2R14A

Structure of morphinone reductase in complex with tetrahydronad
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
369
structure length
363
Chain Sequence
NPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDEIPGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDTYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Morphinone reductase
publication title Mutagenesis of morphinone reductase induces multiple reactive configurations and identifies potential ambiguity in kinetic analysis of enzyme tunneling mechanisms.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Flavoprotein
total genus 131
structure length 363
sequence length 369
ec nomenclature
pdb deposition date 2007-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r14A00
3LX9A 1KM4A 3BW4A 4EF8A 3R8RA 2CLOA 4UFKA 3H53A 3MJYA 3TC6A 3W7QA 1L9WA 3UNDA 4O19A 3A23A 3GXTA 4EOUA 2EF9A 1YTEA 1RPXA 1RD5A 2WNZA 2BWGA 4MVAA 5FESA 5CZTA 4CQAA 1JCMP 3W1PA 4AWTA 1AG1O 1KTBA 4UIOA 4DO4A 5TQLA 1RQHA 5G5IA 4N9DA 4G1KA 4UXDA 2YR1A 3GK0A 3F1QA 2X30A 5DELA 3FJ6A 2ZZ3A 3C3NA 2QCFA 5G2WA 4FHAA 3LRMA 1C9DA 3T4CA 1OF6A 4OGZA 2Q8LA 1IXQA 2WOQA 2I14A 1WA3A 2WSQA 4K7YA 3TE9A 1OK4A 4EWND 3W85A 3W1NA 3C6CA 1LM1A 1VHNA 2CW6A 2GJNA 2QJIA 2Y7GA 4LC6A 3VNDA 1TV7A 5DY2A 3W7LA 1KTCA 3VCRA 3P5YA 5E93A 3DHDA 1GVFA 4O53A 5F4SA 4FB7A 3GX9A 2A7NA 1K8YA 3DHFA 4JTFA 3C2OA 1UBSA 5I3GA 3W7KA 4LUIA 3E96A 3PSWA 4DQWA 2O7QA 4MLRA 5FF3A 2EPHA 4UTWC 1SW0A 3GKFA 1L6SA 4Z1AA 4K6AA 2RDWA 3N19B 3N2MA 2V30A 3LERA 3UPWA 3MO7A 3B4UA 3W7JA 4TO8A 1X6UA 1G4SA 4Y96A 4P61A 3DFSA 1YXYA 1AMKA 2RDTA 3LHYA 4E2DA 4ADUA 4HKPA 2HS8A 3HBLA 4LT9A 1YPFA 1M5WA 3B0VC 1DJQA 3GXPA 2VEPA 4EF9A 5KZMA 2FB2A 2DORA 3W71A 4NQ1A 1U83A 1NSJA 3IGSA 1OFRA 3LCFA 4IMEA 1EWDA 3VFLA 3W1LA 2X2GA 4NJKA 1FXQA 1LBLA 2FIQA 3CU2A 4Y8FA 1KTNA 2HS6A 3NQ8A 3EXRA 4XWUA 3EWWA 2XN0A 2E77A 3ATZA 4O52A 4QSHA 2JK2A 3CWOX 5LNVA 1B3OA 4JDBA 4LNYA 1NEYA 1TYGA 2R14A 2GQ8A 1HUVA 3LTSA 2FLIA 4P2VA 3LXCA 3MHGA 1S5VA 3QW3A 4HNVA 1GG0A 1TPWA 3G1VA 2J88A 4GE8A 3PR2A 2B7QA 3LLDA 4GXMA 2GVLA 4DPQA 2EAWA 1OK6A 2DZVA 1WQ5A 3PBUA 3OHIA 3IRDA 4RXGA 4XQ6A 2X1UA 2QCCA 3LCXA 4ALDA 1JRBA 3C0JA 3QF0A 4KFPA 1WYIA 3TSBA 3TROA 2FB3A 1KFBA 3WJYA 4WY0B 1KM3A 3ABRA 2WJZA 3BK0A 4O11A 4I9AA 1LP6A 3TMLA 4LU0A 4Z0SA 3SFKA 3OIXA 3EXSA 5AHLA 4JN6A 5KZEA 2V5BA 3S9YA 2V81A 3HPSA 3LV6A 3ANYA 2W0UA 1T8XA 5AC7A 3W75A 3NPUA 1YDOA 3BG9A 3TH6A 5F2GA 5U4NA 4JNMA 1YTKA 2J9YA 4N6FA 1D3GA 2BTMA 4JR5A 5CPMA 2JKAA 3LM7A 3P5ZA 1TTIA 3FIGA 4NZJA 3GDRA 4JTJA 3RF9A 3N9SA 2JKEA 2XN2A 4LV9A 3W23A 4PA8A 2A6LA 3QFEA 4K8EA 4IUOA 3FYPA 1ICSA 4NJHA 4UC5A 5DBTA 1RQBA 4ZQNA 4UFHA 2G5WA 3JRKA 3W7MA 1JUKA 4ZL1A 1AK5A 3G18A 5HWJA 1FWTA 4UR7A 3KVLA 4NU7A 4O50A 3DENA 3GZ3A 2AGKA 4DBEA 2V82A 3KAOA 3L5MA 3NQ2A 5AFDA 4RXFA 3W7EA 4DEFA 1YDNA 2DJLA 3MYPA 1W56A 1CX9A 1J4EA 2FFCA 3IIXA 3MP3A 4FIQA 2VFGA 1KW1A 2V5LA 3HJZA 1TPVA 5TBOA 1PE1A 1LOSA 4CLMA 2YGYA 1SFJA 3M0ZA 4CQ8A 4Y6GA 2ZA3A 3ZWSA 3I7SA 4LWWA 2QCMA 5AC8A 3LXBA 1QPQA 5DY3A 4WY0A 1JCNA 4HSOA 2Y89A 4UFMA 4LRSA 4UFIA 3W07A 3R5EA 2VKZG 2VEMA 1AW1A 3TCEA 3E49A 1LLWA 2PRLA 5LHEA 4WXYA 3ZWTA 2A6NA 4MYAA 4JICA 2ZA1A 3RNDA 4A21A 1GYLA 4OQVA 5CSRA 1KBJA 3LCHA 4TX9A 2O7SA 4O28A 4O4VA 1DHPA 1F05A 1G4EA 1G4TA 1YADA 3UY8A 5LNSA 3RLUA 2WO5A 3KRZA 4GRSA 4AHPA 1LROA 4UFLA 3WK1A 4AHQA 4JYDA 3HB9A 3SR7A 3BW3A 1ML1A 1H60A 4LUJA 4PODA 1VQTA 3FYOA 4DF1A 5K9DA 5D33A 3V75A 1VYSX 4JTLA 1FCVA 4R34A 2FPTA 1TPC1 2Z6IA 3EKLA 1OFOA 3KVMA 4LRTA 4NZFA 4UTLA 2QR6A 4K8HA 3LCWA 1A5AA 1SUXA 3DFQA 2WKJA 3SJ3A 5BMXA 4X2RA 1F7BA 3CT7A 2A5HA 3KOFA 1W5MA 4O54A 3S5YA 4OE7A 1TJRA 1R46A 1KLYA 3A22A 4AF0A 1OX4A 3MI3A 1FXPA 1M6JA 5C5YA 3W7DA 5K4XA 3E9AA 3M16A 1I2RA 3QSRA 4S1FA 3S5ZA 3W76A 3HPZA 1HFBA 4IQLA 3NQMA 4MUZA 3AO0A 4TMCA 3TA6A 1EIXA 5HUOA 3LRKA 1SSGA 4IXHA 2ZFAA 1IXPA 3NGJA 3NO5A 3C56A 2DZPA 3ATYA 1SZEA 2ZDRA 1FY6A 3IIPA 5C2XA 1JUBA 3E02A 1TCDA 3P67A 1UJPA 3IGXA 1VR6A 1KFEA 1AL7A 3G0XA 1YPIA 3C52A 3TQVA 5I3JA 4LY8A 3MMTA 3LCGA 3W9ZA 1TSIA 1H63A 3CTLA 5L9FA 4A2RA 1NAL1 3M5XA 3DFTA 4Z0JA 1LLZA 1EP2A 3G24A 1EPXA 5DN1A 2ZTKA 2WNQA 1LZOA 4O13A 2ZZ6A 4JTUA 2Z6JA 1K03A 3CLMA 2H8XA 4RR4A 2R8WA 3M41A 1D9EA 1XUUA 2BZNA 2CLFA 3SI9A 4M6QA 2QCLA 3HF3A 2C1HA 4IMFA 1TPFA 1KFJA 4Z1BA 1H5YA 2A2IA 3V1PA 3M44A 3W7NA 5IBXC 4GJ1A 5G4EA 3GIYA 3NXFA 4Q4KA 1BEUA 2QCNA 4TR9A 3G1XA 1QOPA 3I7RA 1T99A 1CI1A 2ZTJA 3QMRA 3U2OA 1FWRA 1VCGA 4WQ6A 4BR1A 5K9XA 3N73A 2J24A 5LGZA 1VH7A 1X1ZA 2H8ZA 1GQNA 2E6FA 3I65A 3W74A 4D2JA 3NYZA 4MZ1A 1ADOA 2H3DA 1VCFA 1KA9F 3O8AA 4IPJA 1K7FA 2V0TA 4A3UA 2QEZA 1NF0A 3BLIA 3EX6A 3NQGA 3PULA 2BX7A 4IXXA 3GXNA 3W2MA 5HR6A 4FO4A 3NL5A 1S5TA 2G97A 2QAFA 3RK8A 1ZENA 2HSAA 3HG5A 2NXIA 2QUUA 1W37A 3TKFA 3LHUA 1P0KA 1F5ZA 4X3ZA 1OFDA 5CG7A 4WOZA 3DH7A 3EWZA 4NX5A 2CZ5A 4HNTA 1LRTA 4AB4A 3NQFA 2CWNA 3IGUA 4M5PA 1KFKA 3NZ1A 3P61A 5AYXA 1ZCOA 4BWLC 3GKAA 3ABOA 3WJWA 1KV8A 3GYEA 4LV4A 4UTWA 3CEPA 2FPVA 2ZCGA 1PS9A 1VPXA 1G7VA 4Z1DA 3B04A 3S6DA 1QNVA 1R2RA 1H1ZA 5I3FA 4YCOA 1QMLA 2YDAA 3W1AA 3ELFA 3LGEA 2ZRZA 2X1RA 1WXJA 3A5VA 4H3DA 4PC8A 5HWMA 2NUYA 1D3HA 4MY1A 3O15A 3SECA 4CNPA 2RH9A 2VFHA 3B06A 3HG4A 5BRBA 4I7UA 4MZ8A 4FNTA 3U8GA 1QAPA 4NJIA 1OX5A 1MO0A 4GUHA 3OVRA 1QDSA 2QAPA 1SU5A 2C3ZA 3Q94A 2CLIA 3I68A 4KKXA 2AAMA 3W7PA 4FNQA 4JDYA 2RKXA 1XM3A 2E1DA 3SGZA 4RCXA 5J5RA 3RU6A 3DFNA 1I45A 2ZZ1A 1YLVA 3W1TA 2F7FA 5A5WA 4RV8A 1T0OA 1W8SA 2P10A 5LSMA 2E6YA 1R2TA 4JTHA 1S3HA 3SW6A 1A5SA 3HIJA 2CLHA 4S2CA 2OT1A 4LVDA 3M5ZA 4XKYA 3PUOA 4HPXA 1KFLA 4OV9A 3L5LA 2ISVA 4FNSA 5FI8A 1JCXA 3DAQA 5LNWA 3CM4A 3P8IA 1RZMA 3LCLA 1EB3A 3DU0A 5K9CA 2NX3A 4A2SA 4EIVA 1HL2A 1LOQA 1YTDA 1WDWA 2A21A 2WQPA 3A21A 1P1XA 2WSRA 1JUEA 1DQWA 3N14A 1BTMA 4XUGA 1JJKA 1ME8A 4ZVJA 4O15A 1XFBA 3C2EA 4K7VA 4PEKA 1ZAHA 3C8FA 1X8FA 2NUXA 4MKNA 2NWRA 4IMDA 2YYTA 3UWVA 1OABA 5I3HA 3AJXA 3W7CA 4N6EA 3NA8A 4HNUA 4R53A 1GTEA 1GG1A 2DZXA 3GVGA 1WAUA 3S1VA 1TV5A 2FPYA 4IMCA 4JGDA 1R47A 1P0NA 2OX1A 4M7SA 3A24A 3G1FA 1VJIA 3N9RA 1XL9A 1SSDA 1VYRA 3BG3A 3W6YA 1DKWA 5FEXA 4OT7A 5HUPA 1IXNA 2OMAA 3WK3A 1KFCA 2H6RA 2ZRWA 1HO4A 5F2IA 4NJGA 2VENA 4ORMA 3LTPA 3TJLA 2ZBTA 2QF7A 3W7RA 4O1AA 2PRMA 4H4IA 3HGSA 1H7WA 1J2WA 1H7XA 4EVZA 1EP3A 5EY5A 3QYQA 4CCEA 3P82A 3PS7A 5MHBA 3RMJA 3PUDA 2V8ZA 1K7XA 3NOEA 3P60A 4LS2A 4NT0A 5K7JA 1P5BA 3P81A 3MI6A 2OT0A 1MSSA 1EUAA 2WV8A 4Z08A 1SPQA 4JX5A 4UTIA 3LI1A 3L65A 3QEZA 4RK8A 4GUFA 4DPPA 3TV8A 4POCA 2X1SA 4A22A 4KFOA 1JVNA 1SW3A 5D30A 4AH7A 1BWKA 2VFDA 4O1BA 2GVJA 2YZRA 3ABQA 1TQXA 3S0CA 1C29A 3UZ5A 1GVQA 3PBWA 2NXHA 5DLCA 2YYUA 5I3KA 1GT8A 1XI3A 5EPDA 1B4EA 4UTTC 3DFOA 3THQA 3W84A 1TPB1 3BLEA 4JTEA 1CW2A 3UWZA 1AW5A 4HPJA 3TU9A 4AHOA 3ABSA 4BI5A 4MOZA 4FNRA 4AWSA 1QO5A 4Q33A 1J5TA 5D2YA 3NM1A 3UWWA 2ISWA 5L6UA 5EA9A 2H3BA 1O4UA 3C2FA 1OYAA 4FIRA 4O17A 4IX0A 4BF9A 5C6MA 3TMQA 3DFPA 5D37A 1OG0A 1QFEA 3C4UA 2ZZ4A 1TPUA 1W3TA 4ZZ9A 1Z44A 3LB0A 4NVTA 4O10A 1YYAA 1GWJA 2Q8ZA 3L67A 1W5OA 3Q37A 1XKYA 2G95A 4O0ZA 1LYXA 1W0MA 1DORA 5F2LA 3FKKA 2Y7FA 4ZQOA 3L68A 3HGJA 4AAJA 2I9EA 3TW7A 3RLVA 5DCBA 6ALDA 3HG2A 3S1XA 3EB2A 5A8GA 3BG5A 1H61A 4JY9A 3LHVA 1YXCA 1F74A 2QKFA 3O6CA 4LVBA 2JGYA 1FCQA 3NPVA 5D03A 5CPLA 1Q6LA 4OU1A 4OV4A 1XBZA 3KVJA 2A7RA 2XN1A 1ME9A 5J5DA 3W7GA 2NXGA 3BPWA 1TV8A 3L0NA 1O5XA 2GQAA 3NQVA 5FF0A 1TQJA 4ADSA 1M7PA 3IIVA 5G2IA 1TB3A 3UQNA 2A85A 4Y9AA 5CSSA 4E0CA 1ALDA 5AHFA 1XBXA 1SO6A 2OJPA 5E1QA 1DL3A 3C2RA 5CPOA 4N02A 1FQ0A 4O18A 4NNBA 1RVGA 1FBAA 2BLEA 3F4WA 1R30A 3B03A 1DQXA 2FQIA 3TK7A 3NL2A 4N4PA 3L0KA 1SO3A 3STCA 3BVJA 4N2YA 1VC4A 5IBXA 1K8XA 2CFFA 4L4MA 5E0KA 1VZWA 3CQ0A 1Z48A 1VCVA 3GNNA 4PTNA 6TIMA 4N9EA 4J9JA 4MFEA 3W7IA 4YMZA 1JQVA 1O94A 3ZS4A 2VFFA 3P8JA 3C2VA 1OFQA 5DXXA 4BI6A 1I2QA 2WNNA 3NDOA 3M5VA 4QAIA 2E5BA 1XBYA 3WK2A 3NM3A 3PB2A 4UTJA 3S42A 2YX0A 3CB8A 3I6RA 3PAJA 1I2OA 4IWWA 3M1ZA 2V9DA 5HMSA 3LRLA 1Z42A 4XBKA 3UWQA 2R94A 3G1AA 4ONVA 1GYNA 2Z0IA 4WZHA 2X16A 4WXZA 2B7NA 2CZFA 4QJ1A 4K39A 3T44A 2QDGA 3S1UA 3NQAA 1LRNA 3EX4A 3NQEA 4HHPA 3DXIA 1N8FA 3BLFA 3D0CA 3STGA 4S2BA 2QUVA 5LGXA 2ZZ2A 5F2MA 1A5CA 2R91A 3DI1A 1ZFJA 1N7KA 1UB3A 3SIZA 3JS3A 3TAKA 4FX8A 2FJKA 2Y63A 4AMAA 4O4WA 3TFXA 3IEBA 4JY8A 3LI0A 1EEPA 4OWGA 2PRHA 1GVSA 1TMHA 1FX6A 3TFCA 5D05A 1KLZA 3GR8A 4JYEA 2YW3A 2GVGA 4JEQA 2GPTA 1I4NA 2Y70A 4QNEA 2RDUA 1TPH1 2DZUA 1KM6A 3HPXA 4ZQPA 2ALDA 1OYCA 2ABBA 1EUNA 3CIXA 3B8DA 3PF3A 1XDLA 4K38A 3TQKA 3QSTA 2PC4A 3L21A 1RV8A 4UUIA 3UPBA 3UWUA 1KM5A 5HWNA 1L2UA 3I7QA 4LW7A 2A4AA 4JD4A 1NVMA 5T26A 3SZ8A 4UTKA 4Z1CA 4FXSA 4WOQA 5H2ZA 4UMCA 3R2GA 3GDLA 4WX2A 2BXVA 2JBMA 1QOQA 3G0UA 1E51A 2G96A 5AYYA 4MY8A 2PURA 3WJSA 1Q45A 2ATSA 3Q58A 1LBFA 3QW4B 1DVJA 5LHFA 1AW2A 3W1XA 3W2JA 1W5NA 1FDJA 1UUOA 4CCDA 5D38A 3G3DA 4O57A 1PVNA 4NNCA 4LOCA 4BI7A 2C16A 4ADTA 4NNAA 5G4WA 3VE7A 2A1YA 2VFEA 2E68A 3LTYA 1C8VA 3L5AA 3QRHA 2QCDB 3O6YX 3NPXA 3PBYA 3O6DA 3WJZA 3HOJA 4JTIA 1SW7A 2CLEA 3L0GA 5HR7A 2PE4A 5KTLA 3PG9A 3NNTA 5D2XA 3HMJG 4GWEA 4X9SA 3TW6A 3THAA 3QM3A 5BOOA 3TXVA 3O16A 4M19A 3NZRA 2NUWA 1QPNA 3M6YA 3IVSA 5AHMA 3T7VA 1ONRA 4FF7A 3PC0A 3W72A 4N4QA 2Y62A 4UR8A 3C61A 1WOAA 5AN7A 5C55A 3G1DA 5H91A 5I3IA 2H90A 2JGQA 1QPRA 2NLIA 3L2IA 4DO6A 3OEXA 1SR9A 4AWUA 3DI0A 3W2LA 2NZLA 4FXRA 4RJEA 4LS1A 3GLCA 3QQ0A 1JQXA 3PVFA 1B4KA 2VC6A 3ZR4A 4U4MA 1VYPX 3NQ7A 1MZHA 2OZ0A 3K30A 3LHTA 4GC4A 5F1UA 1O95A 4YCPA 1S5WA 3GDMA 3UWYA 1THFD 1TIMA 3W2NA 1JCLA 2B4GA 1PL9A 3T55A 3W86A 1MEWA 2EHHA 3N2XA 4CNNA 1GTHA 4NJJA 4IMGA 3B0PA 3VKJA 1SO4A 3PBVA 4ZQCA 4LVAA 5D04C 1JRCA 4XTDA 2ABAA 1QR7A 5CPNA 3A9IA 2C19A 3W70A 1W1ZA 2KZHA 1SO5A 4GFSA 3P74A 2DZWA 1FDYA 3NG3A 5EKYA 3W1QA 1LDCA 1H7RA 4UNLA 2QCDA 1KM2A 4GUJA 4NXSA 3BO9A 5F1VA 5G1TA 4JTSA 3LOTA 2TMDA 3N34A 1WBHA 3UXDA 1LCOA 1RR2A 3YPIA 1F73A 1H7OA 3WK0A 1LOLA 3W83A 1G7UA 1A53A 1VLIA 3EEGA 1QPOA 4KFNA 5D2VA 3DBPA 3KXQA 1DBTA 4QQ3A 4UMBA 1K7EA 3GB6A 2VXNA 3NR0A 1JR1A 3U6WA 4MJMA 3EX3A 4IJBA 5DCEA 1SZFA 1OX6A 3CPRA 1UCWA 1H62A 1IXOA 3G8RA 1TPDA 3S5OA 1G6CA 4GBUA 1Q6QA 1B9BA 3W2UA 3UZJA 1VRDA 2CLLA 1IIHA 4UTTA 2Q3OA 5D2WA 3SSJA 2W79A 3R89A 5C54A 4ICNA 5HNRA 3MUXA 3INPA 2D73A 4M7TA 1L6WA 4PL1A 3M5YA 2VELA 1VLWA 1WV2A 4IPIA 1PHWA 4MJZA 3FS2A 4AEOA 1TREA 4E2BA 4U28A 2P1FA 5D32A 2GJLA 1UUMA 2QJHA 3BARA 2NX1A 4DXVA 3W3OA 1H7NA 3TXZA 4R7JA 1JULA 5LNUA 3HGRA 3HQ1A 1DV7A 3G0SA 3UXAA 1OFPA 2C0AA 1WBJA 2J9XA 1ICQA 1MEHA 2TSYA 3R12A 3EWXA 1T96A 2V2CA 3IVUA 2DJXA 5LNRA 1F2JA 5GVJA 2C18A 3EKZA 3GAKA 5IM51 4JTTA 4R33A 1DJNA 4RKAA 1EA0A 5D09A 4W9TA 5DXYA 2GOUA 3B05A 2E6AA 4WD0A 1VHCA 4BK9A 3QPYA 1GOXA 2E5CA 1P4CA 3PM6A 3TNOA 4MFDA 5CGQA 1M7OA 4QISA 4KWWA 2JKPA 4N9BA 1V5XA 1KM1A 4CQ9A 1TRDA 5KITA 1TTJA 3F03K 2TYSA 1Q6OA 2CLKA 1TO3A 3E12A 1Z41A 3F4NA 1SZGA 2TRSA 3OA3A 2UV8G 3O1NA 5AHEA 4WJEA 1U5JA 4JTGA 2ZRUA 2C13A 4OHQA 2DP3A 4YL2A 2YFOA 4IOTA 1PIIA 4FEZA 3G1HA 5KMYA 3LHWA 1W5PA 3GAYA 3P62A 1KM0A 5KZDA 2FTPA 3CIWA 3EWUA 4RZ6A 5CZ0A 4B5NA 3PG8A 4O1CA 4HIBA 3HGOA 4RZ4A 2EKCA 4DO5A 1GJPA 3PB0A 4ORIA 2E5DA 4FNUA 4ZQRA 2DU2A 1BWLA 3QQ1A 4NX0A 1H1YA 3IV3A 4LTSA 5CZJA 2XFWA 3GDTA 1TTQA 3TDFA 5K2ZA 3GDKA 5AB3A 2OCZA 5BW6A 2VFIA 3PUEA 2RHGA 1SFLA 4YWIA 4I7WA 3H54A 3IVTA 4DF2A 1LORA 1F6PA 3BV4A 3KX6A 1G69A 3A5FA 3EX1A 3M43A 1RQEA 3ZFHA 3SGUA 1H51A 4N9CA 2YCEA 4MZYA 1K3UA 3EWYA 3MHUA 1PV8A 2Y88A 1HG3A 3EWBX 5FEZA 3LXAA 4M6PA 3PWAA 4X22A 3G1YA 1VS1A 3TJXA 1L6YA 2A0NA 3O07A 1TPEA 4MYXA 5FF4A 4FNPA 3S5NA 4QM1A 1LTDA 1TRIA 4JIQA 4JXCA 4O14A 1MXSA 3EXTA 3CHVA 1ZHAA 3FKRA 5HQEA 3QC3A 4H6KA 5DCDA 1F6KA 3M7WA 1PCKA 3LHZA 3HG3A 2NV1A 2PCQA 1VGAA 2J6XA 3O06A 2QCHA 1XBVA 2YW4A 3NAVA 5FF7A 4MY9A 2GUUA 4LS0A 2ZA2A 1XXXA 2ZZ5A 1OFEA 3G22A 3Q2DA 1W54A 3L9CA 4O8RA 2YXGA 5KINA 7TIMA 2IQTA 5F4WA 5HINA 2CZEA 4MPQA 4ZQMA 3R13A 2W6RA 4AF0B 1OX4B 3KRUA 4NXKA 2J9ZA 3QH2A 1PCWA 2NV2A 2P0OA 4OBTA 5TIMA 2NX9A 1FDZA 2HTMA 4QIUA 5EL1A 1IIGA 1B57A 3STEA 3RFAA 3TSMA 5D2TA 5SWUA 4C1LA 4M6VA 3NPWA 5AHIA 5U7SA 2VOMA 1QWGA 4AXKA 2ISSA 1W3NA 2QJGA 4NUWA 3O63A 3WFAA 3CEUA 2I1OA 4FX7A 3IIOA 4K37A 2YFNA 5FEPA 4WY0F 5BMWA 3N3MA 1NFBA 1FWSA 5ABTA 3JR2A 1SZNA 1TJPA 4LC8A 2CLMA 2B7OA 4HN4A 3FEMA 2WPBA 4XBSA 3TQ0A 3W7HA 1G67A 4UTUA 1KV5A 5HULA 4AVFA 3QZEA 2B0MA 5EYWA 4HSNA 1JCJA 4O0KA 1Y0EA 5EBUA 3UYCA 3W1RA 3QMSA 1HTIA 2GQ9A 1FUYA 2Y7DA 4ML9A 2WSYA 5AC6A 3PY2A 1G4PA 2TPSA 3NQDA 3SY5A 1A50A 8TIMA 4GUIA 3W73A 3FJLA 3MP4A 4UTHA 4PL2A 2ZRXA 2C14A 3OG3A 3W7OA 1FWNA 2CU0A 1KBIA 1DOSA 3LLFA 4IGHA 3MWAA 5F4XA 4L4LA 1X7FA 4K36A 3KHJA 4JS3A 1BKSA 1X1OA 3W1UA 3MW7A 2ZZ7A 1JCYA 5HJLA 3DGRA 3KRSA 3NQ6A 4UFJA 4GUGA 1OFBA 1H7PA 1ZAIA 3TAOA 4BWLA 3LV5A 2Y6ZA 4YXGA 3E0IA 1YDVA 1TTPA 4GNJA 1QCWA 1EX5A 3O05A 3TR2A 2YSWA 4CCCA 1ICPA 3FFSA 2DZTA 1W3IA 2DZSA 2Z2UA 2Y85A 3P7YA 3M47A 1GZGA 4DELA 4RLIA 3VE9A 2CZDA 1FCBA 3TIMA 1FWWA 3LDVA 5K4ZA 2YPIA 3M9YA 4I7VA 4PFMA 3NEVA 4MIMA 3T40A 4PCFA 3STFA 3UD6A 2ZQ0A 4YLWA 4JX6A 5BNKA 1O60A 3HO8A 3CC1A 2C15A 1K8ZA 1W5QA 3DKLA 4WUIA 3MI2A 3TSDA 4IX2A 2AQWA 3DZ1A 4O16A 4QITA 3MBFA 2ZRVA 4A29A 1IGSA 4QNWA 3S1WA 3IIZA 2LLEA 3LBCA 1I2PA 1LBMA 4LVGA 3BGGA 1ME7A 1OHLA 3BGJA 4Y90A 4C1KA 4ZMGA 3LCIA 3G3MA 3H55A 1ZNNA 1YXDA 2QDHA 5D02A 1NF7A 1WX0A 1OYBA 3TC7A 3S8HA 1V7YA 4MLJA 4DF0A 3W2KA 4UCGA 4JX4A 5AOUA 4E38A 2ZRYA 2Y7EA 4PH6A 1W31A 2NWSA 2Y61A 4UNKA 2F84A 2HMCA 1HO1A 5LKYA 3W22A 1OFAA 1I8JA 3P84A 4CNOA 3FA5A 3T78A 1SQ7A 4Q32A 1Q6RA 1GPWA 2Z1BA 1EP1A 3GNDA 3EX2A 1IF2A 1GVRA 1LRQA 3G8EA 3QMTA 4UTMA 1OF8A 1A5BA 2QUTA 3UY7A 3OVQA 3MP5A 5G2HA 2RFGA 1OJXA 3LBMA 2VEKA 2Q3RA 2X1TA 5FF2A 3USBA 3W87A 3KVKA 3WJXA 3W88A 3MBDA 3B0UX 2B7PA 4HT3A 4HNNA 3BW2A 1GVOA 2EGZA 3TUUA 4TU1A 3P80A 3QPZA 4JTKA 4O1DA 4XKYB 3G1SA 5G1YA 4DBDA 3NL6A 1XUZA 2BSLA 4XZ9A 3PSVA 3OVPA 4RZ5A 2ATMA 3NL3A 5AYZA 4JIPA 4FX6M 3FLUA 2A7PA 1GEQA 2E6DA 1XC4A 1XCFA 4LVFA 2VEIA 2ZYFA 3OBKA 3NQCA 2J27A 2QCGA 4RX0A 3MYOA 1AL8A 4TIMA 3DKJA 1UASA 3VI2A 1H50A 3QJAA 1PHQA 5CZSA 1O5KA 4UMAA 2FDSA 1F76A 1Q3NA 2V2HA 1WOBA 1K02A 3L66A 1ZALA 1QO2A 3KFTA 2V2DA 4TMBA 4KWVA 4O12A 3W1MA 5CKSA 5DBUA 5EMUA 1ZAJA 1FCUA 1XDMA 5KSWA 3CWNA 5AHNA 4XTIA 1OVDA 5LZLA 1N55A 3TX9A 3NVTA 3FOKA 1EWEA 1I2NA 3MHFA 2C6QA 1ZJIA 1MEIA 2E09A 4JYFA 2QCEA 3GR7A 1R2SA 5FEWA 5K3VA 4BFAA 1ZY9A
chains in the Genus database with same CATH superfamily
1GQKA 3KS5A 3ANVA 5BOFA 2D0HA 1JGIA 3H53A 4QG6A 1AD4A 1YDYA 3GXTA 3JW7A 4CQAA 3GC4A 5M1TA 3DG3A 2E3ZA 4UIOA 4CKQA 1A47A 2Z28A 5G5IA 3GK0A 4S38A 3KBNA 2QULA 3FJ6A 1H11A 2WANA 3I3BA 4GVFA 1IXQA 1BRLA 3VMPA 1PZ3A 2I14A 3WDPP 1Q2RA 4K7YA 1I0BA 3QR1A 3W85A 3W1NA 4A8IA 3WLQA 1LM1A 1VHNA 4JNYA 3W7LA 3N15A 5DY2A 1KGWA 3VCRA 3RJXA 5E93A 1QI2A 2J47A 3DHDA 3G77A 4B5UA 1NWRA 4FB7A 2A3HA 3GX9A 2A7NA 3BMVA 1K8YA 4C6KA 3SQMA 3C2OA 1U22A 3AIQA 3WBEA 5XINA 5CSUA 2EPHA 1JD7A 3O2LA 4BKNA 3A6OA 1IHIA 4K6AA 4AVNA 2RDWA 3VD7A 2V30A 3MO7A 3B4UA 2WW5A 4HYVA 1OC7A 1X6UA 4Y96A 3ANUA 1GYMA 2JF7A 1R3SA 3DFSA 4FMVA 3AI0A 1YXYA 4ATWA 3CZGA 3RRAA 2QMJA 3LHYA 3BLOA 3H7VA 4E2DA 3K8LA 4WKFA 2PTYA 3B0VC 2GK1A 3VMNA 4XG1A 4NQ1A 1U83A 1OFRA 4IIGA 4F2BA 3VFLA 4NJKA 2WVVB 4QAWA 1LBLA 2A3LA 4Y8FA 2OTDA 1KTNA 1O12A 2HS6A 3NQ8A 4XWUA 1KRAC 1JFXA 4O52A 1NEYA 4KCUA 2R14A 2WK2A 3AHTA 3OOQA 1HUVA 2Y5SA 5J8LA 3U5UA 3VAVA 1GG0A 1TPWA 3WF2A 2VUYA 3PR2A 4S3EA 4J3SA 3TJIA 3WLHA 5DMMA 2EAWA 1OK6A 4XAGA 1AD1A 2BY3A 3OHIA 3IRDA 4C6MA 3LCXA 4ALDA 3GUWA 3GTXA 1JDFA 2DSVA 1KFBA 3SCVA 5EFFA 2A3AA 1D8WA 3BK0A 4O11A 1GHSA 3F4VA 1LP6A 2Z25A 2ZUMA 3T2PA 3TMLA 3EOLA 3SFKA 1W9UA 3EXSA 4LBUA 5KZEA 2OYMA 2V5BA 5I03A 4PMQA 1EJUC 2OVLA 2V81A 3HPSA 3UZZA 4KGJA 2VRQA 1NY1A 3ANYA 1T8XA 1Z69A 2X7VA 1LQ0A 3S5SA 1YDOA 2Z29A 4JNMA 2FHBA 2V3FA 4N6FA 4E3VA 3GS6A 3PUGA 5CPMA 3ZZ1A 2A3BA 2IXUA 3LM7A 2XSAA 4NZJA 2WHLA 4JTJA 1A4MA 4JQ3A 3BLLA 4LV9A 4PA8A 1UPPA 1WDSA 5GNYA 3PPFA 3VCNA 5C9ZA 4LUSA 3FYPA 4UC5A 4NJHA 1RQBA 3M0VA 1UD2A 4A3HA 1VEMA 3JRKA 4P7OA 1VFUA 1XLGA 4ZL1A 1AK5A 3G18A 2G41A 1FWTA 2HVOA 4L9YA 4UNIA 3NEHA 2CIPA 3SY8A 3DENA 1UWUA 4MM1A 4D8LA 4DBEA 2V82A 1PX8A 3ZJ8A 2ACRA 1YDNA 2DJLA 1J4EA 3IIXA 1XYFA 4D72A 2DY3A 2DW7A 4PSPA 1MFVA 4MB3A 1E6XM 3QOKA 1ENUA 5TBOA 4X63A 1H0IA 4YVVA 2P76A 5F7UA 1UZDA 2YGYA 3QV9A 1SFJA 3NCOA 2QCMA 2GJXB 4DWDA 2VDHA 2WCAA 2PTZA 2VKZG 2HISA 4W93A 4C6JA 2VDIA 1AW1A 1CNVA 1LLWA 3ZWTA 2W63A 5CAHA 1XIHA 3CV6A 4IHCA 1HZYA 4IIHA 4RNIA 4OQVA 1KBJA 1C93A 1OD8A 1XRSA 1F05A 1G4EA 2HXTA 3WLSA 2CBVA 4AHQA 3HB9A 1ML1A 4LUJA 4Y8EA 4QFUA 2HRWA 5D33A 3V75A 4A8LA 1ADDA 1JXJA 4GCXA 4DLMA 2Z6IA 1XH1A 2ADAA 3EKLA 4NZFA 1Q5MA 1WDPA 4RE4A 1SGJA 1DJWA 3SJ3A 5BMXA 4X2RA 3SFWA 3UW6A 3S5YA 3RITA 3A22A 3E6EA 3MI3A 1FXPA 2RAGA 1M6JA 3W7DA 1JYWA 5K4XA 1I2RA 3M16A 1J0JA 4BJHA 2YBTA 2FH8A 1XH2A 7XIMA 4GYPA 3VZYA 3W76A 3FVDA 3SN1A 3WL1A 4QDMA 4XK2A 1W32A 4TMCA 3TA6A 2ZFAA 1JL8A 1UH4A 1IXPA 3NGJA 5DRIA 1ZPTA 4UZSA 3ZO9A 3ATYA 4J3ZA 1SZEA 2ZDRA 2ZC8A 2FDMA 3IIPA 3PJWA 1H4PA 3ONBA 2DUZA 2UWFA 4CVWA 2XIIA 1UWTA 1EZ2A 2YL6A 1MQPA 1AL7A 3G0XA 2O0TA 1U1JA 3WX7A 1H63A 1AH0A 2X2YA 1LLZA 3RMEA 1A0EA 1BGAA 5DN1A 4JCLA 3LMZA 2ZTKA 3VNLA 1LZOA 1S2VA 4JTUA 3CLMA 1HJVA 3CHEA 3DG6A 8XIAA 4HYRA 3F4DA 2QCLA 3EYPA 4GKTA 3HF3A 1YBQA 1RUSA 4IMFA 4AIEA 3CV1A 3ARPA 1H5YA 4M6UA 1FRBA 3V1PA 4IPPA 1S2AA 4FLRA 4OIFA 3WNKA 1OT2A 4TR9A 1BEUA 2G3JA 1T99A 2ZTJA 4AQLA 1VCGA 4WQ6A 4BR1A 1IT0A 1NM9A 4QGCA 3L12A 4AZIA 1M65A 4CNSA 3WQPA 2V0TA 2E40A 3ISIX 3DDMA 1ZB5A 3P0WA 1PAMA 2QEZA 4IJCA 2OLHA 5HR6A 3CQKA 1RJQA 1Q6CA 2D1ZA 3GVWA 1C7TA 3HG5A 1GQIA 1HKKA 3UZWA 3U7VA 5A8PA 4X3ZA 1PSCA 4O0QA 4WOZA 5CG7A 3U5YA 5FKYA 2REQB 4AB4A 2CWNA 2ZX5A 4TOQA 1VAHA 4M5PA 1KFKA 2VC5A 1BSLA 5FOOA 5AYXA 1UP3A 1ZCOA 3PZNA 2E25A 4UTWA 4RDYA 4IFKA 3OZYA 1CT5A 2ZCGA 1G7VA 1R2RA 3L4ZA 5I3FA 1V3HA 2PWEA 4XIAA 1AODA 3PFMA 4WLCA 3W1AA 1A80A 1TWSA 1UP2A 3WG6A 3WQWA 5EMMA 2X1RA 1GOWA 3GR4A 3L4YA 1XINA 1WXJA 3A5VA 4PC8A 1AA1B 2NUYA 3K8MA 2GUBA 1FVPA 3F2DA 2QNEA 1KB3A 1C7SA 4CNPA 2IS7A 2RH9A 2VFHA 3GH5A 3HG4A 4I7UA 2EBNA 4E2VA 5BRBA 4LUTB 3U8GA 3UGRA 4GMEA 1MO0A 4GUHA 4YWSA 1QASA 1QDSA 2GSEA 2QAPA 3C5QA 1SU5A 5HNUA 2C79A 2BY2A 1V02E 2XHYA 2AAMA 3W7PA 2AOSA 2RKXA 1SYTA 5J5RA 3RU6A 5DMYA 1Y5WA 2ZZ1A 1YLVA 3QXBA 5PTDA 3ZVHA 2AQOA 5A6SA 3WUEA 4L1WA 3UEQA 1RK6A 1R2TA 4JTHA 1E5NA 3WLKX 4OUIA 1GJWA 3LENA 3FGCB 4S2CA 2GZXA 3W25A 1ZTVA 3PUOA 1KFLA 2WCGA 4XD3A 1C92A 5FI8A 2PCEA 3DAQA 1I60A 3VPLA 1RZMA 2CETA 4H9VA 4DJDD 5K9CA 4LALA 1MDRA 2IKHA 1HL2A 1ONWA 3QR0A 5DT7A 3T1GA 1RALA 1SMDA 1UIOA 2CBUA 2WSRA 3VD9A 4XUYA 1JUEA 4AY8A 3W28A 4QLLA 1BTMA 1IEQA 4XUGA 1ME8A 1FH7A 1R0MA 4ZE5A 4O15A 1OZQA 1XSKA 5I77A 1I75A 2I16A 1JAKA 2XGBA 3C8FA 1X8FA 4IMDA 3I3DA 3TTEA 3W6LA 4YVPA 3AJ7A 2PDYA 4BEQA 1GG1A 1UYQA 1WAUA 1ZJHA 4N7QA 2FPYA 2G0WA 4EAMA 1K70A 1R47A 5J04A 2PZNA 1V6WA 3VGBA 2X0YA 3G1FA 3EWDA 1HKMA 1VJIA 3N9RA 1KKRA 4W89A 4XZBA 1VYRA 3TTQA 4MAZA 1H5VA 5FEXA 4OT7A 1CXIA 3OIHA 4LFYA 2OMAA 3RM4A 2H6RA 4PUNA 2ZRWA 5F2IA 4NJGA 2ON3A 5IXEA 5JIPA 3TJLA 1Q66A 2QF7A 3W7RA 4O1AA 2PRMA 4YHGA 4I6KA 1IV8A 2XVNA 3AIVA 3QYQA 1XSIA 3P82A 3FK4A 1IEWA 1J18A 3CPGA 3UG4A 3RMJA 2PF0A 3U4AA 2BOFX 4NT0A 5K7JA 4NZ3A 5HATA 3AC0A 3FX4A 1BVWA 1XKJA 4Z08A 4ICMA 2INEA 3GVVA 3LI1A 3DX5A 3QEZA 5C9RA 3LBOA 4Z2GA 5B80A 2X0SA 4DPPA 3TV8A 4POCA 2X1SA 1BLIA 1ZZMA 2BY1A 1SW3A 1E15A 3ES7A 1CB7B 2YZRA 1XPYA 3ABQA 3FYYA 2ISDA 4XIMA 2XM1A 2PDFA 5DLCA 5ENLA 1XI3A 5AYBA 3UWZA 3PTDA 2O4QA 3FDGA 4Q8OA 1RA0A 4AHOA 4MOZA 3GG8A 4FNRA 4ACYA 2OZ8A 2VVNA 2HXUA 1NP2A 2VRJA 3NM1A 2ISWA 4F0SA 1TV3A 2H3BA 2Z2AA 4F40A 5JVLA 1OYAA 2F61A 4O17A 3UJSA 2Z27A 3C4UA 4IP4A 3WDRA 3VDHA 4I8YA 5DF0A 4O10A 4XB3A 3A12A 3MU7A 2FGZA 2Q8ZA 3CZ8A 4LAMA 3Q37A 4PMUA 3BCDA 5F2LA 1TCMA 3AMCA 5C7VA 2VQTA 1EPVA 5DT5A 2P3EA 3HGJA 3RPMA 4AAJA 2CERA 3TW7A 4MB4A 2YJQA 1ECQA 4LGXA 3IJIA 5IDZA 3M0HA 2JEQA 2DUAA 1WP6A 1DXEA 1H61A 2QKFA 1TE1A 2JGYA 1XLFA 3NPVA 4OU1A 3MWCA 5J5DA 3KTXA 1TV8A 5LA2A 4Q3MA 2QUNA 4TQTA 1CGXA 3EKGA 3CL6A 5E1QA 3C2RA 4N02A 1FQ0A 4EPKA 1RVGA 1FBAA 2BLEA 1R30A 3B03A 4C60A 4N4PA 2ZX6A 4N2YA 1W1YA 2TODA 4US5A 1UR0A 3U57A 1VCVA 6TIMA 2Y24A 3P0XA 4HJWA 4YMZA 1JAEA 4L61A 1E9IA 2ICSA 3AXMA 3ZS4A 4DXXA 1KBKA 4W84A 1I2QA 4O1FA 3WNOA 2J7CA 3NDOA 4LB3A 3VMOA 4ILSA 3QKZA 3MSYA 3CB8A 3I6RA 4NYYA 3T07A 1GKRA 3AUOA 3M1ZA 5HMSA 3LRLA 4H7ZA 4WZHA 4MSSA 4K39A 3S1UA 1CECA 3DXIA 4DUVA 3BLFA 3PWGA 1F4AA 3STGA 4S2BA 2QUVA 1OC6A 5LGXA 3BDKA 4CU6A 4CNTA 3TAKA 2QT3A 2Y63A 4O4WA 1F4HA 2R82A 3EB3A 4S3CA 3GC5A 1GVSA 2ZICA 2PPGA 4AWEA 5JBFA 3PZMA 1LUCA 4I3GA 5EFDA 1VFHA 2YW3A 1HJWA 1R3QA 1NDVA 3HTWA 4JEQA 4LUYA 4NRRA 2DZUA 4AIUA 4DM1A 4AD0A 3CIXA 3TCSA 4DXKA 5I7GA 1RV8A 3UWUA 3UPBA 4LW7A 4JD4A 5CAKA 1O5QA 4OBRA 4UCFA 4YYFA 2C8NA 4HZ7A 3KWSA 3CGTA 4FXSA 4HQVA 4C6NA 4WOQA 1E40A 4I8DA 5H2ZA 4UMCA 2ZUWA 1MNZA 4PRWA 4HMCA 1PYFA 3GDLA 3L2LA 1QOQA 1E51A 2AL2B 1Q45A 2ATSA 1S2UA 2HZGA 3KTCA 1FWHC 1LBFA 2PGFA 3QW4B 1DVJA 2PGWA 3ZR6A 1AW2A 3W2JA 1ZS2A 3L4XA 5FACA 4IJRA 1CGYA 4O57A 4NG3A 5BWAA 3BLKA 1WKYA 3QN3A 4M1RA 4NNAA 3UR2A 4WSKA 1GHRA 2E68A 1C8VA 1L2QA 2QCDB 3PANA 4A4AA 3O6YX 1EDTA 4ZOEA 3O6DA 4LJ3A 3WJZA 3HOJA 3SY1A 5D2XA 4DI8A 1BXCA 4ZBCA 3O16A 4GO8A 3NZRA 1ZBWA 1ONRA 4AG0A 2OB3A 3W72A 3C61A 1WOAA 5AN7A 4PGLA 4I5UA 1XR2A 2HROA 2JGQA 3L2IA 1HQTA 2E8YA 1KWGA 1EYEA 2NZLA 4FXRA 4HCLA 3WBAA 1JQXA 3PVFA 3K13A 1ISYA 2VC6A 2O92A 1VYPX 2DV0A 2OZ0A 2HWGA 3LM3A 3HN3A 1S5WA 3OQEA 1TIMA 3A4JA 4JFUA 3O7UA 3T55A 2WM0A 1MEWA 3PPGA 3RGTA 5H1WA 1SO4A 4G7EB 5D04C 1BRLB 1KFWA 3H4GA 3M0YA 2ABAA 3N17A 3UYIA 1X6NA 3AYSA 5CSYA 2C19A 4QRNA 4Z2IA 2GDUA 2NQHA 2YXXA 2ZUSA 3P74A 2DZWA 4C6DA 1AJ2A 1FDYA 4G7FA 5EKYA 5CBJA 4GD0A 4LB4A 2C1GA 1KM2A 4GUJA 5BXSA 4NXSA 5F1VA 4MADA 3CQIA 3POHA 1WPCA 3M4HA 1TMQA 1WBHA 4BS0A 2F9RA 4AZBA 2W5FA 1LCOA 2PBGA 2CHOA 2G8ZA 2V5CA 4GH1A 2J79A 4WDUA 4B5XA 1FTXA 1QPOA 2XVPA 1GZ1A 4KFNA 2YXOA 2WHJA 1KRCC 4WCJA 4GX9A 1DBTA 4IL0A 4QQ3A 3PZQA 4TV6A 1XLHA 4MJMA 3EX3A 2GK1B 3T8LA 1SZFA 1P6WA 1VBGA 3CUGA 4GBUA 5A95A 3RCMA 1UZ4A 3PTMA 4XAFA 5D2WA 2PMQA 3SSJA 2W79A 2SFPA 1M7JA 2ZXAA 5HNRA 3WMCA 3INPA 2D73A 1ESWA 4PL1A 3M5YA 3W82A 4PULA 1PHWA 1Q7MA 4L65A 2IKIA 2QJHA 3G6LA 3AXKA 4DXVA 4Y9NA 2CZVA 4DJFC 4D6FA 1E6ZA 5C0QA 4DNHA 3G0SA 1UR2A 4W87A 4JPGA 1Z3NA 3E38A 1MEHA 2TSYA 2D3LA 1FWEC 1T96A 2DJXA 4US5D 1NOWA 3ZT6A 5IM51 3ZXWA 4JTTA 2CHRA 4R33A 1DJNA 1EA0A 4PYSA 3A3WA 4IFOA 3RO8A 1UWQA 4X61A 4W9TA 3AZRA 4GOAA 3UZYA 3VUPA 1NQ6A 3BWWA 4WD0A 1VHCA 2XGIA 3VVGA 1A5KC 3VGGA 3VD4A 2Q02A 2L5HA 3APYA 3FA3A 3CUJA 3TEVA 5CGQA 2DQXA 4QTGA 4KWWA 1VB9A 1KRMA 1TJ1A 3UF9A 3IANA 4N9BA 1V5XA 1KM1A 4JAWA 4CQ9A 4FAMA 1TTJA 4BF7A 3F03K 3HFYA 4RNJA 1LWIA 3E12A 1Z41A 3R6IA 5D9OA 1XWYA 4QR6A 1IE7C 1SZGA 1XICA 2NQJA 3O1NA 4ZEPA 1O5RA 1PXGA 3LQLA 2GSHA 3T0DA 2ZRUA 2C13A 3H26A 4EK7A 3JVAA 4ZR8A 4YL2A 2YFOA 1EJ7L 1ITUA 2FMNA 5KZDA 5A6AA 1OY0A 2XINA 3HGOA 3OZPA 2WJFA 4L6OA 4DO5A 4IZGA 4ORIA 2DU2A 3EDJA 5A6JA 1YNYA 2V38A 3GDTA 4U3AA 1LQ2A 4RE0A 3MDWA 1SFLA 4YWIA 4BA0A 1PZ0A 4I7WA 3VOIA 4DF2A 3BV4A 1GPFA 3M43A 4AY1A 3SGUA 4N9CA 3A4AA 3MSDA 4GYJA 3LXAA 4M6PA 4X22A 4CQBA 2D2OA 3URQA 4U33A 4PUDA 1L6YA 4I6VA 3LD5A 1TPEA 4GJJA 4GVIA 3S5NA 3TYAA 4QM1A 1MW1A 4JIQA 4JXCA 1MXSA 3WO8A 3SN0A 2NVCA 3V5FA 2QPSA 2D3NA 4GCAA 1N82A 4WDTA 3HG3A 4PMDA 1K9DA 1V6YA 2D2JA 5FF7A 4HCDA 3SCPA 4MY9A 4C6QA 1XXXA 2VEGA 1QBBA 1VFTA 2ZZ5A 5LXEA 3G22A 3V0UA 1W54A 4XZMX 4O8RA 3E0FA 5HJXA 1CYGA 7TIMA 5F4WA 2CZEA 4ZQMA 1UOZA 3WLRA 3A13A 3R13A 3KLLA 2WHKA 1P1MA 3DEQA 3OLGA 3KRUA 4NXKA 3QH2A 3LY0A 5D9NA 3S2CA 2P0OA 2HVNA 4QIUA 2XH2A 2VZOA 3FNDA 3STEA 5ECVA 1DXFA 1E73M 3LMYA 1GORA 2ASHA 3VNMA 1ZP4A 3H8AA 5U7SA 2YDRA 3HA1A 3DYOA 3CQHA 3M07A 3O63A 3BLDA 3WFAA 5CPSA 2XVLA 1AQFA 4K37A 2YFNA 2DT3A 3IK2A 4W8BA 1KXHA 3N3MA 3KBWA 1SZNA 1TJPA 3CHDA 3M0IA 2B7OA 4HN4A 1NOUA 1TWWA 4XBSA 3VX0A 3A64A 5A94A 4L1GA 4UTUA 3H6OA 1SJAA 1J79A 4JKKA 2B0MA 2FHFA 1Y0EA 3BSHA 4O0KA 2GQ9A 2Y7DA 2WSYA 2FVKA 1T5AA 2TPSA 4P7RA 5BYWA 3NQDA 2XU2A 2IQDA 3B0XA 3SURA 2J7HA 1WDQA 1JXKA 1AH4A 4L4LA 4KGLA 4C6PA 1TVLA 1TZZA 3TZFA 2YB4A 3MW7A 1CLXA 5HJLA 3DGRA 3NQ6A 3BMXA 3ZOAA 3UZXA 4GUGA 3SIMA 2QZRA 4BWLA 2Y6ZA 1YDVA 4YS1A 4KEUA 1QCWA 1F3XA 4D9PA 5A8QA 1ICPA 4TX6A 1HGYA 3P7YA 2WLZA 3N04A 4W85A 3K8KA 2PWHA 3TLQA 4PBFA 2DZAA 1Q7QA 3LDVA 3TYEA 5K4ZA 2YPIA 2YOCA 4MIMA 3CHCA 2WYSA 3QKEA 4PCFA 3STFA 2ZQ0A 1O60A 2GUYA 3WNMA 3CC1A 4PMJA 5XIAA 3EPMA 2C15A 1FWDC 1R8LA 3MMUA 4ZO6A 2Z26A 4GY1A 4V15A 1Q85A 1KR0A 4C7GA 1A3XA 1ISVA 4QNWA 4IFKB 3TYCA 4LVGA 4FSAA 5B7ZA 3RX3A 3E2VA 4C1KA 2QVHA 1BFNA 1UA7A 4ZMGA 4L1XA 1R3RA 1WB0A 5I23A 3KBJA 1RBAA 3QFWA 3WH7A 1ZNNA 3S9ZA 3T08A 4A3RA 5C9UA 1B3WA 3B9AA 3TC7A 1OCBA 3U2ZA 4ZENA 4DF0A 4UCGA 1RCXB 4PH6A 2NQ5A 3BJTA 2F84A 2HMCA 3WQDA 1HO1A 3GXDA 1OFAA 4HMNA 1POJA 1EDQA 3FA5A 1ITQA 3APTA 3T78A 1SQ7A 1J12A 2FZNA 4FA3A 1EP1A 4RDVA 3EX2A 3W37A 3H2NA 2I9UA 1ZGDA 3OVQA 1XQKA 4PBGA 5G2HA 3ZVHB 1VJZA 1DQUA 3FDKA 3VKBA 4PTXA 4FS9A 2Q3RA 3TTSA 1Z9AA 1EHAA 3W87A 3MBDA 1KRBC 1N8IA 2B7PA 3VIPA 5LIUX 2VCCA 1W2PA 2XVGA 3NWRA 2QJNA 1BGGA 4JTKA 4H9YA 1BTCA 3G1SA 3QPZA 4GZJA 5G1YA 5I06A 4DBDA 4GYPC 1XUZA 4IIBA 1YMYA 3K2GA 2V5KA 3CZEA 2ATMA 3NL3A 5AYZA 1NOFA 4JBRA 1S1RA 4JIPA 3QBUA 3FLUA 2A7PA 1KD0A 5T9CE 1FKWA 4C91A 4NI3A 1XLKA 3MYOA 3VI2A 3TONA 4DJED 1O5KA 1T8QA 1F76A 4B15A 2V2HA 3CS2A 1WOBA 1WDRA 1K02A 4O12A 2PD9A 1RCQA 3QY8A 5DBUA 4LAKA 5EMUA 1FCUA 1E71M 4H19A 3DECA 5AHNA 4DZHA 1XYBA 2V67A 1B2YA 5ABFB 1MW2A 3ABXA 1UW9A 4ATLA 2C6QA 1Y65A 1P6CA 5FEWA 1E3ZA 1MWOA 3A9BA 5K3VA 4BFAA 3LX9A 4JN7A 1KM4A 3QLLA 2QPXA 2Z1VA 4Y2WA 1YQ2A 3MJYA 3CL8A 3W7QA 1W91A 3S9IA 2AKMA 4C6EA 2WNZA 4MVAA 5FESA 1JCMP 3W1PA 5CBIA 1AG1O 1B3VA 1S2WA 3SRDA 2XISA 5AVNA 4R85A 4UXDA 5DELA 4I9MA 3C3NA 2HBXA 4FHAA 3LRMA 3TQPA 3KL0A 2NT0A 1OF6A 2Q8LA 1FOBA 4DM2A 5C2GA 2D22A 2OZTA 1OK4A 3REQA 2QJIA 3VNDA 3GNPA 5HK4A 4BF5A 1K8CA 3DG7A 4JTFA 3H12A 5FJIA 4LUIA 3PSWA 2J8FA 2X1IA 4Y9OA 2O7QA 2WWDA 3WH6A 1VPQA 5FF3A 1XG3A 4UTWC 4GQGA 1XYLA 1L6SA 4Z1AA 2XYLA 2CLPA 3FAXA 3N19B 2AAAA 3N2MA 1Q4NX 3UPWA 5IDIA 3W7JA 4TO8A 3RLGA 5LA0A 4PUEA 4B9ZA 3AZSA 1OD0A 2VGIA 1LT7A 3UR8A 4ADUA 4L9XA 4HKPA 3HBLA 1YPFA 3SB0A 4CU7A 2ZKMX 2VEPA 5KZMA 3N4EA 1NSJA 3IGSA 3LCFA 4IMEA 4R5EA 3UT0A 3W1LA 1UR8A 1FXQA 3SCNA 1FFQA 3E1F1 4RL3A 1F3TA 3EXRA 1DJXA 4NSBA 4A8RA 2XN0A 4GK8A 2E77A 4H1ZA 1B3OA 1XF0A 1B3YA 4IF2A 2GQ8A 4BQ5A 2PDJA 3LTSA 2FLIA 4TVUA 5I24A 2DEPA 2ZXQA 3KDOA 4S23A 1S5VA 3QOMA 4ZFCA 3LLDA 3FJ4A 2P88A 2DZVA 4Q7NA 3QQWA 2PDPA 2EPLX 4XSLA 2BP1A 2QCCA 4LCSA 4OZOA 5B7YA 3C0JA 3TSBA 3TROA 2FB3A 3NYDA 4HU8A 4I9AA 3PBGA 2FVMA 4Z0SA 3UVAA 3IJLA 1UWIA 3PBMA 1WAWA 3EAUA 3S9YA 2OR2A 3MCOA 5C7HA 2W0UA 4H2CA 4GXWA 4FK9A 3NPUA 3K1GA 2ZVRA 5EMJA 1YTKA 2J9YA 2B31A 1D3GA 4JR5A 4MGGA 1XPGA 5DRCA 4AD2A 2JKAA 3AS2A 3P5ZA 4Z42C 4GQBA 3PWIA 1QU4A 4ZFMA 4ZSUA 2WVVA 1RK5A 4RDWA 2A6LA 3TYZA 1AJZA 2FJUB 1GNXA 4ZQNA 2GGJA 3MTWA 5HWJA 4UR7A 4XZLX 3O0FA 5LA1A 2P5NA 1A3WA 2VGFA 4DEFA 4RNFA 1W56A 3MANA 1CX9A 4J7RA 5LIYX 4YJ5A 1OG6A 3MP3A 3WFZA 3VC5A 1KW1A 2BGSA 3LPPA 1NELA 2V5LA 1W1B1 3W27A 4BQ4A 1J6PA 3HFTA 1OT1A 3CYJA 3A3XA 1PE1A 2PC8A 3GO2A 4CLMA 2INZA 3EPOA 3WIJA 4R3UA 2ZA3A 2PWVA 1E6QM 5AC8A 5DY3A 1CXEA 1VP5A 1JCNA 2Y89A 3RU8X 1IT8A 4UFIA 2HE5A 3R5EA 4OJYA 3UJFA 3E49A 4Q6JA 2P50A 1W8GA 4WXYA 2VI0A 2ZA1A 4HHHA 5CSRA 3F5LA 4YTRA 3QHOA 4O28A 3LN3A 4O4VA 3TP4A 4M24A 2WHMA 2WO5A 1B31A 4MWAA 1V51A 4F2TA 1MZRA 4AHPA 5DMLA 1LROA 1P0EA 4UFLA 3WK1A 1SVDA 2DVXA 1OEPA 1H60A 1VQTA 3G2GA 5K9DA 1E6SM 3UETA 2I5GA 4JTLA 3N4AA 4AW7A 4D1JA 3BAKA 2FPTA 3SUVA 1TPC1 4UTLA 1OFOA 4I5XA 2EPOA 1US3A 3QV8A 1SUXA 3DFQA 3CMGA 2VMFA 3H22A 3GYCA 4NYUA 3CT7A 1XLLA 1R46A 4AF0A 1OX4A 4FOUA 3N12A 4HCHA 2PDNA 4E5TA 4E8GA 1V77A 2WBKA 4W88A 1MXDA 2V6AA 3S5ZA 3OLIA 6PTDA 1KWKA 1DWFM 1MQQA 2CKSA 4C6FA 3MSGA 4GI8A 5FIPA 2NV9A 1A0CA 4KERA 3NO5A 4HA1A 1QWKA 1JUBA 3E02A 2HK0A 1P48A 3VM5A 3P67A 3IGXA 1W6TA 1TIWA 3DIPA 4P7QA 3C52A 3WUGA 2RDXA 3F5JA 1BYAA 3CTLA 5L9FA 4A2RA 4Z0JA 3H2CA 1EP2A 4AX7A 1ZLPA 2VZVA 4NAFA 3ECQA 3S3GA 4M8UA 2EJAA 1K03A 2H8XA 1REQA 2R8WA 1D9EA 4EE9A 4PUUA 4G9PA 4TUFA 4Q4SA 2CLFA 1TPFA 1KFJA 3FN9A 2XZ7A 3R7MA 3TN5A 2WMIA 5G1MA 4QDWA 2ZADA 4DAFA 1WXYA 2JE8A 2VX7A 5FJJA 4Z17A 1Q63A 4GC3A 3N13A 4OKDA 2F38A 3EDDA 1ISXA 4ZE4A 3N73A 2VQUA 2H8ZA 1GQNA 4D2JA 3NYZA 3D6NA 4XO6A 1KA9F 3O8AA 2XGZA 3TN3A 4ECLA 4G8TA 3PULA 3RM9A 3GXNA 4B5VA 2VYOA 4FO4A 1S5TA 1A5OC 4MTVA 1QHZA 3RK8A 1XD0A 2JEPA 1V6VA 1ZENA 4IM4A 3FV9A 4GISA 1XD1A 1P0KA 3CASA 3W53A 1FWCC 1JDAA 4TXEA 3WLNA 5CPTA 3NQFA 3APGA 3IGUA 4NZ5A 2BHUA 3N6JA 3QY7A 4U31A 2OELA 4LV4A 2QDDA 2FPVA 2Q8XA 2Z1SA 3BMWA 3I4EA 3VNJA 1VPXA 4Z1DA 1HXJA 4MKSA 3B04A 3S6DA 1QNVA 1H1ZA 4YCOA 4PCSA 3ELFA 4V27A 4AEEA 4AISA 1D3HA 2ODOA 2ZUNA 5HBFA 4INFA 3PJTA 1OGBA 4CD7A 3GG0A 4Q7BA 3UG5A 2P0IA 2ZE0A 3B06A 4NJIA 3OVRA 4HVXA 1OCQA 3LA4A 1TMLA 1QW8A 4PTDA 3RXZA 1AMYA 3GNXA 4DUWA 3EGJA 2CLIA 3IJ7A 4KKXA 4H6RA 4FNQA 5GNZA 3QV6A 4RCXA 5A6BD 4DYEA 3VIJA 1F6YA 3WQVA 3VCCA 3T2OA 5A5WA 1PTGA 1T0OA 1C8QA 2W3ZA 5BOEA 1I1WA 3L7RA 3B9NA 3KZSA 2WSKA 3CUHA 2PS2A 2CLHA 2OT1A 3FSUA 5CC7A 3QVQA 4E6MA 4XKYA 4LYRA 4OV9A 3D47A 2ISVA 3RYSA 3WKZA 1JCXA 4BHYA 3BLPX 3RCNA 1GKPA 1DEDA 2R1MA 4RW3A 4A2SA 1MDLA 2VD9A 1WDWA 1V8EA 3G1RA 4XX6A 4JIHA 1UP0A 3B9OA 3UWEA 3RR4A 4GVGA 5HMEA 1E4NA 4H00A 4LY4A 4B5TA 4M82A 2BDQA 1RD6A 3OW1A 3W81A 1EO5A 4B5WA 4PCNA 3H2EA 3R79A 4JCMA 4P7NA 2VJXA 1QTWA 3AFBA 4GLEA 4W5UA 4N6EA 1EJWC 4HNUA 4R53A 2DZXA 1UR1A 4KW2A 1E43A 4DUXA 4IMCA 4JGDA 3T09A 2OX1A 5FJUA 2J62A 5ABGA 2C1IA 4MPKA 2OG9A 4V33A 1JIBA 3TOYA 4OTKA 2AL1A 1UD3A 3WK3A 1JFHA 1KFCA 2XH4A 4FF5A 4ORMA 2Y5EA 3LTPA 4UTFA 4US6A 1OSEA 1W3HA 3ENLA 3AMDA 1M1BA 4H4IA 1H7WA 4D8AA 1EP3A 5EY5A 3FGCA 3PUDA 1R9XA 3WMBA 2V8ZA 3NOEA 2XFFA 4XD4A 1P5BA 3P81A 2OWXA 1DE5A 4M1BA 1SPQA 4UTIA 1GK8A 4H9MA 3LLXA 4AZHA 2V63A 4RK8A 3VKKA 4GUFA 3D5HA 3I6TA 1E4IA 1K9EA 4AH7A 1H2JA 4O1BA 4PCPA 1RVKA 1BQCA 3S0CA 3UZ5A 4GA8A 2NXHA 5I3KA 3TW9A 1DP0A 2GFTA 4F0KA 3NZPA 5HNNA 4HPJA 3GC2A 3TU9A 4BI5A 2IKJA 2GWGA 2OSXA 4Q33A 2DT1A 1J5TA 3UWWA 4PUKA 5XIMA 1BG4A 5L6UA 1EJTC 5EA9A 3SGGA 1QXLA 4U3CA 2YIHA 2EG8A 4R7OA 1E70M 3WH8A 3GSMA 4JQ2A 1U30A 1RH9A 1Z44A 3LB0A 4J1OA 4AIBA 1MXGA 1GWJA 5GQBA 1NU5A 3L67A 1QI3A 1XKYA 5RUBA 5E0CA 1YE4A 1DORA 3TTOA 3WDQA 3FKKA 4ZQOA 1BF2A 4QEEA 4AD5A 5DCBA 4AD1A 1H09A 2A3EA 4NL1A 4YNGA 3LHVA 1YXCA 3CYVA 4HYWA 1F74A 3CZKA 3AALA 5FJOA 1FCQA 3M6DA 4Q8NA 4CUCA 1XBZA 2A7RA 3AMKA 1ME9A 3EBVA 4NASA 2NXGA 3BPWA 3V0SA 5GJNA 1O5XA 3T4WA 3SUWA 3THDA 1SM9A 5FF0A 4Q8PA 3N2TA 4YTTA 2A85A 3WEOA 3OVGA 1ALDA 1SO6A 2OJPA 2Z4GA 4ZA0A 1POKA 2MANA 4GI4A 4DHGA 4NNBA 2OEMA 3K4DA 1RSCA 1K6WA 3F4WA 1CDGA 3F7JA 3KW3A 1TFVA 3STCA 4ZOBA 3BVJA 5IBXA 1K8XA 4TVCA 2X05A 2ZWZA 4J3UA 2ZE3A 4PTNA 1RJRA 3M0LA 3QYSA 4B91A 3WLJA 4PZVA 3WDHA 1JZ6A 1UIPA 5DXXA 2ZOXA 4GJIA 2E5BA 1AZ1A 2OKOA 3S42A 1J11A 5A6KA 3C0SA 3PAJA 4IWWA 2V9DA 3UWQA 2R94A 4HJFA 4ONVA 4WXZA 5AVHA 1M53A 2B7NA 2CZFA 1S39A 2WC4A 3EB4A 3L23A 1LRNA 4WGXA 4P5UA 4HHPA 2PD5A 3RJYA 2JFEX 4MWAE 1IWAA 4WSJA 3D0CA 4V2XA 2ZZ2A 5F2MA 1A5CA 1IEVA 2R91A 4MG4A 3DI1A 3V36A 1N7KA 3SIZA 2YCKX 2PLKA 3FA4A 1ADSA 4ENLA 4DBUA 3AMGA 5E09A 3KDNA 2QJJA 3LI0A 4OWGA 2PDUA 3IJ6A 2YCJA 5D05A 4JYEA 3N25A 2GVGA 1K1DA 4A35A 2GPTA 2RDUA 5CC6A 1TA3A 3HPXA 4ZQPA 2ALDA 2NSXA 1OYCA 4NAEA 4Q8QA 1D8CA 2ABBA 1EUNA 2PWDA 1W9DM 1XDLA 1ZBVA 2XDFA 4G56A 3QSTA 4A8NA 3HQPA 3I7QA 5AC5A 2I56A 2A4AA 4X60A 3WDIA 2YDSA 3SZ8A 4HHMA 3WEZA 2WZIA 3BAIA 2FGBA 4H8HA 4D6DA 3FXGA 3R2GA 3E2RA 3CNYA 4WX2A 4D6IA 2BXVA 4MY8A 5CC3A 1EF2A 2PWFA 3N18A 4EXAA 2FZ8A 3BAYA 2YBUA 1UHVA 4GO9A 1W5NA 3IUDA 1QATA 1UUOA 4CCDA 4GABA 1ZBCA 3G3DA 1PX3A 2PI6A 2IPWA 5JH1A 3KLKA 2GGGA 3B0YA 4MNJA 1UKSA 1SW7A 3GU1A 3IGHX 2CLEA 2V5DA 3OTRA 3PG9A 4GWEA 4X9SA 3TW6A 2XIJA 9CGTA 1DWAM 4GZEA 4HN8A 4J27A 1FP9A 2NUWA 1FA2A 5G4HC 2PGEA 3CZJA 5C71A 4QJ4B 3PC0A 4LF1A 1C8YA 2WM1A 3H2MA 1MW3A 5H91A 2Y8UA 3AS3A 1AQ0A 5C9XA 4GI9A 4DO6A 1EHNA 3PJUA 1DJZA 3OEXA 1SR9A 4NHVA 2PTWA 3AHXA 4LS1A 2ZX9A 3K46A 2E9LA 1QVBA 3NQ7A 2BFGA 3QTGA 3SQLA 5F1UA 5H6HA 3UWYA 2CHNA 1THFD 3BSGA 1IWBA 2B4GA 3NOYA 2XZ9A 4X9YA 5A2CA 1ECEA 4CNNA 4IMGA 4LVAA 1LG1A 1HX0A 4XTDA 3ABZA 1QR7A 3GG1A 4ZSTA 4AZGA 1QT1A 1KCZA 1N2VA 1Z8AA 5GJPA 1XLEA 4XZNX 3UBPC 2KZHA 1SO5A 1PUDA 2J7DA 3REQB 5A6LA 4JKLA 5JIWA 2FGLA 3NG3A 1RAKA 3W1QA 1H7RA 4UNLA 2QCDA 3BO9A 4W5ZA 5G1TA 4JTSA 1EDGA 3N34A 2B81A 5GNXA 1J9YA 3UXDA 3ZSTA 3YPIA 3WK0A 2I17A 1LOLA 1G7UA 1NWTA 1A53A 4JTCA 2R1PA 3SQSA 4R9XA 5D2VA 4EX4A 3KXQA 2PFHA 1CXFA 2DQWA 3ARYA 2YA2A 1W9XA 2YLAA 3UCQA 3I6EA 4UWMA 3GZAA 3RX2A 1OX6A 1UCWA 4G2DA 3G8RA 3S5OA 1G6CA 3OA5A 1Q6QA 4Q7IA 4UQ9A 3DBNA 3W2UA 3CBWA 5CGTA 1IEIA 2CLLA 4UTTA 3R89A 4ICNA 2QGHA 2GYIA 3MUXA 4K2SA 4M7TA 6XIMA 2VELA 1VLWA 3THUA 4IPIA 4MJZA 3FS2A 2QPUA 4U28A 1E72M 5C8BB 4G7EA 1M01A 2XSBA 1XLAA 2NX1A 3NXLA 4HZMA 3NSXA 3W3OA 4U5KA 4JIEA 4PMRA 4R7JA 5BROA 4PMYA 3IV8A 3HGRA 4BZYA 4NILA 2NSOA 1HJXA 4B5SA 2NQLA 3R12A 3EWXA 3IVUA 5LNRA 1DE6A 5GVJA 3GAKA 3VOCA 4CQDA 1GOOA 1PTAA 2DIJA 5I09A 1EA9C 4ZB5A 1NDZA 2NW0A 3RHGA 1P0DA 2GOUA 3CIVA 2V3GA 1QI4A 3QLDA 3BSMA 4BK9A 4IL2A 1UD6A 5I0DA 1P4CA 1LT8A 3KL3A 4F0HA 1TR9A 2QDEA 4MDOA 1OADA 1XIDA 1G5AA 2W62A 3AXXA 2VRKA 2A3CA 1TRDA 5KITA 5HMDA 2OKTA 2X0HA 4BY3A 1TO3A 1W3KA 4FXJA 1UOKA 4PMVA 2TRSA 1XRFA 2O9RA 4GIRA 4WJEA 1U5JA 3ITOA 3NURA 2I5IA 4TTGA 5REQA 3QV7A 4FEZA 4PSRA 1UKQA 1W5PA 3W29A 2FTPA 3EEZA 3S2LA 4B5NA 3FAWA 4HIBA 1ZP3A 4RZ4A 3UXKA 3DC8A 2XIQA 2EKCA 4F2UA 2O9OA 2JIWA 3POCA 3JU2A 3T05A 4R9OA 3GTNA 5BRPA 4Q22A 1OIFA 4NX0A 1FWIC 3IV3A 2XFWA 5K2ZA 2OQHA 5FAGA 2WKLA 3GDKA 5AB3A 4PMZA 3UG3A 4F9JA 1OCJA 2E0PA 1XW8A 4XISA 2JF6A 1KBBA 1PDZA 1G69A 5EMYA 3H21A 3A5FA 2ZXDA 4H41A 1RQEA 1HKJA 4E8CA 3IJDA 3VD3A 3EWYA 3BAJA 2XWDA 3GVQA 5FEZA 4EXQA 5DO8A 5CJNA 3BZGA 5JUVA 1ZL1A 4PFHA 1K4HA 3IUHA 1OGGA 2A0NA 1Z89A 4E4UA 3AXIA 2YBVA 1TRIA 1MRQA 4O14A 2Y0FA 1E6NA 3CHVA 1ZHAA 1PDYA 3FKRA 2OQYA 3CO4A 3QC3A 4H6KA 5DCDA 1F6KA 3E0WA 4MWAB 1PKNA 4GXPA 3SUTA 7ODCA 3LHZA 1AJ0A 1EBHA 1E9YB 3WNNA 3O06A 1QNQA 2RJHA 4L80A 1Y7VA 3V5OA 5BXPA 3Q2DA 3MUCA 3L9CA 2YXGA 1Q6FA 4MPQA 1DWHM 3CXOA 4AF0B 1OX4B 3FVMA 4U5IA 3ZQ9A 5EL1A 1HP4A 3HQNA 2YL9A 3RFAA 3TSMA 2OGYA 4IQDA 4DJDA 3FJNA 3TYBA 3NPWA 4LYPA 4AXKA 2ISSA 4XAYA 2QJGA 3CH9A 5JXQA 3CEUA 1CPUA 5BMWA 3QY6A 3R11A 2VX5A 1G9HA 3LPGA 4LC8A 3ARUA 1ODUA 3QGKC 2DH3A 4PE8A 3B8WA 2WPBA 1VEPA 3GTHA 3TQ0A 1I9CB 3VUSA 4XAZA 3K1DA 5HULA 4DX3A 3H2OA 5EYWA 1VFLA 1N8WA 4G1NA 5EBUA 4NAFB 3QMSA 1R85A 2VC9A 1REQB 3SY5A 3GU2A 1XIMA 2O55A 1VENA 3GTFA 3PAOA 2DH2A 4UTHA 4PL2A 3OG3A 2Z24A 1FWNA 3V7PA 3QGAC 1DOSA 2ZX7A 1X7FA 1BAGA 2WMIB 2OSYA 1X1OA 2PWGA 4JTDA 3W1UA 4QHRA 5I5RA 4MNMA 1XRVA 3VZXA 1JCYA 4UFJA 2OQLA 4PB3A 1H7PA 1ZAIA 4DVOA 3LV5A 1TTPA 5IRPA 2DPEA 1HL9A 3TR2A 4L7ZA 3FFSA 1W3IA 2F6XA 2Z2UA 1PIFA 2GQ3A 1GZGA 4IP5A 4RLIA 2AQVA 3VE9A 3TIMA 3MDUA 1HNYA 1OQFA 3QZAA 1CXHA 4PFMA 1WUEA 3T40A 4PRRA 3B8SA 4PBEA 3UD6A 2E4TA 4YLWA 5JH2A 1C8XA 4WUIA 1W5QA 3DKLA 2WJDA 5CH9A 3OG2A 1B54A 2WZTA 2D69A 2DW6A 4QITA 1TE6A 2CESA 3S1WA 2ALRA 3VGFA 1LBMA 2C91A 1GUVA 1ME7A 3BGJA 4Y90A 3SCRA 4X2PA 4ERAA 3UVIA 1E1EA 3H55A 4KQNA 3WL0A 3NFUA 5FSEC 1HVQA 3GUGA 4WRHA 1WX0A 3S8HA 1JZ7A 1V7YA 4MLJA 1GW1A 4ZO9A 4HOWA 5AOUA 2DT0A 4ASTA 1QNRA 1RBOB 1EJVC 1R7AA 3SM0A 1WKEA 1XIBA 2CBIA 1ELSA 4MWAC 1UD4A 4CNOA 4Q8WA 4XSMA 3M46A 3AYTA 1LL7A 3GNDA 1Y5VA 3G8EA 1OF8A 1A5BA 2QUTA 3UY7A 3UPMA 1UD8A 4KEZA 2GVEA 4N0RA 1WNOA 1Q6GA 1V0MA 4O1EA 4D6HA 3LBMA 4C6LA 1HN1A 3UJEA 5FF2A 3USBA 4YTQA 3T8QA 3WJXA 1J10A 3DYMA 3W88A 4HT3A 4M29A 2EGZA 4TU1A 4XKYB 1BQGA 3OB8A 3QC0A 3STPA 2VR5A 1E9ZB 2IQ0A 5E9AA 3OGRA 4RZ5A 3M0KA 3HV9A 1G01A 1DJIA 1GEQA 2E6DA 1WUFA 3VOGA 4LVFA 3OBKA 2GJRA 1SMAA 5I2UA 2C71A 1C90A 3P3BA 1AL8A 3JUGA 5CZSA 1J0IA 3OZOA 4UMAA 2WCSA 5HA7A 1ZALA 3EA2A 4IFRA 1YE6A 2V2DA 2E1WA 4KWVA 1DYSA 1ZAJA 5A2BA 4RW5A 1XDMA 5KSWA 4PTMA 4TV5A 4XTIA 1J8VA 3AXHA 4MUPA 2J77A 4LF2A 1I2NA 3V1HA 1ZJIA 1MEIA 2E09A 3B8IA 3GR7A 4S39A 1R2SA 1V3MA 4UQCA 5D4YA 4DZAA 1ZY9A 5I6SA 4EF8A 3R8RA 2CLOA 2WB5A 4UFKA 3C8NA 1RA5A 1TX0A 4NZ4A 4L4OA 3A23A 1V3IA 1W1VA 1MUMA 5T9BG 1PPIA 1RPXA 4JQ4A 4GPNA 3BE7A 1KCLA 3LPOA 2BWGA 2I7GA 3O0KA 2X40A 1PWLA 1YX1A 2ZIDA 2R1KA 3LK6A 3EMQA 5TQLA 2OYLA 1RQHA 1MYRA 2HVMA 5A8MA 2QXWA 5G2WA 4B90A 1A5LC 3SN4A 4OGZA 2INFA 2WOQA 3GHUA 4QEHA 1X8CA 4D1IA 4CQCA 3ARWA 3ZJ6A 2CW6A 4HD5A 2GJNA 2Y7GA 1KTCA 4JNZA 3P5YA 4L9ZA 2O4MA 4O53A 3GXIA 4RE2A 3DHFA 4Q6XA 3UP8A 3OGSA 2HPMA 3E96A 3AWOA 4DQWA 2Q71A 2BOEX 4KRTA 3ITLA 3OODA 5A8NA 2G3IA 3GU9A 3BOFA 2PTXA 1W9PA 1XGZA 2R1LA 5ABFA 3QGVA 1G4SA 2UY3A 1Q7ZA 1V08A 5CGMA 3KM8A 2RDTA 3E0LA 1JF6A 4J5NA 3CLWA 1M5WA 1XLDA 2CKRA 2XSXA 2PU0A 4DZ5A 2PP1A 4HZ8A 3TC3A 3W71A 4AD4A 5LIKX 3ZLGA 3T0TA 2X2GA 2WKGA 3CU2A 2WMKA 1OBAA 5A8OA 3ATZA 4KRUA 3CWOX 4Z1YA 2D2GA 4IQEA 4LNYA 4H9XA 3P14A 1TYGA 4JEJA 4B4FA 3MUY1 2WLYA 3BANA 4Q4OA 3GH4A 1P43A 2UY5A 3A4XA 3G1VA 4IIFA 2J88A 3NGFA 2BG5A 4GY0A 1T6MA 2B7QA 4DYJA 4GXMA 2ZX8A 1DIKA 4QCEA 4P8WA 4GYFA 3G6MA 4XQ6A 4XD5A 1PJ9A 3WF1A 4CN6A 4LAOA 2ONEA 4KFPA 2WJEA 3GIQA 4WY0B 2J7EA 5ABEA 1KM3A 3DCPA 3ABRA 4M81A 2WJZA 2WAGA 2D23A 2HNHA 2FFIA 4LU0A 4S3KA 3OIXA 2GDQA 2Q09A 5AHLA 3S2NA 2DSWA 2NQ9A 3R0KA 4X0VA 3LV6A 4KS0A 1E3XA 4P7LA 3W75A 1HJQA 2OOFA 5EGRA 3CMJA 4LBRA 2J25A 3LS9A 3ALGA 4D6EA 4MAVA 3VKDA 2BTMA 3SO7A 3FIGA 3GDRA 3W23A 4HTYA 1TV2A 1CIUA 1KXTA 3QFEA 4B3ZA 4IUOA 4C65A 2F8QA 5DBTA 2FZDA 1R6WA 4UFHA 2G5WA 3OGVA 1V93A 1X7IA 3W7MA 1JUKA 3B3DA 3HURA 3KVLA 4H6EA 4G6CA 1TWDA 3RLHA 1R38A 1YW1A 3GZ3A 1G0CA 3KOZA 5BU6A 1X39A 2R6OA 5CLWA 5HJYA 3NQ2A 5AFDA 4AVOA 9XIMA 2HQAA 3KS6A 3MYPA 1UKTA 2IMRA 1NJJA 2VDGA 4FIQA 1EXBA 2VFGA 3ZR5A 3HJZA 5FJPA 3TYDA 4C6CA 3PJXA 3MUAA 5HDRA 1LOSA 3NTYA 2GDVA 4ZO8A 3EA1A 3ZWSA 4JTAA 2E28A 3LXBA 1QPQA 4J3XA 6ENLA 4ML4A 1TA3B 3UGVA 2CWXA 4HSOA 4UFMA 4NAEB 3W07A 3MPGA 3VIHA 2HNEA 2VEMA 3TCEA 5LHEA 3WF4A 2Y4SA 1CB2A 3U9IA 4MYAA 4JICA 1DHKA 1HT6A 1IYXA 5DEZA 3RNDA 2J78A 3NSNA 1A49A 4A21A 1GYLA 3MB9A 1AFSA 3MUZ1 1DHPA 3VOJA 1YADA 5LNSA 1HP5A 2JIEA 4B9YA 3KRZA 1BHGA 1B3XA 1R3TA 4GRSA 3VKAA 3SR7A 3BW3A 3OU8A 3SJNA 2PDGA 3FYOA 4DF1A 2BMBA 3ZVIA 1W2VA 1MVYA 1R87A 3H2AA 3KVMA 4K8HA 1A5AA 4IPNB 2WKJA 3WMSA 1HVXA 3IWPA 1SFTA 2A5HA 1PYMA 1W5MA 4O54A 4FPSA 1KLYA 3WLMA 1W1A1 2Q6ZA 1A5NC 3LG3A 4XBJA 5C5YA 4UQEA 3PTQA 2VGGA 1GVIA 3HPZA 4IQLA 4MUZA 2VD8A 2BVWA 1Q8AA 5HUOA 3BURA 3LRKA 4C90A 5CEWA 1SSGA 4OOZA 4H7VA 1TVNA 3RAOA 2IKGA 2X09A 4YU1A 1ONEA 2VOTA 4F8XA 4DO7A 3SCUA 5A69A 1XYAA 2D0GA 1FWJC 1VR6A 4F4RA 4CD4A 3TQVA 1FHLA 4TTUA 3OP2A 1QNSA 1NAL1 1EGMA 1M7XA 3M5XA 3DFTA 3G24A 1TG7A 1EQCA 4GKLA 3FHAA 4O13A 2Z6JA 4RR4A 5CCZA 1PEZA 3M41A 1MI3A 4DBWA 4WKAA 2P8CA 2BZNA 4A6GA 4M6QA 1US2A 4UBPC 1MMFA 2C1HA 3TA9A 2OFJA 3VKCA 3WQGA 2A2IA 3SUUA 1F07A 3W7NA 5IBXC 4LYQA 3GIYA 4F0MA 4PR4A 3WQOA 3NXFA 2QCNA 1CGUA 1QOPA 2DSUA 2X8RA 3U2OA 1KC7A 5K9XA 2J24A 1S3TC 5TF0A 5LGZA 1X1ZA 1EC8A 1XFCA 3I65A 3S4TA 3W74A 1ADOA 2VR2A 4HK6A 4IPJA 4U2ZA 2PEVA 1NF0A 3BLIA 4OECA 4ZGYA 5JU6A 3KOWA 3W38A 2V3EA 3F2CA 3E3HA 3N29A 3NL5A 1FWGC 2E9MA 2Z7GA 2QAFA 1J5SA 3I10A 4RUBA 2QW5A 4Q8UA 1H3GA 3OQ8A 4AZCB 3RN6A 3IJ9A 1KQZA 1XV8A 2PWUA 2ACQA 1UG6A 3TKFA 4M51A 3PHAA 1OFDA 3EWZA 4NX5A 2WC7A 1PBGA 3MS8A 1EJXC 3EA3A 1JYNA 1E56A 1YPXA 1JI2A 3KTSA 4MF4A 2BXZA 3ABOA 3GYEA 2E8ZA 5BRQA 2VZTA 1PS9A 2PP3A 4URIA 1UKOA 1AVAA 2IW0A 2ZRZA 2J8GA 4L64A 2YKKA 2DIKA 1V02A 4H3DA 3CUFA 3U2EA 4IP7A 3ONCA 3MCMA 4Z2KA 1NDWA 1M41A 4L4PA 1DWJM 2DVUA 3O15A 4MZ8A 1XIIA 4FNTA 1QAPA 2WQDA 1OX5A 2XH7A 1K6AA 1GOIA 1PWMA 1XCWA 1JZ5A 2C3ZA 3A4WA 3PZUA 4OFCA 3DHPA 2GJPA 2IPGA 3GM8A 3Q65A 1UH3A 3VIOA 3CV7A 4JDYA 3SGZA 2V68A 1L8PA 3DFNA 5HPCA 1I45A 1X96A 3W1TA 4FI4A 2F7FA 4EXBA 2OLSA 4FLSA 1W8SA 4GFIA 1LWHA 1S3HA 3SW6A 3WQ6A 3CQJA 3HIJA 1MUCA 3N2BA 3T0BA 3M5ZA 3PP7A 3KL5A 1QI0A 4FNSA 5LNWA 3CM4A 3CTTA 3P8IA 1EB3A 1TJ0A 3DU0A 2NX3A 1FHVA 5REQB 4EIVA 1B1YA 4HK7A 1YTDA 2A21A 3EWCA 2WQPA 3SUSA 3A21A 1FKXA 4JL1A 1XIEA 5FAJA 1DQWA 4PEEA 4ZVJA 4KH2A 3VM7A 4FLQA 1JD9A 1AZ2A 1ZAHA 2NUXA 1VD6A 3WSUA 1PB0A 1NH6A 4BQ2A 4UQDA 4EANA 4YVXA 1EF3A 3MKCA 3W7CA 3NA8A 1GTEA 4GGHA 3EOSA 5JMUA 1UMLA 1E0WA 3S1VA 1TV5A 4MB1A 3BJSA 1P0NA 3NJ3A 5HNTA 3WCZA 1LJYA 3A24A 3BUVA 1PKMA 4H7CA 2VURA 3WELA 1W1IE 3U7BA 1SSDA 3BG3A 4PMXA 5HUPA 1IXNA 1V0KA 2X7WA 3AIEA 1UR9A 2BHYA 4J2PA 3WN6A 2VENA 3N6QA 2VT0A 4FOKA 3R10A 1VEOA 3HGSA 3UA4A 4PTVA 5LYRA 1J2WA 4EVZA 4J3WA 2DGAA 4CCEA 4U2YA 4Q8VA 3ZM8A 5MHBA 1P7TA 4WDXA 1K7XA 2Y1HA 1XGEA 1XIJA 4JFWA 3HZ3A 2OT0A 4JX5A 3L65A 1J01A 2VGBA 4A22A 1QHOA 4KFOA 1JVNA 1IZJA 1BWKA 2VFDA 2GVJA 1QRQA 2XH0A 3MY9A 4H01A 1PTDA 3LNMA 1TQXA 3SAZA 1D3CA 4AYGA 3VIFA 5AKQA 4ZTXA 4MDPA 1GT8A 5EPDA 4UTTC 3DFOA 3THQA 3W84A 1TPB1 3BLEA 4JTEA 3GBEA 1CW2A 1AW5A 4K8GA 4DB7A 1H49A 4Y7EA 3ABSA 4AZ5A 4HHLA 4A05A 1XDJA 3JZUA 5D2YA 2Z00A 2XIBA 4DJEA 3R58A 5E6ZA 1EGZA 2WMHA 1O4UA 4FIRA 3VK5A 5C6MA 1LQAA 3TMQA 3DFPA 4H83A 5D37A 4XZIA 5E6YA 4QE4A 1OG0A 1QFEA 2ZZ4A 1TPUA 2CYGA 2G50A 4GYKA 2BHZA 3AQUA 5C70A 4NVTA 2PUZA 1KKOA 4XO7A 1JGMA 2G95A 1IQ8A 4O0ZA 1VFMA 4PMNA 3NSMA 4HOZA 2WC3A 2I9EA 1K9TA 4NRSA