2R14A

Structure of morphinone reductase in complex with tetrahydronad
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
369
structure length
363
Chain Sequence
NPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDEIPGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDTYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of morphinone reductase induces multiple reactive configurations and identifies potential ambiguity in kinetic analysis of enzyme tunneling mechanisms.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Flavoprotein
molecule keywords Morphinone reductase
total genus 131
structure length 363
sequence length 369
ec nomenclature
pdb deposition date 2007-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r14A00
1RZMA 5G1YA 1T8XA 4K6AA 2A85A 1NF0A 2YPIA 4IMEA 1LBMA 1TSIA 2WOQA 3W76A 1KM0A 1Z41A 1S5WA 4QM1A 3L67A 1VLIA 3R12A 1PCKA 5AHIA 2FPTA 3MI6A 3BG3A 1QDSA 1J2WA 2A0NA 1EP1A 5K7JA 1T99A 3P61A 5CPNA 1WDWA 4XTIA 4GE8A 4IQLA 2GQ9A 1IXOA 3I7RA 3SI9A 5D2YA 3VE9A 1FBAA 1I2OA 3EWBX 3TE9A 3U8GA 5GVJA 1OHLA 3BARA 3LHYA 3PBWA 4J9JA 1N7KA 3S5NA 1WBHA 2QKFA 4I7UA 4X2RA 5BRBA 3ZFHA 3LCXA 4IMGA 3FOKA 4P61A 2QAPA 4GFSA 2WSRA 2ZRWA 1OFPA 3PF3A 5EBUA 1KFEA 1GVFA 4GJ1A 4FNQA 3AO0A 1FWWA 3KRUA 5E93A 4AHQA 3LI0A 1ZAIA 4UTWC 4FX6M 1N8FA 3WJWA 3BO9A 5LNVA 4NU7A 4NT0A 4LC6A 1VJIA 1FDJA 1VC4A 2FJKA 1PV8A 4CQ8A 1A5SA 5AHLA 5LHEA 4HSOA 1B57A 4CNPA 4P2VA 3GR7A 1LRNA 3C2FA 2Q8LA 3CIWA 5FF0A 4FNSA 3SJ3A 5E1QA 5BMWA 4GUFA 4JNMA 3P7YA 2V5LA 5KZMA 3EXTA 5DN1A 1I2RA 2V82A 4CQ9A 2ATMA 2CZDA 4ZQNA 2C18A 3L5AA 2C3ZA 4MY1A 3W22A 1VCGA 1JULA 1H7WA 4ORIA 2QCDB 1LBFA 4K39A 3P62A 5K3VA 2NUWA 1ADOA 1VPXA 3MI3A 3UY8A 1VYRA 5D04C 4S1FA 4UTMA 3MBFA 1EX5A 2NV2A 2ZZ3A 3W2UA 1TJPA 3STGA 3W7NA 3EEGA 1ZENA 3C61A 1OK6A 1YXYA 2WQPA 1VS1A 5BW6A 3GNDA 2Q3OA 1OX5A 4LV9A 4JTUA 1TPEA 5D2TA 3UNDA 1GVSA 3BG9A 1KV5A 4BI7A 4GUGA 4TO8A 4NXSA 3WK3A 3STCA 3W74A 3NPXA 2NXIA 3TMQA 3QQ1A 1JCMP 4LV4A 2VEPA 1MEHA 3VNDA 1KM4A 3GKAA 3JRKA 3BW4A 2PRMA 1UCWA 2Z6IA 3G8RA 3DFOA 5HWJA 4ICNA 1XL9A 2NX9A 1W8SA 1GVRA 3M47A 1GWJA 2DZVA 4BF9A 1PHWA 4UMAA 4AWSA 2I9EA 3G1YA 4QQ3A 3MYOA 3NQCA 3AJXA 2B7QA 1A5AA 2QUTA 1FDZA 1Q45A 4MY8A 4XBKA 3W70A 4UTKA 3I68A 1GQNA 2ZZ2A 3OG3A 2H8XA 3IIVA 3KAOA 2CU0A 2WKJA 4BWLA 4UTIA 3HO8A 3O07A 3H55A 4UMCA 3TQVA 5HR6A 6ALDA 4UTLA 4BR1A 1WA3A 1KLZA 2OT0A 5CPLA 3P84A 1VYPX 4M6VA 4O54A 4OQVA 1WQ5A 4WZHA 1JQVA 3L68A 3NL2A 3FIGA 2A6LA 1THFD 1M7OA 5AYXA 3PWAA 2F84A 3G1AA 3PBUA 4RXFA 3NQ2A 4IX2A 1AL7A 3BGGA 1I4NA 3L0KA 2GJLA 2JKPA 1G67A 1YPIA 4UIOA 1SR9A 2TPSA 3L9CA 4JICA 1TV7A 4UCGA 3NM3A 1JVNA 3FLUA 3E96A 4NNAA 1A50A 1OFDA 5FF3A 2FQIA 3PUDA 1O5XA 3NXFA 3M5XA 2HSAA 2CLHA 1I2NA 2ZA3A 3W1UA 4Y96A 3NG3A 4CCCA 3IIXA 1B4EA 2YYUA 3S1XA 1F73A 2A7NA 4K7YA 5LSMA 1AMKA 3UZJA 2X1UA 3EXSA 3G1DA 4O52A 7TIMA 3LOTA 2HS8A 5FF2A 1SFLA 4PODA 4GXMA 2XN1A 4IXHA 3Q94A 4NZJA 5I3GA 1EB3A 1W1ZA 3ABOA 4QIUA 1XDMA 2DORA 2QCNA 3RMJA 3LCFA 2FPVA 1FY6A 4Q32A 1A53A 4E2DA 3C2EA 3M5YA 4GNJA 5EPDA 3HBLA 2B7NA 3GVGA 1H1YA 3GXTA 2G96A 4FX8A 2A7RA 2ZRYA 5DY3A 4UFJA 4UNKA 3SGZA 3QJAA 3FYOA 2Z2UA 3D0CA 1MO0A 4IXXA 3W1MA 1K8XA 3G24A 1H51A 3W7IA 5FEPA 1A5BA 1ZHAA 3W1AA 3PG8A 1LDCA 1Z48A 3F4NA 3OVRA 3W84A 3HPZA 4MPQA 3PBYA 4AAJA 3TH6A 3NAVA 3LHVA 1WXJA 5LGXA 4N9EA 4JTTA 1OF8A 2RH9A 5K9CA 5LKYA 3S5YA 4LRTA 5LHFA 3LCGA 1M5WA 3BW3A 1TPDA 3E0IA 8TIMA 2JKAA 4L4MA 1EIXA 2E6YA 3HOJA 1F7BA 1S5VA 4UTTC 4DQWA 3NQVA 2CLFA 4LVBA 2EPHA 3CB8A 4TX9A 3NO5A 4R34A 3O6YX 4UFLA 5DY2A 4MFDA 4LY8A 3P5YA 2OJPA 3W86A 4PC8A 4FXRA 2A5HA 5C54A 4LTSA 3UPBA 2A6NA 2V2HA 3P67A 1MZHA 2C1HA 5LNUA 5F4WA 3P74A 2TYSA 3HGSA 1F5ZA 4YCPA 5HWNA 4LUIA 1M7PA 5K2ZA 1R2RA 5AYYA 2YFNA 3M44A 4QJ1A 2Y7FA 4L4LA 3PC0A 5KSWA 3CPRA 3W75A 3W7HA 1F05A 5HUPA 3W1RA 2V8ZA 1SO5A 2E6AA 2A1YA 1SFJA 2Y61A 4LOCA 3NDOA 2G5WA 2X1RA 1TO3A 1VR6A 3QMSA 3TUUA 5AB3A 2ZQ0A 1VHNA 2FB2A 1U83A 1DQXA 3CIXA 4MVAA 3FYPA 1LRQA 3CT7A 4FF7A 4AF0A 1ZAHA 3P8JA 2Z6JA 3QQ0A 3KVJA 4OE7A 3G1VA 1O94A 3LTPA 2FFCA 1NFBA 4O4WA 3TSMA 4MJZA 2X30A 3QPZA 2ABAA 1SUXA 3QC3A 2WSQA 2Q8ZA 4H6KA 2QF7A 4JX6A 3S8HA 4U28A 1YDOA 1HG3A 4O1BA 2EF9A 4TR9A 5AC8A 4XTDA 5ABTA 4ZQMA 2FTPA 4MFEA 3KX6A 2QDGA 4GWEA 1LCOA 1X7FA 1EEPA 1AG1O 5BOOA 4WQ6A 1I2QA 4S2CA 1TREA 3TXVA 3DKJA 4ZZ9A 3QZEA 2RFGA 2DZXA 3NQFA 3IVTA 1D3GA 3W7JA 2ZTKA 4IPJA 1FCUA 4D2JA 1MSSA 4PA8A 4X22A 3IIOA 2QAFA 4Y90A 3UWVA 2CLIA 1IGSA 3PULA 2ISSA 3N73A 3EXRA 5G2WA 3MMTA 5D2XA 2AQWA 3PVFA 2E5DA 1VHCA 5I3HA 4C1KA 1DJQA 1LROA 1W5OA 1TPUA 1VGAA 2VOMA 1TPWA 4A2RA 5CZ0A 1R2SA 4RZ4A 3GDKA 4K36A 4DO5A 1Q6LA 1SPQA 1WX0A 3H54A 4O19A 4WY0A 5KITA 4LVAA 3QW4B 4AWUA 2YXGA 2ABBA 1IXNA 2GQAA 3UZ5A 4PFMA 4POCA 1KFKA 2XN2A 2OCZA 5T26A 4UTWA 3S6DA 3WK2A 1RQEA 3PB0A 3G1FA 3WK1A 1C29A 3FEMA 1U5JA 2Q3RA 1KFBA 3HPXA 3STFA 4WXZA 1GTHA 2WNNA 4NQ1A 3HJZA 2OZ0A 2ZFAA 4NNBA 1PCWA 1OK4A 2BWGA 5AHNA 1XDLA 3GX9A 1W0MA 3CWNA 3M43A 3CQ0A 3G22A 3ATZA 3W7QA 1KW1A 3GKFA 4RKAA 2H3DA 2WV8A 3LCIA 3DGRA 2YDAA 4NJJA 4LC8A 4DXVA 1NVMA 1TMHA 2WPBA 5C2XA 3UD6A 3TJXA 4UFHA 5E0KA 4Z0SA 1TTJA 1VQTA 4FNPA 3TW6A 1DKWA 1OFRA 3LTSA 3NOEA 1FQ0A 4HPJA 4Q33A 3LV6A 3NL3A 1WBJA 3NYZA 3C3NA 3QYQA 3USBA 1LYXA 2ZA1A 2CLLA 3QSRA 1L6WA 2PRLA 4TMBA 1XKYA 1QO5A 3DZ1A 4IMDA 1H61A 2J9ZA 1G69A 2YX0A 3L5LA 1T96A 1OFQA 3S1UA 3LXAA 1EP3A 1H1ZA 3EWWA 2OMAA 2ZCGA 4AB4A 4LNYA 3TK7A 3LB0A 1ZAJA 1SW3A 1XI3A 3S5OA 1ZY9A 2JK2A 3W88A 4A21A 1DBTA 2LLEA 3OIXA 2HMCA 4JTJA 1LLZA 2W0UA 1BWKA 1TQXA 3TQKA 3OA3A 3VFLA 2PCQA 1G4SA 1Q6RA 3LDVA 1ME9A 1W37A 2JGYA 4HKPA 3TXZA 1DL3A 3OHIA 2ZZ4A 3W85A 3DI0A 1F6PA 1VCFA 1JJKA 1Z42A 1TPFA 4JTFA 5C6MA 3O6DA 3MI2A 4ADUA 3W1NA 3FJ6A 2O7QA 4JX5A 1SW0A 3NZ1A 4DF0A 3S1WA 3TAOA 4Y8FA 1OF6A 1EWDA 1SO6A 3LRMA 3S9YA 3P5ZA 4NXKA 2VFDA 1QMLA 2D73A 4IUOA 1F2JA 3A24A 3N19B 2WO5A 2OX1A 1TPC1 4YL2A 4RZ6A 3KVLA 4AWTA 5CSSA 1PVNA 3BG5A 1RVGA 5G1TA 4I9AA 4BI5A 2PURA 1GT8A 3TU9A 1FCVA 1FDYA 4UFKA 4DF1A 2BTMA 1ME8A 3N9RA 4UMBA 4ZQRA 2B7OA 5K4ZA 3IEBA 5HINA 2HS6A 3Q58A 3RF9A 3TC7A 1OFAA 4MZYA 5MHBA 1BTMA 4CCEA 5HUOA 1H7PA 1QR7A 4O57A 2ZA2A 3MHGA 2RDWA 3NPVA 1GYNA 2NWSA 5EA9A 4K8HA 4I7VA 1LOSA 2Z0IA 1GJPA 3EX3A 2CZ5A 2ZRZA 1H7XA 1W31A 5HJLA 2AGKA 4MYAA 1YDNA 5F4XA 4UTHA 3UXAA 5EMUA 1S5TA 3N2XA 1GVOA 4EIVA 3EKLA 2HTMA 4AHPA 1WOBA 5KZDA 5EY5A 4UTUA 2E77A 2NZLA 1DJNA 1R47A 2C19A 3KVKA 5FI8A 4WX2A 4LS1A 3OVQA 1TV8A 5F2LA 1VCVA 4LS0A 3ZWSA 1DVJA 4HT3A 3TKFA 3LHWA 1Q3NA 2FLIA 3LTYA 2VKZG 4IJBA 3HGJA 2Y89A 3FKKA 1JCJA 2Y6ZA 3LHTA 4H4IA 1FXQA 2VFGA 3OEXA 1S3HA 1TTIA 1P5BA 1PL9A 3TMLA 2P10A 1RR2A 1SSGA 3EWYA 1L9WA 4FXSA 4IGHA 4DF2A 1WOAA 5G2IA 3W83A 3W7LA 1KA9F 4O17A 3P60A 3IGXA 4DO4A 2X16A 1A5CA 2NV1A 4O11A 1FX6A 4FIQA 2R8WA 1N55A 3L2IA 3P80A 4R33A 2PC4A 2E1DA 3DFPA 2V5BA 1O4UA 1ZALA 1Y0EA 2E6FA 4RLIA 1RD5A 3ABQA 3LCLA 3M9YA 1PHQA 1X1ZA 5H2ZA 4MLJA 2Y7GA 4JEQA 5LNRA 2B7PA 4JY8A 5AFDA 2R94A 3G0UA 3RU6A 1YXDA 3KFTA 4ML9A 3W7EA 1FWRA 1KTNA 4OHQA 2P0OA 2QUVA 2ZZ6A 3U2OA 4OU1A 5C5YA 1JQXA 3RLVA 1QOQA 4XKYB 2UV8G 3YPIA 1ICPA 3SFKA 4DO6A 4M6PA 3PSWA 1V5XA 1IIGA 1L6SA 2ZRUA 4JXCA 4A3UA 3LCWA 2BSLA 1QFEA 2QCCA 4JX4A 3PR2A 1C9DA 3QMTA 1YXCA 3W2LA 3L0NA 2C16A 2Y70A 1V7YA 3WJZA 3T55A 4BFAA 2QCMA 4ORMA 2NUXA 2H90A 4LVDA 4LUJA 4WOZA 4E2BA 3O8AA 4U4MA 2CLKA 1OYAA 2FPYA 3PB2A 1CW2A 2QCDA 2VEMA 1K7XA 3C2VA 2EHHA 3GXPA 3C6CA 4MJMA 4BK9A 5FEXA 1QNVA 1XCFA 1I8JA 2DJXA 1DQWA 2DZWA 3QEZA 2B4GA 3S42A 4R7JA 1YTEA 4HSNA 5I3FA 4FHAA 3LRKA 4Y9AA 4PL2A 1W3IA 2H3BA 4YXGA 1B9BA 2VXNA 2EKCA 2QJGA 1JUEA 3CU2A 1H60A 2VC6A 4UR8A 3U6WA 5CKSA 1LTDA 2J27A 4NX0A 1FXPA 1TJRA 2NWRA 2FIQA 3QSTA 1PS9A 3HG2A 3CWOX 4XQ6A 4JYEA 1F74A 5G4EA 3MHUA 1UUOA 4UTJA 3M1ZA 2J24A 1WAUA 4YLWA 1OX4B 3LXBA 1MEIA 2DZUA 3HG5A 2I14A 3MHFA 4ZQCA 1OFOA 3QF0A 1KBIA 4WY0F 4AVFA 1P4CA 2ISVA 3BW2A 1DOSA 3NPWA 4KFNA 3C2RA 3MP3A 3MUXA 3NQGA 2QDHA 2YCEA 4N02A 1GVQA 5DXXA 5CGQA 1BEUA 4M5PA 1Q6OA 4GBUA 5D2VA 5G4WA 3IIZA 1LLWA 1L6YA 3EX6A 4JTEA 4MOZA 3FJLA 4FIRA 3T7VA 5SWUA 1LRTA 4JN6A 4HIBA 2NUYA 4XKYA 1K8YA 1YTKA 2QEZA 3PM6A 4X9SA 2V30A 4Z0JA 3TIMA 1LP6A 1D3HA 1SZGA 1XBZA 5DLCA 3B04A 4PEKA 2X2GA 2Y63A 1R2TA 3NQAA 5AN7A 2TSYA 3GIYA 1VYSX 5KMYA 3C4UA 1KM6A 3JR2A 4DEFA 5C55A 2A2IA 3C2OA 2ZRVA 5D2WA 3F4WA 4LU0A 4GRSA 2QCEA 3HQ1A 5FF4A 1ME7A 4YCOA 1FWTA 1OYBA 1D9EA 4MKNA 2TRSA 4O18A 2NLIA 2V0TA 3MYPA 4RK8A 4NVTA 3KHJA 3ANYA 3BK0A 5HQEA 4HN4A 5FESA 1XFBA 1LOLA 2C14A 2RDUA 1LOQA 4AEOA 1NF7A 5J5RA 5AOUA 2Z1BA 1ICSA 2WSYA 3GDLA 1K7FA 1P0KA 5AC7A 1XBYA 3DH7A 1KLYA 4EF9A 2BZNA 5A5WA 3MWAA 3IV3A 4IWWA 3W87A 4N6FA 1IIHA 1R30A 1H62A 2ZZ7A 3B0PA 2YFOA 3UWYA 4M19A 3O1NA 3M6YA 4JTKA 3SR7A 3TJLA 1DHPA 3NQ8A 4DPPA 4MZ8A 4B5NA 2VEIA 3LHZA 2CLEA 3VCRA 1K8ZA 1KM2A 3LBMA 3WJYA 3M5VA 3UYCA 4GUHA 4QAIA 3UWZA 3P82A 3G0XA 3TSBA 1I2PA 2JKEA 1KM3A 3A9IA 5CPOA 4E38A 4HNVA 1ICQA 1VH7A 1KFCA 4MYXA 5F2IA 4Z1AA 2XFWA 1R46A 1WYIA 3G3MA 4JDYA 1OABA 1XXXA 4NNCA 3HPSA 5H91A 2DU2A 5AC6A 4A22A 3CEPA 3GZ3A 1J5TA 1K02A 1H63A 1TPVA 1EWEA 4FNRA 4BI6A 4DBDA 3MO7A 3DKLA 3LLDA 5TBOA 1YPFA 5KTLA 3A22A 3RNDA 3UPWA 3MW7A 3W7CA 1MXSA 3DHFA 1JR1A 5KZEA 1HO4A 4OGZA 4Z08A 2W79A 1TTPA 5IBXA 3N9SA 3B0UX 5LNWA 4Y6GA 1QWGA 3C56A 5U7SA 3LBCA 1EUNA 2ZTJA 5CZTA 1B3OA 3I6RA 3M7WA 1YLVA 4CQAA 5DBUA 3HG4A 1T0OA 3S5ZA 3G1XA 3LX9A 1ZJIA 4WOQA 2E5BA 3KRZA 3QMRA 2B0MA 3MP4A 3ABSA 4DBEA 1SO3A 4AH7A 1JRBA 2A21A 2NX1A 3NQ7A 5HULA 1W5MA 3NR0A 3G8EA 3BV4A 4Z1CA 4WD0A 1G7UA 1RQHA 2WJZA 3GYEA 3A23A 1TIMA 2J6XA 3EWZA 1MEWA 1RV8A 4FX7A 2ISWA 4NJHA 1QPRA 3O6CA 3GB6A 4LT9A 3DFQA 1X6UA 2E68A 3GK0A 1GTEA 5EKYA 3A5VA 1H7RA 2DZPA 2H8ZA 5DBTA 2VEKA 5BNKA 4O10A 1JCLA 2EGZA 3DAQA 3IVUA 3B06A 3ZWTA 3IRDA 1ONRA 2WNQA 1OG0A 3NL6A 1H7NA 3Q37A 3G3DA 1GG0A 3L0GA 4NJGA 5CZSA 4MZ1A 4JIPA 3ZR4A 4FNTA 3LXCA 3CTLA 1Q6QA 2VFFA 4PTNA 4OV9A 3NVTA 3O15A 4WUIA 5DCBA 3UWUA 1W56A 3T4CA 3W1LA 3NZRA 4M7TA 4KWWA 4NUWA 3FS2A 1TPB1 3I7QA 1SU5A 1QPNA 3NGJA 2AAMA 5CPMA 1TCDA 3EX1A 4O16A 1XBXA 4K7VA 1K7EA 1OJXA 1GZGA 1JCYA 3OBKA 2V9DA 1K3UA 1VZWA 2E6DA 4FO4A 4ZL1A 3W1QA 5AHMA 1VRDA 3IGSA 5I3IA 1SO4A 3W23A 3W1PA 3QPYA 4O1AA 3K30A 3GDMA 4O13A 3N14A 3G1HA 3ELFA 2O7SA 1EP2A 1CX9A 3FA5A 3SIZA 3LI1A 2DZTA 2FDSA 3NQEA 2GVGA 3DFTA 4ALDA 1OYCA 2J9YA 3HGRA 3LGEA 1ML1A 1ZCOA 3RFAA 2C15A 3ATYA 4RV8A 3N3MA 3TNOA 4CNNA 4O12A 3T44A 3W2JA 3THQA 4FB7A 3W72A 3RLUA 2RHGA 4JDBA 4QSHA 2CWNA 4RJEA 1SZEA 4QNEA 5LZLA 4JD4A 1G6CA 2Y88A 4WY0B 1YADA 2GVJA 2C6QA 4AHOA 1G4EA 4N4PA 4WJEA 1SW7A 2QCHA 1ZFJA 4OT7A 2CZEA 2TMDA 4RXGA 5I3KA 3BLFA 3M0ZA 1WV2A 3E9AA 3TW7A 4XZ9A 1P1XA 3DFSA 3T40A 5J5DA 1PIIA 3W7PA 3T78A 4M6QA 4UR7A 1E51A 2XN0A 3CHVA 1W5PA 2YGYA 2NXGA 2F7FA 2R14A 3VE7A 5D33A 3QM3A 2J88A 1GOXA 3LERA 5TQLA 2X1TA 4MY9A 3ABRA 1G4TA 3W6YA 3R8RA 4O1DA 3GDRA 1JUBA 1W3TA 2DZSA 1X1OA 3C0JA 4YMZA 3NEVA 3TCEA 3G18A 3THAA 1HTIA 4CLMA 4K8EA 3W07A 3NA8A 3W71A 3WFAA 3W1TA 5L9FA 3N34A 2W6RA 1J4EA 1YDVA 2X1SA 4XBSA 3SGUA 5HR7A 5AHFA 5U4NA 3W3OA 1IXPA 3M41A 1AW2A 1I45A 1GEQA 3W7KA 1UBSA 1W5QA 1BWLA 3EWXA 3IIPA 3NNTA 1VLWA 2GPTA 4A29A 2Y7DA 5G5IA 5HWMA 1H7OA 5LGZA 5CZJA 4K37A 5DXYA 4JTSA 3GNNA 4KFOA 2PRHA 1W3NA 5G2HA 4AF0B 3L5MA 3BLIA 4IPIA 1AW5A 3FKRA 3MP5A 2J9XA 1XC4A 4QISA 3BPWA 4FNUA 2OT1A 3INPA 3SY5A 5IM51 3DI1A 3R13A 1F76A 1EUAA 1QAPA 4O28A 1IXQA 3GAKA 4RR4A 5F1VA 4W9TA 3L65A 5HMSA 1SQ7A 1FWSA 3VI2A 3PY2A 5DCEA 4EF8A 3JS3A 2GJNA 3SSJA 3V75A 4HNTA 5DCDA 3GLCA 3N2MA 4O4VA 4E0CA 3PSVA 4TMCA 2CLOA 1HO1A 1JUKA 3TQ0A 4LVGA 4R53A 1SZFA 1XBVA 3WJSA 3GXNA 3QFEA 3NQMA 1GPWA 4RX0A 3DU0A 2DJLA 4JYDA 1Z44A 3TR2A 1SSDA 3DFNA 1KM1A 3PUOA 5HNRA 5D32A 3F03K 6TIMA 3L66A 3UWWA 3W1XA 2P1FA 4XUGA 5I3JA 2YR1A 3O16A 1HL2A 1FCBA 1OVDA 2QJHA 2GOUA 3S1VA 2NXHA 2ZYFA 3B0VC 4EOUA 2V2DA 3HMJG 3E02A 4IOTA 3Q2DA 3KVMA 5EL1A 3E49A 1TB3A 3A5FA 4JTLA 5D38A 4I7WA 3W2KA 3PAJA 4RCXA 4EVZA 4Z1BA 1K03A 2QCLA 3PG9A 4YWIA 4PCFA 4MUZA 5DELA 2KZHA 1LBLA 5D30A 3KOFA 3EKZA 4GUJA 1LZOA 4IMFA 2VELA 1NSJA 5L6UA 3W2MA 3E12A 4G1KA 3B4UA 3G1SA 4ONVA 3SECA 1XM3A 2PE4A 3BVJA 1G7VA 3SZ8A 3CC1A 4OBTA 5FEZA 4ZMGA 4HNUA 4UNLA 1EA0A 3TDFA 4EWND 3LCHA 2GVLA 4LS2A 4AMAA 5AYZA 1RPXA 3HF3A 4JGDA 4DPQA 1QOPA 4M7SA 1KTCA 2JGQA 3R2GA 3CM4A 5CSRA 3RK8A 1RQBA 3KRSA 3FFSA 1IF2A 1UUMA 3QRHA 3S0CA 1SZNA 3LRLA 4GC4A 1FWNA 1KM5A 4KFPA 1HUVA 2QJIA 4QNWA 1H50A 2R91A 4HNNA 2BXVA 3LHUA 5D02A 2YSWA 1QCWA 3HGOA 2E09A 2VFHA 3PS7A 2BX7A 4KWVA 3DHDA 3KXQA 4UFMA 5F2MA 3UQNA 3BLEA 3TFXA 3NM1A 3B05A 3TA6A 4DELA 3W73A 2CW6A 4XWUA 2VFIA 4JTGA 4LW7A 1DORA 2ZDRA 3QH2A 3WK0A 4ADTA 1JCXA 4MLRA 3UWQA 5AHEA 2GUUA 1ZNNA 5F4SA 3O06A 2CLMA 4JIQA 3WJXA 4N9BA 1TPH1 4A2SA 2VENA 1L2UA 1TRDA 1AK5A 2QUUA 4ZVJA 2ZZ1A 5K9DA 3CEUA 3M5ZA 4N9DA 4AXKA 2Y7EA 3TV8A 3OVPA 4TIMA 3O63A 3STEA 4BWLC 3EX2A 1F6KA 1AW1A 5BMXA 1OX4A 2A4AA 3TX9A 1PE1A 2YZRA 4S2BA 2DP3A 3M16A 1C8VA 1OX6A 4OWGA 3B8DA 5K9XA 4JS3A 3R5EA 1O5KA 3TC6A 1TRIA 1JCNA 3EB2A 1M6JA 2V81A 1DV7A 4MIMA 1YYAA 3DENA 4NJKA 2JBMA 2VFEA 3F1QA 4GUIA 4O15A 2ATSA 3C52A 3MBDA 4IMCA 3DXIA 4CCDA 2CZFA 2QCGA 1OFEA 2NX3A 3NPUA 2ZBTA 2Y85A 2E5CA 1KTBA 5F1UA 3W9ZA 3W7OA 4PH6A 2ZZ5A 1H5YA 5D03A 1KBJA 3W7DA 3P81A 2GQ8A 1P0NA 2Y62A 1KFLA 3UXDA 2C0AA 3R89A 2EAWA 3TFCA 4JY9A 4O14A 1EPXA 1NAL1 4Z1DA 3W2NA 4CNOA 2FB3A 5K4XA 2YYTA 4O1CA 1XUUA 1QPOA 2IQTA 4N2YA 3LV5A 3A21A 1XUZA 3VKJA 1UASA 4O53A 2I1OA 4O50A 3BGJA 4H3DA 4Q4KA 4N4QA 1TTQA 3W7GA 1TV5A 4UFIA 2BLEA 3CLMA 2RDTA 4KKXA 3LLFA 1CI1A 5CG7A 4LRSA 3ZS4A 3QW3A 3UY7A 4X3ZA 4JTIA 1JRCA 3DBPA 3H53A 1KV8A 3W7MA 1ALDA 1BKSA 1QPQA 1TYGA 1X8FA 4QITA 1O95A 4UTTA 4JTHA 5IBXC 3I7SA 4ADSA 3PBVA 4UC5A 4LWWA 2WNZA 4N6EA 5A8GA 1LORA 2G95A 1GYLA 3MJYA 4TU1A 4NX5A 1GG1A 3NQDA 3W7RA 4O0ZA 4ZQPA 3GR8A 3EWUA 3C8FA 3I65A 5D37A 1G4PA 3P8IA 4WXYA 1KFJA 1W54A 2YW3A 2ZRXA 3PUEA 3V1PA 4N9CA 5FF7A 3B03A 4UXDA 2V2CA 4UUIA 4ZQOA 3HIJA 5KINA 5F2GA 4RZ5A 3HG3A 5D09A 1FUYA 4O0KA 3LM7A 2YW4A 4PL1A 1NEYA 4OV4A 2QR6A 1YTDA 4NZFA 5FEWA 4JYFA 5TIMA 3TSDA 3TAKA 3L21A 4FEZA 2A7PA 1LM1A 3GDTA 3IGUA 1FCQA 2ALDA 1O60A 2H6RA 5EYWA 3GAYA 3G0SA 5LNSA 1B4KA 4LVFA 3EX4A 1TQJA 1W5NA 2RKXA 4K38A 1HFBA 3NL5A 4NJIA 3TROA 2CFFA 4C1LA 2QCFA 3SW6A 1UB3A 4JR5A 3IVSA 1UJPA 5D05A 4HPXA 3HB9A 3NQ6A 2G97A 2C13A 1OFBA 3O05A 4IX0A 1AL8A 4HHPA 1QO2A 4O8RA
chains in the Genus database with same CATH superfamily
3FYYA 2GSJA 2XGBA 2YPIA 4QQUA 3CUIA 1FKWA 2UWFA 3R12A 1ZBKA 5AHIA 2BMBA 2DT2A 3V1HA 1QASA 4RNJA 2A0NA 1E4LA 2ZDSA 4IQLA 3HQNA 3SI9A 3BC9A 2VD9A 3VE9A 3OIHA 1I2OA 3KZSA 3EWBX 5HJXA 3TE9A 3AMCA 1NWUA 1V3HA 2ZVRA 2OLSA 3PBWA 2FJUB 1WBHA 1GCYA 5A94A 3WL1A 3MY9A 2CWXA 3WLNA 4GI9A 1YNYA 4IMGA 3PZUA 2PWVA 3NSNA 2PWFA 4GFSA 3ONBA 4ZB5A 3LNPA 3W0KA 1RJRA 1KFEA 4FLRA 2PAJA 1FWWA 1UJQA 2O9PA 3LI0A 2PDKA 5LNVA 4NU7A 2VX7A 3R6IA 3WLQA 4JFUA 1FDJA 1VC4A 2FJKA 2GLKA 1PV8A 4CQ8A 1A5SA 4EPKA 1VF8A 1B0IA 4HSOA 1B57A 4P2VA 2HWGA 1EYEA 1BG9A 3CIWA 5FF0A 4FNSA 1O1ZA 3W29A 5E1QA 3R0DA 3TTYA 4US6A 3P7YA 2V5LA 4WSKA 3CPGA 3B8TA 3D5HA 2QF8A 4CNUA 4OUIA 3M0KA 4ZQNA 3L5AA 4MY1A 3LPOA 5DEZA 1MW0A 4MSSA 2NSXA 4XVDA 1H7WA 1QK2A 2XVLA 4PCTA 3ZMRA 1R9XA 1BD0A 2QJMA 3VC6A 1VYRA 2VD8A 3BSHA 1XLJA 3VIJA 3E0LA 4UTMA 1IZCA 2NV2A 1HKMA 3W2UA 1TJPA 4AD3A 1ODZA 2GOKA 3EEGA 5C71A 3F4DA 2G3IA 4U2YA 5LIYX 2Q3OA 4LV9A 3LS9A 1PX8A 4GUGA 3WK3A 3NPXA 3TMQA 1PBGA 2VEPA 3VNDA 3JRKA 3BW4A 4ICNA 4B90A 2NX9A 5GJMA 3PZGA 2QIWA 2I9EA 1EH9A 3SIMA 2WMKA 4O1EA 3MWCA 1A5AA 3W70A 1GQNA 3OG3A 2H8XA 4L6OA 4N42A 1SMDA 4DUOA 3SBFA 4UTIA 1PDZA 2DPEA 5HR6A 3MS8A 5CPLA 3P84A 5JBDA 5HXMA 1VYPX 4M6VA 2CHNA 1OCQA 1R87A 4F79A 1JQVA 3L68A 3NL2A 1P7TA 5C8BB 4F9JA 3VMPA 1THFD 1XW8A 3SQLA 3R0UA 1Q2RA 3PWAA 2F84A 2QGYA 4IQDA 3VABA 4RXFA 1AODA 1WE5A 1I4NA 3ITXA 1LUCB 4JICA 1V6UA 4XZHA 1KXTA 1D7FA 5EMKA 4HB7A 5CJ5A 2HSAA 1QU4A 2V5JA 2FHFA 4UZSA 2YJQA 3NQBA 1NQKA 3W1UA 3UR8A 3OGVA 3NG3A 1UWQA 3WMLA 2ACQA 2XTKA 1XDJA 6REQB 3IIXA 3WENA 3WF1A 1OCJA 3DEQA 3CQHA 3FVDA 2ZX9A 4O52A 3MV01 4C6QA 2ACSA 2Q09A 4HYVA 2NVAA 2XN1A 2OQHA 3Q94A 1EB3A 4E3TA 4QAWA 1XDMA 2ZX5A 3QGAC 4UTFA 2QCNA 4PSPA 3RMJA 2QMKA 2OYLA 2P8CA 3M5YA 5EPDA 1H1YA 2G96A 1E6SM 3BV7A 2A7RA 2JQXA 1YRRA 1NM9A 4UFJA 3RU8X 2XIIA 4UNKA 3FYOA 2Z2UA 1RCQA 2VUYA 4J40A 4CVUA 4IUGA 4IG2A 2XIOA 2ISDA 1BQGA 2Q02A 3W84A 5I00A 3HPZA 1VRXA 1OD8A 3VUPA 3TH6A 1AH0A 3LHVA 1WXJA 3N4EA 5K9CA 4LRTA 2HNHA 2ONEA 4Z2HA 1UP2A 4RE2A 4XZNX 1KKRA 1GONA 1EBHA 3CMFA 2E6YA 2I9UA 2OZ3A 3HOJA 3I3BA 4DQWA 3NQVA 3N6QA 4HCDA 1T40A 3CB8A 3ZQ9A 2VT0A 4DJDA 3OU8A 4XKMA 4QLJA 4F0HA 2OLAA 5ABGA 4LY8A 3P5YA 2SFPA 4FXRA 4IL2A 3KWXA 3UPBA 1B3XA 2C1HA 3JZUA 5K2ZA 4YNGA 3M44A 4QJ1A 4HYRA 3ITTA 2Y7FA 3DOPA 3EDDA 5KSWA 3W7HA 1IT0A 4R9OA 1F05A 3SN4A 3PFRA 3IWPA 1SO5A 1XYCA 2Y8VA 3PZMA 3BOLA 1F07A 3WDJA 3VZXA 3PNZA 3QMSA 5G4HC 2F2HA 3TUUA 4XBJA 4R5EA 3PZQA 5HPCA 3CT7A 4CD4A 2QZRA 4R9XA 1I1WA 1DE5A 4KIRA 3FXYA 4OE7A 1CIUA 3WYZA 3GHUA 1TCMA 4PMXA 1NFBA 3DESA 4O4WA 4LPCA 4MJZA 3QPZA 1SUXA 3QC3A 4H6KA 1QNQA 1AD1A 3S8HA 4RPPA 2HE8A 4XO6A 5IDIA 1HG3A 4O1BA 2DW7A 4Q4RA 1C8YA 4YPJA 4JQ3A 1WDRA 1AG1O 2I57A 2Z27A 1TR9A 2VCCA 4HOXA 4QEEA 4DLMA 3QZEA 1OM0A 2RFGA 3NQFA 2FFIA 2BBFA 1RVKA 1FCUA 4D2JA 4PA8A 3UWVA 5GJPA 3N73A 1VEOA 3NURA 3SEPA 4FOUA 1ELSA 2ACRA 3TWAA 1XWYA 1YIXA 2V68A 5FL1A 1DJQA 1RY8A 2VOMA 1B90A 1TPWA 2DDXA 4A2RA 4RZ4A 4FA3A 3VKAA 1SPQA 3TP4A 3H54A 3QW4B 4S3AA 4HPNA 4GKTA 3GUWA 4MMWA 1GOOA 2X41A 2O4QA 3VAVA 3VGGA 1KFKA 4A35A 5FKYA 3HTWA 4B5UA 1U5JA 3MQTA 4AD4A 4DYKA 2DZAA 8RUCA 4BQ2A 1IWBA 3BZGA 2WNNA 5CZKA 1EO7A 1XDLA 2FHCA 3GX9A 3AOFA 2BY0A 3G22A 3AZSA 1DYSA 7CGTA 3AYRA 3BCDA 1KW1A 3DC8A 3GKFA 2VOTA 4ASTA 2YDAA 1E15A 2GSEA 4DXVA 2VRJA 3H4XA 1XPGA 1VPYA 1PYFA 5C2XA 2WZEA 1GYMA 1GVEA 3ZZ1A 4QE5A 3EA2A 3LTSA 3NOEA 4HPJA 4Q33A 6TAAA 5CC5A 3C3NA 3QYQA 4C6CA 4XZMX 2CLLA 3WLPA 1PYMA 4QRNA 3UYIA 1QO5A 1G69A 3QQWA 1QK0A 3STPA 1T96A 1EP3A 3CB3A 3GU1A 4KIEA 1US3A 4DNMA 3MSDA 2WMIB 2R1LA 3EWWA 4NG3A 4AB4A 4LNYA 3TK7A 3LB0A 4KEVA 1ZAJA 4ZTYA 2XM1A 1S2AA 1XLGA 4I5UA 2JK2A 2PGFA 3R94A 3HU7A 4B5XA 3OIXA 1LLZA 2ZUNA 1TQXA 3GRIA 4G1NA 4LCQA 1Q2SA 1XIMA 3CHEA 1Q6RA 1LT8A 5A6BA 1TA3B 1J9YA 3L2MA 3ARQA 3OHIA 3DI0A 1F6PA 2UY5A 4QLKA 1VCFA 5GNYA 2WLZA 2X8RA 1N2VA 1R7OA 3EOSA 1KCZA 2OLHA 9XIAA 1U1HA 3RCYA 1YKWA 1UG6A 3NZ1A 3S1WA 3TAOA 4Y8FA 4ZB0A 1SO6A 3WDQA 2XVNA 4NXKA 2VFDA 2OO0A 4GXPA 3AALA 4XSLA 2WO5A 4YL2A 1WZMA 3KVLA 4RDWA 3U2EA 3BG5A 4CU7A 2PWEA 1SFTA 5G1TA 4I9AA 3VOIA 3TU9A 4US5D 2WLYA 3KHDA 1L8NA 3FHQA 1ME8A 3F5KA 3QKZA 4ZQRA 4ZODA 1DWAM 3GC5A 1RJQA 3A12A 4LJ3A 4IQJA 1H1NA 1EF3A 1BGGA 4PUWA 1E9ZB 3LQGA 1EHAA 3MCOA 5I6SA 1TIWA 2CERA 5MHBA 3WQEA 1J12A 3KOYA 2VWTA 2J7GA 1Y5VA 1GYNA 1W1YA 4K8HA 1O6IA 2Z0IA 2PLCA 1GJPA 4O8AA 8XIMA 1W31A 1XRSA 3B9DA 1ISVA 3TYZA 2X05A 2P3ZA 3N2XA 5FJIA 4D6HA 4EIVA 1BSLA 3SDOA 3BLOA 3QHMA 3SUVA 5KZDA 1DIEA 1PZ1A 5EY5A 1VJSA 1R47A 2EJ1A 3KVKA 4WX2A 4JOMA 4LS1A 3UXIA 3G77A 4GGBA 3ZVHB 4KWUA 2AMGA 3C2YA 1CXEA 2DSKA 4K8GA 3ZWSA 4ENLA 5CCZA 3J7HA 4IJBA 3M0IA 3HGJA 3GVVA 4H9ZA 2Y89A 4H4IA 2VCAA 3F2BA 3OEXA 1GQKA 3MZ2A 1LL7A 1RR2A 2CHRA 3EWYA 1L9WA 4MJ4A 5JH1A 1V02E 5G2IA 2W4XA 3W83A 4PCPA 1KA9F 5BWFA 4O17A 3P60A 3IGXA 5T8GA 2FVLA 1VBUA 2X16A 3PK7A 4W87A 3THUA 2WWDA 1CLKA 5D9MA 4O11A 3ZIZA 5I03A 3L2IA 1HKWA 4R33A 2AQVA 2V5BA 4AUBA 1O4UA 1QUMA 1LL4A 3ABQA 3LCLA 3M9YA 5H2ZA 4MLJA 2Y7GA 5LNRA 4ZBCA 3LQLA 3WIJA 1R3YA 2P0OA 2QUVA 1TG7A 3FHAA 4HHHA 4PUNA 2PI6A 3CL6A 4XKYB 2VCBA 3E2QA 4GABA 2CBUA 3OO2A 2OZTA 2ZRUA 5XIMA 4A3UA 1AFSA 1XIEA 3DUGA 3W2LA 5I2UA 4GVGA 3L0NA 1F8IA 3WBEA 2IUZA 1MW3A 4BFAA 2J7EA 2QCMA 4ORMA 4DJFA 4I5RA 3VKKA 4YJ5A 5DANA 2FPYA 3WNPA 2VEMA 4DXXA 3AZRA 3L23A 1K7XA 3WEZA 2PDQA 1WAWA 4W89A 1X8CA 1J10A 3C6CA 1FP8A 3WLRA 2WCGA 2ZUTA 3ID7A 2DJXA 4JQ2A 2DZWA 3S42A 2VQTA 1YTEA 4HSNA 3RPDA 4QXIA 4FHAA 3FN9A 3URNA 1W3IA 3MCNA 3V16A 2BVYA 3RGTA 2QJGA 4GI6A 3MPGA 1H60A 3P93A 4J2PA 4H2HA 1J79A 4OZOA 1BF6A 3HG2A 3CWOX 1AQFA 3P0XA 3T0CA 3PHAA 4PUKA 3SFWA 4M1RA 2J24A 2FTWA 3GO2A 4YLWA 5A95A 4CD6A 1DTUA 2DZUA 3HG5A 2Z7KA 1REQB 1OFOA 1A5LC 2YXXA 1S1PA 1EGMA 4MB4A 3CV1A 4KFNA 3BW2A 3TVAA 3NPWA 3CUZA 1E6ZA 3NQGA 2QDHA 3IRSA 2YCEA 1J0YA 2VI0A 3WQWA 5DXXA 5CGQA 4M5PA 4R7WA 3IIZA 3LEPA 1SJBA 3GIQA 3EX6A 3T7VA 1HKJA 4XKYA 1XGDA 3B40A 3NOYA 3TIMA 1LP6A 1D3HA 2WBKA 3E0FA 4GIEA 4S3BA 3GIYA 1VYSX 2Z24A 3ARWA 1KM6A 4YTTA 5C55A 3EBVA 4ZO8A 2E25A 1FRBA 2YOCA 4LU0A 2BY1A 2QCEA 2HPIA 1AH3A 2XSXA 3BANA 2IKHA 3BK0A 2W91A 4TVCA 4AX7A 4GBDA 1ICSA 3BAYA 2WSYA 9CGTA 3GDLA 1HL9A 3CT2A 1E4IA 3HZ3A 3K8MA 4N6FA 1RD6A 3DYMA 3R4IA 1H62A 3B0PA 3BAWA 3UWYA 1TMLA 4HPHA 3SR7A 3HURA 4S3DA 1KXHA 3WD3A 3GXFA 1K9EA 5CQ1A 3O3RA 2GK1B 1KKOA 4B5NA 3L2LA 3AI0A 4BA0A 1K8ZA 2WANA 1CDGA 2EXOA 1A4LA 3N9KA 4GD0A 2PU0A 3P82A 3G0XA 4H9MA 3A9IA 1S5NA 3R25A 2OGJA 1VH7A 5F2IA 4TVUA 1RK5A 1T41A 1OABA 4AZHA 3GBDA 1TWWA 1TVNA 2ICSA 3VD5A 4NNCA 2CBJA 3HPSA 4AG0A 1E9LA 4US5A 2NQZA 4TTUA 2NVDA 1L8PA 1H63A 1EWEA 4DBDA 1FHDA 3LLDA 4LBSA 4MWAC 2CBVA 3IJ9A 3A22A 3RNDA 1AJ2A 3SCWA 3UPWA 3GQYA 1HP5A 1XCXA 1JR1A 4OGZA 1EGVA 1TA3A 2W79A 1TTPA 3B0UX 5LNWA 3C56A 1EUNA 2ZTJA 1RLCL 1QW8A 3M7WA 5DBUA 3KW3A 3HG4A 3ANUA 3QMRA 3DG6A 1DJGA 2OQLA 4DBEA 4AH7A 3SRFA 1JRBA 5I5RA 2A21A 2C0HA 2NX1A 5HULA 2XWEA 1RA5A 3PJUA 4W7WA 2GSHA 4WD0A 2CXEA 3GYEA 4S3FA 2IS7A 4JFVA 1O5RA 3H21A 1L6GA 4KF1A 1XH1A 1VBHA 1WP6A 2OEMA 3M0XA 4LT9A 4GXWA 2E68A 4R7OA 4MHBA 1TWIA 3ZM8A 1EXPA 3A5VA 2WC7A 5DBTA 2DGAA 2VEKA 1FWIC 3MA8A 1LWHA 3BCJA 3IRDA 1IWPA 3NL6A 4HOWA 4HNOA 2IQ0A 4PTNA 3H7UA 4WUIA 5DCBA 5CAKA 3E2SA 3T0AA 2D69A 4KWWA 1PUDA 3VNJA 5FJTA 1E6XM 2FZDA 1TPB1 2YB1A 2DIEA 2PDJA 3NGJA 4IIFA 2AAMA 1TE1A 3CASA 1REQA 4GZIA 4K7VA 3C3UA 2QPUA 3T07A 1JCYA 1IEVA 3OBKA 5BOEA 4KESA 1K3UA 1VZWA 2IW0A 2E6DA 3A3HA 3W1QA 1DEDA 2EPNA 3W37A 1MYRA 1MWOA 5AHMA 1VRDA 3IGSA 4XAGA 2YDQA 3W1PA 3WUGA 3UW6A 3GH7A 3VU2A 3N14A 1NDVA 1CX9A 3FA5A 3N1AA 4S3JA 1HT6A 3LI1A 2FDSA 2GVGA 3M4HA 3QV6A 2J9YA 1ZCOA 2CKRA 1FP9A 3N3MA 3TNOA 4GMEA 3W2JA 3SADA 3LPPA 5EMYA 3W72A 1B2YA 2FYMA 2RHGA 1K1DA 4L9YA 2FZNA 1NJJA 1XLDA 4IHCA 3K4DA 5LZLA 2VGIA 3GE7A 4B2DD 1NDYA 4WJEA 2TMDA 3BLFA 3M0ZA 4WIWA 1QNPA 3U48A 5J5DA 1P1XA 1H4PA 2D23A 3T78A 1HXJA 1FH9A 2F7FA 3FJ4A 3FDGA 5JXQA 7TAAA 2YBUA 3U5UA 4H9UA 3DG3A 1UMYA 3W6YA 3R8RA 4OKDA 1Q6DA 4U5KA 3ME3A 1AQHA 2PDLA 3C0JA 3TCEA 2EPMX 3NEVA 2V3FA 3THAA 1HTIA 1PAMA 4H41A 1KBKA 4AZCB 2MANA 3NA8A 1CXHA 5L9FA 3S6TA 2J75A 1OBAA 4XBSA 5AHFA 4C6NA 2OOGA 3W3OA 5I3DA 3CL8A 3M41A 1I45A 3VZZA 1GKQA 3EWXA 5A2AA 3PZNA 3QYSA 5BXPA 1A5MC 4A29A 5HWMA 1HNYA 1H7OA 4KW2A 4ZTXA 4ZE5A 1QT1A 4TUFA 1KGXA 4LX4A 4GI8A 1XC4A 2R24A 3BPWA 4FNUA 1P6CA 3INPA 3A9BA 3SY5A 5IM51 3DI1A 3LGGA 3RM4A 3UP8A 1H49A 5A8PA 1JCTA 1IXQA 4RR4A 5F1VA 3SCPA 1E1EA 2OODA 1JGMA 1FWSA 2J74A 3MDUA 3EYPA 1G1YA 5DCEA 3JS3A 4E8GA 3OP2A 1TVPA 2WC4A 4HNTA 3GLCA 3RPMA 4E0CA 4REQA 4S3GA 1HO1A 3KUMA 4LVGA 1TV4A 3QFEA 1GPWA 4WF7A 2J6VA 3UZXA 3DU0A 4FOJA 3KTCA 2PDIA 1VBRA 3Q4DA 1KM1A 5D32A 1A0DA 4K3ZA 3UWWA 4GPNA 4JTRA 1FCBA 2QJHA 1FKXA 3CH9A 5FCZA 4P8XA 1ZJHA 2V2DA 1SM9A 3E02A 4IOTA 4LAKA 4EE9A 1ZP4A 3KVMA 3E49A 4KERA 3WQ8A 1V0LA 4KRUA 3W2KA 4BS0A 2NW0A 4BEUA 1S39A 4J3XA 4ZGYA 1EPVA 1JXJA 4ZB2A 2J66A 3CZKA 1LQ2A 3M46A 4CD8A 3EKZA 5E9XA 4Z17A 2O56A 4IMFA 5L6UA 4OBRA 1WZKA 4GACA 4Q4OA 3F2DA 2VM8A 1IV8A 3NVDA 1V4YA 3LLXA 2J25A 1TV2A 2G37A 3BVJA 4DVOA 3SZ8A 1OG6A 2W3ZA 5FEZA 4ZMGA 1ZLPA 3CQIA 4AZBA 3N2TA 4HNUA 3WDPP 6REQA 5PTDA 2Z2BA 3MJMA 3DN5A 1UYQA 3LCHA 2VZUA 4F0RA 2YL8A 4W85A 3GXIA 4YTSA 1QOPA 3GS6A 2KX9A 3CM4A 2XWDA 2RDXA 4P5UA 1RQBA 3QRHA 1JZ7A 1FH8A 4QR6A 1FWNA 1KM5A 1HUVA 4QNWA 4G8TA 3UEQA 1ECQA 1QCWA 1UPPA 4GZ7A 1QNSA 3N18A 1CGVA 2VFHA 3GHSA 1A0EA 1UROA 3DHDA 3KRBA 3W53A 4Z1YA 1V3MA 4DELA 1FWHC 2ZX8A 5E6ZA 2Z26A 3M0HA 1LT7A 3WK0A 4ADTA 1BYCA 1W3HA 3KBVA 5ABHA 3UWQA 2GUUA 4JIQA 3KE0A 2DIJA 2VENA 3IANA 1ITQA 5K9DA 1HVXA 4AXKA 2Y7EA 4C6JA 3TV8A 2BY3A 4TIMA 3O63A 1AW1A 3B3DA 3MVTA 3GFZA 2A4AA 2YZRA 1LG2A 2DP3A 3OZOA 1OX6A 3B8DA 3R5EA 4AY8A 2XSAA 3DYOA 3W28A 1O5KA 1LWJA 2EPKX 2PSNA 1Q66A 2J7DA 3WBYA 3DGBA 1YYAA 2WVUA 4ZENA 4DWSB 4Q4QA 1W9PA 4NJKA 4H9TA 3F1QA 2D1ZA 3FCPA 2ATSA 4EP8C 3TOPA 3DXIA 4IJRA 3KCOA 2KAUC 2QCGA 1OFEA 3VIMA 4CUCA 3NPUA 5FL0A 2PTZA 4C7GA 2E5CA 3AFBA 4PH6A 2ZZ5A 4DBSA 4RNHA 4ZCWA 1KFLA 3L4ZA 2C0AA 3CO4A 3TFCA 3AYSA 1EPXA 4YVPA 4Z1DA 3W2NA 2FB3A 1Q7QA 1E6QM 3LUTA 3U7BA 3UXLA 4F8XA 1S1RA 1XUZA 3VKJA 5H8MA 1R8LA 4O53A 4O50A 3BGJA 4H3DA 1UR1A 5T91A 2HV5A 3PPFA 4N4QA 1TV5A 2RDTA 3UNTA 4Z2LA 4GJIA 4JCMA 3VIOA 5JH2A 3UY7A 2INEA 3EAUA 4DUWA 4AFYA 3CUGA 4PYSA 1XC6A 1BKSA 5BROA 1OWQA 2B81A 5T9BG 2Z1VA 2QULA 4LWWA 2WNZA 4N6EA 5A8GA 2J78A 4R3UA 1LORA 2G95A 3UJEA 3SUTA 2NQ9A 3NQDA 3WQCA 4B3ZA 3TYEA 1SGJA 2XFFA 3JZEA 3APYA 1G4PA 3CAQA 3PUEA 3V1PA 3D47A 4P7QA 4N9CA 5M1TA 3ZT5A 2V2CA 4UUIA 4N7QA 2V5DA 4RZ5A 3HG3A 5D09A 5M03A 1P0EA 3W81A 2PDCA 4AYGA 1YTDA 1EC8A 1S2TA 5FEWA 4JYFA 3L21A 3VNKA 3GDTA 3WQPA 1TR1A 4FK9A 1KR1A 1B4KA 4LVFA 2QW5A 3EX4A 1UD2A 3TJ4A 4U3AA 1XH0A 4JFTA 3TROA 1R3VA 3F2CA 2NVCA 3MUCA 4JTCA 1W9XA 2WPGA 3SW6A 1RH9A 4H8HA 4WGHA 4P8VA 1UJPA 4L61A 3F4VA 4DZIA 3ENLA 1QNRA 3H2NA 2G97A 4UOQA 1OFBA 4IX0A 4HHPA 2QNEA 2EQDA 3W82A 4K6AA 1LBMA 1E9YB 4FXJA 1VLIA 1PCKA 3MI6A 3BG3A 5C2CA 2AL2B 3FA3A 4Y7EA 5BZAA 4ZOEA 3W00A 3NZQA 3DECA 3ZLHA 2XISA 1T99A 1HL8A 3MUZ1 4XTIA 4GE8A 3I7RA 2BGQA 3TA9A 2VMFA 1UIPA 2WWCA 3AIWA 5DX7A 5B7YA 1CGYA 1XF0A 1R5YA 3WZ0E 2BDQA 1BVWA 4MB1A 2PDXA 1CNVA 3S5NA 5BRBA 3M64A 2VX4A 1K77A 3LCXA 1XIGA 3RN6A 3EOOA 3GG0A 2E0PA 2V63A 5BWAA 1YHTA 4H2CA 4FAMA 1GVFA 1TE6A 1Z69A 3G6LA 4KT2A 2DIKA 3SY1A 1W1PA 3UR7A 1GVIA 4UTWC 2OVLA 1XQKA 1XYAA 1JNDA 4NYYA 1Q4WA 3E1F1 1TJ0A 1ZJAA 2Q8XA 1LRNA 3H8AA 1J18A 2Z1SA 1OD0A 1H11A 4JNMA 5KZMA 2ZIDA 1I2RA 1UBPC 2IPWA 2V67A 4CQ9A 4DWSC 3ARXA 2C18A 1DJIA 3W22A 2DQXA 1VCGA 4ORIA 3L7RA 1BXBA 1QNOA 3PNUA 2OKTA 2NUWA 1ADOA 1GQLA 3MI3A 4B2DA 4HQVA 5C7VA 1WKEA 2BHZA 2C7FA 3MBFA 1EX5A 2ZZ3A 3RIKA 3STGA 3C61A 1OK6A 1YXYA 2F9RA 3QFWA 5BW6A 1XP3A 2YBTA 3GNDA 4ERGA 3IJ8A 4CEUC 4GYKA 1JDCA 5JMUA 4JTUA 4WKAA 2D24A 3OVGA 1TPEA 3UNDA 4A3YA 8CGTA 1GVSA 3BG9A 3NCOA 1PXGA 4JTDA 4NXSA 3W74A 3UF9A 2NXIA 3VMNA 1Y5XA 4HNLA 1BVZA 1MEHA 3GKAA 3N04A 1UCWA 1ONWA 2GDVA 2QQ6A 4DI9A 4INFA 1GVRA 2DZVA 4L65A 4WDWA 4PMQA 4QQ3A 3NQCA 3C0SA 3AS2A 3EOUA 1HVQA 2B7QA 4GI4A 1J5SA 1W1TA 5I77A 2CU0A 1MW1A 4GLEA 2ZUVA 3SCSA 3H23A 2WKGA 3H55A 4UMCA 4UTLA 1ZUAX 4BR1A 1KLZA 2YLAA 1POJA 1JZ5A 2CETA 4XZIA 3VDAA 3UGVA 1WQ5A 3EKGA 3M0YA 4WZHA 3QV9A 3WQFA 2WMGA 2WKLA 1M7OA 4Q8QA 2Y1HA 1JEZA 4ECLA 2QPSA 2JIEA 2OSYA 3NQ2A 4IX2A 1NTHA 2P0IA 4UIOA 1BFNA 3L9CA 1TV7A 1VFFA 3GNXA 1XICA 3BAKA 3NM3A 1JVNA 3FLUA 1Z7AA 3E96A 1UIOA 1O5XA 3NXFA 3M5XA 1I2NA 3BJFA 1SFSA 1ESWA 4DI8A 4Y96A 3SCQA 1V3IA 1J0HA 4HVXA 2C1GA 1C7TA 2QHAA 5H1WA 4HN8A 1CZ1A 4GY1A 2X0HA 3U9IA 1F73A 2BODX 2A7NA 3W6LA 1HKVA 4K7YA 4XD6A 2PLMA 3G1DA 2J77A 1EKOA 2PD5A 5FF2A 1Q5MA 4PODA 3CLWA 3LA4A 4NZJA 1W1ZA 1A80A 4QIUA 2OOFA 3RDKA 3UCDA 3S1GA 1WDDA 3VD3A 3A4JA 4PR4A 1XHGA 5DMMA 1A53A 1L2QA 3R8HA 4GNJA 1E72M 3ZR5A 3GXTA 4HMNA 4M81A 1M03A 4RV3A 3CUHA 2HXTA 3QJAA 1YNQA 5DF0A 3W1MA 3LZ3A 1JFHA 3OTRA 1A5BA 1GEHA 3W1AA 3PG8A 1LDCA 4YVXA 1Z48A 4RZBA 4CQBA 3F4NA 3OVRA 3RPTA 4MPQA 2Q6ZA 5LGXA 4QSFA 3MDWA 3CZJA 4JTTA 1OF8A 2CESA 2FVMA 4FS9A 3VC5A 4FLSA 1IE7C 1U30A 1E6RA 3UFYA 4XX6A 3KOZA 1NH6A 3V7PA 1TPDA 4HMEA 4JQ4A 8TIMA 4M80A 4L4MA 3UGRA 5FOOA 5C9XA 8XIAA 4UTTC 3XISA 4LVBA 1UQYA 1M53A 3V35A 4BCEA 4R34A 4IP7A 4UFLA 4EAYA 3ITCA 3G1RA 1JDEA 3W86A 4Q8VA 1RP8A 3NUKA 1JYVA 2A6NA 2V2HA 3SN0A 3P74A 2PDMA 2TYSA 1F5ZA 3ABXA 4EK7A 5JUVA 3CS2A 5XINA 1QPKA 3BAIA 4D9PA 1PZ2A 4B16A 4L80A 3W75A 1Q63A 3W1RA 3WCZA 1E1FA 3EEZA 1W6TA 1UD5A 2A1YA 3KBWA 1SFJA 4AISA 2G5WA 4XD4A 1DXEA 2BV9A 1WDQA 1LG1A 5AB3A 4ML4A 3IUDA 3PTDA 4MB5A 1U83A 4WKFA 1R9ZA 1NOWA 1ZAHA 2F6KA 3G1VA 1M7XA 5CPTA 1O94A 2OU4A 4IM4A 2NT0A 3ONCA 1XLMA 3U5YA 1M3UA 2YZ5A 5BOFA 1VKFA 4Q7NA 4JX6A 4U28A 1YDOA 2QVHA 3MMDA 3VX0A 1A49A 3E5PA 3KWSA 5AC8A 4NAFB 3KX6A 1EEPA 1MDLA 2PDGA 3BXWA 3FAXA 3R58A 4LNCA 1QBBA 4ZZ9A 4IP5A 4LYPA 2CXGA 5AZ0A 4OUEA 3IVTA 3NFUA 3W7JA 4IPJA 2OSWA 1MSSA 1W1B1 1P48A 4F48A 3NDZA 2QAFA 2YCKX 4NSBA 1M04A 2ISSA 1W9DM 2XZ7A 5G2WA 2E3ZA 2PWHA 5TF0A 2QLYA 2YCIX 1VHCA 3MKCA 5I3HA 1J96A 5FJJA 1NP2A 1TPUA 2HE5A 1R2SA 3GDKA 4DO5A 1PSCA 1Q6LA 5BCAA 4JIEA 1WB0A 4O19A 5KITA 3AMKA 4AWUA 4P7LA 2DQWA 2ABBA 3WBWA 3UZ5A 4Q8PA 1A5OC 5T26A 1Q7MA 3PB0A 4XV0A 1EOMA 3FEMA 1YE6A 1DJZA 2Q3RA 3STFA 2EKGA 1UOZA 1GTHA 2OZ0A 2VZVA 3WF2A 4NNBA 1PCWA 1OK4A 3LM3A 3ATZA 2PP3A 4RKAA 2WV8A 3DGRA 5XIAA 3CJPA 4LC8A 1Q6GA 1TMHA 1VFMA 5CEWA 1XLFA 2WPBA 2MNRA 3KDOA 3UD6A 4AVNA 4UFHA 1P43A 4DY1A 4CN4A 1AVAA 1TTJA 3H6OA 1OFRA 3VCNA 1ISZA 3LV6A 3NL3A 3GU2A 3RM8A 3II1A 3USBA 4HJWA 1S2VA 2ZA1A 3RCNA 3BLPX 2EO7A 3K1DA 4TMBA 1RK6A 1XKYA 2A3CA 3QR0A 2YX0A 3DFYA 3VGHA 1VB9A 3L5LA 1OFQA 3P3BA 1NOUA 3PJTA 1R6WA 1UA7A 4NHVA 1SJAA 1WZAA 2OZ8A 3WEMA 4Q4PA 1V77A 1V8EA 3HFYA 4A21A 1OGGA 3EGJA 4JHOA 2LLEA 1BWKA 1IZKA 3TQKA 4LY4A 2PCQA 1E1CB 4M56A 3TXZA 7XIMA 4XG1A 2ZZ4A 3SRKA 1W3JA 2XG9A 3BLDA 4H9VA 4JTFA 1PX3A 5EMJA 4ADUA 1NOFA 3ORWA 2O7QA 3R10A 4DF0A 2J7BA 1EWDA 3S9YA 2HBXA 1ECEA 3A24A 4D1JA 2OX1A 1XRFA 1E0XA 3KCJA 3E0WA 4GC3A 1RVGA 4BI5A 2A3EA 2PURA 4I90A 1R38A 3BJSA 2ZC8A 4H7ZA 4UFKA 4DF1A 3N9RA 4W5ZA 1J8VA 3NTYA 3R79A 3IEBA 2L5HA 1GUVA 1HJWA 3B8IA 4MZYA 3OLEA 3VIGA 3Q45A 1D3CA 4AC1X 4CCEA 3JU2A 4PZVA 4O57A 2ZE0A 2WXDM 3NPVA 1MVYA 5EA9A 1Y5WA 4TVDA 3EX3A 4J27A 2ZRZA 4BQ5A 2VZOA 5HJLA 2AGKA 1DWFM 1E0WA 1PEZA 2PGRA 3R11A 1S5TA 5I23A 3BQ5A 1JZ4A 3TN6A 2ZICA 2NZLA 5LIWX 2Y5EA 2BHUA 1TV8A 3CHDA 5F2LA 3CUJA 3B9AA 5A6BD 3LHWA 3BGAA 2P5NA 3CBWA 1H2JA 4GIRA 3LHTA 2PLJA 1SJDA 3E74A 1XYFA 4DBWA 1P5BA 4FXSA 1K9DA 4DF2A 4PTMA 1Z89A 4AY7A 1K70A 3OLGA 3KS6A 3WLIA 3UZZA 4QJ5B 3O0KA 2DVTA 3P80A 2PC4A 3DFPA 2FTYA 3PZ9A 3VOGA 1Q85A 4EPBC 1X1ZA 2B7PA 3IUHA 3RRAA 1HQTA 3RU6A 3PPHA 5AC5A 3RILA 1YXDA 5A6AA 1S5MA 3BMWA 1FWRA 4OHQA 4OU1A 3ZJKA 4F4RA 3RLVA 3YPIA 1ICPA 5I78A 3OOQA 3IAPA 3VTRA 3S46A 3DYPA 3VGDA 2BP1A 2PGEA 4MF4A 5A8OA 2G8ZA 3AHTA 3MZNA 4DUVA 1QFEA 4JX4A 2QCCA 1QBAA 3QMTA 2Y70A 1V7YA 2YXOA 1NFPA 3TR9A 4DBUA 3T05A 4E2BA 4WOZA 4MWAE 2IXVA 1EFZA 1B54A 4XSMA 3O8AA 4U4MA 2CLKA 2PWDA 3MMUA 5GNXA 2E8ZA 1XLAA 4H01A 4IJCA 4WK9A 3W4RA 3C0QA 1R3RA 4NAEB 3CYJA 2EHHA 2O55A 2AKZA 4BK9A 5CC7A 1QNVA 1XCFA 3CO8A 3QEZA 2ZX7A 2B4GA 5I3FA 5M3WA 1CGXA 4MNKA 4AZ7A 2VR4A 4XK2A 5FAGA 2VC6A 1US2A 3U6WA 5CKSA 5BRQA 4OTKA 4NX0A 1TJRA 2FIQA 3QSTA 1IR2A 4IIHA 2RJGA 3AMLA 4JYEA 4U5IA 4JKMA 1UUOA 4PMNA 5EBAA 4I3GA 3IJLA 3W27A 5FA5A 3E5BA 1UKOA 4W86A 4WJXA 4O0QA 4CNSA 1J0KA 5FJPA 5FACA 4LSBA 1JIBA 4FOKA 2HVNA 1GVYA 4GCXA 3QF0A 3SSZA 1POKA 1G01A 3MP3A 1CB2A 3L12A 4MNJA 1Q6OA 4GBUA 3BE7A 2B31A 2EPOA 2WHKA 1L6YA 3UJSA 2QIIA 5C0QA 4ACZA 1LRTA 5AC4A 1C3FA 4HIBA 3PM6A 2Z7GA 2V30A 3ABZA 1C9WA 1XBZA 2GK1A 3D3AA 1RP9A 4CD5A 3AIEA 2XIQA 2Y63A 1OCBA 1LLOA 4U33A 2EBNA 5C70A 5CAHA 1XIDA 3C4UA 4IPPA 3C2OA 3HJEA 2ZRVA 4E4PA 4EPDC 3F4WA 4GRSA 3HQ1A 2J8TA 2E7FA 1KGWA 1FWTA 2J47A 3THCA 1WDSA 4W5UA 4MKNA 4DNHA 4RK8A 2PS2A 4JFSA 5CXPA 1KR0A 4I9MA 4OIFA 3KLKA 4HJFA 5FESA 1LOLA 1EO5A 1LOQA 2PUZA 1AH4A 1Q65A 2DSZA 2Z1BA 3TTEA 3CH0A 4IF2A 4GNVA 1P0KA 4LGXA 3UBPC 1KLYA 1EZWA 1VFLA 3AJ7A 3GTXA 5EFDA 2VEGA 3MVIA 1IIHA 4H9XA 4PMOA 5LIUX 4C1NA 3M6YA 3TJLA 3ES7A 4DO7A 1SZRA 4NRSA 2Z00A 3APGA 5JIWA 2F38A 5C9UA 2VP8A 3MSRA 3D3FA 4CNTA 4QAIA 1V3LA 2OX4A 4JHZA 5JVLA 1KM3A 6CGTA 4HNVA 2FGLA 2XFWA 5J04A 3WUFA 3G3MA 4JDYA 1WO2A 4KEMA 5H91A 2DU2A 3RUBL 1J5TA 1IZJA 3NO3A 1QTWA 3U2CA 1WPCA 4U31A 3U57A 1HN1A 1PB0A 3URAA 4BI6A 3USZA 3MO7A 3DKLA 5TBOA 3E38A 5KTLA 3N12A 3PTMA 4H00A 3MW7A 3DHFA 1E9IA 4V1XA 1UC4A 5KZEA 1UR2A 1WUEA 4LUSA 3NWRA 3GNRA 4Z08A 4Q8WA 4PMRA 1WKYA 4PB3A 1W1A1 3LBCA 3I6RA 2QUNA 2WM1A 1T0OA 5EU9A 2E5BA 3KM8A 4GJJA 3ABSA 3B8VA 4UOJA 7PTDA 2VGGA 3NQ7A 3TZNA 3NR0A 3BV4A 2GJRA 3PZOA 4RL3A 3GSMA 3VDCA 1RV8A 3VIHA 2BGNE 3GB6A 3DFQA 3KL5A 3GK0A 1GTEA 5EKYA 4ZEPA 3AISA 2DZPA 4S23A 2JEQA 3VZYA 1JCLA 1JF5A 3ZWTA 5I7GA 4BF5A 4X60A 2WNQA 5CBJA 1HX0A 4GISA 1FWAC 5A8QA 1H7NA 3Q37A 5M2FX 3L0GA 4NJGA 3BICA 4GQBA 4BHYA 1Q6QA 3AHZA 3T8LA 2NLYA 3W1LA 4M7TA 4NUWA 3FS2A 4LXFA 5LYRA 1JD7A 1SU5A 3M7SA 3EWCA 3T0TA 2Y24A 3LZ5A 2E9BA 1R9YA 1QPNA 4UBPC 2PDBA 2PDWA 1XBXA 1E6PA 3LY0A 4AX6A 3AIVA 4FPSA 1I0DA 1K7EA 1GZGA 1A5UA 4FO4A 2WMJA 4ZL1A 1TZZA 5HJYA 4XAYA 1TMQA 1GGOA 4UQ9A 3ZT6A 3EWDA 4O1AA 3K30A 1DXIA 3GDMA 2WSPA 3VKDA 3DBNA 3IARA 1E55A 3OZPA 3VNZA 2O7SA 1EP2A 3PAOA 1QRQA 2DZTA 3NQEA 1DTNA 1EZ2A 1QI4A 1HGWA 3I10A 3W6MA 3CHCA 3HGRA 2C15A 3UVAA 3T44A 4FR6A 4R27A 1Q8JA 4FB7A 3RLUA 1F3XA 4LQ1A 1YEYA 2PB1A 2VVNA 4QG9A 2CWNA 1F4HA 2QV4A 4JN8A 4QNEA 4C5YA 1Y8BA 4E3VA 1G6CA 3TN4A 2G3MA 1RLDA 2OWWA 1SR0A 2C6QA 4AHOA 3HPFA 4N4PA 5D9PA 4I6VA 2QCHA 3WL0A 5D8WA 5HMFA 2CZEA 1MQPA 3E9AA 3DFSA 3OB8A 3ARZA 4AIEA 3SN1A 4M6QA 1KRCC 4F66A 1E51A 2XN0A 3CHVA 2CYGA 2NXGA 1GOMA 3VE7A 5D33A 1N8WA 1GOXA 4YTRA 3RR4A 1C8QA 5TQLA 2PEVA 5A6KA 2X1TA 3BZJA 1G4TA 4LBRA 4L6DA 2XU2A 2QYGA 3GG8A 3VKBA 1W3TA 2DZSA 1GOKA 4F0LA 3IV8A 3W71A 3WFAA 5A2CA 5I0DA 3N34A 2PDFA 1NIUA 2W6RA 5DMLA 4BZYA 2Y8UA 1H0IA 2X1SA 3SGUA 5HR7A 1E71M 2ON3A 5ABFA 5U4NA 3BH4A 2D3NA 5CC6A 1AW2A 1GEQA 1UBSA 3S2NA 4HK7A 1W5QA 1BWLA 3EMQA 3IIPA 1DJHA 2WVSA 4D6GA 4PUJA 2GPTA 2AAAA 4DXKA 5LGZA 4MKVA 1UWAA 5ECUA 3GTNA 2ALRA 4L1GA 2PRHA 4IFOA 3L5MA 3BLIA 5D8ZA 1AW5A 2X42A 2J9XA 3MP5A 4A3RA 2OT1A 3WNMA 3BDKA 3EPNA 5BRPA 4F0SA 4A8NA 3SQMA 4O28A 3GAKA 3A4WA 1F3TA 3AUJA 1UP3A 5HMSA 3VI2A 4B92A 3P2VA 1WZLA 4Z2GA 4KCVA 3V75A 3AHVA 5DCDA 3N2MA 1XR2A 1U1UA 4FF5A 3RX2A 1JUKA 4B5WA 4R53A 2P50A 3T2PA 1SZFA 4DWSD 2XVKA 4CU8A 3MCMA 4RX0A 1TJ2A 2WBGA 2F8QA 4GY7A 1ITXA 2EG7A 3DFNA 3WO8A 2CIPA 3R43A 1FWJC 2AL2A 2GWNA 4FZIA 1YDYA 4C1NB 2OEJA 3S6OA 4XUGA 5I3JA 3KTXA 1A5KC 1HKKA 3ECQA 3MV11 2GOUA 3KZPA 2NXHA 4GYPA 4OFCA 3HPAA 2FGBA 1PPIA 1TB3A 4WEVX 4NZ3A 5D38A 5D9OA 1EF2A 3UG8A 3PAJA 1EQCA 4EVZA 3QY7A 2QPXA 1FWBC 3CL7A 3ARUA 2KZHA 5D30A 2CLPA 4S38A 4DJEC 3QY8A 4GUJA 1S38A 3KL0A 2VELA 2D2OA 2AQOA 3W2MA 3UPMA 3E12A 3VKCA 4G1KA 1KQYA 3T08A 2BVWA 1EJSC 4HK5A 4NZ5A 1ZS2A 1CB7B 1KD0A 4AZIA 4KWSA 4UNLA 1J0JA 5AYBA 1RCXB 3VD4A 1MUMA 1EA0A 3TDFA 2GVLA 4D8LA 4AMAA 3HF3A 1FA2A 4DPQA 4AD1A 4M7SA 3K46A 1O68A 5CSRA 3WF3A 1UUMA 3MSGA 4GC4A 2OWCA 4KFPA 2QJIA 2R91A 5HOSA 3WNOA 3BLLA 4IGNA 2E09A 1RXOB 3PS7A 1XYLA 3GY1A 1O1HA 3KXQA 3MTWA 3M0LA 3V5FA 5B7ZA 4UFMA 4PTWA 3AU2A 3TFXA 3NM1A 1DJYA 3B05A 3TA6A 3SM0A 2CW6A 4HU0A 2VFIA 2WW5A 1B3ZA 1BXCA 4LW7A 2XDFA 2XFYA 1Z6KA 3GR4A 2PDPA 3LPGA 4R88A 2GUYA 1JCXA 4H83A 1ZNNA 3UZWA 2CLMA 3SAZA 1LQAA 4N9BA 2DZBA 3UCCA 2PWGA 1FHUA 1L2UA 1TRDA 2QUUA 4ZVJA 2ZZ1A 1ITCA 3CEUA 3M5ZA 1CLVA 4IFKA 3TJIA 1P1MA 4E5TA 1WKFA 4C6IA 1GQJA 3STEA 4BWLC 2CEQA 1P0DA 1F6KA 1UD4A 2XZ9A 5BMXA 1OX4A 3PUGA 3H2CA 4S2BA 3NGFA 3M16A 1C8VA 1W2PA 4LAUA 4UQDA 2A3AA 4KWOA 3N29A 3A3WA 4FLQA 4ICMA 1M6JA 4MIMA 2X7VA 4HA0A 3KP1A 2FGZA 3SO7A 4IMCA 3JUGA 3K1GA 3VOFA 4D6EA 2CZFA 2NX3A 2VHLA 4XD3A 1JAKA 5FSDC 4PRWA 2WJEA 4H7VA 4C5ZA 1H5YA 1KBJA 3W7DA 3P81A 1P0NA 4JY9A 2WQDA 4H8VA 2DVXA 5K4XA 3BWWA 2YYTA 4N2YA 1VFUA 4JNYA 4AVOA 1MUWA 1FWGC 1UD6A 1JI2A 2I1OA 4MUPA 5HAOA 1M9HA 1UD8A 3W7GA 1JG9A 1VBGA 4MADA 4HMDA 4KKXA 2QUMA 5CG7A 4QJ4B 4LUSB 3ZS4A 3QW3A 1MDRA 1PX4A 3RG6A 4WKHA 3KOXA 4X3ZA 3IJIA 4LB4A 1UKTA 2HNEA 3WFLA 5HQMA 1E3ZA 3H53A 3WEOA 4K1GA 1ALDA 4R85A 1X8FA 4JTHA 5IBXC 1GW1A 3PBVA 4UC5A 1V3KA 1KRAC 2CBIA 4Q8UA 3MJYA 1OCNA 4PB5A 4P8WA 2QV5A 4TU1A 1ITUA 4B5SA 4KRTA 3OA5A 3W7RA 1V3JA 4ZQPA 1H09A 3ITYA 1UHVA 5D37A 3XINA 4C6PA 2V5CA 4DJDD 3ARPA 3GHTA 3HA1A 1WNOA 2EG8A 2O9OA 3B03A 4UXDA 4ZQOA 1J6OA 4PE8A 5H8UA 5IHSA 4AW7A 4NY2A 3EDEA 1MQQA 1FUYA 3N6JA 4O0KA 3LM7A 1G0CA 2YW4A 1NEYA 1J01A 5TIMA 1BTCA 1ZSXA 3TAKA 2A7PA 4FEZA 3IGUA 1FCQA 2ALDA 2Y5SA 1O60A 4HA3A 2H6RA 3M0JA 1XLKA 2BVDA 2VDHA 3H70A 1CXIA 1HJUA 4QHRA 2VC5A 1E4NA 3UERA 1HFBA 3G6MA 3FW6A 5I09A 4GYJA 1JDAA 4NJIA 3AC0A 2WYSA 1SVDA 3BJTA 4M0XA 4AYSA 5I07A 3H2FA 3A13A 4C1LA 4IL0A 2G3FA 3WDIA 3AHXA 4NYUA 6XIAA 1TVLA 3UXKA 3HB9A 4ROPA 2ZC1A 4PBEA 4CQDA 4KEZA 3O05A 4DYJA 3AXXA 1QO2A 4FI4A 5G1YA 3T42A 1NF0A 4IMEA 4XIAA 1Z41A 3N25A 2FPTA 1GNXA 4NZCA 1QDSA 3ES8A 5LA0A 1ENUA 3FK4A 1EP1A 1EDQA 3P61A 1WDWA 4JCLA 1IXOA 4M8UA 1FBAA 2RAGA 4XIMA 5GVJA 4XZBA 3BARA 4GGHA 4S3EA 3LHYA 2ZX6A 4J9JA 1N7KA 2QKFA 4I7UA 4X2RA 1QW7A 4C6OA 1PKLA 1OC5A 3A3XA 3VOCA 5I24A 4P61A 2XM2A 1TWSA 1VFTA 2QAPA 3S9IA 2HCVA 2WSRA 4TV6A 5CBBA 2ZRWA 5A6MA 1OFPA 5DMNA 5EBUA 4GJ1A 4FNQA 3AO0A 3AXIA 3KRUA 5E93A 2X7WA 2WB5A 1H0GA 4GQQA 2J7CA 4ROQA 4FX6M 2PU1A 4GG9A 3WJWA 3BO9A 3E2RA 4H9YA 4IISA 4NT0A 3WD0A 3CV2A 1VJIA 3O2LA 3UG4A 1W91A 4F9DA 5AHLA 3WMCA 4A8IA 3MU7A 3C2FA 1I75A 1QVBA 1ZBWA 4V15A 3SJ3A 4MNLA 5C9ZA 5DN1A 2V82A 3KTSA 2NT1A 2C3ZA 2G3JA 8A3HA 4BJHA 1LBFA 2ESCA 4K39A 3FXGA 3WQ6A 2NQHA 4IICA 5K3VA 1EC9A 5BXSA 2VGFA 1PJ9A 5HANA 3UY8A 5FAJA 3SCRA 3DC0A 1B31A 3LSBA 4IIDA 5D04C 4S1FA 4G6CA 2HVOA 3ZLGA 1ZENA 2WQPA 1VS1A 2D0FA 4RE3A 3IACA 2V38A 2QGHA 4TTGA 1R85A 4S3CA 2J62A 4WVXA 1C7SA 3POHA 1V6XA 1T7LA 3STCA 4LV4A 2HISA 3VGBA 5HATA 2G0WA 3BTNA 3G8RA 3DFOA 2GGHA 4DJEA 3M47A 1GWJA 4BF9A 1PHWA 3I6EA 3N15A 1BXNA 3N3TA 1XIJA 3MYOA 4NF7A 3AJXA 3WNKA 4D72A 6XIMA 4MY8A 4Q3MA 4UTKA 4JAWA 3I68A 1DJWA 3KAOA 4DIAA 4UB9A 2W62A 4BWLA 1Q13A 3BMXA 2PBOA 3HO8A 3O07A 4TOQA 6ALDA 1CXLA 1WA3A 2OT0A 3GVWA 4OQVA 4I8DA 3FIGA 4QE1A 2IPJA 2JF7A 4DX3A 2PDYA 1AZ1A 3G1AA 5KETA 3L4XA 4QLLA 1HF6A 3BGGA 2GJLA 4CCZA 2JKPA 2XFRA 1TX0A 1RY0A 4J3ZA 1YPIA 1IEWA 4UCGA 3SB0A 4NNAA 1A50A 4KMQA 3WLOA 5FF3A 2FQIA 3PUDA 1XS2A 3QC0A 5TD4A 1TUXA 2WAGA 4LAOA 1I1XA 4CCCA 2Y4SA 5CGMA 1CTNA 2YYUA 1GZJA 3S1XA 1ISYA 2OYKA 5LSMA 3UZJA 7TIMA 3LOTA 2HS8A 1SFLA 4MNMA 5GPRA 3GC4A 4TQTA 4GXMA 4JL2A 1J2BA 4JTAA 4EXQA 1J11A 4H1ZA 4AZ5A 3ABOA 2VGBA 4M1BA 1TKKA 3T2QA 2FPVA 4H04A 4ATDA 1JF6A 4Q32A 1KXQA 1CXFA 1RHCA 3LMYA 2INFA 4E2DA 3HBLA 5A1AA 1R3SA 3GVGA 4FX8A 5I79A 1C8XA 1V7AA 2WHJA 1ZB5A 3GVQA 4W8LA 1K8XA 4AEFA 3L4VA 3IUIA 3W7IA 3DERA 5FEPA 1AZ2A 4KCWA 1W3LA 1PKMA 4L9ZA 2BGSA 1GJUA 4GYPC 4AAJA 3NAVA 4J3TA 4QS5A 3TWBA 2RH9A 5LKYA 2POTA 3S5YA 1XRTA 5LHFA 3LCGA 1NU5A 1V08A 4AY1A 1M5WA 3EA3A 4GH1A 2O9TA 4F2BA 1Z32X 3E0IA 2JKAA 1EIXA 2YKKA 2DSWA 2VTFA 1UR9A 3S2MA 3O6YX 1ZRQA 3OGSA 1A0CA 5DY2A 1FFRA 3TONA 1JZ8A 2OJPA 4PC8A 6ENLA 2W66A 3P67A 3UETA 3KEHA 1KWKA 4G7EA 3HGSA 1E3XA 3WBAA 1IEXA 1W32A 4ES4A 1R2RA 4Y9OA 2J8FA 5AYYA 2YFNA 5D4YA 3F5LA 3CPRA 1MRQA 2BS9A 3SUSA 5HMEA 1PKYA 1GKRA 1XLBA 4YYFA 2J7HA 2E6AA 5I06A 4HHMA 1TO3A 1IYXA 1F3EA 3VO0A 2FB2A 1AJ0A 1OC7A 3WLTA 1BPLB 1DQXA 3CIXA 4MVAA 2HDJA 2CKSA 3XIMA 3QQ0A 1JNEA 3KVJA 3K13A 4W7VA 3WF0A 1UOKA 3TSMA 2ABAA 4U2ZA 1J0IA 3NIYA 1CT5A 1EJTC 3R8GA 4ZQMA 1GOQA 4MFEA 2Z29A 3UT0A 2QDGA 1KBBA 3HN3A 4GWEA 1LCOA 4QDPA 1X7FA 5H6HA 3VFCA 2D2JA 4S2CA 4C6BA 1MI3A 3TXVA 3DKJA 2WMFA 2YIHA 1D3GA 1NQ6A 3UWEA 3ITLA 3QXBA 3IIOA 4Y90A 4XZWA 4UNIA 3PULA 4Q8MA 3EXRA 3SCNA 5A2BA 3ICJA 5D2XA 2AQWA 3PVFA 4DJFC 4NIRA 2ODOA 3QOKA 1GHSA 1LROA 1W5OA 5CZ0A 4LUYA 1KC7A 3V5CA 4J3WA 4HD5A 2PZ0A 3NDYA 1BRLA 1WX0A 1Q4NX 2PDHA 2DH3A 3EZ4A 2VR2A 1IXNA 2GQAA 4POCA 5BU6A 1IT8A 2OCZA 3EOLA 4UTWA 3WK2A 1RQEA 1ZTVA 1Z9AA 1QHOA 1JI1A 4GH3A 3WK1A 1GOIA 1C29A 4QFUA 1ZCCA 1KFBA 4GO9A 2F6UA 4WXZA 3HJZA 2ZFAA 5AHNA 4PUUA 2QXWA 4ATWA 2FHBA 1W0MA 3M43A 4LH8A 5ECVA 2XIJA 3CNYA 4WDTA 3LCIA 3T81A 3AS3A 2IPGA 3DHPA 1E1CA 1NVMA 3GNOA 1F8MA 3CZ8A 5C7HA 4XAZA 3TJXA 4Y8EA 1W17A 5E0KA 4Z0SA 1TELA 1B30A 1VQTA 1U2YA 1DKWA 1FHVA 3UJRA 1FQ0A 4YS1A 1BG4A 1WBJA 3GDBA 1X6LA 3TTOA 4PUEA 2PRLA 4GZEA 4BF7A 1WKDA 4IMDA 3VMOA 3U4AA 2DT0A 2WJDA 2WHMA 1EIBA 4GQ0A 4HA4A 4M3PA 1TV3A 1UR0A 2OMAA 2ZCGA 4ZSTA 3U0HA 4NRRA 1SW3A 4FMVA 1XI3A 1UP0A 1T5AA 3VDGA 4IG2B 4W4QA 1KB3A 1ZY9A 4LF2A 2HMCA 4PBGA 2BOGX 1BVNP 3OA3A 3LDVA 2FMNA 1F9CA 1W37A 2JGYA 4AWEA 1EDTA 1DL3A 4C91A 2IXUA 1XG4A 1JJKA 3QN3A 3LPFA 3S47A 3O6DA 5A69A 5CJNA 3FJ6A 2DSUA 3UJ2A 4Z2JA 4MPKA 3GH5A 3GC2A 5FIPA 3LRMA 3QY6A 2YLLA 1LL6A 1MMFA 3GTHA 4RDZA 4CD7A 3OBAA 3QOMA 4IUOA 3BMVA 3WNNA 1F2JA 3N19B 3KS5A 1TPC1 3VDBA 4AWTA 5CSSA 4ZOCA 1PVNA 3IJDA 1J0ZA 4Q6JA 1ZGDA 2HPMA 3AZTA 2PPGA 4UMBA 4G7EB 3I4KA 1VFSA 4PMZA 2HXUA 5HINA 3FDKA 3Q58A 4TV5A 3RF9A 3TN3A 5E6YA 3TC7A 1OFAA 4RDYA 3PBMA 2D3LA 3ZSTA 3ITVA 3TOYA 5HUOA 1H7PA 2P53A 2ZA2A 3MHGA 2RDWA 1D7KA 2G4FA 4X2PA 2NWSA 1QHZA 4I7VA 1LOSA 1KCKA 1IEQA 1V51A 3F7JA 1H7XA 1K6AA 2OWXA 1XD1A 1YDNA 4UTHA 4KCTA 2P3EA 1GVOA 1VAHA 1WXYA 4RNFA 3M0MA 1JZ3A 3WKZA 2EPLX 1WOBA 5AKQA 1E40A 4UTUA 1JDDA 3KOWA 4KS0A 5FI8A 3N13A 2ZXAA 5FD0A 1V0NA 3OVQA 5CPSA 1VCVA 4GCAA 1DVJA 4GZJA 3CUFA 4HT3A 1Q3NA 4GVIA 1JCJA 1FXQA 1TTIA 3TMLA 1SSGA 1TJ1A 2DT3A 4P7RA 1WOAA 4DM2A 1Q7ZA 3W7LA 4EXAA 4OOZA 1PWLA 3MB9A 4NP7A 2NV1A 4CEXC 1FX6A 4FIQA 1R0MA 1XYBA 1N55A 2R8WA 5CLTA 3WLHA 3LBOA 2C8NA 1PDYA 1ZALA 1Y0EA 2E6FA 2DW6A 2QDDA 3WH8A 4AU0A 5IOBA 4MWAB 4JEQA 1RBOB 4B5VA 2R94A 2NSOA 2YCLA 1BQCA 3KFTA 4UR9A 1KTNA 3WLSA 2H9AA 1UWSA 4RW3A 1UWRA 5C5YA 1JQXA 1UKPA 2ZWZA 4FR1A 3SFKA 1H3GA 4V1YA 4B91A 3B8WA 3MANA 3ZYZA 4EKJA 3RCMA 2ZWYA 1L6SA