFA 1E36B 5AVDA 1AMHA 1KYNA 1O2NA 1YPJH 2A7CA 2TGPZ 4UFEH 4IC6A 3UIRA 1YCPH 1SFIA 5EGMA 3HKIB 1VGCB 3NK8A 1TOMH 1INCA 1T31A 4B75A 3SJOA 2JJ1D 5C94A 4UE7H 3O8DA 5F6MA 4RKOB 2ALVA 3PMAB 1UW7A 3MO3A 1LMWB 5DP3A 1CHOF 1JWTA 2PTNA 2ZCKP 2KCOA 1EJNA 2VVVA 1MZDA 2Y7ZA 4JZIA 6CHAB 2HNTC 1MTNC 1S6HA 1Y59T 3S9BA 2VIPA 1S83A 3RUOA 1K1LA 3PYHA 1GI1A 6GCHG 3H7TA 3HK6B 3QK1A 4X8SH 1OWEA 3U28C 1P11E 2OBOA 3UWIA 1RIWC 1A7SA 2BOKA 1O34A 2BD9A 2J4IA 1Q31A 2FOGA 1KMHB 1VR1H 2QF4A 4X6OA 1AU8A 3RXDA 3ZVFA 2BD3A 1QA7A 4P02A 5GJ4B 5GIBA 2OD3B 1DY8A 1Z8IB 4CRFA 1HGTH 1CO7E 1AFQB 3RLWH 3FOAA 3IITA 3IWMA 1DY9A 3CENA 4OGYA 3R3GB 4OS4A 2WPJS 1GJCB 3UR6A 1W12U 3QGNB 1HAPH 3GYLB 1F92A 5BRRE 2QXHA 2KAIB 3SOSA 1EUFA 2VU8E 2J95A 1LHEH 3ZZAA 2SNVA 1VGCC 2XOKD 2CJIA 4WJG2 3RXJA 1QJ7B 1ABIH 2GJGA 2ZU1A 3BEFB 4TYDA 3E91A 2P8OB 1LQDB 4CRCA 1PPZA 3K2UA 1GHYH 4Q7XA 1ELEE 1DUEA 3RXUA 5F53A 1ESTA 4CH8B 3SI3H 2HALA 4RI0A 2BXUH 2ANYA 1C2GA 6CHAC 2UUKB 3EDXB 1BTHH 4DW2U 1F0TA 3GY3A 5AFZH 5A0CA 1O3GA 2FOFA 2I6QA 1W0JD 2BOHB 4OS5A 4WMEA 1O3JA 4FUJA 1GL0E 5C5OA 1BTYA 1O2OA 1TBQH 2B8OH 2IPHA 3OY5U 3M7UA 1BTZA 1GMHF 4A1XA 1T4UH 1WOFA 2A5KA 5HYOA 4YT6H 1LKAA 1UMAH 2P3TB 1BRCE 5A2MH 3LGVA 1KLIH 2WUBA 3DUXH 1GDQA 1IHTH 4DOQA 2YMSD 1DVAH 3VPKA 2ODPA 3ODDA 2FESH 5HM9A 3QN7A 4HGCA 1UCYK 1Y5UT 1GCTB 2XBVA 1DPOA 4FOUC 3LGIA 2ZEBA 1AFQC 4XOJA 1CT4E 3NCLA 1CSOE 3SU2A 3U1IB 1TQ0B 2ZCHP 1E35B 2XYAA 2GDEH 1GMDG 1PQ5A 3T25A 1NN6A 1LVOA 1SGYE 1UTMA 1GBFA 3GY8A 1ELDE 1J14A 3UFAA 1UK4A 4XSKU 1WTGH 2Z3CA 3KCGH 1ESAA 2IJD1 3MNXA 1UVUH 1T8OA 1T32A 1FMGA 1H8HD 4NIXA 5E2PA 4A5TS 2OC7A 1TNGA 3PM3A 1NRPH 1ARCA 1XUGA 3Q77A 1O2XA 4ISIH 1D6RA 4OM9A 1MQ5A 2H2ZA 2P8OC 4GSOA 1DWDH 4XRNA 1RJXB 4GHTA 2VIQA 3OFND 3MMGA 1BHXB 1GHAF 2XNIA 2FPZA 1UTKA 3KHVA 2AIPA 1Q3XA 3QZQA 5JB9S 2QGRA 2UWOA 3OY6U 1VCPA 2EY4C 1MD7A 2PLXA 3LGWA 4NFFA 2ZGHA 1CGJE 1ZZZA 5C1XA 3CP7A 2FOHA 1LCYA 2F9BH 2AERH 1QJ1B 4CRDA 2LP6A 2K1QA 1ELFA 2FI4E 5EPYA 2BXTH 1H4WA 1ELCA 2OTVA 3HPTB 3ZZ5A 4KTUA 1FDPA 5I25A 3DA9B 1MMJN 1GCTC 4LOYH 1BMAA 1GBMA 4BAKB 1GGDB 2WZQA 3M36A 1O5DH 1GJAB 3URCA 1GJ7B 1SI5H 2GMTB 3RXOA 2ZDNA 1E1QD 4D9QA 1S0QA 4D7GA 1GMCF 1PPGE 2BY9X 1FY1A 2M5TA 1VJAU 1THPB 1TPOA 1TGSZ 3ITIA 3KYGA 4J1YA 4Y11E 4Y8XA 4NA8A 3RXEA 3UQOA 4B2BA 2ULLA 3NRLA 2CK3D 4I33A 5FXLA 1PJPA 3SBKA 3DSPA 3OYPA 2BDCA 1C1UH 1YCPK 1EOJA 1P8VC 1D3PB 5ESBA 1ETTH 4KTSA 2EA3A 4X2VA 1BB0B 2D8WA 1OWKA 4AGJA 1CA0B 1BTUA 2J98B 3A83A 2ESTE 4TT3D 3MU0A 4GLYA 3L6PA 5EQRA 4K1SA 1TE0A 1RTKA 1YLDA 4AYYB 3A7TA 1J17T 1ELBA 1GVZA 2C4FH 3ATIA 2WHXA 4X1SU 1UK2A 3KQBA 4I32A 5CDFE 1HLTH 1THSH 4LXBH 1A0LA 2YNAA 3TH3H 3TH4H 1UO6A 4YTAA 2EI7A 1EX3A 1SVPA 4FUEA 3QTVH 2I6SA 1TRNA 1K9OE 3A80A 1H8ED 1QRWA 1IQLA 3O8BA 4F48B 5CHAB 4FU9A 1FLEE 1W0YH 4A1TA 2KCPA 3JZ2B 1O39A 2Z3EA 4NSVA 3H09A 2JH5D 1QRXA 1ANCA 2UUJB 4FVDA 3O8RA 1MQ6A 1GGDC 2BDGA 3VG8A 2A7HA 1P2NA 3GY6A 1ZOMA 1QA0A 2GMTC 2XRCA 5HM2A 2ZU3A 1HNEE 1BITA 2QYIA 4ESTE 3F6UH 3DFLA 1E38B 1GJ4H 1Z8JB 4WXVA 1IOEA 2BDAA 3LIWA 4NIWA 3F2HA 2A31A 1ZR0A 3BEUA 1ZPCA 4OGXA 3E16B 2A2QH 1O37A 1MTUA 2HNTE 1EXFA 3MWIU 1CA0C 1V2MT 2VGCB 5J4SA 1C2KA 2R0LA 5H4IB 5T1VA 2M2AA 4XBCA 3TGJE 2IN2A 2CF8H 1KDQA 4GAWA 4FXGH 3G01A 2SGPE 1Y5AT 4ABAA 4ABHA 4WWYA 1Y3XA 2LPRA 5AHGH 1QGFA 1NO9H 2AEIH 5EU8A 4DGJA 4CBOA 1LTOA 1L1JA 1GI4A 1HBTH 1SQAA 2G81E 5C0UA 1MUEB 2ZWLH 3LU9B 5CHAC 2KAIA 2SGEE 2TBSA 2VBCA 2FM2A 2EC9H 1TMTH 1DANH 1QCPA 4FUIA 2R0KA 1O2PA 3DHKH 3LPRA 1CHOG 2ZFTA 4INHA 3AASA 1EQ9A 1ETSH 1SBWA 1IQIA 2FI3E 4ABGA 1HAVA 3ZZ9A 2H9TH 1HXFH 1KSNA 1V2PT 1Z7KA 4JYUH 2ZO3H 1O3DA 3K6YA 1OKXA 1TABE 2XBWA 3M5LA 1V2TT 2NWNA 1F7ZA 1P2KA 3F9FA 1AFEH 2Y82A 1SLXB 5G4BA 3SHAH 1SFQB 3KNXA 5FCRA 1QFKH 1DITH 3DSGA 4MQAA 4ZKNU 3Q3YA 2VGCC 1O3KA 2VH0A 3LC3A 3E90B 3TNSA 4RT0A 3RXLA 3RXIA 2W6ID 4DIIH 1GDNA 1GBBA 1G3CA 1XXDA 1O35A 2W26A 4XD7D 3A89A 1RXPA 1G3BA 5JBAS 1ID5H 2XTTB 3OX7U 1O31A 1V2LT 3PV5A 3VGCB 2ZDVH 1BRAA 4TSFD 2ZI2H 4CR9A 1XXFA 1W10U 1DWCH 3D65E 3A88A 5F8TA 2BQ7B 3BG4C 3MO9A 2WPHS 2PKAB 2BDBA 1Y5BT 1NFUA 1C1WH 4NSYA 3M7TA 1UHBA 1ESBA 1Z8RA 1BRBE 5JYIA 2OLGA 3AVZA 1QQ4A 3RXTA 3SV2H 2ZTYA 3SYJA 5L2YH 4X1RU 1NFXA 3SUGA 1RD3B 2ZC9H 5L30H 4X6PA 1O3OA 3BTTE 3ZZBA 3FP7E 5GWZA 4UFDH 1TPAE 2ZU2A 4K69A 3ZVEA 1GMHG 1A46H 4ABFA 4O3TA 1X7AC 2FTLE 3M5NA 2P16A 3TVJB 3GY2A 1F5KU 2AH4X 3UPEA 2XNDD 9LPRA 2G51A 1P57B 1GBKA 1JBUH 5FBEA 2ZA5A 4B6EA 1WUNH 1FONA 3GYMA 2CV3A 3SZEA 1W3CA 1D3QB 4ZHMU 2HPPH 3ATLA 3MNSA 1GJBB 1O0DH 5CE1A 5PTPA 2ZHDA 1BRUP 3ZZ6A 1UVOA 3BTFE 3TGIE 2J92A 2JETC 2O9QA 3VGCC 1QTFA 5EQSA 2A5AA 3MYWA 3TU7H 4Y6DA 5C17A 5DP9A 5DP5A 3F68H 3UAIC 3QLPH 2Y80A 1P2QA 1TBRH 1W11U 3B9FH 2PGBB 1V2OT 1Z1IA 3MFJA 5EG4A 1JOUB 1YGCH 1YBWA 2HRVA 3BTEE 4NIVA 3RMNH 3K65B 4DURA 3SI4H 1C5MD 1QY6A 2GGVB 1O5GH 3GCTF 3UOUA 3ENSB 2D1JA 2O8MA 1OP8A 1GHAG 1OOKB 2J98A 3A85A 1BDAA 2P93A 1L1GA 1C1MA 2GD4B 4BTUB 1KY9A 1PQ8A 4O97A 4NWKA 4H6TA 2B5TB 1YPKH 1FIZA 1GJ9B 1BMNH 3SORA 4MDSA 2BZ6H 1G36A 3U69H 2XC0A 4KELA 1UVPA 3BTME 2ZPRA 1A5IA 3LJOA 2FXRA 1ZHMA 4THNH 1LHFH 3SGBE 1QNJA 1DUAA 1NPMA 1QQUA 3PMJA 2LNCA 1GDUA 1GBDA 1YY3A 1ZGVA 2ILNA 3Q3XA 4I8LA 1O2UA 3T26A 1SGRE 2P95A 1EAIA 2J94A 2FWWA 3EA9A 3PMHB 1TMBH 1WBGB 1DT2A 4YOGA 1C1TA 2J9NA 2NU0E 1SSXA 1IQNA 3TJUA 2BTCE 1GMCG 1O32A 2Z9JA 1J16A 1OPHB 1ZSJA 3EGKH 1C5WB 1V2VT 3M3SA 1C1QA 2AMPA 3SNBA 2BVSH 2YMSB 3H5CB 4R8TB 2BD7A 1Y3YA 2H5CA 2ASUB 1SGEE 3SU3A 1ELTA 3UNSA 2IJOB 5ETXA 4DIHH 1AHTH 3R0FA 2PFEA 3S0NA 2FP7B 2R9PA 3UUZA 2FDAA 5IDKA 1A61H 3OE7D 1D6WA 1HAIH 1CBWB 3ZYDA 2B9LA 1IQEA 4AORA 1OP2A 2CF9H 2ANWA 1SR5C 1MCTA 1LDTT 1MAYA 4K1EA 2QXJA 2VWNA 1FJSA 5DP4A 4JZFH 8KME2 5DPAA 1A0HB 1T8MA 1GI2A 3T5FH 3RMMH 1TGCA 4IW4E 4WH8A 1FAXA 3ATKA 3V12A 2R3YA 3MH4A 3V0XA 1DWEH 1HUTH 3VB4A 2Q6DA 2ZDLA 1O5EH 3ZV9A 2G8TA 2ZECA 1HIAB 2AMDA 4CHAB 5SGAE 1GL1A 1AB9B 2V3HH 1O2ZA 4A1VA 3F3BA 1ZSLA 1NESE 1GBIA 2A2XH 1V2JT 3UWJH 1IQKA 4JZEH 4ZKRU 3SJ8A 3U8OH 3S9CA 1K0HA 1F2SE 3SV9A 3MU1A 1O2VA 5EOKA 1KXCA 2GZ7A 3D23A 2F9NA 3BG8A 1A3BH 3ZZ4A 2G5NA 2YMSC 2ZF0H 4MPXA 3ATWA 1ARBA 3LJJA 2SGQE 2F9PA 1V2UT 1XUKA 1OWDA 3ZVGA 3OAAD 2L6OA 3TLOA 3MH7A 4JYTA 1DWBH 1NC6A 4K3JA 5T6FA 4E05H 4CREA 5CHBA 3RM0H 2W3KA 2H1UA 4X2YA 4BAHB 4FU7A 2IPQX 3OEHD 1CBWC 5IK2D 1KDQB 5HKKD 1C5YB 4H42U 1AIXH 3P8OA 1QB1A 5T6GA 2ZGXH 1SGQE 3PWBA 2TGTA 3E8LA 1A5GH 2C90B 2Z9LA 3RDZA 1SOZA 3A86A 2OC0A 1ZJDA 2AGGX 9ESTA 1O2RA 4CHAC 1SOTA 3HKJB 1AB9C 3GDUA 3RXMA 1XKBC 1F0RA 2A32A 4ZCNA 4NZQA 1N6YA 2PKAA 1BOQA 2AMQA 3SNDA 3M35A 3NZIA 4X2WA 1UTOA 4AYVB 3GDVA 1HFDA 4TY7A 3BV9B 2HGTH 3EYDA 4YM9A 4PROA 2EEKA 1HAVB 1FY5A 3MI4A 1P10A 1Z6EA 1H8IH 4IGDA 1HJ9A 1DSUA 1YPHC 1NROH 5JBCS 4BAOB 1KIGH 4BTTB 3N7DA 1CT0E 5DN6D 5HXFA 3RC5A 1HAXB 3OTPA 2QF0A 1F0UA 3RC6A 3S7HB 1TNLA 1O2YA 1GI7B 1C1VH 5EJ1A 3LH3A 3F9HA 3VFEA 1AQ7A 2QA9E 2ZGBH 3SV8A 5C1YA 5DP6A 5A0AE 1KXDA 1GG6B 1TALA 2PWXA 3E0PB 1ZPBA 4MPWA 4RT1A 1ZHPA 1TNKA 1O2QA 3RU4E 4K1TA 3OTJE 3UOPA 4Y7BA 4Z1MD 1ZPZA 1C5VA 3JZ1B 4CBNA 2QF3A 1NFYA 1MTWA 1A4WH 3WWFA 1GBLA 1V2KT 3V13A 2BLOA 4B6FA 4ABDA 1XUFA 3ZZ7A 4DCDA 3TH2H 5ABWA 1Q2WA 3LGYA 1FNIA 5DJ7A 4IMZA 5C2ZA 1C2EA 2QY0B 3LH1A 6ESTA 1W13U 2WV4A 2YOLA 2G4UA 1UHBB 3GY7A 3GY4A 2BHGA 3P17H 3M37A 4FETA 4MVNA 3A8DA 1O2SA 1NRSH 2FOAA 4JZDH 4KKDA 1G37A 1TPPA 3P6ZB 1D9IA 3N99A 5EODA 1P9SA 3P92A 1S85A 1ANBA 4ZHAA 3TJVA 1SHHB 3M5OA 3EQ0H 3A84A 2HWLB 1PPFE 3B8JA 1FY3A 2BDYA 2TIOA 2J5UA 5B6LA 2BY5X 1MBMA 1PYTD 3KEEA 4Y7AA 3SV6A 1TONA 2D2DA 3E1XB 3K6ZA 3ZZDA 2OCVB 5E2OA 1UTJA 1LPGB 3PV2A 4FUBA 5C67A 3GICB 3ZIAD 3PTBA 2ZHEH 5FBIA 1E79D 1GG6C 2WUCA 2ODQA 1WQSA 1OX1A 4Q80A 1KTSB 4A92A 4IN2A 1NBMD 3F9EA 1N6XA 2RFKC 1O36A 1G3EA 4NA9H 1P2JA 1NZQH 1XM1A 5DP8A 2FYRA 3MU5A 2GV7A 1UVSH 1RS0A 1C4Y2 4A6LA 1QHRB 1JMOH 1JXPA 1VITH 2Z9KA 2B0FA 4IC5A 1YPGH 2BLQA 3DD2H 5CMXH 1T8NA 1P09A 3EA8A 2JKHA 5FPSA 1OHHD 2G00A 1BHXF 4H4FA 3GCTG 2WSSD 1P06A 3BTHE 1UTQA 3P70B 4MPUA 3WY8A 1Y3UA 3GDSA 3RXSA 3UQVA 1GI0A 2ZU4A 1LHDH 1C4V2 1P04A 2FOBA 2ZHFH 2C8YB 4I31A 4U32A 2WV5A 3Q00A 1K1IA 4BXWA 3QTOH 1KXFA 2HOBA 3GS9A 1DM4B 2H5DA 3OEED 2GCTB 1NRRH 2BLWA 3M3VA 2BX3A 5FL7D 2ZPSA 3OU0A 1SMFE 3UB0A 5DO4H 3MNBA 1CGIE 4DY7B 1HIAA 2DE8A 3GCNA 1N1LA 2RG3A 4E7NA 1QL9A 2BDHA 2F91A 1K21H 1EJAA 2ZDKA 1W7GH 1Y3VA 3A7XA 1V2ST 2BY7X 3SJ9A 2QV1A 1TPSA 2GV6A 1ZMNA 4BAQB 1EZUC 2J34A 1BTXA 1C2DA 2OQUA 5TJXA 3M7QA 3T2NA 1HAOH 4NG9H 1AVGH 1FIWA 1AO5A 4F49A 1G9IE 3BF6H 1YF4A 4P00A 1C4U2 3RXKA 1P02A 2GVFA 3RC4A 1XX9A 5JB8S 2AS9A 1ZTJA 3SJIA 1LQEA 3A81A 1O3NA 1A5HA 1XUIA 4YLQH 4MLFB 3O8CA 2B7DH 4Y8YA 3KQDA 2PR3A 1EASA 4IBLH 3KYFA 1O2IA 4X1QU 1QZ8A 1ELVA 3LT3A 3MU8A 1WV7H 3PRDA 1TMUH 2NU1E 2Z3DA 3A8CA 4Y10E 1LHGH 2Z94A 1GI8B 4I8KA 3RXQA 1S82A 5J4QA 1DS2E 2GCTC 3FANA 2ZNKH 3NKKA 1GJ8B 3GCOA 3SJKA 1GBTA 1GHZA 2H9HA 1O3MA 4F55A 5I46H 3BG4B 2BVXH 1T7CA 2AGIX 2P59A 1EAWA 2J97A 5E0JA 3T27A 2BD5A 1W0KD 4JMYA 2FTMA 1AWHB 1GHXH 2THFB 2A7JA 1P2OA 1GBAA 2CXVA 2KM0A 3ZV8A 1K1OA 4HFPB 2PP6A 4HTCH 4LZ1H 3UNRA 1WYKA 2ANKH 3U9AH 1V2RT 2VWMA 2Z7FE 2FMJA 1C1SA 1BA8B 1WQVH 4GPGA 1UTLM 2KR7A 3CS0A 1W7XH 3NPSA 2ZG0H 1JIRA 1C2MA 4NCYA 3BTGE 5JBBS 3N7OA 1TFXA 2PSXA 1EB2A 2KX4A 3MU4A 3PO1B 1YPHE 1GBEA 1BZXE 1SC8U 2VVUA 2ZDAH 2W7SA 2XXLA 1C9PA 2A4RA 2V6NA 2A1DB 2YNBA 1S81A 1V3XA 1WSSH 1HYLA 3KQCA 4D76A 1AN1E 2STBE 5GCHF 1QR3E 2WYJA 2WPKS 1AY6H 4Y76A 1O3PB 1J15A 1THRH 3E6PH 4D8NA 2JETB 2W6JD 3F0OA 1CQQA 5T6DA 1LO6A 3F2GA 2GCHF 1KTTB 3STJA 2ZGCA 1TX7A 2K8IA 1O33A 4INLA 2AIQA 4F4OC 1MTSA 6LPRA 1BBRE 4IMQA 4FUFA 2ZP0H 1HB0B 3FN8A 2VB0A 1EFRD 1W14U 1OWIA 1B5GH 2ZFPH 4B2AA 1XKAC 1QBNA 3Q3KA 2OP9A 4NGAH 2ZKSA 3SV7A 1TRYA 2Y6TA 1P9UA 2WPLS 2ZZUH 5FCKA 1ZJKA 5DK1A 3ZZ3A 1K1PA 2A45B 4ACBA 1VJ9U 4DT4A 3SU0A 3W1EA 1SLWB 4LZ4B 3D49H 4OS6A 3PROA 1H9IE 3TK6A 2QN5T 3LKWA 2FI5E 2VH6A 1D3DB 3NUMA 1MTVA 3A7WA 1CVWH 1Z1JA 2W3IA 4Z6AH 4B73A 1DXWA 1C1NA 4Y0YE 1S6LA 1J9CH 2BM2A 4ISNA 1C9TA 2SGAA 4R0IA 3PO1C 2FOMB 4FUGA 3SU5A 3LDXH 1RRKA 5BPEA 4ZHLU 4GUXA 1CA8B 3VEQB 1G3DA 1V2QT 1O3EA 1RFNA 1ANDA 2RCEA 3F9GA 1NTPA 1K1MA 2RDLA 3HK3B 1ETRH 2OC1A 3DCLA 1HAYB 1GBJA 5GXPA 2QAAA 1GCDA 2V35A 1G2LA 1XMNB 5A0BA 2AFQB 4OS1A 2HVXA 1SLVB 2Z9IA 4WH6A 3KIDU 3SGAE 4B76A 1SQOA 1TNHA 4ZKOU 1Z6JH 5KGOA 1VCQA 1COWD 3GOVB 3KQEA 3VB3A 3T62A 2F9UA 4DJZB 3ZZCA 1EOLA 4O03A 2XCNA 1SL3A 1EP6A 4BTIB 1MKWH 2R3UA 5LPFA 3QX5H 1F5RA 1HV7A 4YXWD 1E0FD 3D62A 1O2TA 1ZMLA 3SUDA 5C20A 4AX9H 1OSSA 1MU8B 1JRSA 1VKYA 2JDID 4YESB 2WPIS 2FYQA 2PUQH 1BIOA 1TX6A 2OC8A 1ZTKA 1DOJA 2F83A 3URDA 4M7GA 5DSFA 5LPEA 3SNCA 3SQEE 1UTPA 3MH6A 2SGDE 1O2KA 3U1JB 2ODYB 3QGJA 1SGTA 1F5LA 3ZVDA 5JBTA 3BTKE 2VVCA 5GDSH 4BXSA 2O8LA 2Q6GA 1O5BB 1VITF 4YOJA 2DE9A 4YOIA 1AVWA 1C5UA 2STAE 4I8GA 2XC4A 3F0PA 1K2I1 3BIVH 4GVUA 1EP5A 1C2IA 1ELAA 1YM0A 2OK5A 1GI3A 3SO3A 1QJ6B 2BQWB 2XBXA 3A82A 1YCPM 3RLYH 1UTNA 1QBVH 1AWFH 2VWLA 2A4OA 1HAGE 5FAHA 4I8HA 3BTDE 2BX4A 3HGPA 1MKXH 1B0EA 4U30A 4ZROA 2O8UA 3M61U 4GHQA 4Q63A 2FS8A 8LPRA 4UFFH 2F43B 1DX5M 2Q6FA 1T4VH 3EE0B 3MO6A 2ANMH 4XBDA 5F03A 3WWBA 2G55A 2F9OA 1PPCE 1HXEH 2BMGB 4I7YH 3LGUA 1G30B 1L4ZA 2HLDD 1TRMA 2QIQA 1BJVA 1BMMH 2GP9B 4BANB 4CRBA 3SGQE 2R2MB 2UWLA 4BNRA 5LPRA 2IOTA 1BJUA 1GBHA 1BMLA 3EAJA 7GCHF 1EATA 2V7QD 3QZRA 2RDEA 4WF8A 2GZ8A 1O3LA 2WYGA 1QB6A 1PPHE 1D3TB 2HNTF 4X0WU 1TYNA 3I77A 1A1RA 1A0JA 3RU4T 1SGNE 1DDJA 1O5AB 3A7YA 3TK5A 3QO6A 1YPLH 2BDIA 3HATH 3B23B 5F8XA 2Q1JA 2FOEA 1NU9A 2KZ4A 5KEDA 3KN2A 3VB5A 2V3MA 5EXNA 4IN1A 1C5PA 1N8OB 4TPYA 1L4DA 3WW7A 2Y5HA 3PB1E 4MG3A 4BAMB 1QL8A 5C1UA 3DT0H 2L74A 1YP9A 2SFAA 3AAVA 5C5NA 2ZTXA 1E34B 4ISHH 1EPTB 1B0FA 3PV4A 2FOCA 1VZQH 2FZZA 5F8ZA 3GISB 1SGCA 1TLDA 1NRQH 2C8ZB 2CN0H 1H8DH 1DXPA 4CR5A 4XDEA 4U2WA 1SGFG 1GJDB 1P05A 1ABJH 2D26C 4TWYA 2JJ2D 1QL7A 3SNAA 1FN8A 3FP6E 1QRZA 3HGNA 3KF2A 1EB1H 1QURH 5JPMH 2BD2A 2XC5A 1O2WA 3TJNA 4ASUD 2XWBI 1U6QA 1O38A 1SGPE 2GDDA 1SLUB 3V3MA 4TWWA 1ZLRA 1C5SA 2G5VA 1AUJA 1O2GH 2GZ9A 3RM2H 1P12E 1KXEA 1PQAA 4XBBA 1NM6A 2VIOA 5DGJA 1D4PB 3BIUH 2BZAA 4RSPA 1FN6A 2GT7A 1P03A 2ZCLP 3SUEA 5FX5A 1PYTC 3FAOA 2KFWA 3BEIB 3RMLH 1O2MA 4K5ZA 5EXMA 1K1JA 3KQ5A 3RXVA 4OS2A 4Y79A 4AN7A 1XVOA 4IS5A 1C5OH 1LVMA 3SU6A 4HZHA 5EW2H 1ACBE 2V3OH 2W7UA 2BY8X 4MNYA 1N8OC 1GJ6A 5FPYA 8GCHF 4WVPE 3AK5A 2BY6X 2SGFE 2ZFRH 1UJ1A 2ZHWH 3ELAH 4JK6A 3STIA 1EPTC 3UTUH 4FUDA 1ZRKA 2GT8A 1BUIA 2KCAA 4WY3A 1MKWK 1DSTA 4K2YA 5GCHG 3KL6A 3LC5A 7LPRA 2LELA 2SNWA 3ZVAA 2PGQB 4OS7A 3RXPA 1P3CA 1YC0A 1MCVA 3TNTA 1SQTA 2GCHG 1MAXA 5A8ZA 3IG6B 1BTWA 3UR9A 5ESTE 1T8LA 3MHWU 2QXGA 3E3TA 5TCAA 1S6FA 4X6MA 4HI3A 1PFXC 3U8RH 2AHME 1L0ZA 3LOXA 4B2CA 3PLPA 3H7OA 4SGAE 1O30A 3AAUA 2WV9A 4D7FA 1RTFB 1SKYE 4FU8A 2V0BA 3V7TA 3I29A 2RA3A 3A87A 4A7IB 4ABBA 1W2KH 1O2HA 5KECA 2QCYA 3UNQA 3RXBA 3Q76A 1FI8A 1NRNH 1ZYOA 1DFPA 2XBYA 1FQ3A 2PW8H 4Q4LA 1EZSC 1C5LH 4B1TA 1MZAA 1C2FA 2WINI 1C1RA 1YWUA 3PRBA 1CE5A 3RXGA 1EZXC 2Z9GA 3T29A 1MKXK 3L33A 2CHAB 3I78A 1QBOA 3GY5A 4MPVA 4Y8ZA 4UFGH 4AC9A 4MNWA 1XUJA 1TQ7B 2QC2A 2BLVA 2OBQA 4HG6A 1AKSA 1GHBG 2ZQ1A 3RMOH 4LK4A 1HAZB 1LPKB 1GVKB 4RN6A 1SPJA 3S9AA 5LGOA 4D9RA 1KXAA 1YYY1 4E06H 1NY22 2XWAA 4AFUA 3M3TA 1RGQA 4K60A 4Y71A 4ZXYH 4XFQA 2H6MA 1C5XB 2ZPQA 1SGIB 4DG4A 5C3NA 5A09A 1KLJH 2F4LA 2ZGJA 1JIMA 1FUJA 3FFGA 1NFWA 1RTLA 3LGTA 3RXCA 1ANEA 1QIXB 3OSYA 2A0QB 4WXIA 1OWHA 1B7XB 1WU1A 4RKJB 3E0NB 7KMEH 1O3FA 5E0GA 3ESTA 2P3UB 4ABJA 2F9VA 3S69A 1C2JA 1K22H 2FLRH 3GCHB 3FZDA 3RXAA 3NXPA 4B71A 1MU6B 4AFZA 1C1OA 2OXSA 2HLCA 2VNTA 1AD8H 2VINA 4FUCA 1SQRA 1O3CA 2QF5A 1E1RD 2Y7XA 3LONA 1GHWH 5L6NH 2CHAC 2FEQH 1MABB 1LPZB 1TBZH 3BTQE 1P3EA 4M9FA 3DFJA 2VIVA 1GHVH 1VITG 2UUFB 1TOCB 4MTBA 3RXRA 1O3HA 3N7EA 1OYTH 1BMFD 1HDTH 3SHCH 3FZZA 2JH0D 1WAYB 2K0QA 1FAKH 4Q2KA 3VXFH 4JK5A 1IAUA 4AGKA 4INKA 1TA2A 2UWPA 2A4QA 3DSOA 1E37B 1PPBH 1L1NA 1S5SA 2PSYA 2Y5GA 3K9XB 4KTCA 2BD8A 5E0HA 1GI6A 1HJAB 1A2CH 2GTBA 5A8YA 1FPCH 5L2ZH 4GCHG 1XUHA 1IQHA 1BQYA 1ELGA 1WDIA 1AZ8A 2OUAA 1H9HE 1UK3A 1IHSH 1HPGA 1S0RA 1EPTA 2BVRH 1TX8A 3W94A 2ZIQH 3A8BA 1MD8A 4JYVH 3GCHC 2FODA 1V2WT 1O5CB 5K7RA 2C8WB 1LVBA 4UDWH 5HGGA 4X1PU 4ASHA 1C2LA 4NZLA 1ZSKA 3U8TH 6GCHF 2GX4A 1AI8H 3VB6A 3SQHE 4Y0ZE 1EAUA 4ZKSU 1LVYA 3ZVBA 1UVTH 1WTHD 7GCHG 3A7ZA 3ZZ8A 2PKSB 2A5IA 2PTCE 1FX0B 1NU7B 3TK9A 5K0HA 3TPIZ 4AG2A 3BTWE 2OQ5A 3FP8E 2ZDMA 1BCUH 3P8FA 1M9UA 3MNCA 5FX6A 2CGAA 1GPZA 1GWAA 1ZTLA 4YT7H 4X8VH 1DLEA 3W95A 2JH6D 4DVAU 4CRAA 2A4GA 4X8UH 1P0SH 1SG8B 3SU4A 1TGNA 1Y8TA 1TGTA 1OP0A 5DKMA 3PWCA 5TCCA 4K8BA 1EJMA 4ZMAH 2P3FH 1MH0A 1FZZA 1AE8H 4JCNA 3SU1A 1AZZA 1C5NH 1HJAC 1BT7A 1L2EA 1ZRBA 3UY9A 1QB9A 1TNJA 5DG6A 1O2JA 3SN8A 3FVFB 4UONA 3RXHA 1ZGIA 2ALPA 3P95A 1NBME 3QUMP 5DP7A 1HJ8A 1H9LB 1YLCA 1NT1A 1BBRH 1H1BA 1O3IA 1GVLA 3T28A 2C8XB 2FO9A 4AB8A 7ESTE 3MH5A 8ESTE 1IQMA 2QXIA 1FY4A 1PPEE 4VGCB
chains in the Genus database with same CATH topology
3C1KA 1AGJA 1IQJA 3RP2A 5IYTA 1IQFA 2G4TA 2PKSC 3VB7A 1TAWA 2FS9A 1Y3WA 3KGPA 1Z8GA 1ORFA 4ISLA 2VWOA 4X2XA 5LH8A 1HCGA 1TB6H 1SGDE 2NU2E 2O8TA 1P01A 1G32B 1P2MA 2G52A 4E7RG 2C93B 4WMDA 5AFYH 1HAHH 4X1NU 4J2YB 3ATMA 1GMDF 2VIDA 1XVMA 2ZU5A 1CHGA 1DLKB 4SGBE 3VXEH 1SHYA 1IQGA 1OXGA 1GI5A 1EZQA 1BTPA 4H6SB 5GPIB 8GCHG 3P8NA 4AFQA 2PV9B 1F0SA 4O3UA 1AUTC 2TRMA 1EKBB 5JDUB 1CT2E 3ZVCA 3MOCA 4KP0A 4YZUA 3L3TA 2WPMS 1PQ7A 1DICA 4NA7A 4Q7YA 1ZMJA 2P94A 4UEHH 4XE4A 1CU1A 4AB9A 2RA0A 2TGDA 2Y5FA 1GI9B 4UD9H 1OYQA 2R2WU 1J8AA 5EXLA 5FHTA 3P8GA 1ZHRA 1HRTH 3ODFA 3AW0A 1GHBF 4CRGA 1P2IA 2TPIZ 3M5MA 4NIYA 4NFEA 1K28D 2NU3E 1SB1H 1C5RA 2HPQH 4VGCC 1KXBA 4X6NA 4YLUA 1TIOA 1TGBA 4BOHA 2Z6BD 3TJOA 1NS3A 4ZAEA 2BB4A 3CS7A 1Z71A 4ZH8A 1YPEH 4MNVA 3UREA 4DT7B 4QT8C 2FIRH 2FX6A 3S7KB 2EI6A 2H9EH 2AGEX 1V6DA 4Z0KA 3BN9A 1AE5A 1WCZA 3BSQA 3SZNA 2NU4E 4CH2B 1OS8A 3TGKE 3TIUA 1AVXA 1EAXA 3PMBB 3TITA 1YPMH 2DUCA 4ZXXH 2W5EA 1C5QA 3AW1A 1A3EH 1MBQA 2AYWA 4K8YA 4KGAA 2ZFFH 3ZYEA 1GBCA 4ABIA 1V2NT 1O2LA 4AG1A 1UCYH 2EI8A 1VCWA 2BYAX 5T3HA 1KLTA 1S84A 3PLKA 3QWCH 1JRTA 4TPIZ 3QDZB 1AKSB 5EQQA 2UUYA 4ABEA 1C5ZB 2VJ1A 1G2MA 3U98H 2ZFSA 5A8XA 2FX4A 1UCYE 3NWUA 4AOQA 4U01A 4B74A 4O9VA 2C3SA 2BD4A 4AFSA 1FY8E 4X8TH 2ZHQH 2PHBA 4YO9A 3RXFA 3SW2B 2OINA 4I8JA 2O8WA 2PUXB 3PTNA 2F3CE 1SGFA 1YKTA 2ZQ2A 1O3BA 4TY6A 2ZTZA 3RU4D 2VIWA 2GKVE 1O3AA 2BQ6B 1FXYA 5EPNA 5E8EH 1K1NA 1TWXB 4GCHF 1C5TA 1MTNB 2J2UA 4FUHA 4JZ1A 1FPHH 2Y81A 2TGAA 3SNEA 1W8BH 1C2HA 1W0ZU 3A8AA 4NWLA 2CMYA 4Q7ZA 1GJ5H 4ISOA 1FV9A 2XCFA 1TA6A 4ZUHA 1RIWB 4FVBA 1O5FH 3MTYA 5B6OA 2XW9A 2ZFQH 5AF9H 1CGHA 4AZ2B 1DE7H 5HMAA 4MNXA 1LKBA 2FLBH 3F1SB 3PLBA 1TNIA 3EA7A 5FPTA 3C27B 1OWJA 5EW1H 3A7VA 1LHCH 2J38A 1BBRK 1C1PA 4WMFA 3SUFA 1E36B 5AVDA 1AMHA 1KYNA 1O2NA 1YPJH 2A7CA 2TGPZ 4UFEH 4IC6A 3UIRA 1YCPH 1SFIA 5EGMA 3HKIB 1VGCB 3NK8A 1TOMH 1INCA 1T31A 4B75A 3SJOA 4UE7H 3O8DA 5F6MA 4RKOB 2ALVA 3PMAB 3MO3A 1LMWB 5DP3A 1CHOF 1JWTA 2PTNA 2ZCKP 1EJNA 2VVVA 1MZDA 2Y7ZA 4JZIA 6CHAB 2HNTC 1MTNC 1S6HA 1Y59T 3S9BA 2VIPA 1S83A 3RUOA 1K1LA 3PYHA 1GI1A 6GCHG 3H7TA 3HK6B 3QK1A 4X8SH 1OWEA 1P11E 2OBOA 3UWIA 1RIWC 1A7SA 2BOKA 1O34A 2BD9A 2J4IA 1Q31A 2FOGA 1VR1H 4X6OA 3RXDA 1AU8A 3ZVFA 2BD3A 1QA7A 5GJ4B 5GIBA 2OD3B 1DY8A 1Z8IB 4CRFA 1HGTH 1CO7E 1AFQB 3RLWH 3IITA 3IWMA 1DY9A 3CENA 4OGYA 3R3GB 4OS4A 2WPJS 1GJCB 3UR6A 1W12U 3QGNB 1HAPH 3GYLB 1F92A 5BRRE 2QXHA 2KAIB 3SOSA 1EUFA 2VU8E 2J95A 1LHEH 3ZZAA 2SNVA 1VGCC 2CJIA 4WJG2 3RXJA 1QJ7B 1ABIH 2ZU1A 3BEFB 4TYDA 3E91A 2P8OB 1LQDB 4CRCA 1PPZA 3K2UA 1GHYH 4Q7XA 1ELEE 1DUEA 3RXUA 1ESTA 4CH8B 3SI3H 2HALA 2BXUH 2ANYA 1C2GA 6CHAC 2UUKB 3EDXB 1BTHH 4DW2U 1F0TA 3GY3A 5AFZH 5A0CA 1O3GA 2FOFA 2I6QA 2BOHB 4OS5A 4WMEA 1O3JA 4FUJA 1GL0E 5C5OA 1BTYA 1O2OA 1TBQH 2B8OH 2IPHA 3OY5U 3M7UA 1BTZA 1GMHF 4A1XA 1T4UH 1WOFA 2A5KA 5HYOA 4YT6H 1LKAA 1UMAH 2P3TB 1BRCE 5A2MH 3LGVA 1KLIH 2WUBA 3DUXH 1GDQA 1IHTH 4DOQA 1DVAH 3VPKA 2ODPA 3ODDA 2FESH 5HM9A 3QN7A 4HGCA 1UCYK 1Y5UT 1GCTB 2XBVA 1DPOA 3LGIA 2ZEBA 1AFQC 4XOJA 1CT4E 3NCLA 1CSOE 3SU2A 3U1IB 1TQ0B 2ZCHP 1E35B 2XYAA 2GDEH 1GMDG 1PQ5A 3T25A 1NN6A 1LVOA 1SGYE 1UTMA 1GBFA 3GY8A 1ELDE 1J14A 3UFAA 1UK4A 4XSKU 1WTGH 2Z3CA 3KCGH 1ESAA 3MNXA 1UVUH 1T8OA 1T32A 1FMGA 4NIXA 5E2PA 4A5TS 2OC7A 1TNGA 3PM3A 1NRPH 1ARCA 1XUGA 3Q77A 1O2XA 4ISIH 1D6RA 1MQ5A 2H2ZA 2P8OC 4GSOA 1DWDH 1RJXB 4GHTA 2VIQA 3MMGA 1BHXB 1GHAF 2XNIA 2FPZA 1UTKA 3KHVA 2AIPA 1Q3XA 3QZQA 5JB9S 2QGRA 2UWOA 3OY6U 1VCPA 1MD7A 2PLXA 3LGWA 4NFFA 2ZGHA 1CGJE 1ZZZA 5C1XA 3CP7A 2FOHA 1LCYA 2F9BH 2AERH 1QJ1B 4CRDA 2K1QA 1ELFA 2FI4E 5EPYA 2BXTH 1H4WA 1ELCA 2OTVA 3HPTB 3ZZ5A 4KTUA 1FDPA 5I25A 3DA9B 1MMJN 1GCTC 4LOYH 1BMAA 1GBMA 4BAKB 1GGDB 3M36A 1O5DH 1GJAB 3URCA 1GJ7B 1SI5H 2GMTB 3RXOA 2ZDNA 4D9QA 1S0QA 4D7GA 1GMCF 1PPGE 2BY9X 1FY1A 2M5TA 1VJAU 1THPB 1TPOA 1TGSZ 3ITIA 4J1YA 4Y11E 4Y8XA 3RXEA 4NA8A 3UQOA 4B2BA 2ULLA 4I33A 5FXLA 1PJPA 3SBKA 3OYPA 2BDCA 1C1UH 1YCPK 1EOJA 1P8VC 1D3PB 5ESBA 1ETTH 4KTSA 2EA3A 4X2VA 1BB0B 2D8WA 1OWKA 4AGJA 1CA0B 1BTUA 3A83A 2ESTE 3MU0A 4GLYA 3L6PA 5EQRA 4K1SA 1TE0A 1RTKA 1YLDA 4AYYB 3A7TA 1J17T 1ELBA 1GVZA 2C4FH 3ATIA 4X1SU 1UK2A 3KQBA 4I32A 1HLTH 1THSH 4LXBH 1A0LA 2YNAA 3TH3H 3TH4H 1UO6A 4YTAA 2EI7A 1EX3A 1SVPA 4FUEA 3QTVH 2I6SA 1TRNA 1K9OE 3A80A 1QRWA 1IQLA 3O8BA 5CHAB 4FU9A 1FLEE 1W0YH 4A1TA 3JZ2B 1O39A 2Z3EA 4NSVA 2JH5D 1QRXA 1ANCA 2UUJB 4FVDA 3O8RA 1MQ6A 1GGDC 2BDGA 2A7HA 1P2NA 3GY6A 1ZOMA 1QA0A 2GMTC 2XRCA 5HM2A 2ZU3A 1HNEE 1BITA 2QYIA 4ESTE 3F6UH 3DFLA 1E38B 1GJ4H 1Z8JB 4WXVA 1IOEA 2BDAA 3LIWA 4NIWA 2A31A 1ZR0A 3BEUA 1ZPCA 4OGXA 3E16B 2A2QH 1O37A 1MTUA 2HNTE 1EXFA 3MWIU 1CA0C 1V2MT 2VGCB 5J4SA 1C2KA 2R0LA 5H4IB 4XBCA 3TGJE 2IN2A 2CF8H 1KDQA 4GAWA 4FXGH 3G01A 2SGPE 1Y5AT 4ABAA 4ABHA 4WWYA 1Y3XA 2LPRA 5AHGH 1QGFA 1NO9H 2AEIH 5EU8A 4DGJA 4CBOA 1LTOA 1L1JA 1GI4A 1HBTH 1SQAA 2G81E 1MUEB 2ZWLH 3LU9B 5CHAC 2KAIA 2SGEE 2TBSA 2FM2A 2EC9H 1TMTH 1DANH 1QCPA 4FUIA 2R0KA 1O2PA 3DHKH 3LPRA 1CHOG 2ZFTA 4INHA 3AASA 1EQ9A 1ETSH 1SBWA 1IQIA 2FI3E 4ABGA 1HAVA 3ZZ9A 2H9TH 1HXFH 1KSNA 1V2PT 1Z7KA 4JYUH 2ZO3H 1O3DA 3K6YA 1OKXA 1TABE 2XBWA 3M5LA 1V2TT 2NWNA 1F7ZA 1P2KA 3F9FA 1AFEH 2Y82A 1SLXB 5G4BA 3SHAH 1SFQB 3KNXA 5FCRA 1QFKH 1DITH 4MQAA 4ZKNU 3Q3YA 2VGCC 1O3KA 2VH0A 3LC3A 3E90B 3TNSA 3RXLA 3RXIA 4DIIH 1GDNA 1GBBA 1G3CA 1XXDA 1O35A 2W26A 3A89A 1RXPA 1G3BA 5JBAS 1ID5H 2XTTB 3OX7U 1O31A 1V2LT 3VGCB 2ZDVH 1BRAA 2ZI2H 4CR9A 1XXFA 1W10U 1DWCH 3D65E 3A88A 5F8TA 2BQ7B 3BG4C 3MO9A 2WPHS 2PKAB 2BDBA 1Y5BT 1NFUA 1C1WH 4NSYA 3M7TA 1UHBA 1ESBA 1Z8RA 1BRBE 5JYIA 2OLGA 3AVZA 1QQ4A 3RXTA 3SV2H 2ZTYA 5L2YH 4X1RU 1NFXA 3SUGA 1RD3B 2ZC9H 5L30H 4X6PA 1O3OA 3BTTE 3ZZBA 3FP7E 5GWZA 4UFDH 1TPAE 2ZU2A 4K69A 3ZVEA 1GMHG 1A46H 4ABFA 4O3TA 1X7AC 2FTLE 3M5NA 2P16A 3TVJB 3GY2A 1F5KU 2AH4X 3UPEA 9LPRA 2G51A 1P57B 1GBKA 1JBUH 5FBEA 2ZA5A 1WUNH 1FONA 3GYMA 2CV3A 1W3CA 1D3QB 4ZHMU 2HPPH 3ATLA 3MNSA 1GJBB 1O0DH 5CE1A 5PTPA 2ZHDA 1BRUP 3ZZ6A 1UVOA 3BTFE 3TGIE 2J92A 2JETC 2O9QA 3VGCC 1QTFA 5EQSA 2A5AA 3MYWA 3TU7H 4Y6DA 5DP9A 5DP5A 3F68H 3QLPH 2Y80A 1P2QA 1TBRH 1W11U 3B9FH 2PGBB 1V2OT 1Z1IA 3MFJA 5EG4A 1JOUB 1YGCH 1YBWA 2HRVA 3BTEE 4NIVA 3RMNH 3K65B 4DURA 3SI4H 1C5MD 1QY6A 2GGVB 1O5GH 3GCTF 3UOUA 3ENSB 2D1JA 2O8MA 1OP8A 1GHAG 1OOKB 3A85A 1BDAA 2P93A 1L1GA 1C1MA 2GD4B 4BTUB 1KY9A 1PQ8A 4O97A 4NWKA 4H6TA 2B5TB 1YPKH 1FIZA 1GJ9B 1BMNH 3SORA 4MDSA 2BZ6H 1G36A 3U69H 2XC0A 4KELA 1UVPA 3BTME 2ZPRA 1A5IA 3LJOA 2FXRA 1ZHMA 4THNH 1LHFH 3SGBE 1QNJA 1DUAA 1NPMA 1QQUA 3PMJA 2LNCA 1GDUA 1GBDA 1ZGVA 2ILNA 3Q3XA 4I8LA 1O2UA 3T26A 1SGRE 2P95A 1EAIA 2J94A 2FWWA 3EA9A 3PMHB 1TMBH 1WBGB 1DT2A 4YOGA 1C1TA 2J9NA 2NU0E 1SSXA 1IQNA 3TJUA 2BTCE 1GMCG 1O32A 2Z9JA 1J16A 1OPHB 1ZSJA 3EGKH 1C5WB 1V2VT 3M3SA 1C1QA 2AMPA 3SNBA 2BVSH 3H5CB 4R8TB 2BD7A 1Y3YA 2H5CA 2ASUB 1SGEE 3SU3A 1ELTA 3UNSA 2IJOB 5ETXA 4DIHH 1AHTH 3R0FA 2PFEA 3S0NA 2FP7B 2R9PA 3UUZA 2FDAA 5IDKA 1A61H 1D6WA 1HAIH 1CBWB 3ZYDA 2B9LA 1IQEA 4AORA 1OP2A 2CF9H 2ANWA 1SR5C 1MCTA 1LDTT 1MAYA 4K1EA 2QXJA 2VWNA 1FJSA 5DP4A 4JZFH 8KME2 5DPAA 1A0HB 1T8MA 1GI2A 3T5FH 3RMMH 1TGCA 4IW4E 4WH8A 1FAXA 3ATKA 3V12A 2R3YA 3MH4A 3V0XA 1DWEH 1HUTH 3VB4A 2Q6DA 2ZDLA 1O5EH 3ZV9A 2G8TA 2ZECA 1HIAB 2AMDA 4CHAB 5SGAE 1GL1A 1AB9B 2V3HH 1O2ZA 4A1VA 1ZSLA 1NESE 1GBIA 2A2XH 1V2JT 3UWJH 1IQKA 4JZEH 4ZKRU 3SJ8A 3U8OH 3S9CA 1F2SE 3SV9A 3MU1A 1O2VA 5EOKA 1KXCA 2GZ7A 3D23A 2F9NA 3BG8A 1A3BH 3ZZ4A 2G5NA 2ZF0H 4MPXA 3ATWA 1ARBA 3LJJA 2SGQE 2F9PA 1V2UT 1XUKA 1OWDA 3ZVGA 3TLOA 3MH7A 4JYTA 1DWBH 1NC6A 4K3JA 5T6FA 4E05H 4CREA 3RM0H 2W3KA 2H1UA 4X2YA 4BAHB 4FU7A 1CBWC 1KDQB 1C5YB 4H42U 1AIXH 3P8OA 1QB1A 5T6GA 2ZGXH 1SGQE 3PWBA 2TGTA 3E8LA 1A5GH 2C90B 2Z9LA 3RDZA 1SOZA 3A86A 2OC0A 1ZJDA 2AGGX 9ESTA 1O2RA 4CHAC 1SOTA 3HKJB 1AB9C 3GDUA 3RXMA 1XKBC 1F0RA 2A32A 4NZQA 1N6YA 2PKAA 1BOQA 2AMQA 3SNDA 3M35A 3NZIA 4X2WA 1UTOA 4AYVB 3GDVA 1HFDA 4TY7A 3BV9B 2HGTH 3EYDA 4YM9A 4PROA