2R14A

Structure of morphinone reductase in complex with tetrahydronad
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
369
structure length
363
Chain Sequence
b'NPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDEIPGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDTYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Morphinone reductase
molecule tags Flavoprotein
source organism Pseudomonas putida
publication title Mutagenesis of morphinone reductase induces multiple reactive configurations and identifies potential ambiguity in kinetic analysis of enzyme tunneling mechanisms.
pubmed doi rcsb
total genus 131
structure length 363
sequence length 369
ec nomenclature
pdb deposition date 2007-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r14A00
1OX5A 2JKEA 2QR6A 1ME9A 3GXPA 3NZRA 1DL3A 1TJPA 2CLOA 3MYPA 5F4SA 1SW7A 1W8SA 2BX7A 2VC6A 1GZGA 5CG7A 3NPUA 1K3UA 1KTNA 1QMLA 1VRDA 3VE7A 1EUAA 3NNTA 1G69A 5LZLA 3GXNA 4CQAA 3LHUA 3BARA 4PFMA 4BFAA 1OYAA 1QR7A 2BXVA 3M5XA 2C6QA 2NLIA 3W7PA 3R13A 3M5VA 4N9DA 3BGGA 1KFCA 1JCJA 1VLIA 4AMAA 5DXYA 1A53A 3QM3A 3UXAA 3H53A 4N6FA 2RHGA 4MIMA 4FNQA 1GVFA 2UV8G 4O1CA 4UCGA 3W85A 3TMQA 4E2BA 2ZRUA 2VEIA 1AG1O 3PULA 2OMAA 4Z08A 2RKXA 1P0KA 3W74A 4PODA 4ZZ9A 1N55A 3MI6A 3IGUA 3NQ8A 1O5XA 1I45A 4NJHA 1F76A 3RNDA 4HKPA 1TV5A 3I65A 3NL3A 4O19A 1ME7A 1M6JA 3TE9A 3SJ3A 4QNEA 1J2WA 4POCA 1LP6A 4QM1A 1LROA 3NQFA 3G1HA 4K8EA 2DP3A 1FDYA 1SZFA 4R7JA 1OVDA 3HPSA 3DFTA 5D09A 3EX2A 1S3HA 4XKYA 3PBYA 3QYQA 4AWUA 1NVMA 1FCUA 3KRSA 3W9ZA 4AWTA 4PTNA 4KWVA 3W76A 2GUUA 5CZSA 4WQ6A 2O7QA 2ZA3A 4JXCA 1LOSA 4RV8A 3S5ZA 2ZZ2A 3W1AA 1UBSA 3NPVA 4ZVJA 5CKSA 2NV1A 3KOFA 3PBUA 1SSGA 1C29A 1KM6A 4MJMA 4NZFA 3STGA 2VFEA 1BEUA 3TAKA 4HN4A 2GQ8A 1VCVA 4E2DA 1FXQA 3ABOA 4JICA 1QPNA 4JYFA 1ZHAA 4LVDA 1T8XA 3A22A 4WOZA 4N02A 3DZ1A 1EA0A 1KM3A 2FPYA 1W0MA 3C56A 3EWYA 4LY8A 3GX9A 4O1DA 5F4XA 4LOCA 5E1QA 1PCKA 1EX5A 3LHYA 1TJRA 5AHLA 5BNKA 5H2ZA 3PAJA 4XQ6A 1R30A 3C2FA 2E1DA 3OVQA 2QUVA 5BMXA 2GPTA 3W7LA 2JBMA 1MEWA 1Z42A 3N19B 3B06A 5LHEA 1M7PA 5AHEA 3NQMA 3W84A 3PBVA 3W1LA 3N9RA 1NEYA 1XDMA 3EX6A 1NF7A 3RF9A 1XCFA 5C55A 4FXRA 4NNBA 3G18A 5AYXA 3DFOA 4FB7A 3DGRA 5EYWA 3BW3A 3N34A 4GRSA 3A5FA 1XBVA 1OFBA 5AFDA 5CPNA 3A9IA 3FYOA 3LCFA 3SGZA 1NSJA 1VH7A 5AYZA 5D05A 3W1NA 2VFDA 3EWUA 3FLUA 3G0UA 4U28A 2YXGA 5A5WA 1P1XA 4MY1A 2OT1A 1TV8A 1ICPA 5E0KA 1ZAHA 4FNSA 2JGYA 3IV3A 4FF7A 2NWRA 3M16A 5DN1A 2RDUA 1FY6A 1QCWA 1HUVA 1WBHA 2ZBTA 3M7WA 4LRTA 4WX2A 1G67A 3GAYA 1AW5A 4K6AA 4A2SA 1G4PA 3FEMA 2H8XA 3CM4A 4EOUA 1ML1A 2WQPA 2BWGA 3NDOA 4I7WA 3AJXA 5LGXA 2QDGA 4QQ3A 2PE4A 4JYEA 1QFEA 5FF0A 5FF4A 3ABQA 5HULA 2VEKA 3LCXA 2H90A 4QISA 2ZRVA 3LI0A 4H3DA 3T55A 4G1KA 4GUGA 3W2UA 3TQVA 2WNZA 4ZQCA 4DF2A 1XKYA 3QF0A 4LS2A 3M5ZA 3O05A 1H7PA 1K8ZA 1H7NA 1T96A 1IIHA 1KFBA 3ZWTA 2VEPA 3V1PA 2Y7GA 5KZDA 1AMKA 4GJ1A 3LCLA 4WY0A 3UWUA 2AQWA 1OF6A 2A0NA 3HG4A 4JY8A 4DPPA 1G7VA 1SO3A 1MZHA 4O1AA 3W7MA 2Y88A 5FEWA 2V9DA 3W07A 2Z6IA 2WO5A 4XWUA 1P4CA 3IGSA 2X30A 1TPB1 3W1UA 3W1XA 4HNVA 4AVFA 4DBDA 4TO8A 1VGAA 3LGEA 4KKXA 2ZRZA 4JIQA 4ML9A 2VFHA 1T99A 1PHQA 2VEMA 3L67A 1ZNNA 2V0TA 2QKFA 3UWVA 2EAWA 3E0IA 5AC8A 2DJLA 4GUFA 4RZ4A 1EP3A 1Q3NA 2J24A 3KVJA 3GKAA 5KZMA 4JTJA 1W3NA 4UTJA 1DOSA 4TR9A 5L9FA 1F6KA 4CNPA 1I2OA 5FESA 1WV2A 1XM3A 4PL1A 1W54A 1GYLA 4S2CA 1D3GA 3PG9A 4JTFA 2ABAA 5FEPA 1TO3A 3LOTA 2TRSA 1DORA 2YFOA 3MI2A 1QAPA 2W6RA 3W2NA 3E12A 3G0XA 2CZDA 3NO5A 3QPZA 4Z1BA 4M6QA 4ZQMA 2G5WA 4O17A 3G1XA 1GQNA 1WXJA 3Q58A 6ALDA 4JEQA 1SQ7A 4AAJA 2ZA1A 3U8GA 4JYDA 3A5VA 3NVTA 3QZEA 4HNUA 1OK4A 3S1XA 3NL6A 2QCLA 3MHFA 3IVTA 3QW4B 1O60A 3NM1A 1ZCOA 3M9YA 2QEZA 5AOUA 4WZHA 2QCNA 1S5WA 3O06A 3I7SA 3KFTA 1THFD 1U5JA 3RLVA 1GTEA 2QCHA 3MP3A 2Y63A 3LBMA 3PUEA 3E9AA 3G3DA 2A5HA 3TDFA 4MLJA 1OFAA 2E6DA 2G96A 3KVKA 3BG5A 1W56A 1QO5A 1TYGA 1YADA 3EX1A 1VJIA 1YXCA 4R34A 3S1UA 3HF3A 3KX6A 1IXQA 2NXIA 2ZZ3A 3LBCA 2A6NA 4UFKA 5FF2A 3PBWA 1FXPA 4R53A 4NNAA 1TIMA 1A5CA 3PSVA 5DBUA 4NNCA 4ORIA 1F5ZA 2YZRA 1KV5A 2AGKA 3G1SA 2VELA 1SUXA 4ZQNA 4MZ8A 1LZOA 3CWOX 1OG0A 1GVRA 4A22A 1FWWA 4UTLA 2E77A 1SO5A 3P84A 2OZ0A 4X22A 1F05A 4MY9A 4UTIA 1VR6A 1FCVA 1R47A 5HQEA 1S5TA 4O50A 1C9DA 5I3FA 3EWZA 1RQBA 4JY9A 4LRSA 1TCDA 3CEUA 3N14A 5U4NA 3QQ0A 2A21A 2WPBA 2E6AA 3PVFA 1I2QA 1H1ZA 4AF0A 2R94A 1X7FA 1KM2A 3L0KA 4Y96A 1I4NA 4NXKA 1PCWA 2FPVA 5LNVA 6TIMA 1FCBA 4E38A 2EGZA 2GQAA 5HUPA 1L6SA 2WOQA 4UIOA 3TCEA 4PCFA 4S2BA 1AL7A 1VYRA 3GKFA 5AHIA 4CNOA 4O15A 1YTKA 2E6FA 4Y90A 4IMFA 5F1UA 4JX5A 2FLIA 1LRQA 3SI9A 3WJSA 2X1RA 3HGSA 5D2VA 3QMTA 4O8RA 3P81A 4OGZA 3TW7A 1JVNA 1EUNA 4RZ5A 1XL9A 1R46A 1WX0A 2W79A 4EIVA 3W3OA 3R5EA 3W7IA 3IIVA 5HJLA 3S9YA 4IX0A 3PR2A 4QITA 3N3MA 4FX8A 2QCGA 4H4IA 1NAL1 4MFEA 3RK8A 1TQJA 4QJ1A 4MPQA 2XN0A 1OFQA 3LV6A 2FTPA 1BTMA 1GJPA 3VNDA 3L21A 3LM7A 1F6PA 2NX1A 5D2XA 3DI0A 3EX4A 3EEGA 3PSWA 5G1TA 1JQXA 3N73A 3W73A 5H91A 4NJKA 3GXTA 1XBXA 4BF9A 4MLRA 3S5YA 3BPWA 3PS7A 3VI2A 2CLIA 2HS8A 4QIUA 3IGXA 4DQWA 3S0CA 3VKJA 1WYIA 5KTLA 2ZZ7A 5CSRA 4AWSA 1FCQA 1KFJA 4WY0B 1WOAA 3P82A 3O6CA 1JRCA 1LDCA 2Q8LA 3GR7A 3W71A 3W72A 3SR7A 2ZTJA 2D73A 5IBXA 1DQWA 4CLMA 1W3IA 2QJGA 4ZMGA 2QCCA 4JTHA 3TR2A 3UZ5A 2VFGA 3NPXA 1JR1A 1A5SA 1T0OA 3NQEA 3W7NA 4GUJA 2Z0IA 4Q32A 1B3OA 2DZXA 2ZRXA 1H61A 3SW6A 1OX4B 1AK5A 3W75A 4LVFA 1RZMA 1VC4A 4IQLA 3UY8A 1SFLA 4O11A 2J9ZA 3LHTA 3G0SA 2Y61A 1R2TA 1XBYA 3STCA 1LYXA 1NF0A 3NQVA 4O4VA 3NPWA 3UNDA 5HR7A 4MJZA 1O4UA 3PG8A 4UTUA 5G2WA 5EY5A 1B57A 3DKLA 3F4WA 2GVGA 4M6PA 4N6EA 1TQXA 3M6YA 1I2RA 4JIPA 3NQGA 2NUWA 5TIMA 3LHWA 1QPOA 3GVGA 4UTTC 2FPTA 1FBAA 3DHFA 1ME8A 3U2OA 3DENA 3W70A 3TUUA 3W1MA 2E09A 4UFMA 3P7YA 5FF3A 2V81A 1HO4A 1ICQA 1O94A 4LC8A 1VQTA 1TRDA 3Q94A 3FIGA 3HMJG 1TREA 1H62A 3LI1A 2P1FA 4C1KA 3QH2A 1OX6A 1OJXA 5G4WA 1VCFA 3QC3A 4AHQA 4OHQA 4OE7A 2B7PA 3BLFA 1PL9A 1GYNA 2I9EA 3LX9A 5CPOA 4RKAA 3DBPA 5EPDA 4UTMA 2BTMA 4OU1A 4OV4A 1VS1A 3TV8A 3L2IA 3LXAA 3P5ZA 4IJBA 3T4CA 4DO5A 2E5DA 1XUZA 1SR9A 4NT0A 1GT8A 4DF0A 2JK2A 4I9AA 1PVNA 4WUIA 5K9CA 4O12A 3TFXA 1JCXA 2FFCA 1LM1A 2FQIA 2A4AA 2PC4A 2E68A 4NVTA 1RD5A 4MZ1A 3EXRA 3MBFA 1DKWA 3R2GA 1GG1A 2YFNA 1FDJA 3TQKA 1OYCA 2CFFA 2WNQA 3NQ6A 1LBMA 2TYSA 3G24A 4NJIA 3UWYA 2OJPA 1Q6OA 4FNPA 4BWLC 1WOBA 4HSOA 2E6YA 1DJQA 1ONRA 2F84A 5U7SA 2H6RA 3W1RA 2DZVA 3FOKA 3KHJA 4L4LA 4XTDA 3S5OA 3G3MA 3IEBA 4PH6A 3EXSA 1FX6A 1KFKA 1HO1A 1WAUA 2ZCGA 1V5XA 4AHPA 2JKPA 1LOLA 1W5OA 3NYZA 3SY5A 4K7VA 1FUYA 2YYUA 3MHGA 3FJLA 5DBTA 2CLMA 5ABTA 2DZPA 3FA5A 1EEPA 2EF9A 3OG3A 1SU5A 2E5CA 4GFSA 3W22A 3B0PA 4Z1DA 3MP5A 3CTLA 2YX0A 3CEPA 2QAFA 3EB2A 3HPXA 1JCLA 4IMDA 5J5RA 3O15A 2V2DA 4HSNA 2AAMA 2TSYA 4NJGA 4RCXA 1W1ZA 3N2MA 2Q3OA 1DJNA 3HBLA 2JGQA 1I2NA 1FWNA 3KXQA 4FNUA 1Z41A 4BI7A 5KSWA 1LRTA 3BLEA 4K37A 3UZJA 1SW3A 2ATMA 5DCDA 3H55A 4BK9A 1XXXA 3NL5A 3FKRA 4RX0A 4LV4A 2EPHA 3DFNA 1KBJA 1O95A 1XC4A 4UXDA 1XDLA 4AB4A 1UJPA 2RDWA 1TV7A 5CZJA 1TTJA 4OT7A 4JX6A 3W2MA 2DZWA 4N9EA 3ANYA 2PCQA 4CNNA 4Z0SA 3V75A 1WA3A 1GWJA 4Z1CA 1DV7A 4RLIA 1FWTA 4N4PA 4QAIA 5BW6A 1KFEA 1VCGA 2WNNA 3NR0A 3TU9A 3WJZA 2B7QA 4UR8A 4DO4A 3NQ2A 4ONVA 5AHFA 2JKAA 4IMGA 2QCEA 2NXGA 2NZLA 4KFPA 4NUWA 3B0VC 3MBDA 3LERA 3EWWA 1DBTA 1X1ZA 4UMAA 5HWJA 4JGDA 3T78A 3EX3A 3TSMA 4CQ9A 4BI6A 1YDVA 4ALDA 3UD6A 1KM0A 3BW4A 1RQEA 1OFEA 4GXMA 3HB9A 4IGHA 3G1AA 1KM4A 4JTKA 5CSSA 4AHOA 3ZS4A 3WK0A 3PUOA 1OABA 2CLEA 2J27A 2QCDB 1SZEA 3MO7A 2DZSA 3UXDA 3O8AA 3NQ7A 5G1YA 4RJEA 2YGYA 1H7XA 2F7FA 5D32A 1IXPA 1BWKA 3QEZA 1GVSA 3FYPA 4J9JA 3K30A 1FDZA 4M7TA 1CX9A 3PUDA 1W31A 2X1UA 1JRBA 4JTSA 3LRKA 4GUHA 3DHDA 2A7NA 1SZGA 3ABRA 3UWWA 3TW6A 2VKZG 5DLCA 5EMUA 3L0GA 4ZQPA 4CQ8A 5EKYA 3NEVA 2OCZA 3QJAA 3OVRA 3GYEA 3NL2A 3SIZA 1OYBA 2FDSA 3A21A 1N8FA 4BI5A 2CLLA 5I3HA 2QAPA 5K9XA 3M43A 4HHPA 4HNNA 2QF7A 2Y7DA 1A50A 1L6WA 1LCOA 3DKJA 1A5BA 4WJEA 3W2JA 4A21A 1TRIA 3R8RA 4N9CA 5LKYA 1L9WA 2ZFAA 2G97A 3JR2A 4K7YA 3W23A 1J5TA 4PC8A 2XFWA 3LXCA 1O5KA 1QOQA 3TSBA 3TJLA 2GOUA 4IOTA 3L66A 1AW2A 4OQVA 1B4KA 4WY0F 3GDLA 2B7OA 2BZNA 1YXDA 3TK7A 2NXHA 2H8ZA 3W87A 3DU0A 5AN7A 4D2JA 3NZ1A 1CW2A 4O52A 3TXVA 3PF3A 4JDYA 3BW2A 3USBA 3PC0A 4UTWC 3PY2A 1LRNA 4ZL1A 3I68A 1YTEA 2V2CA 4LUIA 3RMJA 1RR2A 1TPEA 3DXIA 2FB3A 3PWAA 1WQ5A 4UMBA 2A7RA 4K8HA 3L5LA 2GVJA 2KZHA 4O16A 5CZTA 5DY3A 3YPIA 5I3KA 1K8YA 3THQA 1LORA 2DZTA 3VCRA 1NFBA 3TKFA 3RLUA 4O4WA 2X1SA 1TTPA 1K7EA 5TQLA 2HTMA 5HUOA 3CB8A 4UNLA 4IMCA 1EWEA 3NOEA 3HGJA 4O0KA 2R14A 2RFGA 1ZALA 5TBOA 3G8RA 5AC6A 3L5AA 1KV8A 3KVLA 1L6YA 2PRMA 4B5NA 3B05A 1KA9F 3TH6A 1HFBA 1N7KA 1P0NA 4FX6M 3LCWA 2LLEA 1PHWA 1KM5A 4NX5A 5A8GA 2Y70A 1W5MA 1V7YA 2I1OA 4FEZA 8TIMA 3IIOA 1JQVA 3E02A 4Z0JA 2P0OA 4JTUA 3QW3A 2C15A 4RZ6A 2C1HA 5F2LA 3WJYA 3HO8A 3TFCA 3W7CA 4A29A 4RXFA 3P74A 1ZENA 5FI8A 3W6YA 1X1OA 3EWBX 2P10A 2WSYA 5HNRA 1EPXA 4M19A 2RDTA 3PB0A 3M5YA 3CT7A 4Y9AA 4MFDA 3P5YA 1WDWA 3G1YA 4LNYA 2C3ZA 2Z6JA 1OHLA 4QNWA 1Y0EA 3MHUA 3TX9A 4HIBA 2QCFA 4RK8A 2CZEA 3HG2A 1YLVA 1ICSA 4M7SA 4Y8FA 4DXVA 2WSRA 2J9YA 2J6XA 2X2GA 4ZQRA 1HTIA 1FWRA 3B8DA 1YDOA 5G4EA 1JUBA 3QRHA 3W7EA 2ZYFA 3GNDA 4I7UA 2QDHA 5DY2A 2C16A 2FJKA 2CZFA 1YDNA 4H6KA 3WK2A 2PRHA 4WXYA 1QNVA 1VYSX 4MVAA 1ZJIA 2A6LA 1KBIA 2VFIA 4GE8A 2GVLA 4N4QA 5F4WA 3DI1A 1GVOA 4YL2A 3QQ1A 4GWEA 1UUOA 5FF7A 1FQ0A 1UCWA 3P67A 2X1TA 3TC7A 4ZQOA 5MHBA 1QPRA 1TPUA 1SO6A 1VHCA 2A7PA 1EWDA 2Y6ZA 3CC1A 5K9DA 1LTDA 3CIWA 4LTSA 3KRUA 5KINA 3W7HA 2ABBA 2Y62A 5I3IA 1LBFA 1C8VA 1ALDA 1TPC1 3FKKA 3UPBA 1RVGA 4O1BA 2VENA 3QMSA 4AH7A 1SFJA 4NX0A 5AB3A 1QPQA 5LGZA 2QCMA 4X2RA 4XTIA 2HSAA 3B04A 1RPXA 4XBSA 1OFRA 5T26A 1GTHA 2I14A 1YYAA 3LTSA 1UASA 2OX1A 3LTYA 3OBKA 1ZAIA 2FB2A 4GUIA 1VPXA 3PB2A 4L4MA 5FEZA 3VE9A 2YW4A 5CPMA 3C2RA 4JS3A 1W3TA 5DELA 1D3HA 1YPIA 1GPWA 2YSWA 3IIPA 3T7VA 4K38A 1SO4A 3B4UA 3OIXA 3MYOA 3LCHA 3JRKA 3NGJA 1JCMP 2QJIA 3G1VA 2ZZ4A 3W1PA 4MYAA 3C2VA 4XBKA 3WJXA 4ADTA 3HOJA 1QWGA 2ISVA 3DFSA 3I7RA 4P2VA 2WKJA 3O6DA 3HG5A 5D02A 3LXBA 2G95A 4K36A 3C3NA 3R12A 5D04C 2WV8A 3W1TA 2ISSA 4FX7A 4K39A 2WJZA 3G22A 1H51A 4BWLA 4JTLA 1EIXA 3CQ0A 3S1VA 5LNRA 3T44A 4X3ZA 2Y85A 2BLEA 1OX4A 4R33A 3GZ3A 2NWSA 3OVPA 4FNRA 1OK6A 3STFA 3KVMA 3TXZA 2QUTA 4AF0B 3LHVA 3NQCA 4IXHA 3JS3A 4JTGA 1R2SA 5K2ZA 3L9CA 3OA3A 7TIMA 2V5LA 3L0NA 3M44A 3TAOA 5D30A 1SPQA 1XUUA 1PV8A 4O28A 4EF8A 1H60A 4HT3A 5D2TA 4IWWA 5EL1A 4LS0A 1H7RA 4MOZA 3M41A 1OFDA 3SSJA 1JUKA 3TIMA 4WD0A 3H54A 3P8JA 4CCCA 4IUOA 1TSIA 3W7DA 4EF9A 1R2RA 1G6CA 1EP2A 3MJYA 3S6DA 5BRBA 4S1FA 2CZ5A 3GDMA 5E93A 4O53A 3WJWA 3S5NA 3Q37A 1YTDA 4NQ1A 3U6WA 2R8WA 4LW7A 3EKZA 4KFNA 3F1QA 2A1YA 3C61A 4YXGA 2QCDA 3DFQA 3GK0A 3GB6A 3UQNA 3F03K 1SZNA 1RQHA 3QSTA 1QO2A 2W0UA 4I7VA 3BLIA 5LSMA 4LT9A 2B7NA 1ZY9A 4GBUA 3A24A 4MYXA 1E51A 2YW3A 4UR7A 3C0JA 5BOOA 3E49A 1TPFA 3C6CA 1W5NA 3DFPA 1Q6LA 4TX9A 1FWSA 2XN1A 3ELFA 1TPWA 2R91A 3KRZA 1AL8A 1IXOA 2RH9A 1W5PA 3UPWA 3G1FA 1EP1A 1TPDA 3W88A 1IGSA 4KWWA 3SFKA 4IPIA 5AHNA 3BG3A 3G8EA 3GDRA 4TU1A 5DCBA 1IXNA 2ZQ0A 3E96A 2VOMA 3OEXA 1KTCA 5CGQA 2YPIA 3CHVA 1HL2A 2EHHA 3FS2A 3P80A 3OHIA 1WBJA 4YLWA 5HINA 1KLYA 4MY8A 1LBLA 3IVSA 1S5VA 3TA6A 4O14A 4GC4A 4OWGA 1M5WA 1X6UA 2YYTA 3NAVA 3ZWSA 3SGUA 4FIQA 3FFSA 4RXGA 3W7OA 2ZZ1A 2Q3RA 2H3DA 3IIZA 3M0ZA 4PL2A 1TMHA 3LLDA 1Q6QA 4OV9A 4UC5A 1G4SA 2NUYA 4NZJA 1BWLA 1J4EA 3GNNA 5EBUA 3S42A 5D2WA 1W5QA 4EWND 4HPXA 3CU2A 1SW0A 1QDSA 1SSDA 2GQ9A 4FNTA 4JDBA 2CW6A 1X8FA 2Y7FA 5L6UA 3RFAA 5AYYA 3MW7A 1H50A 3C8FA 5G2HA 3W2LA 5KZEA 3AO0A 3BVJA 1ZAJA 1AW1A 2GJNA 1JULA 2ZTKA 1W37A 1ZFJA 3W7QA 1UUMA 4KFOA 3UY7A 2ZDRA 3THAA 4UTWA 5LHFA 3CPRA 2J88A 5HWNA 5AHMA 3HQ1A 1TTIA 2NX9A 3L5MA 4LS1A 3TNOA 5FEXA 1LOQA 3W86A 5F1VA 3LLFA 1GVQA 1HG3A 3BO9A 3EWXA 2ZRYA 4JD4A 5GVJA 4IPJA 3P8IA 4CCEA 4FO4A 2ZA2A 5C2XA 5KITA 2B0MA 3N9SA 4YCPA 3GDKA 3INPA 4LVAA 3GR8A 2TPSA 3G1DA 5HR6A 1K02A 3QMRA 4Y6GA 5I3GA 3CWNA 1KM1A 2HMCA 2TMDA 2YR1A 2QUUA 5EA9A 5BMWA 1H5YA 2ZRWA 1K7FA 3ATZA 4NXSA 1JCNA 4Q33A 5C6MA 4EVZA 4NJJA 2VXNA 3LB0A 4X9SA 3TC6A 1KFLA 3B0UX 1IIGA 3O6YX 4HNTA 3CLMA 2E5BA 1TTQA 1DQXA 5KMYA 4XZ9A 5HWMA 4YWIA 4E0CA 3DAQA 1F2JA 1JJKA 4P61A 4LC6A 2Z1BA 3HPZA 4LVBA 3UWZA 4N9BA 4DPQA 4DO6A 3S1WA 4PEKA 3HGRA 1I8JA 4A2RA 3KAOA 1VHNA 3LDVA 4WOQA 4ADSA 1PIIA 1K8XA 4JX4A 4FXSA 2Z2UA 3STEA 5CPLA 3BGJA 3LV5A 2C13A 4ADUA 4UMCA 4MUZA 3FJ6A 2V5BA 4AXKA 1H63A 1PE1A 5K4XA 3QFEA 1Q45A 3O16A 2NUXA 3B03A 5SWUA 2NX3A 4O0ZA 3C2OA 2Y7EA 3PM6A 3P61A 4O57A 3QSRA 4YCOA 1A5AA 2XN2A 1H7OA 1G7UA 4UFJA 2QJHA 1LLZA 3GIYA 3LCGA 1GG0A 5G5IA 4IMEA 2CLHA 2ISWA 3W1QA 4DELA 2H3BA 1YPFA 4ICNA 3NQDA 5DCEA 1Q6RA 2B4GA 1B4EA 3IIXA 2ALDA 3TQ0A 1JUEA 2CU0A 3L65A 2PURA 4GNJA 3W7JA 2Q8ZA 2V30A 1OFOA 1MXSA 2ZZ5A 4JN6A 1F73A 1XBZA 1DVJA 1H7WA 3BV4A 4DF1A 3C2EA 5LNWA 5D33A 2X16A 3P60A 3L68A 5IM51 4UFHA 3O1NA 5LNSA 3ZR4A 4A3UA 5I3JA 1KW1A 4LVGA 2OT0A 4LWWA 3S8HA 1MSSA 4AEOA 4IX2A 4JTEA 5F2GA 1P5BA 1YXYA 2DJXA 3ZFHA 1Z44A 2C0AA 2C19A 3UWQA 5IBXC 1VYPX 1G4EA 1U83A 3TMLA 2PRLA 2DU2A 1B9BA 3HGOA 1MO0A 3LHZA 3LCIA 2CWNA 4MZYA 4YMZA 3DH7A 3W7RA 4LU0A 5D37A 5D38A 4RR4A 3QPYA 3W7KA 1K7XA 5D2YA 4UUIA 5C5YA 4O13A 3VFLA 4XUGA 5LNUA 5K3VA 2CLKA 3LTPA 1QOPA 2A85A 1GOXA 3MMTA 4TIMA 3I6RA 4XKYB 3SZ8A 3MP4A 4OBTA 1GEQA 3MI3A 4U4MA 1MEHA 3RU6A 2CLFA 2C14A 2V2HA 3W83A 1G4TA 4LV9A 1I2PA 4QSHA 1VLWA 1DHPA 2A2IA 4TMCA 2WSQA 1LLWA 4CCDA 4Z1AA 3MUXA 3O63A 1M7OA 1Z48A 3W7GA 1H1YA 2YCEA 2ZZ6A 3SECA 4JNMA 3BG9A 3MWAA 5DXXA 2VFFA 2EKCA 4WXZA 3LRLA 2IQTA 3A23A 3NG3A 4UFLA 1EB3A 3W2KA 4UTKA 3Q2DA 1MEIA 5CZ0A 2BSLA 1PS9A 2FIQA 3GAKA 3HJZA 2J9XA 3NA8A 3I7QA 1ADOA 4JR5A 1K03A 4W9TA 2O7SA 5K4ZA 1OF8A 1BKSA 3T40A 4IXXA 4M6VA 1TPH1 4NU7A 3GLCA 3M47A 4C1LA 4BR1A 3TSDA 3M1ZA 4O10A 3WK3A 1L2UA 1KLZA 3ABSA 3GDTA 1CI1A 3TROA 2NV2A 3NM3A 4UNKA 4MKNA 3LRMA 3D0CA 4PA8A 2V82A 4UTHA 4M5PA 1F74A 1XFBA 5D03A 3IRDA 4JTIA 4UFIA 3N2XA 1IF2A 3C4UA 5AC7A 2C18A 4O54A 3HG3A 5G2IA 1JCYA 3CIXA 2YDAA 3C52A 1VZWA 4Q4KA 4O18A 4LUJA 5J5DA 1D9EA 5HMSA 4JTTA 3TJXA 3EKLA 3BK0A 2GJLA 1KTBA 1XI3A 1TPVA 3WFAA 2DORA 5F2MA 4UTTA 3ATYA 4FHAA 5K7JA 1TB3A 2ATSA 4TMBA 5C54A 4HPJA 3HIJA 4DEFA 5F2IA 1OFPA 4ORMA 4N2YA 3NQAA 3P62A 3UYCA 2HS6A 2V8ZA 3F4NA 2Y89A 3R89A 3EXTA 1F7BA 1RV8A 3O07A 4DBEA 2DZUA 4FIRA 3IVUA 1UB3A 3NXFA 3WK1A
chains in the Genus database with same CATH superfamily
4GY1A 1GKRA 2QR6A 1ME9A 3GXPA 3WENA 2CLOA 1TJPA 7TAAA 3AOFA 2J6VA 4X0NA 1K3UA 1KTNA 1GW1A 1P0BA 3VE7A 2HK1A 5AECA 1UQZA 4PFMA 1C8XA 1W91A 1OYAA 1QR7A 2DW6A 4QCFA 4HB7A 3M5VA 2REQA 2PLCA 2XIJA 3WZ0E 1EQCA 4GCXA 1KFCA 1CECA 3K4WA 4H7ZA 3H53A 4GJIA 4KQNA 2PC8A 3S47A 5BXTA 3IJDA 1GVFA 4O1CA 4UCGA 4Z2GA 5FJOA 1S2WA 2DT1A 2PWFA 2ONEA 5A1AA 4GO9A 3PULA 2BFGA 1J10A 4AD1A 1K9EA 4Z08A 2RKXA 1HF6A 4ZZ9A 3A4XA 4PTWA 1KNWA 4XVDA 4DUVA 1O5XA 4X61A 1F76A 4IL0A 1EC8A 4AY7A 5E9XA 1ME7A 1J2WA 4I6VA 2YLLA 2CEQA 3V7PA 4QM1A 3G1HA 4K8EA 2DP3A 1FDYA 1SJAA 3GWQA 1JG9A 3ZYZA 4HP5A 5D09A 4XKYA 4WKAA 3WLQA 1Y5XA 3WD1A 2NQHA 3S2LA 3KTCA 4BKNA 3W38A 3DG6A 1U1HA 4I8DA 3MV01 6A3HA 2NV1A 2XISA 3KOFA 3ITCA 4V33A 4HN4A 1ISWA 1VCVA 3CV6A 1FXQA 4KS0A 1XYMA 2WVUA 1QPNA 1W1B1 4JYFA 2OQHA 2IKIA 2VURA 1T8XA 4GACA 3PTKA 4WOZA 4N02A 1KM3A 5CC7A 2GZXA 3PANA 2GWGA 1PCKA 1RSCA 2VOTA 4DJDA 5AHLA 5EGRA 5H2ZA 3PAJA 3C2FA 2QUVA 3BC9A 3CB3A 3CT2A 1MEWA 2WNWA 1F9CA 5LHEA 2ZKMX 3NQMA 3PBVA 2OZ3A 2GWNA 4RDWA 3ZOAA 2ZXDA 1XCFA 4FXRA 2XVKA 5AYXA 1DIOA 5EYWA 1CLXA 3BW3A 3A5FA 1KXHA 1KR0A 3ARTA 3LCFA 1W32A 5AYZA 2VHLA 2VEFA 1KCZA 3G0UA 2YXGA 5A5WA 3AI0A 1ICPA 3N17A 1ZAHA 3QY8A 5FOOA 1YBQA 4REQA 1XYBA 1FY6A 2FGBA 1NH6A 4DX3A 1WBHA 1A80A 2ZBTA 1CGUA 4MB4A 4NL1A 3H12A 1G4PA 3WD0A 3CM4A 3OPSA 4EOUA 1ZB5A 2WQPA 2BWGA 4C6MA 4I7WA 5LGXA 4QQ3A 3MKKA 3ABQA 5HULA 2H90A 4GQRA 4PB3A 4PUMA 1W3JA 4QEEA 4G1KA 1E6PA 4K1WA 3EMZA 3VIIA 4DF2A 1U2YA 3WQFA 1K8ZA 5XINA 4RZBA 4OKDA 2Y7GA 4G7FA 7PTDA 4EXQA 2AQWA 2A0NA 1NU5A 3HG4A 4JY8A 1MZHA 4O1AA 5FACA 1Q6CA 3NXLA 3W7MA 4AX6A 5KZ6A 2ZXBA 5FEWA 2V9DA 4YN5A 3ARZA 4CU7A 1VGAA 4KKXA 4Q6XA 4ZB2A 1PHQA 2FHBA 2CXGA 4E5TA 1QVBA 1XQLA 4L9ZA 3L67A 2QKFA 2X2YA 3AZSA 3KHDA 5AY7A 2DJLA 1Q3NA 4PMDA 1W3NA 1DOSA 3BQ5A 1F6KA 2D0GA 5ECUA 2AQOA 1WV2A 5FESA 1JZ7A 2BOFX 1V0NA 1W54A 4S2CA 1XISA 3PG9A 1Q4WA 4JTFA 5FEPA 3WDIA 4L65A 3JZEA 2ZWYA 3RCYA 1DORA 2E0PA 5I0DA 2W6RA 2CZDA 3VKDA 3ZR6A 1LWIA 1GQNA 1WXJA 4JCLA 4JEQA 1JPDX 4AAJA 3U8GA 3BMVA 3PJWA 4HHMA 3K8KA 3MHFA 4EANA 3SFWA 3CV7A 3NM1A 1AMYA 1HGYA 4TVDA 4E4FA 3MJMA 4WZHA 3GH7A 1BRLA 2GSJA 1EX1A 3I7SA 2JE8A 3ES7A 4MKSA 1GTEA 4EKJA 4E8DA 3MP3A 3LBMA 1H5VA 1A4LA 3FDGA 3E9AA 2GGJA 4MLJA 5E0FA 1V3IA 4J4KA 4CN4A 1EJWC 3TTSA 3BG5A 1R3SA 4DN1A 1HX0A 3II1A 5JVLA 1UJQA 2CKSA 1YXCA 4GYJA 2XGZA 3OQEA 1QW8A 1PDYA 2AMXA 5AZ0A 5D8WA 1XLMA 4FXJA 5FF2A 2XINA 3PBWA 3EKGA 3PSVA 2I7GA 1LL4A 4ORIA 1F5ZA 5BU9A 1JPMA 3B9EA 4Q6JA 4ZQNA 4MZ8A 1LZOA 3ARSA 5M17A 4LUYA 2CKRA 1T5AA 4A22A 1FWWA 1SO5A 4HU8A 1JI1A 4V2XA 4UTIA 1FCVA 5EB8A 5HQEA 1V7AA 4W85A 3TC3A 2OEKA 1RQBA 2O9RA 1NDVA 1TCDA 4DAFA 1Z89A 3OBAA 2VZSA 1UA3A 3PVFA 4ECLA 1KXVA 3KL5A 3TOPA 5HPCA 1KM2A 5LNVA 1NELA 3WQ4A 3DFHA 2ZX9A 2FGLA 3TCEA 2Z29A 4UIOA 3PZIA 4MB1A 2FH8A 1XRFA 1AL7A 3C5QA 4UOZA 3KOXA 4CNOA 3C0QA 2QMJA 1NY1A 4Y90A 3SI9A 2E28A 1QI2A 2GK1B 4O8RA 4RZ5A 1XL9A 2HROA 4EIVA 3W3OA 3IIVA 4PBGA 2PDNA 2XWEA 3HZ3A 1BF6A 4B16A 3OGSA 4HA4A 1MXGA 4KEZA 4MFEA 1HKVA 4DJEC 1TQJA 3WH8A 1F3WA 1FOBA 1SJBA 2FTPA 4LYKA 1GJPA 3VNDA 5RUBA 4QLJA 1GKPA 2XPKA 2NX1A 4GJJA 3CUXA 3KOZA 4OJYA 1UP3A 3T1GA 5H91A 4JIHA 2X41A 4NJKA 3EOOA 1LT7A 4DJFA 2J75A 1PJ9A 3V1HA 5DMMA 2G4JA 1WYIA 3QOKA 3WEZA 3EOUA 3VAVA 3EMCA 1FCQA 4WY0B 2DSWA 3W4RA 3GR7A 3W71A 4P7NA 3SR7A 4LFYA 2D73A 3GH4A 4CLMA 2EG8A 4PBEA 4MWAC 4W8LA 2Z1KA 4JTHA 3TR2A 2GDVA 2NQ9A 2VFGA 1XF0A 1JR1A 1B31A 3HPAA 2Z0IA 4FK9A 3URQA 3SW6A 2DZXA 2I5QA 4H7VA 3TLLA 2X8RA 2CBJA 3VX1A 1A0EA 4LVFA 1GOMA 4NI3A 4TQTA 1OCBA 4RDVA 2E9LA 4MPKA 5LIYX 1WDPA 4O11A 2J9ZA 2XVLA 3RMEA 1YNQA 1VIWA 1LYXA 2FZMA 4HHHA 2VI0A 1E70M 1BXNA 4DM1A 3F4WA 4IG2A 1R5YA 4NAFA 3EWCA 3M6YA 1I2RA 4PTDA 3P2VA 3GRIA 3NQGA 3VZZA 5TIMA 1QPOA 2D22A 4V1YA 4C60A 1DHKA 1MNSA 5HMFA 1L0PA 1ME8A 1TIWA 3W70A 1JD9A 3W1MA 1NWRA 3GR4A 2B81A 3K13A 4UFMA 3APYA 1QI3A 4LC8A 3CL7A 3Q94A 2C1GA 2XUCA 3RGTA 3HMJG 4OIFA 4IIGA 4PGLA 1KFWA 1UR9A 2P1FA 4ZENA 3EA1A 1YW1A 1TR9A 5G4WA 3F2CA 2V63A 2EPKX 3QC3A 1W1A1 5CJMA 1PL9A 1GYNA 3LX9A 2ZUWA 3DESA 4UTMA 4QTGA 1BYAA 2BTMA 1SFSA 4OU1A 3S9IA 1E71M 3BE7A 1CB7B 3L2IA 3MVIA 2BVDA 1PVNA 4D8AA 1CXEA 4JIRA 3RX3A 3TFXA 3R43A 3VGBA 4MJ4A 3FXGA 2A4AA 2JF7A 4PULA 2E68A 2XG9A 3L4TA 1HNYA 3EXRA 3MBFA 1LL6A 3A13A 3PZGA 4O1EA 4CD8A 2C91A 4PUEA 5CEWA 1SMDA 4YPJA 4ZEPA 4L80A 1JI2A 3OIHA 4GX8A 2D2JA 4GABA 4C6KA 3AIUA 3KBWA 5CBJA 5I06A 2OLSA 1FWFC 1Y7VA 4XIAA 1R8LA 3KHJA 4G56A 4PH6A 3EXSA 1KFKA 2O4QA 1KCLA 1HJSA 3PPGA 1LOLA 1W5OA 2YOCA 1FUYA 2YYUA 2J79A 4PUKA 5DBTA 4CNTA 2EF9A 1V4YA 4GFSA 3B9NA 1IHIA 3CTLA 2YX0A 3W00A 1E6NA 4IMDA 3O15A 5I09A 4NJGA 2Q3OA 3R1ZA 2PI6A 1XYFA 2JGQA 1WXYA 1V3JA 1S2TA 1LRTA 3UWEA 1UH3A 3PJXA 3LPOA 3PZOA 4BK9A 3RLHA 1KBJA 3GG0A 5IHSA 2VC5A 3ITLA 3P93A 5D9OA 2XWDA 2XH7A 3ZO9A 2ZC8A 1ZCCA 2DZWA 4RNIA 4ZOCA 3H2OA 4MJ2A 3WNKA 4CNNA 3GHTA 3V75A 4N4PA 2GSEA 3CZKA 4H9MA 4PMQA 3WQWA 3PFRA 2REQB 3R79A 4H6RA 1K1DA 4IMGA 3WUGA 1W1IE 2NZLA 3OU8A 4NUWA 3LERA 2BY1A 1OEPA 5HWJA 1GHSA 3E0FA 3EX3A 4J3WA 4IJRA 3TSMA 2OYKA 5BYWA 1YDVA 1E6QM 2C0HA 3KBJA 4GXMA 3HB9A 1BWVA 3G1AA 3VIFA 2BHYA 4AHOA 4MAZA 3A3WA 1Y65A 3IAQA 4Q8UA 4RV3A 1MQQA 3MO7A 2PTZA 1FWGC 3O8AA 2F7FA 1M03A 2WHMA 1NIUA 2J7DA 4X2PA 1BWKA 1EBGA 4EWJA 4M7TA 1W31A 1Q6EA 2YZ5A 2FYMA 3KBNA 2ZUVA 4U10A 4ASTA 1PSCA 2G4FA 2NQLA 5JBDA 1PXGA 5EMUA 3OO2A 1A5MC 1VD6A 1XPGA 4F2UA 4QS5A 2OCZA 3M0LA 3CGTA 1BGGA 1OYBA 3RILA 4CU8A 1TVNA 2Y5SA 1XLFA 1U5HA 4HNNA 4HHPA 1DWGM 1CXLA 2OSXA 3GDBA 3SRHA 2D0HA 1LJYA 1LCOA 1A5BA 2PDHA 4D6IA 4U2YA 3UCQA 2VVNA 4N7QA 3SDOA 4BQ4A 3GG8A 4TXEA 2NSXA 2CWXA 3JR2A 4K7YA 1J5TA 2DSVA 4B5UA 5GJMA 3BOXA 2Z1VA 3L66A 1AW2A 3HMCA 3GDLA 2NXHA 3W87A 5C7HA 1Q13A 3NZ1A 4FPSA 4BQ5A 2OKTA 2QF8A 2I16A 3TXVA 5T9BG 3BW2A 3PC0A 4J27A 1TA3A 2V2CA 1RR2A 4AZ7A 4P8VA 3S9ZA 1UMYA 1RPKA 5CG0A 4NF7A 3L5LA 4JTDA 5DMNA 3GUGA 3THQA 3KOWA 4O4WA 2X1SA 1TTPA 1B5TA 3ONCA 4UNLA 1J0JA 1MI3A 2GL5A 1ZU8A 2R14A 3GTIA 4G9PA 1Z7AA 1ZALA 5TBOA 3G8RA 3PWIA 3KVLA 4H6QA 2PRMA 3PPHA 4HZ7A 1XIIA 3KWXA 4W5ZA 3FGCA 4ZTXA 2F2HA 2CNCA 1IEIA 5A8GA 2Y70A 1QNOA 1S1RA 1W5MA 1XLAA 2I1OA 4AFYA 1UZ1A 3L23A 1DWAM 4I5RA 1EA9C 1NFPA 3IIOA 2V6AA 3E02A 4S3CA 3B8SA 4XZIA 4HSHA 4FR1A 4NAEA 4QP0A 3M07A 3LMZA 4A29A 5D8ZA 4UQ9A 3FHQA 3WLRA 3EWBX 4GQQA 1OGSA 4M19A 2RDTA 3DCPA 4A6GA 3M5YA 1FHVA 1BD0A 3LG3A 3AU2A 4CD6A 4AIUA 1ZZMA 1WDWA 4YYCA 1OHLA 5DRCA 1XIDA 1TV3A 3BGAA 1NOFA 1DWHM 3HG2A 3MUY1 3I6TA 1S1PA 1PYMA 3KEHA 3IJIA 1XHGA 2GGEA 1FWRA 2PWEA 1JZ4A 3ZT6A 5CC3A 3FCPA 3AWOA 3VZYA 1XLDA 3MMWA 2C16A 4GKTA 3M46A 2P50A 3F4VA 2PRHA 4WXYA 2WHKA 1QNVA 3ES8A 1KBKA 3S6TA 2VP8A 3FN9A 1E4MM 1QNRA 1VBGA 3DI1A 1MRAA 2AL1A 3AAMA 3VIGA 2NW0A 4H9UA 5FJIA 4IZGA 2INEA 4LAOA 1FQ0A 3TC7A 5MHBA 1VFOA 1TPUA 2NQJA 1EWDA 3V16A 5K9DA 4AZ6A 1H1NA 2E7FA 5BU6A 2J25A 4C6DA 3VDBA 3GYCA 4GKLA 5KINA 4F8XA 2WZHA 3WDRA 1CGWA 3GNXA 1LBFA 3E2VA 5A6KA 3CHEA 2GGGA 3UPBA 1RXOB 1RVGA 4JTCA 4JL2A 2R1NA 4NX0A 4IIBA 1J6OA 1US3A 2CBVA 5LGZA 2QCMA 1VKFA 4XTIA 1LQ2A 1GTHA 3LTSA 2OX1A 3LTYA 2YBVA 2FB2A 3CIVA 4U2ZA 4MMWA 4OZOA 5CPMA 1GGOA 5E6YA 3TJ4A 3RDKA 3FNDA 1D3HA 1TWDA 3B9AA 1GPWA 2YSWA 3AHTA 1SO4A 5HQLA 2QJIA 3G1VA 2ODOA 1QWGA 3C3UA 4WR3A 3S3GA 3HG5A 3ECQA 4GGBA 4GO8A 4YNGA 4S39A 4FX7A 4ZXLA 3RRAA 3NFUA 3FGCB 5I02A 3CQ0A 1DXEA 3T44A 4IQJA 4U5KA 2NWSA 4ZFMA 3KUMA 4EPEC 4AF0B 4E2VA 3JS3A 3OA3A 4L9XA 4KEUA 5CXPA 1HVXA 3M44A 4PTVA 1WUEA 1V3MA 1XUUA 4EX4A 3DHPA 1H60A 1VP5A 2W27A 5D2TA 4IWWA 6TAAA 1JUKA 3TIMA 4I9JA 1KGUA 4ENLA 4ZCWA 3RCMA 3S6DA 5BRBA 1XSJA 3WJWA 3U5YA 4D1IA 1YTDA 3CK5A 3IJLA 3CO8A 3FV9A 3QKEA 1EHNA 1F6YA 1JF6A 2A1YA 3ZJKA 3DFQA 3UQNA 1TWZA 1VBRA 3UYIA 3ONBA 4X60A 1QO2A 3PN8A 5C8BB 3BLIA 3ARYA 3TTYA 2F61A 4DZ5A 2YW3A 4XD3A 1GNXA 4H9YA 3QTPA 4UR7A 5BOOA 3N6JA 2GUYA 4UR9A 3CPGA 5A2AA 1UD2A 2W91A 4LBRA 2IPJA 3S2MA 1FWSA 1NM9A 1UUQA 2DPEA 4HCDA 3LGGA 4PRWA 4DY1A 3UPWA 1CPUA 3W88A 1IGSA 3UXIA 2CCRA 3SFKA 4XAFA 4INFA 2YXOA 3G8EA 5HATA 1V08A 2J13A 3VFCA 4AVOA 1OSEA 4M24A 3E96A 1IEVA 1K6AA 2ON3A 1HKIA 2PGWA 3P80A 5A6MA 7XIMA 4CN6A 2JEQA 1WBJA 4P7QA 5JIPA 4YLWA 3BJTA 5HOSA 3ISIX 3AXKA 3TA6A 4GC4A 4PUWA 3CO4A 3AMGA 3BZGA 3NAVA 3GTXA 3LMYA 1ECEA 4DO7A 3GIPA 4PL2A 1TMHA 3LLDA 2Q71A 1UROA 4MTVA 4UC5A 3SGGA 1BWLA 4WKHA 3S42A 3UJFA 4EWND 5CGTA 3QV6A 1SW0A 1X8FA 3IUIA 3WH5A 2Y7FA 1W17A 3RFAA 3UU0A 1JDFA 1ZP3A 5A8MA 5AYYA 1GJUA 1RH9A 2PWVA 4PN2A 3WIJA 3MW7A 3C8FA 1ZS2A 4OFCA 5KZEA 5C9RA 3BVJA 2EKGA 2VUYA 1WDSA 1WUFA 1KRAC 2GJNA 3W7QA 3CL8A 4GVHA 5I07A 2E1WA 4FAMA 2DH2A 1M3UA 5IDIA 3BJFA 1XIBA 2VCAA 3HQ1A 1TTIA 5FEXA 7CGTA 4NP7A 4NYYA 1UKSA 4GVIA 3NYDA 4JD4A 4XD5A 2OQLA 2V5KA 4OVXA 2WCGA 3P8IA 3ARXA 2FZ9A 5FSDC 1RCOB 4AG0A 1JPIA 1QXLA 5KITA 3INPA 3G5EA 2UWFA 3VIMA 1WE5A 2DQWA 3D5HA 1AD4A 1K02A 4GXWA 2HMCA 3MQTA 1J8VA 2WSPA 1ADDA 2QUUA 1DJWA 3UG3A 4J3UA 2WMFA 5M5DA 4XD4A 3RITA 3OLDA 3O6YX 3CLMA 1DIEA 4XZ9A 1UH2A 5HWMA 4YWIA 4Z17A 1R7OA 3U4FA 3VOHA 3HPZA 2PDIA 2PWUA 3H22A 4DPQA 3S1WA 1PKMA 1I8JA 5F7UA 2VGIA 1TMQA 4E4PA 4Z1YA 5ABFA 4JPGA 3FJ6A 4AXKA 1J96A 3Q45A 1EZWA 4DBWA 2EPOA 2NUXA 5SWUA 2YA0A 4O0ZA 3N6QA 3C2OA 2Y7EA 1TMLA 3KRBA 3AHVA 4O57A 4MWAB 3QSRA 5JH1A 5ABGA 1M7XA 3QV9A 2QJHA 2PU0A 3GIYA 3LCGA 1GG0A 1JCTA 5I23A 1CXFA 2D2OA 2CLHA 4G6CA 1YPFA 3WUEA 2CITA 4J35A 1Q6RA 4PUJA 3IIXA 3AYSA 1OWQA 1F4HA 2CU0A 3W7JA 1FWJC 2Q8ZA 1NQKA 2DFAA 3WDPP 3UVAA 4B5XA 5LNWA 1QHPA 2X16A 4EE9A 4UFHA 3ZR4A 4B5WA 1AH3A 4DAIA 3ARWA 3A3XA 1MSSA 3KL0A 4MADA 1N8IA 3SURA 2C0AA 1XD0A 2PPGA 3UWQA 3CUGA 3TMLA 1PIGA 2PTXA 1S5NA 3R7MA 5I78A 3LHZA 4S38A 3MO4A 3N13A 2J7BA 4LU0A 4A3RA 1K7XA 3HJEA 3UXLA 1D8CA 3WMSA 5EU9A 2CLKA 2PWHA 1QOPA 2A85A 4BJHA 2VRKA 3I6RA 3SZ8A 1W1TA 1US0A 4H9TA 4JFUA 2EG7A 1MEHA 4HNCA 2C14A 3Q65A 1I2PA 2PDBA 2WSQA 1LLWA 1OD0A 1REQA 2A79A 3O63A 4GYKA 1JZ6A 3WBYA 1TA3B 1ADSA 2ESCA 4F0LA 2ZZ6A 1GW9A 1TVPA 1L2QA 3BG9A 3MWAA 4AVNA 1J79A 3BLPX 1EB3A 1W1PA 5CZ0A 3WLTA 3RR4A 1EJTC 2FIQA 3GAKA 1PB0A 3HJZA 4BEQA 2J9XA 1JFXA 4WDUA 2XIIA 3DERA 1ADOA 2PDMA 1K03A 3VUSA 3OA5A 4IIDA 4U31A 5K4ZA 3APGA 3NEHA 3WLNA 4KMQA 4IXXA 2VC9A 3P14A 1TPH1 2C8NA 4WDWA 3ZSSA 4PUNA 2HZGA 4C1LA 4BR1A 1R3QA 3VX0A 4AISA 3FHAA 1L2UA 4F2BA 1KLZA 3CZLA 3GDTA 3WD2A 1E1FA 1YNYA 3LRMA 4Y8EA 4PA8A 3SCQA 3WNPA 2V82A 5FAGA 4UTHA 3BAJA 7A3HA 3LGDA 3CZGA 3MSGA 4JTIA 4I3GA 1IF2A 3C4UA 5AC7A 3ZIZA 5AYIA 2G50A 4R5EA 4O54A 4UQAA 5I7GA 3H7RA 4Q4KA 4W88A 3VMNA 1D9EA 2ZX7A 3EKLA 4S3GA 1XI3A 1QJWA 1TPVA 4MKVA 3M6DA 2EEXA 4XZWA 5F2MA 5C9UA 4HYVA 2ATSA 4OBRA 4DEFA 5F2IA 4EPDC 1PTDA 4LAKA 4XVEA 3CUFA 4F0MA 3P62A 2HS6A 4PCSA 3VKCA 1F7BA 3BCFA 1ISXA 1RV8A 2BMBA 3T6CA 4WK9A 3IJ6A 1KXQA 2DUXA 2JKEA 3DN5A 1MYRA 3NZRA 1DL3A 3BH4A 5F4SA 3MYPA 2BX7A 2VC6A 5CG7A 1VRDA 2BB0A 2Y4SA 1EUAA 5LZLA 1KB3A 4CQAA 1O6IA 3B9OA 3BAWA 4BFAA 1KBLA 2BXVA 3M5XA 4X0VA 5E09A 3W7PA 3E0WA 3R13A 4Q7BA 4DYKA 4PBFA 1VLIA 3QM3A 1PZ3A 4KPLA 1YE4A 4MWAA 3EGJA 2UY2A 4E2BA 3OG2A 4H7CA 2OMAA 2OGJA 1P0KA 3W74A 2NT0A 1N55A 3MI6A 4UB9A 5ABHA 3IGUA 1BLIA 4WEVX 4PRTA 2GLKA 3V18A 4HKPA 3U57A 4WJ8A 3NL3A 4O19A 2DEPA 5FCZA 3AZTA 1LP6A 3LUTA 4Y9OA 3BV7A 4AZCB 3U4AA 4XD6A 3B0XA 3HPSA 1S3HA 1E6ZA 3PBYA 2FZ8A 3ZLHA 4G7EB 4KWVA 2Z00A 1TV2A 5CZSA 2Y8VA 3GW0A 4HA3A 1E9LA 3GXMA 3S2JA 1JEZA 4AUBA 1UBSA 3C0SA 3R0DA 5CKSA 1BAGA 2VFEA 1E72M 3TAKA 8XIMA 4E2DA 1YHTA 1ZHAA 4PMXA 3IAPA 3GO2A 3A22A 2QYGA 4PRRA 1I75A 1EA0A 2FPYA 3EDKA 4U3CA 2XJ7A 1AQ0A 4K3ZA 2E9BA 2J62A 3URBA 3NTYA 4JN8A 3FAWA 5E1QA 2QHAA 5BNKA 3MB9A 5CSYA 3CBWA 4XQ6A 3VD5A 3OVQA 1K4HA 1W1VA 2QDEA 3W7LA 2OVLA 3DYPA 1Y5WA 1V6WA 3B06A 1REQB 2OYLA 4AX7A 1NEYA 1XDMA 4HVXA 4GC3A 5C55A 1ZBVA 1UKOA 3QGKC 4HZMA 3N34A 1UOZA 3KLLA 3FYOA 4XISA 4RL3A 2OOGA 5FD0A 3W1NA 2O9PA 4IG2B 3FLUA 4U28A 2R1KA 3GSMA 1Z9AA 4FNSA 3T81A 5DQPA 3IV3A 3CAWA 1J5SA 3A12A 2NWRA 3M16A 1ONWA 1TV4A 1KRBC 1QCWA 1QT1A 1J0YA 2OZ8A 3KZPA 1G67A 1VFUA 2OGYA 1EO5A 3WD3A 4JNYA 3WLJA 5FJUA 2H8XA 4ACZB 1Q7MA 3UJEA 4AU0A 1ML1A 1TX2A 2PMQA 3SY1A 3HQNA 1YE6A 3N1AA 2PDCA 3GZAA 5FF4A 3K8MA 3ALGA 3IPWA 1X98A 4H3DA 3T55A 3U48A 3W2UA 1B9ZA 4ZQCA 1O12A 2ZUUA 4PUDA 1B30A 2P8BA 3M5ZA 3O05A 1H7PA 1J01A 3ZWTA 1M9HA 3SCNA 3V1PA 5DX7A 1CBGA 3LCLA 4WY0A 3UWUA 3DC8A 4ZO9A 4LF2A 4AZIA 4DPPA 1SO3A 3POHA 4O1FA 2Y88A 4H04A 1SMAA 5M2FX 1JL8A 4Q8NA 1TPB1 1PWLA 1UG6A 5D4YA 2PS2A 4IFOA 1K77A 2W5FA 2Q6ZA 1UHVA 3CJPA 2VD8A 3GNRA 2EQDA 1ZNNA 5MKGA 3E0IA 2J7EA 1JDAA 4GUFA 1EOMA 3VIOA 2FGZA 1PKYA 3KVJA 3GKAA 3U0HA 1FA2A 3LENA 4TR9A 3WMCA 3PHAA 1VFHA 4JQ3A 1VAHA 5CH9A 1CYGA 1TZZA 1XM3A 4PL1A 1GYLA 1AQMA 2VD9A 2ABAA 4DJFC 3WBWA 4ZO7A 2QPSA 1H49A 1TO3A 3AIBA 4R27A 3LOTA 2YFOA 5I77A 1QAPA 3V5OA 5E6ZA 3VMPA 4Z1BA 5CPSA 4ZQMA 2G5WA 4GK8A 4O17A 1XYLA 4C65A 6ALDA 3Q58A 3L4WA 3WELA 3PJUA 2ICSA 4JYDA 3NVTA 1PKLA 3RYSA 4CD4A 1POKA 4JTQA 3FY1A 3OQ8A 3S1XA 2DT0A 1VFFA 5A6SA 6ENLA 3A4AA 3QW4B 3SO7A 1I0DA 2QEZA 3WQVA 4QG9A 2WZIA 3BLLA 3PZUA 3EPOA 3RLVA 1VBJA 3SUSA 2Y63A 4L1WA 3G3DA 1TE6A 3VDGA 3KLKA 1OFAA 2G96A 3KVKA 3VIKA 2XIMA 2OKOA 1TYGA 3EX1A 4AZBA 3MU7A 4R34A 3VGDA 4L1GA 2ACSA 2R1MA 1V93A 3BMWA 4HZ8A 4UOJA 1IXQA 2VTFA 4QE4A 2NXIA 2NSOA 4CN1A 3LBCA 2ANUA 4UFKA 1XPYA 1FXPA 3PZVA 4R53A 1TIMA 1A5CA 3D47A 1N8WA 4C5YA 1OD8A 1YQ2A 4A05A 1FHUA 4HHLA 2PB1A 4GCAA 4Q4SA 2OZ0A 1F05A 4KT2A 4GI4A 3JW7A 1XH1A 1R47A 5BWAA 4RPQA 4O50A 2PD9A 5I3FA 3GXDA 3CEUA 1Q2RA 2NLYA 2A21A 1JYXA 2WPBA 4YS1A 1XFCA 5A6AA 1I4NA 1PCWA 2FPVA 1AJZA 1LLOA 4W89A 1P1MA 1FCBA 3IV8A 3O2LA 4E38A 2EGZA 2GQAA 1ONEA 2E3ZA 3L2LA 4PCFA 4S2BA 3ZXWA 4KWSA 3BAIA 2J74A 4IMFA 3CHDA 2FLIA 2WZMA 3WJSA 2HVMA 4HYWA 3QMTA 2QPUA 1EUNA 4FR6A 1KCXA 1WX0A 2W79A 4JIIX 4QSFA 1OC7A 3R5EA 2PLMA 5HJLA 2DIKA 4W7VA 2YA1A 4AZCA 2OR2A 4LB4A 3BQ6A 1NAL1 2I56A 4GYPC 3U9IA 4GYPA 1SJCA 2BXZA 5BZAA 4MPQA 1HP5A 4MUPA 2ACUA 3JZUA 4RPPA 1BTMA 3UCDA 3L21A 3DG7A 4B2DD 3LM7A 3CZJA 1F6PA 4C6FA 3EX4A 5G1TA 2DUZA 4HGXA 3GXTA 3CV1A 4BF9A 3P0XA 3PS7A 2CLIA 4UCFA 4QIUA 3DFYA 1P7TA 5CSRA 1CLVA 2VX6A 3UF9A 4DZIA 1XG3A 1WOAA 4XBJA 2PP1A 3ITXA 4DLFA 3W72A 1AVAA 2OZTA 4NIRA 3H7VA 1RLCL 2YBUA 5IBXA 3BSHA 1R3YA 1H4PA 1NTHA 1U33A 3WF0A 1T0OA 3W7NA 4FF5A 2D24A 2WKLA 1E9YB 2ZRXA 4G1NA 3IRSA 4Q8TA 4KEMA 1RZMA 1G0CA 3UY8A 3LHTA 1WCGA 4AXNA 5GNYA 1R2TA 3LPFA 2O0TA 3N9KA 3WH7A 2VZOA 4XO7A 3PZMA 4O4VA 2RGLA 4MJZA 2WLYA 5G2WA 5EY5A 3H23A 3R11A 5A8NA 4M6PA 1H0GA 1MW3A 1XCXA 3E2RA 3LHWA 3TEVA 1UKTA 3GVGA 4HA0A 4Z42C 2FPTA 4ERIA 2VR5A 3DHFA 5TF0A 3U2OA 1EJXC 5AZ1A 2HPIA 2E09A 3T42A 1K8CA 4ACZA 5FF3A 1KRMA 2V81A 1GVYA 1SM9A 1O94A 2X7VA 4CKQA 3M0MA 3FIGA 4E8GA 4YHGA 3UR5A 1P0DA 1XIMA 2UBPC 2Z1XA 2V5CA 3NZQA 3QH2A 3QQWA 3UJ2A 1KRCC 1M1BA 1OADA 4RKAA 1AJ0A 2WKGA 4OV4A 3UJSA 1V6UA 4HOWA 3T4CA 2DIEA 4R3UA 1KBBA 1SR9A 3NDYA 4JL1A 3PPCA 1GT8A 1GYMA 5LXEA 1PYFA 4O12A 4M1BA 3HURA 3F4CA 2PC4A 2UY3A 4HOZA 2GGIA 2PDYA 4NVTA 1RD6A 4GZJA 4OBSA 1RD5A 2I9UA 2GVEA 3FJNA 1M65A 4G7EA 1DKWA 3REQA 3CMGA 5B80A 2ZX8A 1GG1A 4RW3A 3O3RA 2YFNA 5HANA 3CL6A 3RR1A 3TQKA 1M68A 2ACRA 1OYCA 3LLXA 2CFFA 2WNQA 2C7FA 1LBMA 3G24A 3IJ8A 2OWWA 1NP2A 4NJIA 3ARVA 2OJPA 3CXOA 3O7UA 3PBMA 4XZNX 1ONRA 3M4HA 2F84A 3SQMA 5FJJA 1F61A 3FOKA 2WJEA 3S5OA 1FX6A 3WUBA 3SN0A 2FZDA 4YTRA 1DWIM 1V5XA 3OYXA 2Z24A 2JKPA 2GDUA 3LU2A 5REQA 3SY5A 1V0KA 1KKOA 1UWQA 3K4AA 3KW3A 1Q4NX 3LS9A 3RJXA 3VIJA 1ELSA 1QPKA 2VQUA 1EEPA 3K4DA 4BZYA 3OG3A 4M81A 1R86A 3B0PA 4GZIA 2CERA 1JCLA 5J5RA 2V2DA 2XSXA 4F4RA 1W1ZA 3N2MA 3ARUA 1HZYA 3WUFA 1HGWA 4AMCA 4FNUA 3W25A 4BI7A 4DZHA 2ATMA 9XIAA 4ZB5A 3RG6A 3U2ZA 2WSKA 4LV4A 3DFNA 2F2KA 1XC4A 2A3AA 1UJPA 3BLKA 2RDWA 4H2CA 5TAOA 3WMLA 1TV7A 1CCWB 4QE1A 5CZJA 4DXXA 4FOJA 4OT7A 4ATLA 2X09A 1UIPA 3ANYA 1H09A 4Q8OA 4WSHA 3B8TA 4Z1CA 4RLIA 1PEZA 1S3TC 4GH1A 4DWSA 4QAIA 4IUGA 3E5BA 2HNHA 4A8RA 3ENLA 3ITOA 1Z69A 4M8UA 4PCPA 3NQ2A 3PAOA 4YTUA 3UG4A 3UA4A 4HNOA 3DX5A 4L6HA 5AHFA 5A95A 4KFPA 3GNOA 5FAJA 1RK5A 5JXQA 3EWWA 4UMAA 3U5UA 4CQ9A 1XX1A 1Q7QA 4ERAA 2F8QA 4P8WA 1E55A 1OFEA 3VUPA 1VBUA 1TWIA 2HXTA 2NVDA 2DVXA 2CLEA 1IT8A 1XLEA 5BXRA 2AAAA 5I6SA 2DZSA 3UXDA 3BDKA 5G1YA 3NQ7A 4RJEA 5D32A 3QV8A 1IXPA 4GI9A 4JTSA 3M0VA 4ZOAA 3LRKA 5D9NA 4GUHA 5CC6A 5GPRA 2A7NA 1SZGA 3ABRA 4JFWA 2VKZG 1IT0A 5FA5A 4Y9NA 3HU7A 4CQ8A 4FI4A 5EKYA 4HYRA 1JPHA 1UWUA 1IR2A 4W7UA 2BVTA 4AW7A 3NL2A 3SIZA 4KBXA 5EMYA 3SQLA 3VGGA 5K9XA 3M43A 4LYQA 5HJYA 2IKHA 2QF7A 2DSUA 4WJEA 1UD6A 1UA7A 3L7RA 4A21A 3CWHA 3R8RA 5LKYA 2QLYA 1W9VA 1JNEA 2W67A 4GI8A 3M0JA 1IV8A 2ZWZA 3IJQA 4QROA 4ERGA 1WDRA 1CXHA 3LXCA 3LYEA 5EMKA 3S4TA 3TJLA 1VENA 3N11A 5BCAA 3UGVA 1RA0A 3NO1A 3I4KA 1OB0A 4GYFA 4DWDA 2BZNA 4IHCA 2FHCA 3TK7A 4L4PA 4LEFA 1CW2A 3PF3A 4AEFA 3R94A 3USBA 4KF1A 5A2BA 1Z6KA 3SUWA 1TVLA 3VD7A 2CBUA 2VUNA 2KZHA 2P3EA 2A3BA 3USZA 3YPIA 2NVCA 1LORA 2DZTA 2QJNA 1NFBA 3TKFA 4R88A 3RLUA 4TX6A 3CB8A 1HL8A 4ACYA 3NOEA 2WANA 3URNA 2RFGA 2IPWA 6XIAA 1FWHC 1E56A 3T0AA 3B05A 2FFIA 5DFAA 3TH6A 4EAYA 1P0NA 4E3TA 2BY2A 2NQ5A 4FX6M 3DG3A 2LLEA 2VZTA 5MF5A 4N42A 1PHWA 2XYLA 2PGFA 2NQZA 1RK6A 3EDFA 3APTA 4US6A 4Z0JA 4JTUA 5A8QA 3TTEA 4ZXOA 4MDOA 3TFCA 4AD4A 2XGIA 3OLEA 3EA2A 5FI8A 4GY7A 1B3ZA 1CGYA 1PPIA 3VDCA 1ODUA 1EPXA 4MB5A 3L2MA 4PMVA 3GC5A 4NASA 2ZUSA 2GJXB 1I0BA 1PDZA 3ZQ9A 3HQPA 2O92A 3N29A 4J3VA 3UZXA 2Z6JA 3M64A 2PTWA 3TX9A 4M82A 2ZX5A 4HCLA 3NURA 1PX3A 4PR4A 1E9IA 1WPCA 4V27A 3NVDA 3AROA 3PUGA 4YWSA 3VINA 1HJXA 4LBSA 3SN1A 4GQ0A 2J9YA 1J18A 2VDGA 2PDKA 2IPFA 5G4EA 3WQ5A 3QRHA 2X42A 3GHUA 1W3KA 3K1GA 1O5RA 2QDHA 3SRKA 3EB4A 1H0IA 3DC0A 3N25A 1DTNA 2QW5A 2QV4A 3BZJA 3F5JA 2GVLA 3AMDA 4N4QA 1LUCB 1O5QA 3WQOA 4DHGA 5GJPA 1GVOA 4Q4OA 2YCLB 3QQ1A 4GWEA 1UUOA 2P5NA 1UCWA 2BOEX 3P67A 2X1TA 1QPRA 1VHCA 2A7PA 4QG6A 1UH4A 3SCOA 1LTDA 3SBFA 3T2OA 3KRUA 3W7HA 3QXBA 4J3SA 1D3CA 1PTGA 5I3IA 3MZ2A 1DIDA 4I5UA 2YL6A 4YTSA 2WYSA 3CYJA 2BASA 1BG4A 1F07A 1T7LA 1EF3A 4X2RA 3ITVA 3B04A 1OFRA 5T26A 2I14A 1YYAA 1UASA 1VPXA 4FXFA 2X0YA 3WN6A 3QOMA 2YW4A 4IIEA 1XR2A 4JS3A 2XIQA 5DELA 1MFUA 2XDFA 3FXYA 4QLKA 1YPIA 3T7VA 3N2BA 2OEMA 4WSJA 3B4UA 3WBXA 3LCHA 1K70A 1ZJHA 3JRKA 4D6FA 2DT3A 3C2VA 4NAFB 2YB1A 3WJXA 4ADTA 2VX5A 1ZJBA 5I2UA 2WKJA 2W63A 3E74A 2PWGA 4AYSA 2ISSA 1GKQA 4K39A 4BWLA 4JTLA 2DDXA 3RX4A 1Q66A 3TYBA 5BRQA 3B8IA 2Z1SA 3W26A 3KM8A 3LHVA 3NQCA 1R2SA 3B9DA 1EQPA 5K2ZA 3EOLA 1XCWA 3PP7A 4GPNA 3IUHA 1GHRA 4HT3A 5EL1A 3A47A 4P8XA 5JU6A 4LS0A 3CLWA 1H7RA 1OFDA 3SSJA 3B40A 1LG1A 2OFJA 3VNMA 5A6JA 3P8JA 1R2RA 4IPLA 4OTKA 1VEOA 3A4WA 4O53A 4S3DA 3A4JA 3Q37A 4XX6A 2YB4A 4AIBA 2BGNE 6XIMA 2DVUA 3G2GA 3WH9A 3WBAA 1DYSA 1UKPA 5FSEC 3VPLA 1RQHA 3ARQA 5IFTA 3QSTA 1OC5A 4I7VA 5LSMA 4LT9A 2B7NA 1E51A 2DSZA 3LQLA 2R1LA 1TPFA 3C6CA 4HBKA 2E9MA 1Q6LA 5G1MA 4WJXA 1T8QA 1B0IA 4B92A 3TWBA 1TPWA 1AL8A 1W5PA 3G1FA 1TPDA 2QT3A 3CUZA 4EPBC 4KWWA 2DUAA 4IICA 2IKGA 3GFYA 3QBUA 3CQIA 1KQZA 2AQVA 1XDJA 3BG3A 4WVXA 4AD0A 3H4GA 2OYMA 4TU1A 2V67A 4OOUA 2HE5A 1IXNA 4PMRA 1QASA 3EDJA 3OEXA 2YPIA 3H2CA 2IQ0A 3CHVA 4S3EA 3FS2A 2EJAA 3BAXA 3TYUA 2NT1A 1KLYA 4MY8A 1LBLA 1HT6A 3U7VA 3H4XA 3LN3A 1EJ7L 3ZWSA 4FIQA 1TELA 4F9DA 1RCQA 3W7OA 2ZZ1A 2EPNA 2H3DA 1GQLA 2Z4GA 3W0KA 1ITCA 2R82A 1Q6QA 1HJUA 4NZJA 2NUYA 4CQDA 1E0XA 1PZ0A 2FTWA 5EBUA 2HCVA 1W5QA 1S38A 4DWSD 3G6LA 4AD3A 1IE7C 1SSDA 1R87A 2GQ9A 2CW6A 2Z26A 1AD1A 3CMFA 1NJJA 3V0UA 1YIXA 2KAUC 3AO0A 1J9YA 5LIWX 3RCNA 2ZTKA 4UBPC 3EOSA 2ZDRA 1BYCA 4UTWA 3UW6A 5LHFA 5REQB 3CPRA 2BBFA 2PDWA 1B3WA 4V1XA 4EPKA 1LOQA 3SCTA 1V3LA 1QTWA 2Z2AA 2J7FA 2DVTA 1GVQA 3T0CA 3RX2A 5GVJA 3U7BA 4YJ5A 4CCEA 5C2XA 1NFGA 2JALA 4QDPA 4MHBA 3A9BA 4NRRA 4YVPA 2CHNA 4YCPA 3GDKA 2IKJA 1W9DM 3IANA 3FJ4A 3AYTA 2TPSA 5I3GA 2TMDA 3RO6A 1H5YA 3ATZA 4NXSA 3F4DA 4EVZA 2VXNA 3WNMA 1POJA 3K1DA 3TC6A 5CPQA 5DEZA 1IIGA 4W5UA 2E5BA 1DQXA 3M0XA 4P61A 1F2JA 4XIMA 1RLDA 5FJTA 1W9PA 4C6NA 3PZ9A 2W61A 5A6BA 4N9BA 3A64A 5XIMA 1EGMA 1TR1A 3W27A 1SYTA 4A2RA 2X7WA 4WOQA 1J93A 3GD6A 3JU2A 3A3HA 4F9JA 2E25A 4ADUA 4UMCA 2V5BA 4CU6A 1PAMA 1KD0A 1YNPA 3PTMA 2P53A 2OQYA 1DJZA 1QU4A 1A5AA 2XN2A 2XFYA 3RAOA 1LLZA 4KIRA 2ZUNA 3UESA 4Z2HA 3FYYA 2ISWA 4DELA 4ICNA 3W28A 3NQDA 4V15A 1XLLA 5AKQA 3EWDA 2QJMA 3KDOA 2ALDA 4GQBA 4CQCA 1QHOA 2WLZA 3TQ0A 3IUDA 3SN4A 3L65A 4RUBA 1OFOA 2AOSA 1P6BA 4JN6A 1F73A 3TYEA 4Y2WA 3MSRA 3N6HA 2DT2A 3HM7A 3WSUA 3O1NA 3THCA 4A3UA 5I3JA 4LVGA 2OT0A 4LWWA 3OGRA 4TOQA 3S8HA 2PDFA 4JTEA 4CGTA 3GVVA 1MQRA 1DPMA 3KS6A 2C19A 1U83A 1B54A 1Z32X 1MO0A 3LCIA 3RM9A 1RHCA 3FK4A 2PF0A 4YMZA 3DH7A 4F48A 3EOEA 4RR4A 3H4WA 2HDJA 2D2GA 2HBXA 3GS6A 4UUIA 5C5YA 3KS5A 1UD5A 4B91A 4XUGA 2I57A 3SUUA 4TIMA 4XSMA 1A3WA 1ECQA 2SFPA 5HPOA 1K9FA 3MP4A 3XINA 4U4MA 3RU6A 5I24A 4LUTB 2V2HA 1G4TA 4LV9A 5MKGB 3FDKA 4CCDA 2BY3A 1UR8A 5AVHA 1DJHA 1Z48A 3W7GA 2IW0A 3EZ4A 3NO3A 4CCZA 4L56A 3MA8A 1DXFA 3W2KA 4UTKA 3Q2DA 1MEIA 2FVKA 4XAGA 1NWUA 1PS9A 4BQ2A 2EO7A 5HQMA 1E73M 3NA8A 3LY0A 2H9AB 4JR5A 2HWGA 1OF8A 1BKSA 2MNRA 2MANA 4NU7A 3GLCA 1MFVA 4B4HA 3WNNA 3M1ZA 3OLGA 3WK3A 3B8VA 4MKNA 3RLGA 3D0CA 4JQ1A 4M5PA 4XSLA 1F74A 5I3DA 2YXXA 1EZ2A 3IRDA 1DE6A 4UFIA 1BSLA 2OB3A 3HTWA 2C18A 5ABFB 3AWNA 2VC7A 4H8VA 4O18A 1U5VA 1XYZA 1KTBA 5H8UA 2O9TA 3FAXA 1DJYA 2VVSA 3WG6A 3GE7A 5K7JA 3SUVA 3QY6A 5HNUA 2PZ0A 4AEEA 1OFPA 4MF4A 3AXXA 4US5A 3GM8A 2NV9A 3UYCA 4AIEA 1FWBC 5D9PA 3EXTA 3M7SA 3WDHA 1R3WA 2V5JA 2WMHA 2W4XA 4FIRA 3NXFA 3WK1A 3T2QA 5CBBA 1Q6FA 5I79A 1SW7A 2Q02A 1JIBA 1TX0A 3NNTA 1G69A 3CAKA 3LHUA 3FX4A 1X38A 5JBEA 1A49A 3AQUA 3K8LA 2C6QA 4BCEA 2DW7A 1VFTA 3QZ6A 4M51A 5LXXA 4JQ2A 1LG2A 2QULA 3NSXA 3KP1A 1A53A 4L5ZA 1WP6A 4N6FA 3ZJ8A 4MIMA 4FNQA 2UV8G 3W85A 3TMQA 2ZRUA 2VEIA 1DWFM 1XIEA 3VXGA 2Y0FA 3AIWA 1Q65A 2J7GA 4L4OA 2AL2A 3DBNA 1TV5A 1DJXA 1M6JA 3SJ3A 2ZOXA 4QNEA 4GBDA 3AYVA 1XYCA 4NYUA 3NQFA 3AUOA 5B7ZA 3CHCA 4HZ6A 4FP1A 1QUMA 3DFTA 3EX2A 1VEMA 3J7HA 5CQ1A 4UTFA 1NVMA 1FCUA 4TX8A 3KRSA 3W9ZA 4AWTA 4ZGYA 2GUUA 3ERPA 2O7QA 1LOSA 4RV8A 1EIBA 1WDDA 3S83A 1JAEA 2C71A 3NPVA 4JFSA 2WVVB 4ZVJA 3N15A 3PBUA 1GOKA 1C29A 4NZFA 1UWRA 3STGA 4UQCA 2GQ8A 1ZP4A 4C6CA 4UZUA 4JICA 4LVDA 1B1YA 5A2CA 1XGEA 3DZ1A 2O4MA 1GZ1A 2WZTA 3S2CA 3SADA 1RA5A 3C56A 3N04A 1MW2A 3GY1A 4LY8A 3GX9A 1E0TA 2PDQA 3ZZ1A 1EX5A 3EDEA 3LHYA 1D2KA 1TJRA 1FKWA 3ZM8A 2BGSA 1PX8A 3KDNA 1R30A 2E1DA 1PO9A 2VX7A 1XKJA 1NDWA 3SRDA 1CEOA 2JBMA 3DHUA 1Z42A 3CQJA 1M7PA 5AHEA 2WMGA 1UBPC 5IFPA 2YIHA 3EX6A 3RF9A 1IGWA 3SB0A 5BRPA 4HTYA 1BXCA 2F38A 1C3FA 5HA7A 5ECVA 3DFOA 4C7FA 2WMIB 4FB7A 2PBGA 4GRSA 4QLLA 4DXKA 3A9IA 4A3QA 8A3HA 5D05A 4P7OA 4AD5A 3THUA 1VFSA 4MY1A 2OT1A 3QN3A 1GEHA 1TV8A 4XZMX 4FF7A 3RPTA 3LZ3A 3PWGA 5AVNA 1S2AA 1E6SM 1Q63A 2RDUA 2ZXAA 1HUVA 1S2VA 3M7WA 4LRTA 1EDQA 3AISA 2XZ9A 3D3FA 3V0TA 3JUGA 5HK4A 4GG9A 4A35A 5LA1A 2IXUA 3NDOA 2QDGA 2ZUMA 2PE4A 4HU4A 4JYEA 5FF0A 4DNMA 4AY1A 1WKFA 2VEKA 3LCXA 3LI0A 3WDJA 4GUGA 3TQVA 2AKZA 1XKYA 4R85A 1T96A 4JBRA 1TWWA 1XLGA 1IIHA 4S3BA 2VEPA 5KZDA 3C8NA 1AMKA 1I1XA 4S3KA 1OF6A 2J78A 3WBEA 1G7VA 4IPPA 4K68A 4OECA 5IDZA 1V0MA 3AJ7A 1WDQA 4PSRA 1P4CA 3IGSA 4YTTA 2VDIA 3LM3A 2XSAA 1TUXA 2ZRZA 2PCEA 4JIQA 2VFHA 4ML9A 1T99A 3VD3A 2VEMA 4DJEA 5LYRA 3UWVA 4RNFA 1AH0A 1R9YA 4RZ4A 4HTBA 2XH0A 4GIAA 1F4AA 3MKVA 4KEVA 3WEOA 5L9FA 3QGVA 1TJ1A 2A3LA 2QUNA 3EMQA 4Q8QA 4TUFA 3OZMA 4IGNA 4S3AA 3WX7A 1A5NC 3R4IA 5H8MA 3VNJA 2YJQA 3MI2A 2PU1A 3W2NA 3NO5A 3QPZA 4XK2A 4M6QA 3W6MA 1WAWA 1TJ0A 4OOZA 3G1XA 1SQ7A 2ZA1A 4ZO6A 3N4FA 4LF1A 3A5VA 3O9NA 3QZEA 5ABEA 3UA3A 1XLCA 3NL6A 2Z25A 5JMUA 1O60A 4GGHA 3M9YA 4Q8PA 5AOUA 2QCNA 3ZVHA 5CAKA 4B3KA 4GFIA 1PUDA 3KFTA 1THFD 1U5JA 2QCHA 3SY8A 4W7WA 4HN8A 4C7DA 3PUEA 2YDSA 4DM2A 4QHRA 2A5HA 4LGXA 1DIKA 2E6DA 4LYPA 3B0YA 1W56A 1YADA 2QIIA 3S1UA 3VOGA 1H11A 3KX6A 4ML4A 3KCJA 3VIHA 4HOXA 3ITYA 4AZ5A 3IJ9A 2A6NA 3VNYA 1U22A 5DBUA 4BF7A 1WZAA 4NNCA 4Z2JA 5EFDA 1RBOB 3G1SA 5EBAA 1SUXA 2FZNA 4GISA 4F0KA 1OG0A 2V68A 4JTAA 3LZ5A 1GVRA 1PWMA 5E0CA 1IQ8A 1A5LC 4X22A 4MY9A 1IYXA 1VR6A 1S5TA 1C9DA 1CDGA 3K2GA 4ZE5A 3EWZA 4AZGA 4JY9A 4W8BA 3MDWA 5U4NA 4QRNA 2WMKA 3U3HA 1I2QA 4AF0A 3L0KA 4KERA 2G8ZA 4TTGA 3N3TA 1EGZA 1GJWA 5HUPA 1L6SA 1G1YA 4B5SA 2WC7A 1VYRA 5AHIA 5KEZA 1YTKA 5J8LA 4F3HA 4KCWA 4JX5A 1LRQA 3MKCA 5FL1A 2X1RA 1TZ9A 5D2VA 1F3EA 4OGZA 3SQSA 3OB8A 1I1WA 3TW7A 2UZ9A 4GZEA 1I6NA 2QJJA 4PMOA 5EMLA 3W7IA 5C2GA 2R6OA 3S9YA 3BOFA 3OODA 1KR1A 3L4XA 3N3MA 3V5CA 4FX8A 2QCGA 3H2EA 4FLQA 1XICA 3GVWA 4HK7A 1VFMA 2HNEA 4H4IA 5DMLA 5E9AA 3VGFA 4QJ1A 1UD4A 1OFQA 3LV6A 1DJGA 3PTQA 5D2XA 3ID7A 3V35A 1QNSA 1UMLA 2A3EA 3EEGA 2WBGA 2QZRA 3W73A 3BTNA 2G3IA 3R0UA 4MLRA 4R7OA 3S5YA 3BPWA 3E38A 1NWSA 1Y8BA 3MSYA 3VKJA 4IQEA 1E0WA 5KTLA 2ZZ7A 4AWSA 2IMRA 1FWCC 4JIEA 1XSKA 2FVMA 2GUBA 3QHOA 3O6CA 2DQXA 1LDCA 4JKMA 3K5XA 2Q8LA 1FH7A 1M41A 3GHRA 2ZTJA 4UZSA 3TNBA 2BS9A 1DQWA 1F3TA 1W3IA 1G5AA 4QE5A 4ZMGA 1SVDA 3UZ5A 1NWTA 3NPXA 4Z2KA 2GGHA 4H9VA 3WQ6A 1A3HA 3WLPA 2CZVA 1B3OA 3GVRA 1H61A 1OX4B 3PTDA 3GFZA 3W75A 1EDTA 1GQKA 4B15A 4J40A 1RALA 1SFLA 1RP8A 4G8TA 4L6DA 1XG4A 1GVIA 1MXDA 3NWRA 4AWEA 3MCNA 1XBYA 1IZKA 2G3NA 3STCA 3NQVA 1NF0A 4XUYA 3QYSA 2GJPA 4B90A 3NPWA 2HISA 4UTUA 3PG8A 1B57A 3DKLA 3VM5A 4B3LA 3TVAA 2RDXA 4WRHA 1C8YA 1ZTVA 4JIPA 3TW9A 1BYDA 3E6EA 3C86A 4Y9PA 1UP2A 2ADAA 4UTTC 3QR1A 1FBAA 1R3TA 3DENA 3TUUA 3QY7A 1XYAA 4XZLX 5H8PA 1HO4A 1VQTA 1TRDA 1C90A 3GXIA 3H21A 2EJ1A 1CXKA 1TREA 3SJNA 4KRUA 3GUWA 1AFSA 2B31A 1OJXA 3DYMA 2PP0A 1VCFA 4I9TA 3F7JA 3MV11 4OHQA 3E5PA 4OE7A 2QVHA 1VPYA 1QI4A 3BLFA 5HMDA 5CPOA 5EPDA 4DZAA 3G6MA 4LH8A 1VS1A 3EAUA 3P5ZA 1S39A 1O1ZA 1XUZA 1V6XA 4DF0A 2JK2A 4FLRA 4I9AA 4WUIA 5K9CA 3T07A 4LY4A 4C7GA 4QBXA 3LSBA 1JCXA 1E3XA 1T41A 1WXZA 2FFCA 3BUVA 3EPNA 6REQB 2VR4A 3TOYA 4LSBA 1BQCA 1UPMB 4MNKA 5M03A 2Q01A 3VA8A 8RUCA 1FDJA 4B2DA 2PDUA 1UC4A 1G01A 1GOOA 3ZJ6A 5FJPA 1JDDA 4GZ7A 4D72A 2WK2A 3UWYA 1V79A 1Q6OA 4D6HA 4BWLC 4ZO8A 1WOBA 1HW6A 2E6YA 1XP3A 3W1RA 3ORWA 3G3MA 3IEBA 3K46A 4LAUA 1DTUA 1HKWA 3IS4A 4ZR8A 1X6NA 2ZCGA 4AHPA 3H2AA 1US2A 1VJSA 2PTDA 4K7VA 3AIQA 3MHGA 4DLMA 3FJLA 1AJ2A 2CLMA 1XLJA 4JFTA 2DZPA 3S1GA 3TA9A 4C6LA 4BQ3A 3W22A 5C71A 4IFKB 4Z1DA 2FMNA 3CEPA 2QAFA 1RJRA 3EB2A 4I5XA 4H9ZA 1FH9A 1M04A 2E4TA 2TSYA 2QQ6A 4HPNA 4RCXA 3HBLA 4XO6A 3O6AA 1I2NA 1FWNA 2VMFA 3KXQA 1Z41A 1RAKA 4GH3A 3TP4A 1OM0A 5DCDA 3UP8A 3H55A 1VPQA 2POTA 4RX0A 2EPHA 1O95A 3H70A 2JF6A 4UXDA 1E5JA 5LIUX 4REQB 4L64A 1OG6A 1TTJA 2XVNA 3AS1A 4W86A 4N9EA 2PDPA 4NY2A 3CTTA 1WA3A 2RAGA 1GWJA 1DV7A 1QOXA 4DWSC 1FWTA 4JZ5A 1V03A 5BW6A 3PBGA 1KFEA 4JQ4A 1VCGA 2WNNA 2VYOA 4PMJA 3NR0A 3WJZA 4A8NA 4UR8A 2YDQA 4DO4A 4BY3A 4BA0A 1J0IA 1E1CB 3N2OA 4DIAA 3B0VC 3MBDA 3L12A 1W8GA 3G77A 5C7VA 1DBTA 1FVPA 3VU2A 4WDTA 4LALA 3AXMA 1OT1A 1PZ2A 4GXPA 4AQLA 1KM0A 4C6QA 3VOCA 1MVYA 1OQFA 2JEPA 4IGHA 3WF2A 1KM4A 5CSSA 3WK0A 1OABA 4KH2A 4E3VA 2QCDB 1SZEA 4P7RA 4WGXA 4QEHA 1ZBKA 2G37A 2ACQA 2YGYA 3AS0A 4MGGA 3EPMA 1OCQA 1GVSA 2HJPA 3FYPA 4QDMA 3K30A 1FDZA 1CX9A 2VQTA 3GG7A 3PUDA 2X1UA 1JRBA 2D3NA 3MUCA 5DLCA 3TYCA