2R16A

Crystal structure of bovine neurexin 1 alpha lns/lg domain 4 (with no splice insert)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
175
Chain Sequence
ATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLGKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Regulation of Neurexin 1beta Tertiary Structure and Ligand Binding through Alternative Splicing
pubmed doi rcsb
source organism Bos taurus
molecule tags Cell adhesion, splicing
molecule keywords Neurexin-1-alpha
total genus 39
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r16A00
2EXIA 1AVBA 3AX4A 4FQ4A 1FV2A 1UZYA 5BYNA 1A3KA 1W6QA 4Y1ZA 1WW4A 4K1YA 1QOOA 4XTMA 2WJSA 4BLIA 1G86A 1GNHA 5GALA 1LHVA 1BQPA 4R9CA 2W68A 4XE9A 2D6MA 2DUOA 4FOWA 4ITCA 4YG0A 4DRRA 2ZGKA 3RRDA 2PHRA 5EYYA 4YW3A 3B69A 1SCSA 3ZPYA 1B09A 1ZM1A 3AZXA 3BTAA 4GALA 5CB7A 3USUB 1LTEA 4UW6A 4W65A 1I1EA 3OBTA 2CWSA 4M3CB 3FLRA 4Q2FA 1URXA 1GZWB 4XJUA 2CY6A 4Y20B 1LHUA 1SBDA 1LU2A 3PVEA 4DQAA 5EXOA 1IS6A 4P9YA 2UWAA 1IKQA 1Q8OA 2A6WA 3JU9A 4Q8LA 4XIKA 3ZYPA 1AX1A 1XQNA 4XHBA 1HQLA 4JRAA 3WCRA 2UU8A 5HCAA 1FV3A 1CVNA 1N3OA 3T1LA 5FRAA 2ZGMA 5IK7A 3HMYA 4YW5A 2D3SA 3WDXA 2CWMA 2JE9A 2R0FA 3V64A 2E7TA 1LOBA 4ISQA 4BMEA 3KM5A 5T54A 4WV8A 2AREA 3LSDA 4GWMA 3OYWA 1WW5A 2A7AA 2GALA 4WVWA 1VIWB 1AZDA 1JUIA 3IM0A 3MPPG 5GZEA 3VKLA 1IS5A 1HKDA 2A3YA 2ZGOA 5IT6A 2FMDA 3AYCA 4XJ9A 1QNWA 1CIWA 1TEIA 1LHOA 1HQWA 3ASIA 3AZWA 5DXDA 5IUQA 5GJ6A 4YW2A 1RIRA 2P3IA 3NV4A 1LOCA 3ENRA 1CONA 4FOVA 1W0PA 1W6NA 1Q8VA 2BQPA 5CAZA 4FQZA 4P9WA 3WG2A 1LGBA 2D6KA 1Q8PA 4PCRA 1MS1A 1QDOA 3OY8A 2AH2A 2JD4A 1G9DA 1LOGA 1PZ9A 3APBA 2ZMLA 1LEMA 4TZDA 5KXDA 3PVOA 3M3CA 2WT0A 2D3RA 2E51A 3M2MA 3KQRA 4YZ3A 5FREA 3MW4A 4DS0A 2NZ9A 2B7YA 2Q5TA 3WZ1A 1J1TA 4XXPA 3AYAA 1HLCA 3WDVA 1VAMA 1QOTA 1W6PB 2P34A 4YFWA 4F83A 1H9WA 1APNA 2DWRA 4FPFA 3AP5A 3A0NA 1JN2P 1BYHA 4XMIA 4YFZA 4ASMB 1MACA 1SBEA 1U0AA 4ATEA 1D0HA 2V73A 1GLHA 4JCKA 4CZSA 3OPZA 4AGGA 5JLVA 2CNAA 4YM0A 5L73A 1DIWA 1N1VA 4C1XA 3ZSJA 1LESA 4AWDA 2OUJA 2D3PA 3T2TA 1LOAA 2W52A 4BMBA 1S0DA 2GMPA 1DFQA 1V6LA 3SITA 2NN8A 5KXBA 5GZFA 1H9PA 5IK4A 2ZGQA 1I3HA 4BM8A 1Z78A 3NV2A 1QMJA 4XJWA 4FPOB 4U2AA 1MS8A 5T5JA 3RMXA 3VKMA 4IQPA 5T5LA 1QU0A 4UW5A 1H30A 2WQZC 1C1FA 3FLPA 3IPVA 3D5OA 1JXNA 1G9AA 4UW3A 1N1YA 1LGCA 2A5ZA 4FPJA 2DU1A 4YG6A 3D6EA 1HDKA 1W6QB 1VALA 2ES3A 2R0HA 2NYYA 3C2UA 4GKXA 5HCFA 2XG3A 3R4UA 4Y1VA 2A75A 4AGVA 2DTYA 5KXCA 1YRZA 2ZAAA 1AXKA 4YGEA 2JDZA 1UKGA 3AK0A 4FPCA 1KJRA 4YGCA 5JOXA 3D4KA 1QGLA 3RSJA 1SLLA 2VXRA 1FNZA 4XJ8A 3WHTA 3POSA 3WDTA 2VW1A 4LBQD 4XMAA 1AXZA 3U4XA 4LBNA 1JBCA 3Q9OA 1RITA 3TB0A 1CESA 5DZGA 2NMNA 1SCRA 2GMEA 4Y26A 4YGDA 2WLQA 4XJAA 4M3CF 1GZWA 2DV9A 2I2SA 1G7YA 1QOSA 2ZGTA 1QKQA 2A3WA 1DYPA 3POYA 3AYEA 1RINA 1JW6A 4M00A 5E88A 1WBLA 2PHTA 4Q26A 2UWCA 1V6MA 4C1WA 1DHKB 1W6MB 2D6OX 2DUQA 3AZVA 2PHFA 1SLTA 1S1AA 1LODA 1GKBA 1ULCA 4CTEA 1V6IA 4WVVA 1WUVA 1AJKA 1KQRA 2YV8A 1GZCA 5DG1A 3V0BB 3ILRA 1AF9A 2GNMA 3RG0A 3R4SA 1N47A 4D69A 1OKQA 2CL2A 4ATFA 1F5FA 3IN9A 1AXYA 4LBQB 2JJ6A 3WG3A 4Y1XA 1SLBA 3AYDA 4Y1YA 4YZ5A 2A6XA 1V6OA 1O4YA 3WUDA 4GXLA 3OYWB 2OW4A 2PHWA 2SBAA 2WSUA 4PF5A 4XIOA 3SISA 3M3OA 2W39A 3ZXJA 5EWSA 1V6KA 1NXD1 2D7FA 2D6LX 1Y7BA 1AJOA 2DYCA 3L2YA 3MEPA 1SLIA 2R16A 1IS3A 5CBLA 2A71A 1VAVA 3HN1A 3SNMA 3VKFC 1UN1A 4JC1A 1FNYA 4Y1UA 2DVBA 4ISRA 5JOWA 2ZHLA 3M3EA 3PJQA 2DU0A 1W6NB 2EXKA 2ZGRA 5GZGA 3WV6A 1WLCA 3N7JA 3N3HA 3WDWA 3BIWE 5GLZA 5GZDA 2D43A 1ZA4A 3UJOA 3OY8B 2CTVA 5F5QA 4FVVA 2WT2A 1MS4A 3INAA 2ZGSA 2C5DA 1Q8QA 3FLTA 4LBLA 3O5SA 4OZXA 1OQ1A 4R9BA 2D44A 1ENRA 3A0KA 2EIGA 1FAYA 2PHUA 3LCPA 2VUAA 4I30A 5H9RA 2VH9A 5JDBA 4ZKTB 4FP2A 3V0AA 2G4IA 2E6VA 4R9DA 2WSVA 1C57A 3M3QA 2JE7A 5DUVA 2A70A 2ZHMA 3B9CA 2WT1A 1ONAA 1S0EA 3R05A 2VU9A 4M3CE 3FUQA 5JMCA 1LHWA 3POWA 1LCLA 4YLZA 5DG2A 1WBFA 2WNEA 1BJQA 1UMZA 4NOTA 4Y24A 1G9CA 2GN3A 2ZZJA 3ZVXA 1ENSA 3N7MA 5DZFA 1LOEA 2FHRA 4R9AA 2YY1A 1GICA 1YI7A 4XXAA 3WG4A 2A6VA 4XBNA 5GM0A 1WCSA 2DTWA 5KXEA 2ZGNA 1IOAA 1UPSA 2ZMKA 1VLNA 3UL2A 4FPHA 4FP3A 4HL0A 3OBRA 5T5PA 1UAIA 1X50A 2KM2A 3IPVB 5GLTA 4BOWA 1UZZA 5JOZA 4P14A 2AUYA 1MZ5A 4YGBA 3ILFA 4RA0A 4K1ZA 1LHNA 1WW6A 1V6JA 3GNEA 2ENRA 1KDMA 2LTNA 1LOFA 2EF6A 3V0AB 4K21A 1DQ4A 2GN7A 5T50A 4AVSA 5DUXA 2E7QA 4K20A 1ENQA 2ARXA 2GMMA 4HANA 1LOFC 1QNYA 4BPZA 2HYKA 3HR9A 2GNDA 3ZYRA 1YO8A 1BKZA 2JECA 4XTPA 1MS0A 2XB6C 3DGTA 1GSLA 4FOQA 3ATGA 2A3XA 5F9TA 1LULA 3WOGA 2DVDA 3FBYA 1W6OB 1GNZA 1MR5A 3WHUA 2AYHA 2ZACA 4AVVA 4Y22A 1KDKA 5E8AA 3NWKA 2ZGPA 3AP9A 3B3QE 4LBOA 5SV8A 3VKNA 1F31A 2ERFA 1LEDA 2ZGUA 3AP4A 3I4IA 1DQ5A 1G9BA 3ZSMA 1JOJA 1ULDA 2SLIA 5T55A 1A78A 2ZBJA 1S0FA 1MVEA 1AX0A 1W6MA 3W59A 2P3JA 1Z0HA 1CR7A 1QF3A 2PHXA 4GKYA 2EAKA 2A6ZA 1S0CA 4FPLA 3AZZA 4LBMA 5AVAA 3ZSLA 3JUUA 1S0BA 4ZXKA 1DQ1A 1CJPA 4H55A 5EYXA 3VUOA 3RS6A 3N7LA 1O4ZA 4CRQA 4FPYA 2UWBA 4UW4A 2R49A 2R1BA 1UL9A 3V0BA 2YROA 2GDFA 3WG1A 3IMNA 2NMOA 1LENA 3A4UA 1SFYA 4LBJA 2ARBA 4LBQA 4P9XA 3LSEA 4XYXA 1MZ6A 3T1MA 3VV1A 1WLDA 3WVJA 4AGRA 3USUA 1S0JA 3OGGA 2E53A 1A8DA 2EXJA 2UURA 1MS5A 1C1LA 2YMZA 2VW0A 2ZABA 4M3CA 2YXSA 2JKBA 1UX6A 4PQ9A 1GBGA 2D6PA 3AP6A 3SH4A 1DQ2A 3TAYA 1JYIA 4Y20A 1JYCA 3O0WA 3RMYA 1NLSA 1QDCA 2ZHNA 1ULGA 1SLCA 3AFKA 3BODA 4MYEA 3SH3A 3V65A 2Z42A 1YXWA 1PZ8A 2CYFA 2AR6A 4XILA 3WDYA 2NM1A 3MW3A 1BZWA 3SH5A 3FUOA 1R1ZA 2VW2A 4FPGA 5H9QA 3RQ0A 4XHXA 1MVQA 2OVUA 4YW1A 1YYNA 1IKPA 2P2KA 1DLLA 1Q56A 3I8TA 1G8WA 1LGNA 1JHNA 1FX5A 1LJ7A 4FPEA 4TYSA 3SLIA 1MS9A 2AENA 5DUUA 1G9FA 1N1TA 1ULEA 3UK9A 4XDQA 5H9SA 1CN1A 2ZKNA 5GLVA 3ZXKA 1S0GA 4Q1PA 3UJQA 2A6YA 2YZ4A 3O0XA 3CNAA 4XBLA 3WCSA 3AJYA 3WLUA 1FYUA 4BQ1A 4AVTA 3VKOA 2PELA 3N7KA 2R1DA 3AXDA 1OFSA 1DQ0A 1GYKA 3WNXA 2GNBA 1CPNA 4U36A 1PZ7A 3AXEA 2D6NA 1WD3A 4M01A 1V6NA 4RL7A 3QLQA 5GLUA 1LECA 1F9KA 1N3PA 1W0OA 3AP7A 3MW2A 3WDUA 3ZXEA 1WLWA 4Q27A 4XOGA 1EPWA 1YIFA 4Q8KA 4YZ2A 5GZCA 4YM2A 3PMEA 5JOYA 5IK8A 4FOYA 2AGSA 3NV3A 2V5YA 2ZGLA 1CPMA 3M1HA 2P37A 5H9PA 2NP0A 2VY0A 2RHPA 3OJBA 1KRIA 1N1SA 1WW7A 1N3QA 3ZXFA 5GLWA 1KITA 1DBNA 2DUPA 2ZA9A 3ZXLA 4GA9A 4YG3A 5IK5A 1ULFA 4PBPA 1D2SA 2EXHA 3O12A 1GANA 5HCBA 3GALA 5LK5A 5CNAA 5E89A 1BXHA 4KBBA 1DYKA 1DQ6A 1FATA 1S0IA 2C9AA 3BOPA 4Z8BA 1W6PA 1Q8SA 3NV1A 2DVGA 3ILNA 2GNTA 3WUCA 3AJZA 2P3KA 3IKWA 4L8QA 4YW4A 3FFZA 4BLJA 1LU1A 4PBOA 4YZ4A 4XZPA 1DGLA 3W58A 1GV9A 2TEPA 1WD4A 2OUHA 1GZ9A 3N35A 4YZ1A 2ZHKA 4DPNA 4AYUA 2EALA 3B01A 5T52A 4YM3A 4FPKA 5DUWA 2H0BA 4DRVA 4DFSA 1IS4A 4XBQA 4Q1RA 4XJZA 2DVAA 2DVFA 3O0VA 5T5OA 1DZQA 2WKKA 3PVNA 1CQ9A 1KJLA 1W6OA 3B00A 4GWNA 4LBKA 4WZFA 1SLAA 5JVVA 2LALA 4YM1A 2ZMNA 2W08A 3QCWA 1C4RA 1AX2A 4Y22B 3DUIA 5DZEA 3AZYA 1SACA 1MS3A 4NO4A 3H0OA 1V00A 1SBFA 2DURA 5CA6A 3ZSKA 3N36A 4SLIA
chains in the Genus database with same CATH superfamily
4NN0A 3VLBB 1FV2A 5BYNA 4P00B 2OS2A 1A3KA 4PLOA 4D94A 4XCAA 3VD3A 4K1YA 3WQ0A 1QOOA 1TE1B 3ZX7A 1DZRA 5JXHA 1H8TC 1GNHA 1LHVA 2V4AA 1UU5A 3VZKA 2R041 3KVBA 1DG6A 1QQP3 3OGVA 4RYDA 2X09A 2VNOA 3NAPB 5EIYB 1OH3A 3RRDA 2VZQA 4CYDA 5C70A 1ASJ2 3B69A 2UYAA 3ZPYA 3QH7A 4GALA 5D8AB 2FDFA 1F8VA 1L3JA 2CWSA 3B02A 5FZ7A 3FLRA 2PA7A 2I74A 5K8SA 1BHGA 4JGZB 3VBSC 3AL5A 1O7FA 5FUNA 2XBO1 4WZCA 3DL3A 5G04L 1JHJA 1GFF2 1LHUA 2BGPA 1LU2A 5JI7A 5CFDA 1RTVA 1DYOA 4Z82A 5A32B 1FOD2 1RUC2 2RJKA 4AFDA 1TZOA 1FPN2 1CD3G 4QGNA 3ZYBA 1AX1A 1HQNA 1HV1A 1HQLA 2KD7A 3ZYJB 2UU8A 1RUI2 1FV3A 4LOSA 4E4DX 3JD72 3B93A 1W3VA 4LO7A 5JR7B 2I07B 2HKXA 3Q8BA 5F3IA 1W2NA 1W2TA 5FZEA 3VHRA 5IK7A 2Q1MA 4LHLA 2D3SA 2R062 2RJLA 2WDBA 5FP3A 4CCLA 2VOVA 3V64A 4LUMA 3HT1A 2JDAA 1BK0A 1XSQA 2DCTA 2BVBA 3LD8A 1CAWA 3QH6A 4CEWC 2BRTA 5FOBB 4WV8A 4OI0A 2AREA 2E9QA 2Y34A 4GWMA 3LFIA 4W50A 3ZXEA 1JUIA 1H1IA 1IS5A 1X9TA 1HKDA 1YQ6A 2NLRA 3GBWA 3MICA 4IUGA 4Q4X1 2Q8EA 2VULA 4CDUB 3UV9A 2VE1A 4XETA 1QNWA 3PUIA 3ZFFA 2EAAA 3ASIA 4EN8B 2HWD2 3LWCA 4QGLA 1RUG3 4GAZA 5IVEA 4M4PA 1RIRA 5KC6A 4XZUG 1OSGA 1QH7A 1VRH1 3ENRA 1AL22 3MZHA 4WM8A 2J1TA 5CKNA 2FZ1A 2NPIA 1H8TA 5JZGA 5EP9A 3BGAA 3OOXA 2D6KA 3H9AA 3POGA 4PCRA 1MS1A 4HONA 3T3YA 2JD4A 2O8OA 1LEMA 1EY2A 2RS52 4AFBA 4UYBA 3M3CA 4JGZC 2WT0A 2D3RA 2E51A 2LM3A 3M2MA 3O14A 3KQRA 1UIJA 4FTBA 1QH6A 2NZ9A 1HW5A 2BNMA 1J1TA 2CV6A 4AW7A 3DXUA 4KG8A 4DY3A 5FZ3A 3PIJA 3UKTA 1HX6A 1H9WA 2AEZA 2W0XA 4XUTA 2HBTA 3AP5A 5FMOL 2EVXA 1BYHA 1MPXA 3OGJA 1U0AA 1E5IA 1JH5A 1L7RA 1OA4A 3S57A 3IT8A 2ZEZA 2VUCA 1US2A 1JOBA 1RUF3 2CNAA 5JPMB 5JMOA 2J22A 2BW8A 2Y0OA 4JGYC 4PI2A 4D6SA 2W92A 1R082 4BH9A 2WRAA 5L73A 2HWC3 2X29A 4NPRA 1GWMA 3TEWA 5FYHA 1M4WA 3ZSJA 4AWDA 3JD73 1RUI3 4Z2WA 1LOAA 1VBC3 2GMPA 3AVSA 1DFQA 4MXVA 5KHIA 5GZFA 2HWF1 1VBC1 1I3HA 2ZGQA 5BNOA 4OUSA 4FPOB 5T5JA 1MS8A 2D93A 2ZEYA 4LHSA 3HAGA 4QT6A 4TSVA 4AEJA 2WQZC 3RZLA 5K9YA 2QTWB 2J1AA 3ON7A 2A5ZA 5JPNB 3MIDA 2DU1A 4YG6A 3CBNA 5CEHA 3KHBA 3C2UA 2YC0A 3N9NA 2JXAA 4R4XA 2JG8A 2ZX0A 3OB8A 4ONUA 2DTYA 4IE6A 3ITQA 2B9VA 2JEMA 5FZ6A 2P4EA 2VZVA 1RVF3 1KJRA 1ULOA 2QQIA 3J9SA 1YIPA 5A3PA 4MVTA 2ZAHA 1QGLA 3D4KA 4OI2A 2GH8A 4KG0A 1JS9A 1RVF1 3IZOA 1DCSA 2BDRA 1D4M1 3POSA 4J1XA 2VW1A 4FFIA 2WO7A 3DCQA 3WDTA 1JZ4A 4LO4B 2BOIA 2HJIA 3Q9OA 4CP1A 5D8AA 1CESA 4FFGA 4Y26A 1BLZA 1WKYA 4Q0QA 4YGDA 3IDBB 4JGZA 4XJAA 2ADDA 1ZA7A 3N9OA 4IGPA 4HK8A 1U5ZA 3J7LA 1G7YA 3MV01 3U10A 1QOSA 4B3NA 4B8EA 3H3ZA 4PIXA 1AR91 3DEMA 4COUA 3AYEA 5LY1A 1XPWA 3ABZA 1RINA 4LHNA 4IE4A 3WQ7A 3WEZA 5EJ1B 4C1WA 1ZZ9A 4IE0A 1DHKB 1W6MB 1CAXB 2D6OX 4K9SA 2PHFA 1SLTA 3TN93 1GKBA 1H2NA 1RUD3 1F35A 3LFMA 5L9BA 5JXIA 2ZEXA 3O1OA 4WVVA 1IQDC 2Y60A 1JZ5A 1XNCA 2RS13 1VR3A 4BIFA 1FT9A 2GNMA 3LEKA 3BI3A 1OKQA 1PMHX 1W8TA 1FOD1 1H2MA 1GP6A 1RUC1 2P6HA 3IN9A 2W87A 4V1PA 4GQ7A 1JZ3A 2PHDA 4NIDA 1X82A 2BBVA 2QDNA 1KS4A 5L9RA 2XJVA 3CKHA 2IXHA 3LA3A 5LA2A 4Y1YA 4YZ5A 1EUUA 4QWNA 5BPXA 1V6OA 3WUDA 5A3UA 5AC91 1VB2A 1HRI3 5CU1A 5C8CC 5M0TA 1PVC1 4AQSA 4XIOA 5A1FA 1J1LA 2XBO3 2P17A 4BJ0A 1V6KA 3LKJA 3ZDVA 2D6LX 2ZJCA 2P3YA 3RI9A 3RNSA 3I2OA 2FDIA 3TRSB 5CBLA 3AMQA 1VAVA 1W9TA 3VKFC 1Z7S2 3OD0A 2JB8A 1R1A3 1YEWA 3IDAA 1FNYA 1SDDB 4QDRA 5J48A 4FSJA 2TNFA 1XB9A 3C7EA 3MIEA 3I3EA 1COV2 2IXKA 2VZSA 1AR63 5GLZA 1R1A2 3I54A 3VL8A 4COWA 1W2AX 3INAA 4LBLA 5C8CA 1Q8QA 1OQ1A 5F2WA 2D44A 2LS6A 1HN1A 5B4XA 4LKFA 5I0DA 4QXKA 4LNVA 4I30A 3GHNA 4ZU5A 1S2EA 3VN4A 2AZ5A 1WMXA 4FP2A 5FIXA 1D0GA 2G4IA 4UFLA 4AI8A 1OA2A 3OPWA 4CDXC 2WSVA 2BU9A 3THPA 2JE7A 5FZLA 3L2HA 3FWEA 1RUG1 2O14A 1ONAA 2WYFA 2VU9A 1E57A 3MIGA 4OFGA 2XLFA 1RUJ1 3HWJA 4XFAA 5FPZA 3BIEA 1PO22 4FXKB 2ZEWA 3POWA 5FYVA 2WNEA 2X10A 3TN92 3FHIB 3CJIB 3WP5A 4AVAA 5FTTC 4GB31 3N7MA 2RS33 3VHOA 1FI2A 2OQ6A 2WYSA 4YVSB 1OFNA 1GMMA 3QBQA 1YI7A 5IVFA 4XXAA 5FXZA 2A6VA 4TTGA 4IXLA 4LJHA 1UPSA 1UY1A 2PLV2 2Q4SA 3WP4A 3U78A 4HL0A 4MADA 3MLKA 1OF3A 4QB6A 2Y33A 5T5PA 2XQXA 1X50A 3KSCA 3WP3A 1WCKA 2AUYA 1CX1A 1ZBE2 1CAUA 3VZMA 4GJZA 3LAGA 4RA0A 4K1ZA 4UOJA 1MQTB 3GNEA 3ZIWA 1O3SA 3BPSA 1RHI1 2MEV1 2JG8B 3CLPA 4K20A 4KU8A 3RI8A 1QNYA 4NHLA 4BPZA 4BQ2A 3HR9A 3ZMNA 3F95A 1LB2A 4XF0A 3RPQA 3OBZA 1HJFA 4MHUA 2DF7A 4D6QA 1GSLA 1H6YA 1RUJ2 2QBXA 4FOQA 2A3XA 3LA2A 4CSWA 3N9LA 5I0TA 1GNZA 4PDWC 2VZUA 4HLTA 5CVRA 3WF1A 5A70A 2PN5A 4RGAA 2WZEA 3C7OA 3ETPA 3JZVA 5A33B 3I97A 2BOJA 2RR12 3WF3A 1KDKA 4LO8A 3BTXA 3D82A 5SV8A 3ZXGA 1ZRDA 4HZFA 3T0BA 2FZ2A 2ERFA 1KFUL 3I4IA 4Y5TA 4EN7B 2SLIA 3MUY1 1KS5A 1A78A 1NAEA 1OVSA 1TMF3 2ZBJA 1W6MA 4G4FA 1CAXA 3UGFA 3CMGA 3W59A 4GKYA 4Y5Z0 1WA4A 2PAEA 2PHXA 2EAKA 3KWVA 4FPLA 4LBMA 4XACA 3R6SA 3ZSLA 4FTSA 1OD5A 1R092 1XE0A 4GB32 2IXLA 1KXGA 2YBPA 3J7NA 4LA2A 2WO3A 4WM7A 5EYXA 3MIHA 2VMEA 2XJTA 1MEC1 2ZZQA 1O4ZA 5IJRA 4UW4A 2MEV2 3X29B 4CRQA 2R1BA 1UL9A 2RJ2A 2J7MA 4L9BA 1PHMA 4M0HA 3T08A 1UOBA 3WG1A 4P9XA 4V2WA 3FHQA 1C5IA 1HV0A 1U5XA 1QJFA 1WLDA 4SBVA 2E53A 1A8DA 2UURA 2ZCWA 4IEWA 3HN3A 2Q8DA 2VW0A 1H0BA 1ZBA2 2XWBB 2JKBA 2YXSA 3BN6A 1BEV2 4D3WA 1GR3A 1PNFA 5KHJA 1DQ2A 1JYIA 1UY4A 2ADEA 4AXOA 4Y20A 3O0WA 3RMYA 4RFRB 1NLSA 1QDCA 2RS53 5FYZA 3ZYFA 4CU6A 2VNRA 3DYMA 4S2FA 3AFKA 2E63A 4MYEA 5FFOC 2BPA2 2RS51 4GH4A 1PZ8A 5ABJC 1UOJA 3WDYA 5A7NA 2R072 2DDUA 1AR62 2JIJA 3SH5A 4AQ6A 4HK9A 2J42A 4F8AA 1C8M2 4E4HA 3MV11 5CADA 1Q56A 3I3DA 2Q30A 4QX2A 3N9MA 1ZRFA 2RS11 4QD2A 1H2LA 1MS9A 1W3XA 1ULEA 4HSJA 4HVOA 1VRH2 1WLTA 4XDQA 2BWCA 5H9SA 1HXS2 3ZXKA 1S0GA 5J37A 1Z7S1 5C8CB 4XF3A 2HWD1 5FJHA 4GZ9A 2YZ4A 2OIIA 2YFZA 3NNJA 3WCSA 5FZIA 3ZR5A 3BVCA 2XVKA 3MLJA 3U37A 3VGIA 2VGDA 2PELA 2WUHA 3T2QA 1X7NA 4MGZE 5A7OA 4QM9A 1I5ZA 3WNXA 4NWVA 4JDOA 1CPNA 1NLQA 3ES1A 4BQ5A 4CCEA 4U36A 1PZ7A 2XVLA 5ANQA 3THTA 3CIHA 2OZ6A 4RL7A 4A2UA 3RZHA 3FHAA 2D40A 5C5UA 4CCCA 2CGPA 5D21A 4E2QA 1JI6A 3PNAA 5G05L 3DN7A 4TN7A 3UT0A 5GZCA 5JOYA 3W5NA 1AR61 4CCMA 3CJIA 2ZGLA 1UKRA 1CPMA 5FO9B 3KS7A 3OJBA 4YVSA 1N1SA 4CXWA 5GLWA 1KITA 2ZA9A 2YDEA 3PU3A 4YG3A 2R30A 3H7YA 4PBPA 5A3TA 2YHJA 2DCKA 2EXHA 4META 4LPLA 5HCBA 4CDWC 5KHHA 5JSOA 1A6CA 3QOPA 3WNKA 4AAXA 1POV3 4TLFA 3PJYA 4Z8BA 2W3JA 1CAUB 3GYDA 3URFA 5K0UC 4XF1A 1ZBA1 2GNTA 1GP5A 1MQTA 4L8QA 4AQTA 4BLJA 5FO8B 4ARXA 2DBIA 2VXJA 3TEXA 1GOGA 2C9KA 2TEPA 1WD4A 4XAAA 1H4HA 2OUHA 1AR82 4IE5A 4O65A 3MDPA 5IVJA 2RMU3 4AYUA 2EALA 3B01A 5HI0A 4B1LA 3G7DA 1YHFA 2V09A 4JX0A 4JQTA 1J83A 3O0VA 5FZ9A 3USSA 2WKKA 4LBKA 3JB8A 4AHZA 4GWNA 2J1EA 2QVSB 2XONA 5FAXA 5A33A 1ND2C 1QJU1 2B39A 2ZMNA 3WINE 1AX2A 2ORZA 3GZTB 4NO4A 1HRV1 3T2PA 1UYPA 2EIDA 3H0OA 1MZFA 3LZZA 4N53C 1X9PA 2X5IB 2C26A 4KWLA 3VBFB 1DGWX 2WWUA 4A3ZA 4IV3A 5LATA 3QACA 1FXZA 3TYJA 4TLGA 5JOWA 1O6UA 3PURA 4IEZA 4IV3C 4MH0E 1XNBA 2WJSA 2ET1A 3OGSA 4BLIA 3H8RA 2OYZA 2VVEA 1AR72 4WM7B 1ZZCA 3FMGA 4CCJA 5FWJA 2DUOA 4ITCA 3ZFEA 4IEVA 4YG0A 1SFNA 2I45A 1BBT1 2XL7A 2PQQA 4ZZ8A 4URAA 1QHDA 3ZFEC 4GWJA 2JDPA 1PIV3 4HT1T 5CB7A 1LTEA 4UW6A 3OBTA 3E1F1 2IXCA 3AKRA 1OLMA 4AL9A 3EQEA 1XU2A 4AEDC 4Y20B 2XL9A 3AMNA 3DYOA 1IS6A 5HV4A 2ZX3A 2B4KA 1RUE1 4GMP1 4UBHA 5FLJA 3GZAA 4GH4B 5BNNC 1IKQA 2A6WA 3ZYPA 4Q8LA 2B5HA 1X8MA 2HWB1 1OLRA 4JRAA 1VBE2 1AYM2 2YYOA 5HCAA 1AL23 1N3OA 1X8EA 2ID4A 2XMLA 3ZN4A 2WR9A 4QKFA 3M3IA 2Q8CA 1YFYA 1STMA 3LDKA 1RUG2 2ZGMA 3HMYA 3VHNA 4Z07A 2K46A 4RSUA 2IWGB 2JE9A 4MOAA 1LOBA 4AFCA 2OPKA 3BB6A 1CAVA 1QEXA 1VBB2 4AEDA 1VBA3 5KHGA 3PVBB 4QB1A 1FMD2 2IZWA 1WW5A 2A7AA 4BYYA 1VIWB 3IIAA 3VKLA 3J7MA 2A3YA 5ERLA 3GJAA 4MSVA 4FFFA 2G19A 4X6QB 1CIWA 3AMPA 2R063 3UKNA 3LPFA 5IWFA 2XJPA 4A4AA 5IUQA 5LEJA 4UAPA 5DDJ2 5D1IA 4NRMA 2HWE2 4EWDA 1SEFA 1OMIA 4RS5C 3MPBA 5F5IA 2B8MA 4Q4W3 1Q8VA 2CSGA 2WS91 4FQZA 3PTYA 4Q4Y3 4ZPIA 2XGXA 1LGBA 4ZXEA 4AFMA 4GD4A 1RUI1 4MGKE 1OUXA 2CAVA 2FDGA 4DO0A 3TNQA 1W8HA 1PZ9A 1VE0A 1RMU2 2ZMLA 1OOPA 4TZDA 4DB5A 3PVOA 1O5UA 4LORA 4CCOA 2GC0A 3VBOC 3H8OA 2C1FA 2B7YA 5L7OA 4QQ2A 1PVXA 3AYAA 1VMJA 2CGNA 1VAMA 5CYYA 1UIKA 5I91A 1ALYA 3I2DA 3ZXAC 4F83A 1FMD3 1APNA 3FZ3A 1VP6A 4I3PA 2DWRA 4FPFA 5ABJA 2ZOEB 1JN2P 1RMU1 4BIOA 3KV4A 3GGLA 4ASMB 4CXYA 1HXS1 1HB3A 3K4ZA 3RZZA 1BVP1 1W8NA 3PUHA 3ZYIB 1GLHA 4NRQA 4AGGA 1LAJA 1NLRA 2FCUA 2Y6KA 5E6HA 1U12A 2BFUS 4XPVA 4YM0A 4AAPA 4ES8A 3LF7A 5LA0A 4C1XA 2D3PA 3L9JT 1OQEA 1S0DA 2JIGA 4RD7A 2WQ4A 2R073 1H9PA 4WVMB 3RDIA 1QJY3 1Z78A 2YUEA 4I0WB 1QIQA 5FXWA 4B1MA 5CKQA 1QU0A 2ZTNA 4GH4C 3DXTA 1YQ8A 1H30A 2VQ0A 1C1FA 2VQAA 2X5IA 4FBFA 3VBFA 2JDMA 3D5OA 1JXNA 3VB9A 4IV3B 2RR11 5F3GA 3VL9A 1ZBA3 4X8PA 3H50A 2Q1FA 1RUD1 2VM9A 3D6EA 5JLVA 3CHXA 4GKXA 1QQP1 3R4UA 5FMOS 2JG9B 4FAHA 5AVPA 5LA1A 2B45X 1UKGA 4FPCA 3ZFEB 2WFF1 3MUZ1 4AVCA 5IAXA 1FNZA 1AYM1 2UY8A 5D8AC 4LKDA 5C9AB 4LBQD 3U4XA 1AXZA 2W47A 3AB0A 4Q0UA 3V56A 2VOXA 2TBVA 1CX4A 3HIFA 3KT7A 2HWE1 1RHI2 1HB1A 5IW0A 1NXMA 1GWKA 2NMNA 2O8QA 5A7WB 2XH6A 4F7ZA 3ZKUA 2XVGA 1JZ2A 1W2UA 5C7GA 2DV9A 2Y6FA 1DLCA 3B5LB 4XVHA 2XWJB 4GIQA 2ZGTA 4IV1C 4CUGA 3RZGA 2QKDA 3CZJA 2G9GA 2PLV1 3K48A 5E88A 1WBLA 2PHTA 5FCCA 4XQWA 3GM8A 2DUQA 4S2DA 3WW1A 4BU2A 4CXXA 1XNTA 4K7JA 1NA1A 2BV4A 2K9ZA 1YFXA 3H1MA 4BK4A 4EZHA 4RQPB 2RV9A 4XFFA 1V6IA 3T0AA 2IVJA 1WUVA 2D98A 2ZS6B 3J8F3 2YV8A 1SPPA 4ZU4A 1VBD1 3RG0A 5FLIA 4EV0A 3KF3A 1N47A 2CL2A 4M0NA 4BB3A 3UNPA 4L97A 1AXYA 1M06G 1RXFA 2JJ6A 3WT3A 2AACA 4LT5A 2IUWA 4HKOA 2EIBA 1VBE1 2JX9A 3KMHA 4QPGC 1CAVB 2KR2A 3WF0A 4AEDB 4DXSA 1O4YA 3ZN5A 3PUSA 2SBAA 1W8FA 3ZXJA 5EWSA 1NXD1 2X5IC 4QB2A 4Q4V3 1Y7BA 1XC6A 2DYCA 4W6WA 5A1LA 2R16A 4V2VA 1IS3A 4TXWA 5IYYA 1XSRA 2OPWA 5J96B 1UN1A 3LOBA 2HWB3 4PLNA 2D97A 3THCA 2WZR2 2ZHLA 2OA2A 3FL7A 2EXKA 3LA7A 4QXHA 3WDWA 5IAVA 4K40A 5GZDA 5IVCA 2D43A 1ZA4A 3UJOA 4AG4A 5A7SA 1Y4WA 2CTVA 1UMHA 1AR71 3C8XA 4AEKA 4YM3A 1OOPB 2DFBA 3CJIC 3KT1A 5JSPA 4I3GA 3VDCA 2PHUA 2WNOA 3EYPA 4ORFA 5JDBA 5L7OB 1YFWA 4ZKTB 5F2SA 2JDKA 4NE9A 2GU9A 2E6VA 1V70A 1F15A 1XNDA 4R9DA 4UT5A 5EZWA 2VTXJ 3HNBM 3ME2A 4JHZA 3MF6A 1AYN1 1RUF1 5ABJB 3PIGA 2VBPA 2ZHMA 3B9CA 1QJU2 1U5IA 3J8F2 2Z5WA 3EHKA 3VZLA 5JMCA 1LHWA 4M4RA 4O61A 4XURA 1LCLA 4PHZA 5C71A 4PT6A 5DG2A 1WBFA 1H1MA 1UMZA 1YJLA 1KFXL 1XYOA 3JB4C 3NQHA 2W1UA 3OTFA 2ZZJA 3W9AA 1G9CA 1JYTA 3ETQA 1ENSA 3H1YA 4OLLA 1NQJA 4UFIA 5DZFA 4BCUA 4CVUA 2YY1A 1GICA 5LZ6A 5EFUA 3WG4A 4LK6A 5ANNA 3FJSA 3TNPB 5KXEA 4WVMA 5C3SA 3WW2A 1OHFA 3T4VA 1UX7A 3UL2A 1W0NA 1S2BA 4FPHA 5E1RA 3JCIA 4QPYA 3A7QA 4IEPA 4UI9L 3OBRA 5AC93 4BQWA 2CAUA 2KM2A 2PYTA 5KR7A 1QJEA 2HH9A 2Y6LA 4P14A 4E27A 2FCVA 3ILFA 4YGBA 3KT4A 2QQPA 4BK5A 1LHNA 4KI5M 1V6JA 2ENRA 4K3UA 2OKXA 2PFWA 3GXUA 1K3IA 2GN7A 2YG0A 4LTAA 1UYZA 1QWRA 2JG9A 2GMMA 2ORXA 4NAOA 1D4M3 1YQ5A 2HYKA 5FZ8A 2GNDA 2QQMA 2QQOA 3H42B 3UYJA 5FLHA 2GAUA 2VZ3A 1EUTA 2XB6C 2ZX2A 5FZHA 3C7FA 5C9AA 5F9TA 1LULA 2RDNA 5DAPA 4LEJA 4HVRA 1O8SA 1W6OB 3SHRA 3CU7A 2OZJA 4YRDA 3VDDB 5A7WA 4A3XA 1UOFA 2ZACA 2VBDA 3J4UH 1OUSA 5FZ1A 1PM4A 5E8AA 2WO1A 3S0MA 2ZGPA 4OUEA 2H0VA 3AP4A 1PK6A 2ETEA 3M7AA 1DQ5A 3T0DA 2JENA 3K4DA 5FOJB 3ZSMA 1ULDA 3RJRA 3WP6A 4LXLA 1AX0A 3KV6A 4OZOA 4Q4X3 1NA1B 3AZZA 4RQPA 2WWJA 2XKPA 4RGKA 5F37A 5A3OA 4H55A 4IEXA 4QHBA 5CKMA 3RS6A 3U1XA 1RUJ3 1SPPB 2XPJA 4I0BA 2UWBA 3EJKA 4PDWA 3K75B 4NIIA 3IBMA 4NROA 3RGBA 3O1UA 3OUJA 1YFUA 3A4UA 1H4GA 1SFYA 2ARBA 5LK7B 1PGL1 4LOTA 3SXWA 3WVJA 4XYXA 2YFUA 4XW3A 3T1MA 5A7PA 4AF9A 1HIXA 4AGRA 1IGOA 3USUA 2FD8A 3OGGA 4XFGA 1C1LA 1MS5A 5FP7A 3K2OA 2C0ZA 4N8MA 1UX6A 2VC9A 4OMCA 4PQ9A 3RZJA 2D6PA 1JYWA 2FMYA 5JCTA 4IV1A 4GULA 1JYCA 1YQCA 5E16A 2WLPA 4N53A 4BHPA 3NNFA 4QX1A 2PLV3 4DNYA 2Y26A 2CYFA 2AR6A 4MGYE 2NM1A 3MW3A 4XF4A 4RS5B 1XBFA 3H3UA 3JBG3 3ZOIA 1R1ZA 4FPGA 4DUVA 1K12A 1PGW2 4Q0PA 3RQ0A 4XHXA 1MVQA 2PTMA 4YW1A 2WZPP 1NX9A 2P2KA 2RDSA 3C7HA 4JKMA 2BGOA 3I8TA 1QXRA 2QDRA 1LGNA 5FXVA 2J1VA 3U14A 2AENA 3AMHA 3OUIA 4OI1A 4CA9A 1JODA 2ZKNA 1DGRN 4Q1PA 2K0GA 4BZ4A 1WZXA 1U5YA 4CDQC 4XBLA 5A3WA 3RZMA 4QMAA 1FYUA 2H6BA 4BQ1A 1Y43B 3ZMOA 4PI0A 4CE8A 4J1WA 2VPVA 3PUQA 2CDOA 5SV5A 1PMJX 5FK7A 4A42A 1VBB3 1OFSA 1GYKA 1WCUA 2HWF3 2ZKLA 4JDNA 4ASLA 4AVBA 1JZ7A 1V6NA 3HT2A 1QY4A 3QLQA 4COYA 1F9KA 1N3PA 1PO13 1W0OA 3CEWA 3AKQA 4HBNA 5FBJA 2YC4A 4IGOA 4XOGA 1EPWA 3T2OA 5FPBA 2YGMA 5LRSA 3PMEA 2WA4A 1COV3 4FOYA 2AGSA 4E9KA 1IG0A 4CEWA 5FK8A 2VY0A 2RHPA 5C3QA 2WA3A 4LK7A 3GJBA 3MIFA 1W04A 1YQ2A 1WW7A 4KH9A 4L92A 3H7JA 3EBRA 2X8KA 3OF1A 1DBNA 3P6BA 3ZXLA 4EN0A 4GA9A 5KC5A 5IK5A 2VQTA 1UCXA 4LUKA 2BERA 5FZGA 4X8NA 2PQSA 5LK5A 5CNAA 2XBO2 1FATA 1S0IA 1RHI3 2C9AA 2WN2A 5CISA 1A34A 1W6PA 1ZZ6A 4QPIB 1C8NA 1E5RA 4YW4A 2P3KA 5FPUA 2VMDA 2ILMA 4YZ4A 1XE8A 4XZPA 5LBCA 3W58A 3FBMA 2Z2SB 4IESA 5BNNB 1GV9A 3RZKA 1WCQA 3M4FA 1GZ9A 2QUOA 3KZ4C 4PQQA 3Q8FA 4R8HA 4FPKA 5DUWA 3U11A 5EPAA 3TN91 1GOHA 4DRVA 3H8XA 4DFSA 1IS4A 4XBQA 3NRUA 5FY7A 3OCPA 2DVAA 1V9U1 2VMFA 2CGOA 4QHZA 1HN0A 4B4QA 1W6OA 5AFBA 1SQ4A 3NAPC 4HSLA 5JVVA 3FFQA 4YM1A 3VDDA 3QCWA 2W08A 4CPBD 5A3LA 5BY5A 5FBZA 5C6CA 1FOD3 1NCRB 1RUC3 4FXGB 4AZZA 2JDUA 1MS3A 3D0JA 1XYPA 1V00A 3WNLA 1PVC2 1SBFA 2DURA 2W46A 3VBHC 5CA6A 1PK6B 1UD1A 2B46X 3ZSKA 4QXCA 5FMCA 1ENXA 3ZM8A 5FQ0A 3E5XA 1K5MB 1UZYA 5FPVA 4EN9B 1XNAA 4LE3A 1MEC3 2ZX4A 4XAEA 4XC9A 4XTMA 3S7EA 3SCFA 3VBUC 2FCTA 2Z79A 1G86A 2XUEA 2XDVA 3HPNA 3NJVA 1BQPA 5K4LA 1R64A 2WS92 4QU1A 3GDBA 4XE9A 3LEIA 1QQP2 1EV11 2D6MA 4FOWA 4PDWB 3VZNA 4G3YC 3T09A 4A41A 2ZGKA 2BJSA 2PHRA 3WD5A 5EYYA 1F2NA 3LEMA 4YW3A 4C91A 3W20A 2VUJA 5CG8A 2VMGA 3S7IA 5FY8A 1ZM1A 2WABA 3AZXA 4H3WA 3USUB 4W65A 1I1EA 3IB3A 1AR92 1UNBA 1GZWB 5EQUA 4IV1B 3H1WA 2F4PA 2V72A 2O1QA 4N53B 4DQAA 4YSFA 4HMZA 5L9VA 3BU0A 3K51A 3N4MA 4P9YA 1AUYA 2UWAA 5FZAA 1O5LA 1XQNA 1KGYA 4RS5A 1UZWA 1OA3A 4XHBA 1O4TA 4HG6B 2FDJA 3E6BA 3WCRA 1UPIA 4MZUA 4B29A 4RR3B 5C4WB 4ARYA 2E7AA 5F39A 4CEYC 2JWPA 4BQYA 1VRBA 3SCHA 4DMIA 4DY5A 4N9IA 1S4CA 1RUF2 4YW5A 3WDXA 1RUH1 5K7PA 5I0UA 2R0FA 3VD5A 2E7TA 3OSDA 4BMEA 3S5AA 5LBFA 4JTOA 3WX5A 4E8CA 3NKGA 1AYN2 4DOUA 1PK6C 3NSTA 2GALA 3IM0A 3MPPG 4PF1A 5GZEA 1JOPA 4MGSA 4A44A 2OX0A 3GCXA 3BU7A 2BZDA 1TEIA 3LE0A 1BMV1 5DXDA 1HXS3 2WNUA 2EICA 4NRPA 4B7KA 3KHCA 4YW2A 2P3IA 3NV4A 1LOCA 3F2ZA 1W06A 1CONA 1VJ2A 4FOVA 4NHMA 5FMDA 2BQPA 1C8M3 3VDBA 4P9IA 5I8SA 1RGSA 3WG2A 1GWLA 4QX7A 1JYVA 1OT5A 1Q8PA 4B4PA 1PGSA 1TQ5A 4CEWB 1QDOA 3E5UA 2AH2A 1PGW1 3EXUA 3MF9A 4AI2A 5I0SA 1BBT3 3RJ2X 1QJY1 5KXDA 4EE2A 4YZ3A 1BEV3 3MW4A 2VZRA 2QCSB 2GC2A 2Q5TA 3PLQA 2HWF2 4NWWA 1GUIA 4UBGA 1HLCA 4AEMA 1HB2A 1GNYA 2BFUL 1QOTA 1W6PB 2P34A 2YPDA 4QPIA 3AKSA 4I0AA 3ZFFC 1W9WA 3GHMA 1TMF1 3A22A 4F3JA 2RMU1 2Y64A 3WY6A 5FYCA 3CDZB 3N9PA 3R0RA 1MACA 5FKBA 4ATEA 5BNNA 1D0HA 3POBA 2V73A 1PX4A 5I8TA 3FE5A 4JCKA 1NY72 2W95A 1JZ8A 2JG9C 1A8MA 1O91A 3PMSA 4XFBA 1R093 3SC7X 3POIA 4ET7A 3OBAA 5EHDA 1N1VA 1NOVA 5J7MA 5A7QA 4PIYA 4QPGB 2OUJA 1J84A 1NY71 1UY0A 3T2TA 5A1AA 2W1QA 5HXVA 4KWUA 1V6LA 3SITA 1CZTA 1OLQA 4N7UA 5J36A 1FPN3 5KXBA 4YW6A 1ND2A 5IK4A 1NCRA 5FZFA 3NV2A 4QQHA 3MGUA 4U2AA 3SMHA 5A6XA 5KWRA 1VBA1 2CU5A 2WBKA 4IQPA 2QQWA 2JICA 1EAH1 4QHOA 4UW5A 3FLPA 3ZPOA 1ULPA 4AQ2A 4JVAA 5FQ0B 5FP4A 2P1BA 1K5MA 5F5AA 4FTEA 1LKNA 4Q29A 3V0AA 2JD9A 4NIHA 1UYYA 1VALA 2DCJA 2ES3A 2NYYA 5HCFA 3ROUA 2VZTA 2CDPA 3GCWA 3MO4A 3Q8EA 2A75A 4Y1VA 3VD7A 4AGVA 5HCHA 3GBFA 2ZAAA 4PIZA 2IFRA 1AR83 1UWWA 1VPHA 4N43C 3S5QA 2QFEA 2JDNA 2YPJA 1OPMA 3I2JA 3RSJA 1SLLA 2WS93 2BEOA 3W21A 2FQPA 3WHTA 5DQ0A 4XMAA 1IHMA 4LBNA 2Y8KA 3WF2A 4E4ZA 2QQKA 3TBDA 2WNVB 3G6JB 5FYUA 2QQVA 3BCWA 4Q4X2 1SCRA 2GMEA 2WLQA 2K2SA 2VNVA 3NVCA 4ZZ5A 3VBOB 1ND3C 4M3CF 1GZWA 5DAQA 2VZ1A 4QQLA 3SEEA 3UESA 5A3NA 3KCYA 5DMYA 2I2SA 1F4AA 1OKOA 1QKQA 1WA6X 1DYPA 5C33A 5BUVA 2UY9A 1JW6A 4M00A 5DABA 1RUH2 1V6MA 3CO2A 4YVWC 5IFTA 1UYXA 3AZVA 3ZYHA 3ZLIA 3KQ4B 3BPZA 3I2IA 1O8PA 2VD7A 1R1A1 2WN3A 4RR3A 5C4WA 3R4DB 4CTEA 3TEZA 1PO23 1KQRA 1HJGA 2C24A 4LHKA 1GZCA 2JDHA 3MYXA 5FY4A 3V0BB 5A6ZA 4P02B 4ZHNA 2EA7A 3R4SA 4D69A 1IPSA 2ATFA 1T6GC 5DPNA 5LY2A 4DXRA 1D4VB 3UGHA 5FZCA 4LBQB 1QXPA 1T2XA 3WG3A 4BXFA 2VTXA 3WW3A 3AYDA 3IAPA 3AKPA 4RHV2 1DGWA 3DF0A 4GXLA 2OW4A 5A80A 4PF5A 3M3OA 3TEYA 2XR4A 2YU2A 4HKLA 2VCCA 3CQOA 4Z1VA 1CIYA 1AJOA 3L2YA 3MEPA 3O1RA 2WNUB 2J1SA 3HN1A 1RC6A 3SNMA 4JC1A 3IDCB 3QD6A 3J26N 3U07A 1XOYA 1V0AA 4LULA 5FDBA 3PJQA 4IL7A 3HQXA 2ZGRA 2IC1A 4JHTA 1WLCA 4RQPC 3AC0A 3N7JA 2R043 3BIWE 5I93A 2YGLA 4QM8A 1H8VA 2YC2A 3U0ZA 2FDHA 1PO12 4FVVA 5C3RA 2WT2A 1MS4A 2C5DA 3FLTA 5FYYA 1O3TA 3O5SA 1JUHA 4OZXA 5DDJ1 1ENRA 4YPJA 1QJU3 3A0KA 3OEBA 1ZZ7A 2A73B 1FAYA 2VOWA 3LCPA 1AHSA 2VUAA 1WMDA 3I2FA 5H9RA 2VH9A 3VBFC 4OQ8A 3O1VA 3JQWA 1J59A 2F4LA 1TG7A 3HQUA 2ZPXA 2VAUA 3IDEA 1GQGA 3NO8A 4QPIC 1IZ3A 1NCQC 5DUVA 3PUAA 4UFHA 3MIBA 1TME2 4D8MA 5FP9A 1S0EA 1G6NA 2RS12 3R05A 1POQA 4M3CE 3VDAA 3NNGA 2WO2A 4OYUA 2GC1A 4L99A 1C8M1 4R4ZA 3ZXDA 4KWKA 5A3MA 3P5BA 3WF4A 2W1SA 4YLZA 4QAWA 1BJQA 4Y24A 2R071 3HNYM 3J8F1 4YWAA 1TMF2 4QPGA 4XABA 1LOEA 2GC3A 4IEYA 4R9AA 3ZO0B 4PJYA 3JBG2 4P9JA 4LLFA 1ND3B 1ZZ8A 1NT0A 2HWB2 4BQ3A 4D6RA 4UWDA 1TNRA 4EWEA 3LB9A 2G9FA 4I02A 1ND2B 3RVHA 2IXJA 3E5QA 1IOAA 5LRRA 4Z92B 2VOKA 2W94A 2QNKA 3O7OA 1VLNA 3VDDC 1QJX3 2RR13 4KL1A 1VB4A 2VJXA 4FP3A 4Q4V2 5FXXA 3GF6A 1UAIA 1UOGA 4BOWA 3A21A 5L7OC 1UZZA 1ACCA 1O3QA 5J98B 1MZ5A 4ASKA 1NZCA 2VCBA 4MHRA 3HVDA 1DGRA 2J1RA 1WW6A 3V0AB 2LTNA 2EF6A 3MFCA 3VBUB 1DQ4A 4LIVA 4ZS2A 5T50A 4AVSA 2E7QA 2ARXA 3KVAA 1RVF2 4HANA 1AL21 1RUE3 3BKZA 1O3RA 2PAMA 1YO8A 2JECA 1CWPA 1KEXA 1R091 5F32A 1MS0A 3DGTA 5C8WA 2XUMA 3SCGA 2WL1A 3ATGA 4AI1A 5F1RA 1W9SA 4OHYA 4NIGA 3WOGA 1ZBE3 2DVDA 3FBYA 2WNVA 4XF9A 4XUQA 5JXGA 1X36A 3ALQA 2BNOA 4MLOA 4EQVA 2XHNA 4MO3M 3P3NA 4AVVA 4CDWB 2WZ8A 4IETA 3VBOA 4YARA 5FR3A 2RM22 3ACHA 3AP9A 3B3QE 5FZKA 2C6SA 1EAH3 1CJDA 3EMRA 4BDVB 5CFDC 1LEDA 2ZGUA 3DYPA 4MX3A 1VBC2 2G9ZA 4RGGA 1XJAA 2PAKA 3KGZA 1S0FA 3JBG1 3WXPA 2P3JA 1Z0HA 3POJA 3BTZA 2HWC2 4IEOA 4QX8A 5AVAA 1MQTC 4CP2A 3OD4A 5EJ3A 1OF4A 1DQ1A 4CP9A 1CJPA 1JYXA 3JD71 1UZ0A 2D5HA 1AR81 2WAOA 4Y3OA 5FPAA 4CUCA 4LO5B 4Q4Y1 2GZWA 3N7LA 3V0BA 2O0OA 2Q1ZB 4FPYA 1TME3 4S2GA 2IFWA 3S30A 3TOJA 2YROA 4TWTA 3IMNA 2NMOA 4LBJA 4LBQA 4E2SA 1TME1 4FAGA 4CPBA 1EP0A 4Y4RA 4MXWA 4ZONA 3VV1A 4COVA 1S0JA 1YJKA 3ES4A 2EXJA 4URTA 4YVSC 4M3CA 4E4SA 4INDA 2Z69A 2HEVF 4OHWA 3UGGA 5LEKA 5FY1A 1GBGA 4W8JA 1UU4A 3M8LA 3SH4A 3TAYA 5JIAA 5FUIA 5LASA 4D7TA 5AC92 4DZGA 3Q8CA 4XUOA 3VBHA 1ULGA 1SLCA 1Y9GA 3BODA 3OUHA 4HVQA 3V65A 4BISA 1YXWA 1QJY2 2VMIA 1LRHA 1PX3A 5ACA1 2LW8A 4XILA 1W8OA 4QQPA 3VBRB 1BZWA 1WGPA 4NHKA 3HD8B 2R042 2Y0IA 3J7HA 3NKTA 3WSOA 3FUOA 4AI3A 3A23A 4XUPA 4OHXA 3IWZA 4QQOA 5H9QA 2BYVE 3W5MA 4MG2A 3MHZA 4LITA 2Y6HA 1IKPA 2XLGA 1L7QA 1JHNA 3PDQA 4FPEA 4TYSA 3UK9A 5DUUA 3PU8A 1G9FA 4FO9A 5CG9A 3KCXA 3UJQA 1H1AA 4NUBA 3O0XA 4MGIE 3CNAA 3AL6A 3WLUA 5J09A 3I49A 4AVTA 5F7UA 1ZRCA 4CDQB 5JXJA 3KV9A 5B2GB 1W8UA 4RHV3 1WMFA 1AYN3 2R1DA 3WNNA 3AXDA 3ZN6B 5JSRA 3ACIA 2HEWF 1K5JA 5C3PA 1UW8A 5F3CA 1DQ0A 5K0UB 2X53S 2VVDA 1JU4A 5DAVA 1Q43A 3NMBA 3KCCA 1AL0G 5GLUA 1LECA 4NVPA 2LROA 1WLWA 4Q27A 4DXTA 1RJ8A 3DKQA 5FZBA 4ES9A 1OOPC 1CZVA 2WFF3 5IK8A 2W5FA 3NV3A 2V5YA 4H7MA 4KBZA 4XUNA 3RYKA 3WNPA 1DU3D 4XQ4A 3ZIXA 2HYXA 4WBBA 1F5JA 1QXJA 2Y6GA 1KRIA 1ND3A 1N3QA 5DDJ3 5FPLA 4G9SB 3U75A 3RFRA 3ZXFA 2DUPA 1NG0A 1SFPA 1ULFA 4HN1A 1ZZBA 5LWBA 5F8PA 1GANA 1HRI1 4A45A 1WMEA 2EIEA 4IGQA 3WNMA 4CU7A 1IG3A 5E89A 1BXHA 4KBBA 4MGQA 1DQ6A 3BOPA 1ODMA 3D8CA 4LKEA 3ILNA 3WUCA 4QU2A 3AJZA 3FFZA 3VBUA 4PBOA 2E26A 2JG8C 3N35A 1LR5A 4YZ1A 2ZHKA 1NE6A 1GU3A 1OH4A 3ORJA 4XEZA 5HBAA 2YB7A 1REEA 4OVEA 2PXJA 2QQJA 3BOWA 2L9LA 4H14A 4C0BA 2KXLA 4Q1RA 3I2HA 2DVFA 1DZQA 2J1UA 1CQ9A 1KJLA 3B00A 5L36A 1VBE3 1NUKA 5BNOC 2LALA 2HWC1 3KGLA 4XFIA 1C4RA 4CDWA 5KHKA 5FY5A 1RUOA 2QQNA 4FT8A 1RL3A 4ZY9A 1S55A 1DDLA 3NL1A 1J3RA 2ZXQA 3N36A 2VO5A 4L0PA 4SLIA 5JOXA 1UY2A 2EXIA 1AVBA 3AX4A 4FQ4A 4LR4A 2VQUA 4UFMA 5FUPA 1W6QA 4Y1ZA 1ST8A 1WW4A 4EROA 5AFEA 1PIV2 1K5MC 4JV4A 5LBBA 1GP4A 4CP9B 5GALA 3PL0A 1NQDA 1W9FA 4R9CA 2NQYA 4UXAA 1QJZA 4P5YA 5BNPA 2W68A 4KGGA 1H6XA 3H8UA 1IQAA 4IE7A 3ACLA 5IHRA 5FZDA 1UO9A 4DRRA 5C5TA 1AR73 3K3NA 4XCBA 3ZFGB 4CEYB 2RS31 4O7XA 3ZKYA 3NJYA 1SCSA 4MXWB 4L2NA 1B09A 3BTAA 3MBWA 3NJZA 1X33A 4M3CB 3SQOA 4Q2FA 3I2KA 2E32A 2VZOA 1URXA 5FPXA 4OUMA 4IW3A 4XJUA 3UETA 2ARCA 2CY6A 4HOOA 1W28A 4AHWA 1SBDA 1W90A 4HETA 3PVEA 3VBHB 1PGL2 5EXOA 4KU7A 3DPRB 1XNKA 1W03A 2OT7A 1Q8OA 3JU9A 2MHFA 4XIKA 3VBRA 3AFGA 4AK3A 2N7GA 4JTNA 1SMVA 3GZUC 5F6KA 3GBGA 1CVNA 1RUNA 4IERA 3T1LA 3JXSA 1YI9A 1JU3A 5FRAA 4FI9A 1H2KA 4WM7C 4RR3C 5C4WC 3O1PA 2XQRA 5C9AC 1RYYA 2W2IA 3H3LA 1DZTA 3AKTA 3WQ1A 3DV8A 1IPKA 3OPTA 1POV0 2CWMA 4E2GA 1W8WA 1I9RA 4C90A 4A7ZA 1JMUB 4ISQA 3BTYA 3KM5A 2WC2A 5T54A 3DECA 3VD4A 3HJRA 4CDQA 2X05A 3LSDA 2FBEA 4EN6B 3OYWA 4WVWA 3ZN6A 1AZDA 3I7DA 5LCWL 3POFA 1ZNPA 2ZGOA 5FWEA 5K0UA 5IT6A 2FMDA 2W91A 3AYCA 4XJ9A 2DBNA 4N9HA 1LHOA 1PO11 3N9QA 5ACA3 1HQWA 3PTRB 2ZX1A 3AZWA 4K8FA 4BE3A 2ARAA 5GJ6A 4AI0A 1UY3A 3LEGA 2WQ8A 3OGRA 1COV1 1UMIA 1RMU3 3T30A 1W0PA 1W6NA 5CAZA 4LLOA 3DKWA 4N43A 4P9WA 2WFF2 2R6QA 3B94A 3SKJE 5FYTA 2WINB 5JI9A 4JGYA 2LUWA 3OY8A 4Q4W2 1G9DA 1LOGA 3APBA 1UU6A 1HB4A 1FPN1 4UFKA 5FZMA 3HBKA 5FYMA 1O59A 5ACA2 4AR2A 3LDRA 5FREA 4OQ9A 5CIRA 4RHV1 4DS0A 1AR93 4DUXA 1RXGA 4XXPA 3WZ1A 4N90A 3RYRA 4S2HA 5FZOB 4XDPA 1EYBA 2JKXA 3WDVA 4YFWA 3K46A 4H2AA 3CF6E 1ASJ3 3O1SA 4O9EA 1OXCA 2BTVC 3HOBA 5CZKA 1XU1A 2WAAA 3A0NA 4XMIA 4YFZA 4YVWA 1SBEA 5APAA 1SZBA 1RB8G 4XFHA 3FX3A 4J25A 4CZSA 3OPZA 1V9U3 4QDSA 1VRH3 3WNOA 3T4HB 1MEC2 4IEQA 1DIWA 4RN5A 4B7EA 5JZGC 4YNIA 1LESA 2G1MA 1ZVFA 2OXBA 2W52A 2XKOA 1AYM3 4BMBA 4ZU7A 5IVYA 5F6LB 4MUVA 1VMHA 2NN8A 4A7KA 4A7YA 1PVC3 1EPZA 1YCIA 4BM8A 4I2OA 5LW9A 1QMJA 5DAXA 2HEYF 1REDA 1OPOA 4XJWA 3RMXA 4OHVA 3CZUA 3VKMA 5T5LA 3EB7A 1Y9QA 2VTFA 3IPVA 4QXBA 1G9AA 4WVZA 4UW3A 1N1YA 1LGCA 3P3PA 2RG4A 4Q0SA 2YU1A 4FPJA 5IATA 1VAKA 1HDKA 1W6QB 2R0HA 4OHZA 1PNGA 4DUWA 5IVBA 1DP0A 4GMP0 2XG3A 1EV13 1ZYBA 4O9GA 5KXCA 1YRZA 1AXKA 4YGEA 2JDZA 5F5CA 1YWKA 5BNPB 3AK0A 1D2QA 3BYWA 4WM8C 4QKBA 4YGCA 4QKNA 2MEV3 2GP5A 4NHYA 5B4NA 2BBAA 3JQXA 2VXRA 3M70A 5FP8A 5LB6A 4RFT0 3E6DA 4XJ8A 1RJ7A 4CP0A 4CEYA 3ZFGA 1NCRC 4EYUA 1JBCA 3HEIA 2PHLA 1RITA 4FFHA 3TB0A 1UXXX 4D0QA 4Y5SA 5GKAC 4AHXA 5DZGA 3VZJA 5BV6A 1US3A 2XJUA 2MNGA 5C3OA 3O1MA 2QQUA 4J6GA 1POV1 1VBB1 2ET7A 3AM2A 5BXXA 4K8RB 2A3WA 3POYA 1E5HA 2GP3A 3B7MA 3VBSA 3DPRA 4Q26A 2A1XA 2BNNA 2UWCA 4XFCA 4DEQA 5KBFA 2KA3A 2W1WA 4OI4A 1S1AA 1LODA 2VMCA 5IFPA 3TWIA 1ULCA 4MV2A 1OI6A 2IVIB 3FN9A 3BUCA 1YUDA 1AJKA 2HBUA 4QX3A 3NNLA 4JAAA 5DG1A 1R081 3ILRA 1AF9A 2PMWB 4QX5A 5FZ0A 2Y38A 4OCTA 4ATFA 2RMU2 1ZREA 1F5FA 1RUE2 2C4XA 4JQRA 5JWPA 1JYNA 1S2KA 1SDWA 3LPGA 3MI8A 1UQXA 5CFCB 4Y1XA 1SLBA 2FDKA 3I3MA 5A6YA 1XRUA 2Q0AA 2A6XA 3CL1A 3OYWB 2PHWA 3SISA 1HRV3 2WSUA 2W39A 4JKLA 3SKVA 2E33A 1XE7A 2D7FA 1XYNA 1QJX2 1SLIA 5FYBA 1NE4A 4AI9A 4Z2AA 4COZA 2A71A 2XOMA 4NAMA 4UFJA 5JR2A 4BA6A 3ST7A 2WNUC 4DEVA 3ELNA 2DVBA 4ISRA 4Y1UA 3M3EA 3ACFA 1VBD2 2GSYA 2DU0A 1W6NB 5T3NA 2Y6JA 3OG2A 1VBD3 3Q8AA 4H7LA 4HPKB 4N43B 2QE3A 5FKCA 3WV6A 5GZGA 3IIIA 1PIV1 2P5BA 3HNMA 3N3HA 4LA3A 4YYOA 3RWNA 4BQXA 5I8YA 4JGYB 4DINB 4JRLA 3OY8B 4HN0A 1I6XA 1OURA 4LMFA 4OMDA 5EV7A 5F5QA 1BMV2 1K42A 3HQRA 4R9BA 2ZGSA 1W8ZA 4QGMA 4KQ7A 1NYWA 1P8JA 2YBSA 2EIGA 1TNFA 1GQHA 2BGCA 2XHKA 4GMP3 4CCKA 5LBEA 3WQBA 1TVGA 3KV5A 4Q4V1 3IAQA 5FZOA 3I2GA 4AOCA 2BVVA 5JAXA 1C57A 1C5HA 3M3QA 3VD9A 2VCMA 2QZ3A 4CDXA 1UF2C 2XJQA 4IDZA 5FZ4A 3ZSEA 1W99A 4NHXA 1NCQB 1Q5OA 2A70A 3FC0A 2WT1A 3K3OA 3KD4A 5BNPC 4KNCA 4YVWB 4YW7A 1OC1A 2E31A 3RYPA 2VECA 3FUQA 3I59A 5JIUA 2QZ2A 1ODNA 2VBBA 3K77A 4C8DA 1PMIA 3MFAA 2D5FA 5FYSA 4NOTA 2GN3A 1OVPA 3ZVXA 2F17A 2FHRA 1J58A 2YBKA 4NPLA 5GM0A 4XBNA 4R52A 1WCSA 2DTWA 3I3BA 5ISLA 2RVAA 2ZGNA 4K6BA 2ZMKA 1OQDA 3LDBA 3ACGA 1I5PA 3BALA 4DXZA 3PHMA 5GLTA 3IPVB 5JOZA 1MZEA 4P9GA 2VVFA 4IEUA 2XXZA 1ASJ1 1HRI2 2DCZA 4Q4W1 3WW4A 2MPFA 1W9YA 1Y3TA 2TUNA 2VOTA 1KDMA 2RDRA 1LOFA 4LIUA 1Y9MA 4K21A 1NZIA 4CUAA 4L11A 5DUXA 4A6OA 4CU9A 1ENQA 2VG9A 5L19A 1LOFC 3E97A 4NJ4A 1D4M2 1GOFA 3P1IA 4LO6B 3ZYRA 4XTPA 1BKZA 5HXMA 1J3QA 4DIQA 3C3VA 1EV12 1L7LA 1D7PM 3SEPA 4QX0A 1JTZX 1LNSA 5TSWA 1B35A 3NNMA 4BQ4A 4UF0B 4GB33 2LRPA 1RUD2 1MR5A 3WHUA 4I01A 2AYHA 4JZRA 1B35C 5EJZB 2Z4FA 4HKWA 1RUH3 2DCYA 4Y22A 2RDQA 1FMD1 4ZS3A 2P6CA 3NWKA 2RM21 1E5SA 4LBOA 3VKNA 4OULA 1EAH2 1F31A 4LE4A 2RM23 4C0HA 1G9BA 3VBSB 1JOJA 2B42B 2JDYA 5T55A 2JB4A 4P5HA 5D2AA 1MVEA 2BUKA 4QKDA 3VHPA 1CR7A 1QF3A 5J3UA 2A6ZA 1S0CA 3LIGA 2B9UA 3JUUA 1S0BA 1SHWB 2BWAA 1VMFA 4ZXKA 3WR0A 4A6SA 2F6BA 5I0RA 5HPOA 1V9U2 3VUOA 1ZRRA 1DF0A 2R32A 2VCAA 1BK1A 2R49A 2WNVC 3LGRA 3NAPA 2GDFA 1LENA 4LKSA 4W4ZA 1K45A 1OLME 3LSEA 1MZ6A 4Y4YA 1OBNA 5CFCA 5T5OA 1W2OA 2H6CA 2YMZA 4E8DA 2ZABA 4QDQA 4GWIA 2V5DA 4CUBA 1BEV1 4KGQA 4Y33A 3D3AA 4AFAA 3AP6A 1T6BX 3AMMA 4CCNA 4X6RB 1XXNA 3POEA 3KLSA 2OQ7A 4KWJA 2ZHNA 1BVVA 5CFDB 4D7YA 2JE8A 3RWKX 3SH3A 2Z42A 1YLLA 3EO6A 2AC1A 3ECQA 3LOIA 5FY9A 4NIAA 5A32A 1BCXA 2XLAA 1KD7A 4Q4Y2 2VW2A 2VZPA 4NMIA 4Q0VA 2RS32 2OVUA 3CJXA 1YYNA 4HPKA 2WZR3 5FMBA 5FY0A 1GQPA 1DLLA 2GH2A 1CZSA 2QQLA 1G8WA 2HWE3 3SLIA 1FX5A 1LJ7A 1R083 1J3PA 2WZR1 1N1TA 3KB5A 3NJXA 3OEAA 1CN1A 4FCAA 5GLVA 3NW4A 4BWOA 2A6YA 3AJYA 1CAWB 2VUDA 1ZRIA 3IMMA 1ZBE1 3ZYGA 4EZ4A 1HRV2 3VKOA 4EWAA 1W05A 3S6PA 2HLEA 1UZVA 3N7KA 3GZEA 2BP6A 4P9LA 1VBA2 5FO7B 1JZ6A 3UKVA 2WFPA 2GNBA 4CDUA 5DAWA 3B9IA 4CDXB 3ZFFB 3LIHA 3AXEA 1WWYA 1NCQA 2D6NA 1WD3A 4M01A 4N7IA 4CDUC 2VNGA 1BBT2 4NPMA 1PM7A 1NA1C 3I59B 2Q8OA 3VBRC 3MW2A 3AP7A 3WDUA 2R061 4XDOA 4B4RA 1YIFA 4WM8B 2WWSA 4Q8KA 4YZ2A 1H8TB 4JDMA 4YM2A 5JZGB 5DN2A 3M1HA 2P37A 5H9PA 2XJRA 1C3HA 5LA9A 2NP0A 5JUVA 1YNAA 2CHHA 4HFSA 4AE2A 1QJX1 2AEYA 3ZR6A 5CFCC 1Z7S3 2HWD3 3K4AA 1OD3A 4LQRA 1D2SA 2DFCA 2W9XA 3O12A 1F4HA 4PLMA 4Q5OA 3AVRA 1IPJA 3GALA 2VMHA 2WIIB 4W6YA 1ZX5A 4P08A 4MGTA 1DYKA 4D7SA 1CGPA 3THDA 2RE9A 1Q8SA 3MLLA 3NV1A 2DVGA 3KF5A 3O1TA 5FYIA 1UXZA 5HV0A 2QJVA 4AHYA 3IKWA 4EJRA 1LU1A 4NR1A 4JKKA 1DGLA 3DPRC 3LQCA 5FV3A 4KMQA 2VL4A 5FJKA 1SG3A 3HBZA 4GJYA 4DPNA 2R7EB 2XJSA 4I09A 5T52A 3D0SA 4XQDA 4W6XA 3E6CC 2H0BA 2UYBA 5F3EA 4XJZA 5BNQA 5A6QA 1B35B 5IVVA 1NKGA 1REFA 1PO21 4UF0A 3PVNA 3VZOA 4BXSV 1GZTA 4WZFA 2IXIA 4CCDA 1SLAA 4HXCA 5J1XA 2VR4A 4CU8A 3U4SA 3ZFGC 3ZDSA 1WCDJ 4Y22B 3DUIA 3I3QA 2V4VA 3AZYA 5DZEA 5BNOB 1SACA 4QPWA 1W39A 1Q3EA 3C7GA 1YC61 1C28A
chains in the Genus database with same CATH topology
4NN0A 3VLBB 1FV2A 5BYNA 4PLOA 1A3KA 4D94A 4K1YA 3WQ0A 1QOOA 1TE1B 3ZX7A 1DZRA 1H8TC 1GNHA 1LHVA 1UU5A 3VZKA 2R041 1DG6A 1QQP3 2VNOA 3NAPB 3RRDA 4CYDA 1ASJ2 3B69A 2UYAA 3ZPYA 3QH7A 4GALA 5D8AB 1F8VA 1L3JA 2CWSA 3B02A 3FLRA 2PA7A 2I74A 5K8SA 4JGZB 3VBSC 1O7FA 2XBO1 4WZCA 3DL3A 1GFF2 1LHUA 1LU2A 5JI7A 5CFDA 1RTVA 4Z82A 5A32B 1FOD2 1RUC2 2RJKA 4AFDA 4QGNA 1FPN2 1CD3G 1AX1A 1HQNA 1HV1A 1HQLA 3ZYJB 2UU8A 1RUI2 1FV3A 4E4DX 3JD72 3B93A 4LO7A 5JR7B 2I07B 2HKXA 3VHRA 5IK7A 2Q1MA 4LHLA 2D3SA 2R062 2RJLA 2VOVA 3V64A 4LUMA 3HT1A 2DCTA 5FOBB 2BVBA 1CAWA 3QH6A 4CEWC 4OI0A 4WV8A 2AREA 2E9QA 4GWMA 1JUIA 1H1IA 1IS5A 1HKDA 2NLRA 4Q4X1 3GBWA 3MICA 2VULA 4CDUB 3UV9A 4XETA 1QNWA 3ZFFA 2EAAA 3ASIA 4EN8B 2HWD2 3LWCA 4QGLA 1RUG3 1RIRA 5KC6A 1OSGA 1QH7A 1VRH1 3ENRA 1AL22 4WM8A 2FZ1A 2NPIA 1H8TA 5JZGA 2D6KA 3H9AA 4PCRA 1MS1A 2JD4A 2O8OA 1LEMA 1EY2A 2RS52 4AFBA 3M3CA 4JGZC 2WT0A 2D3RA 2E51A 2LM3A 3M2MA 3O14A 3KQRA 1UIJA 4FTBA 1QH6A 2NZ9A 1HW5A 2BNMA 1J1TA 2CV6A 4AW7A 4KG8A 4DY3A 3UKTA 1HX6A 1H9WA 2W0XA 3AP5A 5FMOL 2EVXA 1BYHA 3OGJA 1U0AA 1OA4A 1JH5A 3IT8A 1RUF3 2CNAA 5JPMB 2BW8A 2Y0OA 4JGYC 1R082 4BH9A 5L73A 2HWC3 2X29A 4NPRA 1M4WA 3ZSJA 4AWDA 3JD73 1RUI3 4Z2WA 1LOAA 1VBC3 2GMPA 1DFQA 4MXVA 5KHIA 5GZFA 2HWF1 1VBC1 1I3HA 2ZGQA 5BNOA 4OUSA 4FPOB 5T5JA 1MS8A 2D93A 4AEJA 4QT6A 3HAGA 4TSVA 2WQZC 5K9YA 2A5ZA 5JPNB 3MIDA 2DU1A 4YG6A 3C2UA 2YC0A 2JXAA 4R4XA 2JG8A 2ZX0A 4ONUA 2DTYA 2JEMA 1RVF3 1KJRA 3J9SA 1YIPA 4MVTA 2ZAHA 1QGLA 3D4KA 4OI2A 2GH8A 4KG0A 1RVF1 4J1XA 1D4M1 3POSA 3WDTA 2VW1A 1O3SA 4LO4B 2HJIA 3Q9OA 4CP1A 5D8AA 1CESA 4Y26A 4YGDA 4Q0QA 3IDBB 4JGZA 4XJAA 4HK8A 1U5ZA 1G7YA 3U10A 1QOSA 4B3NA 4B8EA 3H3ZA 4PIXA 1AR91 4COUA 3AYEA 1RINA 4LHNA 3WQ7A 4C1WA 1ZZ9A 1DHKB 1W6MB 1CAXB 2D6OX 4K9SA 2PHFA 1SLTA 3TN93 1GKBA 1H2NA 1RUD3 4WVVA 1XNCA 2RS13 1VR3A 4BIFA 1FT9A 2GNMA 1OKQA 1FOD1 1H2MA 1RUC1 3IN9A 4V1PA 4GQ7A 2PHDA 2BBVA 1X82A 2QDNA 1KS4A 2XJVA 3LA3A 2IXHA 4Y1YA 4YZ5A 5BPXA 5AC91 3WUDA 1V6OA 5C8CC 1VB2A 1HRI3 5CU1A 1PVC1 4AQSA 4XIOA 1J1LA 2XBO3 2P17A 1V6KA 3LKJA 2D6LX 2ZJCA 3RI9A 3RNSA 3TRSB 5CBLA 3AMQA 1VAVA 3VKFC 1Z7S2 3OD0A 1R1A3 1FNYA 5J48A 4FSJA 2TNFA 3MIEA 1COV2 2IXKA 1AR63 5GLZA 1R1A2 3I54A 3VL8A 4COWA 3INAA 4LBLA 5C8CA 1Q8QA 1OQ1A 2D44A 4QXKA 4LNVA 4I30A 3GHNA 4ZU5A 3VN4A 2AZ5A 4FP2A 1D0GA 2G4IA 4AI8A 1OA2A 4CDXC 2WSVA 3THPA 2JE7A 3L2HA 3FWEA 1RUG1 1ONAA 2VU9A 1E57A 3MIGA 4OFGA 2XLFA 1RUJ1 3HWJA 4XFAA 5FPZA 1PO22 4FXKB 3POWA 2WNEA 3TN92 3FHIB 3CJIB 3WP5A 4AVAA 5FTTC 4GB31 3N7MA 2RS33 3VHOA 1FI2A 4YVSB 1OFNA 3QBQA 1YI7A 4XXAA 2A6VA 4IXLA 1UPSA 2PLV2 2Q4SA 3WP4A 4HL0A 3MLKA 5T5PA 3WP3A 1X50A 3KSCA 1WCKA 2AUYA 1ZBE2 1CAUA 3VZMA 3LAGA 4RA0A 4K1ZA 1MQTB 3GNEA 3ZIWA 1RHI1 2MEV1 2JG8B 3CLPA 4K20A 4KU8A 3RI8A 1QNYA 4NHLA 4BPZA 3HR9A 3ZMNA 1LB2A 4XF0A 3RPQA 2DF7A 1GSLA 1RUJ2 4FOQA 2A3XA 3LA2A 5I0TA 1GNZA 4PDWC 4HLTA 5CVRA 2PN5A 4RGAA 5A33B 3JZVA 2RR12 1KDKA 4LO8A 3D82A 5SV8A 3ZXGA 1ZRDA 4HZFA 2FZ2A 2ERFA 1KFUL 3I4IA 4EN7B 2SLIA 4G4FA 1KS5A 1A78A 2ZBJA 1TMF3 1W6MA 1CAXA 3W59A 4GKYA 4Y5Z0 1WA4A 2PAEA 2PHXA 2EAKA 3R6SA 4FPLA 4LBMA 3ZSLA 4FTSA 1OD5A 1R092 4GB32 2IXLA 1KXGA 4LA2A 5EYXA 4WM7A 3MIHA 2XJTA 2ZZQA 1MEC1 1O4ZA 4CRQA 4UW4A 2MEV2 3X29B 2R1BA 1UL9A 4L9BA 1PHMA 4M0HA 3WG1A 4P9XA 1C5IA 1HV0A 1U5XA 1WLDA 4SBVA 2ZCWA 2E53A 1A8DA 2UURA 4IEWA 2VW0A 1H0BA 1ZBA2 2XWBB 2JKBA 2YXSA 1BEV2 4D3WA 1GR3A 1PNFA 5KHJA 1DQ2A 1JYIA 4AXOA 4Y20A 3O0WA 3RMYA 1NLSA 1QDCA 2RS53 2VNRA 4S2FA 3AFKA 2E63A 4MYEA 5FFOC 2BPA2 2RS51 4GH4A 1PZ8A 5ABJC 3WDYA 2R072 1AR62 4AQ6A 3SH5A 4HK9A 4F8AA 1C8M2 5CADA 1Q56A 2Q30A 1ZRFA 2RS11 4QD2A 1H2LA 1MS9A 1ULEA 4HSJA 4HVOA 1VRH2 1WLTA 4XDQA 2BWCA 5H9SA 1HXS2 3ZXKA 1S0GA 5J37A 1Z7S1 5C8CB 4XF3A 2HWD1 3WCSA 2YZ4A 2OIIA 2XVKA 3MLJA 3VGIA 2VGDA 2PELA 1X7NA 4MGZE 4QM9A 1I5ZA 3WNXA 4NWVA 4JDOA 1CPNA 3ES1A 4U36A 1PZ7A 2XVLA 3THTA 2OZ6A 4RL7A 4A2UA 2D40A 2CGPA 4E2QA 3PNAA 3DN7A 5GZCA 5JOYA 1AR61 3CJIA 2ZGLA 1UKRA 1CPMA 5FO9B 3KS7A 3OJBA 4YVSA 1N1SA 5GLWA 1KITA 2ZA9A 2YDEA 4YG3A 2R30A 3H7YA 4PBPA 2YHJA 2DCKA 2EXHA 4META 5HCBA 4CDWC 5KHHA 5JSOA 1A6CA 3QOPA 1POV3 4TLFA 3PJYA 4Z8BA 1CAUB 3GYDA 3URFA 5K0UC 4XF1A 1ZBA1 2GNTA 1MQTA 4L8QA 4AQTA 4BLJA 5FO8B 2TEPA 1WD4A 1H4HA 2OUHA 1AR82 3MDPA 2RMU3 4AYUA 2EALA 3B01A 5HI0A 3G7DA 1YHFA 2V09A 3O0VA 3USSA 2WKKA 4LBKA 3JB8A 4AHZA 4GWNA 2QVSB 5FAXA 5A33A 1ND2C 1QJU1 2B39A 2ZMNA 3WINE 1AX2A 3GZTB 4NO4A 1HRV1 3H0OA 3LZZA 1MZFA 4N53C 2X5IB 4KWLA 3VBFB 1DGWX 4IV3A 3QACA 1FXZA 3TYJA 4IEZA 4IV3C 4MH0E 1XNBA 2WJSA 2ET1A 4BLIA 2OYZA 2VVEA 1AR72 4WM7B 1ZZCA 3FMGA 2DUOA 4ITCA 3ZFEA 4IEVA 4YG0A 1SFNA 2I45A 1BBT1 2XL7A 2PQQA 1QHDA 3ZFEC 1PIV3 4HT1T 5CB7A 1LTEA 4UW6A 3OBTA 2IXCA 3AKRA 3EQEA 1XU2A 4AEDC 4Y20B 2XL9A 3AMNA 1IS6A 3MZHA 2ZX3A 4GMP1 1RUE1 4UBHA 5FLJA 5BNNC 3GZAA 4GH4B 1IKQA 2A6WA 3ZYPA 4Q8LA 2B5HA 1X8MA 2HWB1 1OLRA 4JRAA 1VBE2 1AYM2 2YYOA 5HCAA 1AL23 1N3OA 1X8EA 3ZN4A 3M3IA 1YFYA 1RUG2 2ZGMA 3HMYA 3VHNA 4Z07A 4RSUA 2IWGB 2JE9A 1LOBA 4AFCA 2OPKA 3BB6A 1CAVA 1VBB2 4AEDA 1VBA3 5KHGA 3PVBB 1FMD2 2IZWA 1WW5A 2A7AA 4BYYA 1VIWB 3IIAA 3VKLA 2A3YA 4MSVA 4X6QB 1CIWA 3AMPA 2R063 3UKNA 2XJPA 5IUQA 5LEJA 5DDJ2 5D1IA 2HWE2 4EWDA 1SEFA 1OMIA 4RS5C 3MPBA 2B8MA 4Q4W3 1Q8VA 2WS91 4FQZA 3PTYA 4Q4Y3 2XGXA 1LGBA 4AFMA 4MGKE 1RUI1 2CAVA 3TNQA 1PZ9A 2ZMLA 1RMU2 1OOPA 4TZDA 4DB5A 3PVOA 1O5UA 2GC0A 3VBOC 2C1FA 2B7YA 5L7OA 4QQ2A 1PVXA 3AYAA 2CGNA 1VAMA 1UIKA 5I91A 1ALYA 3I2DA 3ZXAC 4F83A 1FMD3 1APNA 3FZ3A 1VP6A 4I3PA 2DWRA 4FPFA 5ABJA 2ZOEB 1JN2P 1RMU1 4BIOA 4ASMB 1HXS1 3RZZA 1BVP1 3ZYIB 1GLHA 4AGGA 1NLRA 4ES8A 1U12A 2BFUS 4XPVA 4YM0A 4C1XA 2D3PA 3L9JT 1OQEA 1S0DA 4RD7A 2WQ4A 2R073 1H9PA 4WVMB 3RDIA 1QJY3 1Z78A 2YUEA 4I0WB 1QU0A 2ZTNA 4GH4C 2VQ0A 1H30A 1C1FA 2VQAA 2X5IA 4FBFA 3VBFA 3D5OA 1JXNA 4IV3B 2RR11 3VL9A 1ZBA3 4X8PA 3H50A 1RUD1 3D6EA 5JLVA 4GKXA 1QQP1 3R4UA 5FMOS 2JG9B 4FAHA 5AVPA 2B45X 1UKGA 4FPCA 3ZFEB 2WFF1 4AVCA 1FNZA 1AYM1 2UY8A 5D8AC 5C9AB 4LBQD 3U4XA 1AXZA 3AB0A 4Q0UA 3V56A 2VOXA 2TBVA 1CX4A 3HIFA 3KT7A 2HWE1 1RHI2 1NXMA 2O8QA 2NMNA 2XH6A 4F7ZA 2XVGA 1W2UA 2DV9A 3B5LB 2XWJB 4GIQA 2ZGTA 4IV1C 2QKDA 2G9GA 2PLV1 3K48A 5E88A 1WBLA 2PHTA 5FCCA 4XQWA 2DUQA 4S2DA 3WW1A 4K7JA 1NA1A 3H1MA 2K9ZA 1YFXA 4RQPB 4XFFA 1V6IA 1WUVA 2D98A 2ZS6B 3J8F3 2YV8A 4ZU4A 1VBD1 3RG0A 5FLIA 4EV0A 1N47A 2CL2A 4M0NA 4L97A 1AXYA 1M06G 2JJ6A 3WT3A 4LT5A 4HKOA 1VBE1 2JX9A 3KMHA 4QPGC 1CAVB 4AEDB 1O4YA 3ZN5A 2SBAA 3ZXJA 5EWSA 1NXD1 2X5IC 4Q4V3 1Y7BA 2DYCA 4W6WA 2R16A 1IS3A 5J96B 1UN1A 3LOBA 2HWB3 4PLNA 2D97A 2WZR2 2ZHLA 2OA2A 2EXKA 3LA7A 3WDWA 4K40A 5GZDA 2D43A 1ZA4A 3UJOA 4AG4A 2CTVA 1AR71 4AEKA 4YM3A 1OOPB 2DFBA 3CJIC 3KT1A 5JSPA 4I3GA 2PHUA 4ORFA 5JDBA 5L7OB 1YFWA 4ZKTB 2GU9A 1XNDA 1V70A 2E6VA 4R9DA 5EZWA 3ME2A 5ABJB 3MF6A 1AYN1 1RUF1 2ZHMA 3B9CA 1QJU2 1U5IA 3J8F2 2Z5WA 3EHKA 3VZLA 5JMCA 1LHWA 1LCLA 5DG2A 1WBFA 1H1MA 1UMZA 1YJLA 1KFXL 1XYOA 3JB4C 3OTFA 3W9AA 1G9CA 2ZZJA 3ETQA 1ENSA 3H1YA 4OLLA 1NQJA 5DZFA 4BCUA 2YY1A 1GICA 5EFUA 3WG4A 3TNPB 3FJSA 5KXEA 4WVMA 3WW2A 1OHFA 3UL2A 1S2BA 4FPHA 5E1RA 3JCIA 4QPYA 4IEPA 3OBRA 5AC93 2CAUA 2KM2A 2PYTA 4P14A 4E27A 4YGBA 3ILFA 3KT4A 2QQPA 1LHNA 1V6JA 2ENRA 4K3UA 2PFWA 4LTAA 2GN7A 1QWRA 2JG9A 2GMMA 1D4M3 2HYKA 2GNDA 5FLHA 2GAUA 2ZX2A 2XB6C 5C9AA 5F9TA 1LULA 4LEJA 4HVRA 1W6OB 3SHRA 3CU7A 2OZJA 4YRDA 3VDDB 4A3XA 2ZACA 3J4UH 5E8AA 3S0MA 2ZGPA 2H0VA 3AP4A 1PK6A 2ETEA 3M7AA 1DQ5A 2JENA 5FOJB 3ZSMA 1ULDA 3RJRA 3WP6A 1AX0A 4Q4X3 1NA1B 3AZZA 4RQPA 2XKPA 4H55A 4IEXA 4QHBA 3RS6A 1RUJ3 2XPJA 4I0BA 2UWBA 3EJKA 4PDWA 3IBMA 1YFUA 3A4UA 1H4GA 1SFYA 2ARBA 5LK7B 1PGL1 3SXWA 3WVJA 4XYXA 3T1MA 4XW3A 4AF9A 1HIXA 4AGRA 1IGOA 3USUA 3OGGA 4XFGA 1MS5A 1C1LA 2C0ZA 1UX6A 4PQ9A 2D6PA 2FMYA 5JCTA 4IV1A 4GULA 1JYCA 5E16A 2WLPA 4N53A 4BHPA 2PLV3 4DNYA 2Y26A 2CYFA 2AR6A 4MGYE 2NM1A 3MW3A 4XF4A 4RS5B