2R16A

Crystal structure of bovine neurexin 1 alpha lns/lg domain 4 (with no splice insert)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
175
Chain Sequence
ATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLGKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurexin-1-alpha
publication title Regulation of Neurexin 1beta Tertiary Structure and Ligand Binding through Alternative Splicing
pubmed doi rcsb
source organism Bos taurus
molecule tags Cell adhesion, splicing
total genus 39
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r16A00
2PHRA 3AJYA 1BQPA 1DFQA 1GZ9A 1MS0A 2DTYA 2EALA 2OVUA 2FMDA 4W65A 2A3XA 4LBQB 2ZGRA 4Y1VA 2HYKA 1FNZA 1S0GA 1SLCA 2GMMA 4P9YA 2Z42A 3ZYPA 2EXJA 2D3SA 3D5OA 3LCPA 5T5OA 4JCKA 3T2TA 3ILFA 1N3QA 1SFYA 2EXIA 3APBA 3AP7A 1N1TA 4YGDA 2AR6A 2EAKA 4FVVA 4C1XA 1S0JA 2PHFA 4YM2A 3O0VA 4XOGA 5GLWA 4FOQA 3ZSKA 4LBLA 2D3RA 3IPVB 1S0BA 2ZGNA 1DGLA 1DIWA 1GNZA 4XTMA 2DUPA 1W6QA 3A0NA 3M1HA 4M01A 3USUB 5H9QA 2W68A 3T1LA 4Z8BA 4LBQD 3C2UA 4CZSA 1AF9A 4AGGA 3UJOA 1LHUA 1UAIA 4FPYA 4UW6A 1AX1A 2UWBA 4P9XA 2A6VA 2WKKA 1C4RA 2DVFA 5T5JA 4ZKTB 1C1LA 1S0CA 5F5QA 4TYSA 2ZAAA 2A3WA 1KJLA 4GA9A 3ZPYA 3M2MA 3AYCA 4ISRA 1LESA 1UN1A 2D7FA 2ZGLA 4M3CF 1RINA 2JKBA 1S1AA 2JECA 3ZYRA 1HLCA 3FLRA 4YZ1A 2UURA 3O12A 5SV8A 5L73A 4DPNA 4BLJA 4RA0A 5JLVA 3OY8B 1SBDA 3WV6A 3WVJA 2FHRA 2NMOA 4DQAA 3WG2A 2GN3A 2GNBA 4Q26A 2CY6A 4Q1RA 1A78A 4XJUA 2DTWA 1V6KA 2GNMA 2P2KA 4FP2A 4XE9A 4GWMA 4XJZA 4WZFA 2AUYA 3AP9A 1R1ZA 1ENQA 2CNAA 1LEDA 4Q2FA 3VKNA 1JW6A 1SLLA 1X50A 2JDZA 4FPJA 3OPZA 4YM3A 2JE7A 4ATFA 5IK4A 3KM5A 3M3CA 1Q8QA 4LBJA 3WDTA 1IOAA 5F9TA 1LOEA 4Q8LA 1CR7A 3WUDA 3ENRA 3AYEA 5CAZA 1KITA 4K1YA 1UL9A 2W39A 2I2SA 4R9BA 1IS6A 2D6MA 1UMZA 4FOVA 2ZA9A 3ATGA 4H55A 3PVEA 2ZMKA 3WG4A 1ULCA 3ILNA 4YW1A 5GALA 5JDBA 1LENA 2P37A 4PBPA 4FPGA 1W6OB 1N1YA 3A0KA 2EXHA 4Q8KA 5EXOA 1CN1A 1ZA4A 2LTNA 2A70A 2OUHA 1XQNA 4DRRA 1Q8SA 2PHXA 1LU1A 3RSJA 1C57A 1AXKA 2ZGQA 4XYXA 1MVQA 4FPHA 5HCBA 3D6EA 3N35A 1RITA 1PZ7A 4R9DA 3OGGA 1APNA 5DZFA 3AZZA 3SH4A 4BQ1A 5GLVA 3W59A 2ZGSA 4M3CA 5KXEA 1WLDA 2PELA 2YZ4A 3M3QA 5GLUA 2VXRA 2AENA 1QNYA 2YXSA 1WBLA 1MS4A 4AGVA 1YI7A 1YRZA 3WCRA 1DYPA 3VKOA 5DUUA 1V6LA 4PQ9A 4Y24A 1LCLA 1VALA 1SLBA 1W6NA 4FOWA 3WUCA 2VW1A 3W58A 1KDMA 3DGTA 5CBLA 3NV2A 5T5PA 4LBOA 4Y20A 3WDVA 4LBMA 2D3PA 3H0OA 4AVTA 4ZXKA 2KM2A 1SBEA 4I30A 3B01A 5JOZA 5EYYA 1B09A 3ZSJA 1I3HA 1LGCA 2BQPA 3UJQA 4XXAA 1W6PA 3WHTA 3IMNA 1QU0A 2ZGOA 4Y20B 2V73A 4ITCA 1WUVA 2WSVA 2P3IA 2R0FA 1OQ1A 4ISQA 2B7YA 3WHUA 3N7KA 1IKPA 3AJZA 3FBYA 4L8QA 1V6JA 1V6OA 3TB0A 4XMIA 3OYWB 1G9DA 4YG3A 2D43A 1LTEA 5JVVA 2DU1A 3AZYA 3RMXA 4Q1PA 3SITA 5GZEA 3BTAA 5DUXA 1QNWA 1C1FA 1CVNA 4YGEA 1V6IA 1WLCA 5IUQA 4XZPA 3ZSLA 5LK5A 3AYAA 5JOWA 1D0HA 3SLIA 4WVWA 2ZBJA 5E8AA 1BJQA 1SCSA 2DVAA 4K20A 1G9FA 2ZGKA 1LOFA 3LSDA 1IS3A 3ASIA 4WVVA 3U4XA 4U2AA 1QDOA 2ES3A 5T5LA 2WJSA 4GWNA 3RRDA 3SH5A 3NV3A 3ZXKA 2GNDA 3A4UA 2UWCA 3DUIA 4JC1A 3LSEA 2ZHLA 1GICA 3M3OA 1W6MA 4BMBA 2AH2A 3MPPG 1DQ5A 1MS1A 3AK0A 3FUOA 1AJOA 1WW5A 2C9AA 1GZCA 1RIRA 5H9SA 5EYXA 4YW5A 1GV9A 2ZKNA 5DUWA 5T55A 2DVBA 1W6QB 4HL0A 4YZ3A 4BM8A 1UX6A 5AVAA 1TEIA 1GNHA 1LOBA 4YG0A 4DFSA 2NM1A 4YLZA 2DU0A 2A5ZA 3V64A 4BPZA 1YIFA 5KXBA 1MS5A 2G4IA 4YFZA 3WDXA 3KQRA 4Y1ZA 5T50A 4XJ9A 2YY1A 3RQ0A 4XJAA 4YW4A 2A6ZA 4JRAA 3V0AA 2VU9A 4K1ZA 4XIOA 1UZYA 1VLNA 1FX5A 1SLIA 1VAVA 2ZGUA 2P34A 1WW6A 3MEPA 3WG3A 3GNEA 1J1TA 1IS4A 2D6OX 4FPEA 1CONA 3FLTA 2XG3A 4XTPA 1CESA 4YZ4A 3V65A 4GXLA 2AYHA 2WLQA 4FQZA 5T52A 2D44A 1ULEA 2CWMA 1ZM1A 3T1MA 1LODA 1S0EA 2ZGMA 3BIWE 2A7AA 1HQWA 1S0FA 3HN1A 1WCSA 3WOGA 3OJBA 2WNEA 4PBOA 5DG1A 1JUIA 2A75A 4DRVA 4Y22A 4C1WA 2GMPA 4YGBA 1DBNA 4XILA 1KDKA 5GZFA 2Q5TA 2ZHKA 1D2SA 5GLZA 1W0OA 2GDFA 2R49A 4LBNA 1JOJA 3L2YA 3IN9A 1LHVA 5DG2A 2DV9A 4UW5A 4KBBA 1DZQA 2ZMLA 1AX2A 3N7LA 3JUUA 3AZXA 1SCRA 3TAYA 1F9KA 2NP0A 3VKMA 1MZ5A 3ZSMA 4HANA 1A8DA 3VKFC 4XBQA 1JBCA 1FV2A 4YG6A 1DLLA 3HMYA 4BMEA 3GALA 1UPSA 2ENRA 1Y7BA 1MS9A 4MYEA 5DZEA 1FAYA 4BLIA 1JN2P 2R1BA 1ENSA 1ULFA 1V6NA 4XXPA 1G9CA 5IK8A 1FNYA 3FLPA 2TEPA 4XMAA 4YZ5A 1SACA 2A6YA 3QLQA 3MW3A 5GZGA 5HCAA 3AP6A 1U0AA 2D6PA 2E51A 1FATA 3NWKA 4M3CB 5FREA 1F31A 3NV4A 4SLIA 2E7QA 1LGBA 1LOFC 1QF3A 3NV1A 5KXDA 4GALA 1AXYA 3FFZA 2E6VA 1IS5A 3WDYA 2W52A 1VAMA 1GKBA 1Q8PA 2ZZJA 3AP4A 5GZDA 2JJ6A 4XBNA 1QOSA 1N3OA 2EF6A 3QCWA 2ZHMA 3B3QE 1KJRA 2AGSA 4R9CA 1W6NB 4YM0A 5GLTA 1AZDA 1I1EA 3PVOA 1DQ2A 2DYCA 1GBGA 4FQ4A 4OZXA 4XBLA 2WSUA 4ATEA 2UWAA 1ULDA 1G8WA 2NZ9A 3R4UA 3WG1A 1Q8OA 2ARXA 2E53A 2V5YA 5H9RA 4YZ2A 2ZGPA 1W6PB 1YYNA 3POSA 1GYKA 1PZ8A 4FP3A 4Y26A 1MS3A 3BOPA 2NMNA 3O0XA 3N7MA 5CNAA 5T54A 3ZXEA 1CJPA 4YW3A 1MS8A 2ZHNA 1GZWA 4LBQA 4NOTA 2ZMNA 1LGNA 1SLTA 2OUJA 2R0HA 2VW0A 4XDQA 1N47A 5BYNA 4Y1UA 5CA6A 2OW4A 2DUQA 2DUOA 1DQ0A 2JD4A 2D6LX 4K21A 1N1SA 4DS0A 1KQRA 2C5DA 2EXKA 1ONAA 2ERFA 2P3JA 3AXDA 4FPFA 4NO4A 1GZWB 4UW3A 2RHPA 1JYCA 2VH9A 2CTVA 2VY0A 4GKXA 1CIWA 1S0IA 2PHUA 4AVVA 2VUAA 2VW2A 3I8TA 4P9WA 1JYIA 2YV8A 3IPVA 1A3KA 4UW4A 3RMYA 1LOGA 1CQ9A 5EWSA 3FUQA 1IKQA 1O4YA 1WD4A 3USUA 3MW4A 1LULA 2A71A 2CYFA 1VIWB 1W6MB 3B9CA 1BZWA 2D6KA 5DZGA 4R9AA 3ZXFA 1S0DA 2A3YA 4FPOB 4YGCA 3ILRA 1WW4A 4AGRA 1WW7A 2SLIA 3POWA 3IKWA 4YFWA 4CTEA 1FV3A 3PMEA 4Y1YA 1URXA 1UZZA 3Q9OA 1ULGA 5DXDA 1G86A 1LU2A 1QKQA 2ZACA 3AXEA 3OBTA 1MZ6A 2ARBA 2CL2A 3AZVA 4PF5A 1CPMA 4BOWA 1AVBA 1HKDA 3R4SA 2YROA 1QDCA 1BYHA 3D4KA 5E88A 3V0AB 1DQ4A 1V00A 2R16A 4Q27A 4ASMB 4XJ8A 2EIGA 3OY8A 4YM1A 1H9PA 5CB7A 1MR5A 3AX4A 4U36A 1CPNA 4AYUA 4XJWA 2GALA 4AWDA 1EPWA 5HCFA 2W08A 5IK5A 3R05A 2DVGA 3N7JA 3RG0A 3ZXLA 5JMCA 3AP5A 5JOYA 3SISA 4GKYA 3VV1A 3AYDA 3CNAA 1N3PA 3BODA 2GN7A 4P14A 1LOAA 2AREA 3IM0A 3POYA 1MACA 1OKQA 3N3HA 3UK9A 1SLAA 2P3KA 1PZ9A 2UU8A 1YXWA 1JXNA 3I4IA 5GJ6A 4IQPA 1GLHA 1LHWA 3M3EA 4TZDA 5IT6A 1LOCA 4Y22B 1AX0A 1V6MA 3INAA 4RL7A 2DVDA 1LEMA 3VKLA 2WQZC 3OBRA 1HDKA 3WCSA 3ZVXA 1W6OA 5JOXA 1FYUA 1LHOA 1WD3A 3SH3A 4FPLA 1YO8A 4YW2A 1AJKA 2NN8A 3JU9A 1G9AA 4PCRA 5GZCA 2PHTA 4WV8A 1Q56A 4FPKA 3SNMA 3WZ1A 4CRQA 1Z78A 3MW2A 2A6XA 4Y1XA 4AVSA 3WDUA 1LECA 2SBAA 1GANA 3AFKA 3VUOA 4FOYA 5KXCA 1G9BA 1WBFA 2NYYA 1LJ7A 3PJQA 1AXZA 1O4ZA 2A6WA 3UL2A 3RS6A 3WLUA 4XHXA 1NXD1 2JE9A 2R1DA 1GSLA 3O5SA 1ENRA 3ZXJA 3B69A 2DURA 3B00A 4F83A 4FPCA 4LBKA 1BKZA 5E89A 1KRIA 1DYKA 1DQ1A 1HQLA 1Z0HA 1LHNA 2LALA 1JHNA 1BXHA 2DWRA 1UKGA 4M3CE 5FRAA 1F5FA 2CWSA 1NLSA 2GNTA 1SBFA 2WT2A 3HR9A 3O0WA 5H9PA 2WT1A 3V0BA 1DHKB 1DQ6A 2XB6C 2ZABA 1H30A 2GMEA 3N36A 3PVNA 3WDWA 1QOOA 2D6NA 2H0BA 4XIKA 5DUVA 3WNXA 3AZWA 5IK7A 1G7YA 4XHBA 2YMZA 2E7TA 1H9WA 2PHWA 2ZGTA 2WT0A 4M00A 1OFSA 1Q8VA 3V0BB 1WLWA 3OYWA 1N1VA 1QMJA 4D69A 1QOTA 1W0PA 1MVEA 1QGLA 5GM0A
chains in the Genus database with same CATH superfamily
4J1XA 4XF9A 4BDVB 1BQPA 2GC3A 1DFQA 3UGHA 1NY72 2OVUA 3CKHA 1HRI3 3NQHA 3HT1A 4A42A 1HJGA 4ZS3A 1CX1A 2RDQA 3OD4A 1GWKA 5FYHA 3T2PA 4ARXA 3VBHB 2W1SA 3LOBA 2GMMA 3MIEA 3AMHA 4O9GA 3D5OA 1PIV3 3CHXA 3T2TA 2HWE2 3ILFA 3N4MA 1SFYA 3HEIA 5FR3A 3AP7A 4JGYB 5FKBA 1YC61 3K77A 3O1UA 2EAKA 1W9FA 4X8NA 4TTGA 4YM2A 4FFIA 2JICA 4P00B 4LBLA 3PJYA 5A3TA 2D3RA 1CAUA 3IPVB 3JCIA 3MV01 4XTMA 3T0BA 5I0DA 4YVWA 2K0GA 1STMA 2WABA 3IZOA 4N53C 1R1A3 3AC0A 3TN92 4LBQD 4NIHA 3LZZA 1AF9A 5F37A 1QH6A 1RXGA 5BPXA 4E2QA 3WXPA 1NT0A 3HWJA 1AX1A 1BBT1 2AEYA 2WZR3 4P9XA 3I2GA 4DEVA 2WKKA 3VDAA 1W8WA 3IDCB 5DDJ3 4CCDA 3NAPC 4B4PA 1YFYA 4YARA 1JU3A 1JI6A 2A3WA 3WQ0A 3RZHA 4KGQA 5LRSA 1RUI2 5CKQA 3M2MA 2FDHA 4ISRA 2D7FA 1FOD2 2JKBA 4MZUA 1S1AA 2P5BA 1W8HA 3N9NA 4GB32 4GZ9A 4DUVA 1DGWA 4CEYC 1EUTA 1MQTA 5FDBA 1HLCA 3O1SA 5FPZA 4YRDA 2UURA 1OMIA 4QKDA 1J59A 4LHSA 4BLJA 5G05L 4FTSA 2PAMA 4RA0A 1IG0A 4XQWA 5CISA 5K7PA 4HBNA 2BERA 1RHI2 4RN5A 5J98B 4C0BA 3ZYIB 2GNBA 5C3OA 4WM7B 4Q26A 5GKAC 4BQXA 2XJSA 1D4M1 3EO6A 2DTWA 2RS32 3BB6A 2GNMA 2VMIA 3N9MA 3P1IA 3PDQA 4NHYA 4XE9A 4CP0A 3TNPB 2XUEA 4XJZA 5A6XA 3NJYA 1QHDA 4LO6B 1ENQA 4MHRA 3TNQA 4Y4YA 1JW6A 1X50A 3MV11 2JDZA 1UY3A 3OPZA 5IK4A 1ND2C 2HWE3 4NIGA 5FK8A 4TN7A 3AYEA 3ZYJB 4NE9A 2GH8A 1IS6A 2CDOA 4EQVA 2Q8EA 5FK7A 5C3RA 1OD5A 5I8SA 3OTFA 2J1VA 2CU5A 3AKRA 2V4VA 3GZAA 4RR3B 1CAXB 5FO7B 2ZAHA 1LENA 4FPGA 5IVCA 2QKDA 3Q8EA 4R4ZA 1NAEA 1N1YA 4N43B 1IQDC 2EXHA 4NPLA 5FP3A 3EYPA 2ORZA 2P4EA 4PIYA 4IGPA 5E16A 1XQNA 3R4DB 4DRRA 2ZOEB 1Q8SA 4AI9A 3MYXA 3VBHC 4GWJA 2G9ZA 1NCRB 2VVFA 1W90A 3D6EA 3ELNA 3N35A 4IE7A 4LK6A 2XLGA 4GWIA 1M4WA 5DZFA 1APNA 1F4AA 3AZZA 3S30A 5DAWA 5GLVA 4JGYC 3VDDA 2ZGSA 3W59A 5KXEA 5A7WB 1RUI3 2AENA 1BBT2 2YPJA 2IFWA 4ARYA 4IEYA 3UGGA 1RUG1 1WBLA 1MS4A 1TVGA 4G4FA 4GB33 5I0UA 1NA1B 2ZPXA 4MLOA 5A3OA 1EV13 3B93A 3PTRB 3W5MA 4Y24A 5T3NA 3OEBA 4W8JA 1SLBA 3WP3A 1MEC1 3L2HA 3PU8A 4LHNA 1RUD2 3DGTA 1VE0A 2W1WA 3BU7A 4HVQA 5CBLA 1RHI3 4OQ9A 1TNRA 3ES4A 3H0OA 1UYYA 4AVTA 4ZXKA 4UFIA 3LA7A 4KU8A 4O7XA 2C9KA 5JOZA 5EYYA 3ZSJA 4B7EA 1VMJA 2BQPA 1GOHA 2Q1FA 4BXFA 3WHTA 3QOPA 1QU0A 2GC1A 2X53S 1CX4A 1D4M2 4ITCA 1WUVA 2VTXJ 1UYPA 2G19A 2B42B 4OFGA 3H7JA 1CJDA 3P3PA 4CCKA 5A7OA 4S2HA 4LA3A 3TB0A 4XMIA 4YG3A 5JVVA 4NWWA 4QX0A 3RMXA 1OUSA 2QQOA 4V2VA 1QNWA 1UYZA 3VGIA 1V6IA 3ZSLA 1D0HA 4LULA 2ZBJA 1KS4A 4B3NA 2DVAA 2ARCA 3ZMOA 3LSDA 1IS3A 1HN1A 1A8MA 1V0AA 4MGYE 4U2AA 1QDOA 5I8TA 2ES3A 2NQYA 3SKJE 3VD5A 2JB4A 1GICA 2O8OA 2CGOA 4QB1A 1IPKA 3SMHA 2BVVA 1MS1A 2ET7A 3AK0A 3FUOA 1AJOA 1WW5A 5FXXA 1F8VA 1K5MA 3NJVA 1CAUB 4YW5A 1WKYA 5FZ8A 5I0TA 4YVWB 1K3IA 4HL0A 4BM8A 2HWD3 2JIGA 4RR3C 1TEIA 1GNHA 1LOBA 4YG0A 4DFSA 1I5PA 3KQ4B 2DU0A 5I8YA 1W8ZA 2A5ZA 2VQAA 5KXBA 1RUD3 1MS5A 4ZZ5A 1RUG2 3WDXA 4DEQA 1AR81 1KGYA 4UAPA 3T0AA 2XH6A 4P9JA 4QX3A 4YW4A 2XWJB 2YPDA 5A32A 5KHHA 2DFCA 5J3UA 1MEC2 1SLIA 4GJZA 4Q29A 1NKGA 4QQ2A 4COYA 3GNEA 2VXJA 3LEGA 1IS4A 3B9IA 4FPEA 1XBFA 1CONA 4JVAA 3RGBA 1D4M3 5ANNA 5ANQA 3V65A 3O14A 1MQTB 3U37A 5FPVA 2WWUA 4FQZA 1ASJ3 1NA1C 5T52A 5LASA 5C4WA 1ULEA 2RDSA 3T30A 1EPZA 3KS7A 1H8VA 2ZGMA 3F2ZA 2A7AA 3BVCA 4A3XA 3HN1A 4B1MA 5D21A 3H7YA 4O65A 5JZGA 2CAUA 2Y6GA 4LE4A 4ORFA 4Y22A 4C1WA 5IVYA 1X8MA 1F5JA 2DBIA 4YGBA 5JMOA 3CEWA 4Q0SA 2ZHKA 1D2SA 2PXJA 2R49A 3WP5A 1U12A 1LHVA 3PUIA 4H7LA 3DN7A 3UYJA 1PVC1 3CZUA 4KBBA 4MO3M 1DZQA 1PMJX 3AZXA 3JBG1 4DO0A 4QDQA 3TAYA 4QT6A 4MHUA 2YU1A 4URAA 2NP0A 3H9AA 4IE4A 2PQQA 4HANA 3RZKA 4IETA 4XBQA 2YDEA 4CA9A 3OOXA 5A7PA 4BA6A 1JBCA 4ZHNA 1FV2A 2W3JA 1IQAA 1DU3D 3RZZA 3HMYA 3JQXA 4ZS2A 1NOVA 3GALA 1W9WA 3WY6A 1WGPA 4W6WA 3UKTA 1S2BA 5DZEA 2GC2A 5LZ6A 1OBNA 5JXJA 2R1BA 1ULFA 1J3PA 2XXZA 2V5DA 1RUG3 1V6NA 1G9CA 3PTYA 3BI3A 3DPRB 5IK8A 3IDEA 2WIIB 4XMAA 2A6YA 1Y3TA 2WNUA 1AL23 3ZFGC 5GZGA 1VBC1 2BWAA 5C33A 3GM8A 2B4KA 3N9OA 4HXCA 5JCTA 3VDDB 1Z7S1 3MF9A 4AQ6A 2E7QA 4B4QA 1W2AX 3WF3A 1NYWA 4G3YC 1AXYA 1AYN2 4IEPA 4HONA 5B2GB 1GKBA 4AHZA 2ZZJA 4QMAA 3ZN4A 2JJ6A 4NJ4A 1QOSA 4I0AA 4XBNA 5A3LA 1EUUA 3B3QE 3AKSA 3GZTB 3H1MA 4YVWC 4D6QA 4XFAA 2RS11 1O3RA 1OVPA 4LKSA 3I3MA 2QQPA 2W0XA 1DQ2A 4K6BA 4XBLA 4FT8A 4JX0A 2DCZA 2BGCA 4AAXA 2NZ9A 1ULDA 1H2LA 4ONUA 1Q8OA 2ARXA 4I02A 4N9IA 4AI3A 5A3MA 2E53A 1OOPA 5DAVA 4YZ2A 1W9YA 1ZBA1 1W8NA 1DYOA 3ACLA 1YYNA 4Z82A 4GMP0 4CUAA 1OKOA 2JDNA 1LKNA 1JHJA 1YQ5A 1W3XA 2G9FA 2IVIB 1IG3A 3BOPA 1G6NA 2NMNA 2EA7A 5JSRA 5CNAA 1RTVA 2W1UA 3POGA 4Q5OA 2JKXA 3V56A 5L9VA 4RYDA 2ETEA 1MQTC 1U5ZA 2KA3A 1E5SA 1DP0A 4JKKA 4LUKA 3UV9A 4AAPA 1U5IA 5CA6A 1VR3A 4KNCA 1IHMA 3J4UH 1UXXX 1DQ0A 2B9VA 2DUOA 2X8KA 2VUDA 2JD4A 4TLFA 1PVC2 2D6LX 1N1SA 4DS0A 2HH9A 3GZEA 1KQRA 2C5DA 2EXKA 2BGPA 2AC1A 3JBG2 2IVJA 5FIXA 5EJZB 1ULOA 1VB2A 2CTVA 2VY0A 2W94A 1JYXA 3E97A 2CAVA 2PHUA 4QDRA 1CAVA 5JXIA 5A7SA 1RUC3 4IEZA 1QXJA 4ZPIA 2RM21 5EWSA 3FUQA 2D40A 4YVSA 2XUMA 3USUA 3NKTA 5C6CA 1XSQA 2A71A 4SBVA 3NO8A 3B9CA 5DZGA 4AHXA 4R9AA 3J8F1 2JDYA 1S0DA 3I3QA 4WVZA 2A3YA 1JZ5A 4XDOA 1KEXA 5FYVA 3SC7X 1K5MB 4MGSA 3Q8CA 1WW7A 4P9IA 3UGFA 3H8RA 1AYN3 3ZFEA 3IKWA 1GP5A 1VBC2 2HBUA 2OZ6A 3CIHA 1Z7S2 3Q9OA 1ULGA 1HJFA 1W3VA 4P08A 1G86A 1LU2A 4Y4RA 5FY8A 3ZXDA 1F2NA 2CL2A 1CPMA 4BOWA 2QQKA 1OF3A 5FMOS 4AQTA 2DCJA 1HKDA 1D2QA 2RS51 3WT3A 3JD73 5E88A 3DPRC 4QQHA 2RS12 4AFMA 4F7ZA 2R30A 3PL0A 4XFHA 4ASMB 4J1WA 2WC2A 3OY8A 2YGLA 4LIUA 5APAA 5JWPA 2WYSA 2GP5A 1CPNA 5LB6A 4AYUA 4DIQA 4RGGA 1EPWA 2W08A 4W6XA 1SZBA 1UF2C 4L0PA 4CDWA 2HWF1 2WZPP 1YQ6A 5JOYA 1RUE1 1ZBA2 3B02A 2HJIA 5C4WB 1HXS3 1Y43B 2F4PA 5F5AA 3UK9A 3J9SA 4N53A 3D3AA 3D8CA 4JHZA 3J26N 4Q4Y1 1LHWA 4QU2A 3BKZA 3JBG3 4Y22B 3DYMA 1AX0A 4BQ4A 1JU4A 4H7MA 5FY7A 2W87A 4IUGA 4JDNA 4OI2A 3H1YA 2EIDA 5IVFA 1S2EA 1UZVA 3RJ2X 3IT8A 1OF4A 3NAPA 5FMOL 1HDKA 3OGRA 2VE1A 3ZVXA 4QKBA 5JI9A 5JOXA 3FN9A 4UFKA 1FYUA 5FY5A 3WP6A 2WR9A 1YO8A 4YW2A 4CCOA 5KBFA 1NG0A 1QIQA 3ZFFA 3C7FA 4PCRA 5F3EA 2ZX1A 2VCMA 2HEWF 2RM22 2VNVA 4H14A 1Q56A 3O1MA 3WZ1A 4CYDA 1V9U1 3W21A 1VBC3 2SBAA 3CF6E 3AFKA 3VUOA 3J8F2 4FOYA 5KXCA 1Z7S3 1WBFA 4GAZA 1SMVA 3VD3A 1LJ7A 1R64A 2A6WA 5HI0A 4IXLA 3U1XA 1HB4A 2QJVA 1ENRA 2CDPA 3BU0A 4RD7A 4P5YA 1CIYA 2LROA 5LA9A 3HD8B 4D3WA 4DXZA 4E2GA 5E89A 4XDPA 5FZFA 5J7MA 1GQGA 1X36A 3T2OA 3MF6A 3VD7A 1HW5A 5FRAA 4HSJA 2CV6A 1F5FA 2C1FA 3VL9A 1K5MC 4META 4EZHA 3NRUA 4EYUA 4IE0A 1DHKB 4N9HA 4QB2A 1H30A 2LS6A 2H0BA 4XIKA 1CGPA 3AZWA 3D0SA 2W92A 4AHWA 4DZGA 2HWF2 1H9WA 5KC5A 4PLOA 4NPMA 2J42A 2W2IA 1CD3G 3TWIA 1OFSA 2QCSB 2Y64A 3V0BB 1OOPB 2YBPA 1E5IA 4MGQA 3H3ZA 3Q8FA 5LEJA 3HVDA 5EJ3A 3VBHA 4COZA 1W0PA 5GM0A 1QGLA 1NE4A 4Q0PA 5FZOA 1UW8A 3TBDA 4CDQA 3M4FA 4XUTA 3HQRA 2Y33A 5FZLA 3AJYA 4Q4Y2 3ZR5A 5A6YA 1GZ9A 2DTYA 2EALA 5DAXA 2FMDA 2ZGRA 4Y1VA 1C3HA 1GZTA 3LDBA 1S0GA 4P9YA 1SLCA 5C4WC 2Z42A 1UMHA 2EXJA 2D3SA 2RM23 4XCBA 2TNFA 4DXTA 1N3QA 2P1BA 4NHXA 5DN2A 5FYBA 4YGDA 5AC91 4V1PA 5JAXA 1GQPA 3AMPA 3IWZA 4FVVA 3J8F3 3BTXA 1LRHA 4NWVA 3LAGA 2PHFA 4C1XA 3AL5A 1CAVB 5LY2A 2PA7A 2QQUA 1V9U2 1S0BA 1DIWA 1O59A 1W8UA 5IAXA 4XAEA 1H0BA 5FYSA 3VHPA 4YVSB 3USUB 4EROA 3KZ4C 4N8MA 3T1LA 3BCWA 1RUNA 1DGRN 4CZSA 1GP6A 2XVGA 5IWFA 3LOIA 4AF9A 1UAIA 3LQCA 4K9SA 3RPQA 2UWBA 4MSVA 2BVBA 2JDMA 1JH5A 2IXKA 3ZFEB 4CEWB 1C4RA 3LF7A 4KG8A 4Z1VA 4QPIC 5BY5A 3I2DA 5EIYB 4BQ3A 1H4GA 4DY3A 3KVBA 4D7YA 2XBO1 3AYCA 1LESA 1UN1A 1RUJ2 2C4XA 4K3UA 1RINA 3GGLA 2HWF3 2UYAA 4R8HA 3ZYRA 2PMWB 4YZ1A 5SV8A 5L73A 4XF1A 5LA0A 3U75A 4MV2A 3OY8B 3WV6A 1OUXA 2NMOA 4JV4A 4DQAA 4HLTA 5FZAA 4EN8B 5FOJB 4MVTA 5M0TA 2CY6A 4CDWB 3A7QA 4Q4Y3 4I01A 1HIXA 2VZTA 4WZFA 5FOBB 1BMV2 2CNAA 1QJX1 1LEDA 4QX1A 4AI1A 5FZCA 1QJY1 1VMHA 2OZJA 1J84A 4FPJA 3MLLA 2JE7A 1Q8QA 2WL1A 4LBJA 4N53B 5F8PA 3WF0A 1UYXA 3ENRA 4QM9A 1BHGA 5CAZA 1KITA 1VBE3 1UL9A 2I2SA 1BK1A 1BK0A 2D6MA 3WD5A 1WMDA 2WAOA 3LPGA 1W8FA 4HG6B 3KV9A 3M70A 1V9U3 3B7MA 3OPWA 3ILNA 5GALA 4OCTA 5AC92 1EP0A 2P37A 5JR7B 2ZKLA 1CWPA 1W39A 5EXOA 1CN1A 1ZA4A 4D8MA 2A70A 2OUHA 3C8XA 1OA3A 1RVF3 2CSGA 3ZFFB 4AI0A 2ZEZA 5EPAA 5F3CA 5ACA1 2YYOA 4Z92B 2LW8A 2ZGQA 4XYXA 3S6PA 4D6SA 4I0BA 3LKJA 2BTVC 3K48A 1W8OA 2X10A 5IAVA 3ON7A 4M3CA 3M3QA 3AKQA 5GLUA 1OVSA 4FSJA 3MDPA 2Y6HA 4TWTA 1JYWA 2FDGA 4OVEA 2FZ2A 1YUDA 1RUJ3 1NQDA 4IV3A 4AE2A 4HKWA 3RZJA 1DYPA 1ZX5A 3E6CC 1I5ZA 5DUUA 3VKOA 1V6LA 1NX9A 2CGNA 1HB2A 4PQ9A 1LCLA 1VALA 1W6NA 4H3WA 4YVSC 3JQWA 4B4RA 2XBO2 4KWLA 4JTOA 3NV2A 4XURA 5J36A 3WDVA 2WFPA 3GZUC 4AXOA 2DFBA 4I30A 3B01A 4JZRA 4LKDA 4QX5A 1S55A 1B09A 1XRUA 2XJTA 1LGCA 3CMGA 2TBVA 3ZFEC 5K0UA 4CEWC 5DMYA 2IXCA 1CAWA 3C7GA 3LWCA 1W6PA 4E4DX 2BPA2 4AZZA 3H42B 5CFDB 2ZGOA 5C5UA 4Q4X1 2V73A 1GU3A 5FZ7A 2R0FA 4PDWC 3I49A 4ISQA 3ZYBA 2B7YA 2JD9A 3AJZA 2EVXA 4L8QA 4BIFA 3EHKA 1QJX2 3OBZA 1G9DA 1QJY2 1WCUA 4JAAA 1NLRA 1XE8A 1ZBE1 2OT7A 1YIPA 1IGOA 2WBKA 5FZOB 3SITA 4CDQB 2YC0A 5DUXA 2GC0A 2AEZA 2C0ZA 3ZFGA 1WLCA 5LK7B 4XZPA 3H8XA 5AC93 1ZRFA 2BUKA 4WVWA 4CDWC 3PUSA 2RV9A 4IEVA 1UY4A 5D8AA 4WVVA 3U4XA 1J83A 1RUF1 2JB8A 2PYTA 4N7UA 5T5LA 3RRDA 3NV3A 4JC1A 4LKEA 3TRSB 2ZHLA 1GOGA 1ZZ8A 4IESA 3LIHA 3MPPG 2XL9A 1C8NA 1A6CA 1XU1A 4PI0A 2C9AA 5ACA2 5FYZA 2B46X 3C3VA 1GV9A 2ZKNA 2ZS6B 1J1LA 4FAHA 4XVHA 4ET7A 2BOJA 3I7DA 1W99A 2YG0A 3POBA 1Y9QA 3HBZA 4OMCA 3C7OA 2XBO3 1ZVFA 2ORXA 2VECA 4Y1ZA 5T50A 4XJ9A 3GCWA 5A3WA 3RQ0A 3ZFFC 2A6ZA 4MGIE 4K1ZA 5F7UA 1UZYA 3FFQA 4QPYA 1VLNA 3RWNA 2ZGUA 3W20A 1D4VB 2VZUA 1J1TA 5CYYA 3OSDA 4IERA 3BTYA 3FLTA 1UWWA 2WAAA 4XTPA 1CESA 4YZ4A 4UI9L 1ODMA 1QJX3 3PUHA 4E4ZA 2QE3A 4AOCA 1XE7A 4Q4V1 1ZM1A 4Q4X2 4X8PA 1LODA 3T1MA 4AG4A 4QQPA 1AR61 2VM9A 4EJRA 3D0JA 3HBKA 4EN0A 1W04A 4ZU5A 1WCSA 4ZU7A 4AVBA 3VB9A 2WNEA 2XVKA 4PBOA 1JUIA 2A75A 5BXXA 4W50A 1H6XA 5F39A 4CDXA 1JODA 1ZBE2 2BBAA 1KDKA 3VBFB 2ET1A 1ACCA 2XJVA 3K51A 4A45A 1W0OA 2GDFA 5JPNB 2HYXA 3HJRA 2HKXA 3AMMA 4LBNA 1JOJA 3KF3A 1US3A 2YB7A 3L2YA 3MLKA 4L9BA 4EN6B 4QPGA 4MXVA 2DV9A 1T6GC 4CPBD 3BIEA 2V72A 4HFSA 2XR4A 2OX0A 3N7LA 1OD3A 4A2UA 3HT2A 3VZKA 1ENXA 4DUWA 1OLME 2BZDA 2VNRA 3VKMA 1JZ7A 1PNFA 4CCLA 5ACA3 3J7HA 3VKFC 1VB4A 3NW4A 3DPRA 4CDQC 3IAQA 3W9AA 4AVAA 4BMEA 4YPJA 1UPSA 1Q43A 1MS9A 1Y7BA 4KMQA 1E57A 4DXRA 2FCVA 3WX5A 1FAYA 1VJ2A 4BK4A 5FPUA 5KHKA 3GJAA 4NMIA 4QXKA 5FYTA 5FZKA 4CSWA 3KLSA 4XXPA 1F15A 3LEKA 1FOD3 5EV7A 2TEPA 3MW3A 4IEOA 3AP6A 2ZCWA 4NIIA 4BCUA 2WDBA 5L9RA 2E7AA 1XB9A 5FPXA 4M3CB 3NV4A 4SLIA 4AFDA 2ADEA 2VZVA 5KXDA 3NV1A 3KD4A 2E6VA 1IS5A 4IV3B 1Q8PA 2RS33 2QTWB 3HPNA 5GZDA 2EF6A 3RDIA 4R9CA 1W6NB 1AZDA 4PT6A 4QX8A 4XF0A 4M4RA 3PVOA 2E31A 1I1EA 1W9SA 4LTAA 2DCKA 2R041 1GMMA 3NNFA 5FYUA 3THPA 4QHZA 4C0HA 4A7YA 4UXAA 4QWNA 5A6ZA 1LR5A 2Y6FA 2WFF1 5H9RA 4Q4V2 5K0UB 1YQCA 1XYOA 1CAWB 1ZBE3 1W6PB 3DXUA 3KSCA 2JEMA 3POSA 4BISA 1GYKA 1AR62 4QX7A 3M8LA 5J37A 3WNOA 4CCNA 2OA2A 4NPRA 4UF0A 4OYUA 3O0XA 3MHZA 3N7MA 4GULA 3THCA 1CJPA 2QDRA 5K8SA 3G7DA 4LBQA 4NOTA 2ZMNA 4AQSA 2VW0A 3J7MA 3TN93 2DUQA 3KWVA 4FFGA 4PLNA 2FDFA 3WNLA 4ZONA 4L2NA 3ZFGB 5FCCA 5IFTA 4K21A 1WMFA 5JUVA 3O1VA 1YCIA 2P3JA 2ERFA 1QJZA 1KD7A 3B94A 1GZWB 1HRV1 4XFBA 2VH9A 3UT0A 4GKXA 5D8AB 3MGUA 3ROUA 2VQ0A 5FO8B 4TLGA 4LORA 4LO5B 1BBT3 1A3KA 5IJRA 3VBFC 4OHXA 4WM8A 2O14A 4LOSA 1ZZ9A 1WD4A 2FBEA 1RGSA 3ZIWA 2BNNA 1BZWA 2WZEA 4IDZA 5LW9A 5DAQA 5FZMA 4AGRA 3EBRA 3VBOA 1W28A 2GU9A 3BYWA 3GCXA 5LCWL 2SLIA 3POWA 3GHNA 1FV3A 3JB4C 1UZZA 5BUVA 1K5JA 4CU7A 1XNAA 2Y6KA 2WQ8A 4HK8A 2QZ2A 3OBTA 1GR3A 2HWB1 3AZVA 3DEMA 3LA2A 4PF5A 4HZFA 2Q1MA 3ZIXA 4OUMA 2YROA 1QDCA 3D4KA 1UU6A 4I3PA 5A3PA 1JS9A 3LFIA 1YFUA 4F8AA 4IEWA 4CP9A 4Q4V3 4XJ8A 2EIGA 4QM8A 2R042 1HB3A 1SEFA 5CB7A 1WLTA 5BNOC 1AR63 1JMUB 1SFNA 4RFRB 4XJWA 5F5CA 2R071 5BNPA 5IK5A 3KCCA 3NJZA 5FYMA 3RG0A 3JZVA 4NRMA 3ZXLA 4W4ZA 4Z2AA 2WFF2 1YI9A 3AP5A 3G6JB 3GXUA 2J1SA 4IV3C 3SISA 4CPBA 2WWSA 4LO7A 4GQ7A 4QHOA 1AYM1 1O5LA 3DXTA 3VV1A 3CNAA 3BODA 4CU6A 3TOJA 2AREA 3DCQA 4D7TA 1MACA 4H2AA 3HAGA 3RWKX 1JXNA 4IQPA 1QJU1 2ZXQA 4NN0A 5FTTC 1COV1 4EWAA 2X09A 1W8TA 2GSYA 4CDXB 4CU9A 3INAA 2DVDA 5K0UC 2V09A 5FZ1A 2ZTNA 4XQ4A 4MADA 3VKLA 4LR4A 2WQZC 3K3OA 5LBBA 4QPIA 2R061 2UYBA 2VG9A 4QPGB 1HRV2 2OPKA 2BEOA 4P9GA 5L7OB 3ZX7A 5D1IA 2ZEWA 1WD3A 1POV0 3QH7A 3SH3A 1SG3A 3T09A 1RYYA 1NXMA 4AI2A 1RC6A 1UMIA 4OULA 3S57A 5GZCA 3U11A 4GH4A 3AL6A 2PHTA 3PMSA 4WV8A 3K4AA 4BQ2A 3NNGA 5C3PA 3WDUA 1GANA 1SQ4A 3IMMA 2C6SA 1G9BA 4KWKA 1MEC3 4JTNA 3VD4A 3UKNA 5A7NA 4N7IA 1AXZA 1O4ZA 5D8AC 4NRPA 4OUEA 3HIFA 4XEZA 3GBFA 2P6HA 2R1DA 1AR82 4NIAA 1H2KA 2Z5WA 3WLUA 3BUCA 1W2OA 1VBB1 4UYBA 4F83A 5I0SA 3RZLA 1ST8A 1B35C 1D7PM 1DYKA 1Z0HA 4B7KA 2HWB2 2LALA 2W1QA 3PIJA 1XNKA 2PN5A 2R043 5FYIA 2Q8OA 2DWRA 3U10A 2CWSA 4BU2A 1NQJA 1SBFA 2AZ5A 3HR9A 4E4SA 3OUIA 2WT1A 5JXGA 2XJUA 2XONA 2PAEA 2BNMA 3V0BA 5K4LA 2ZABA 2WNVC 2GMEA 2Q0AA 4L11A 4QKFA 2HBTA 1VMFA 2R072 3LFMA 4XHBA 2YMZA 3U78A 1NZCA 2YFZA 3I2FA 3SEEA 3P5BA 4OI1A 4Z07A 2ZGTA 3ZKUA 2WQ4A 3WINE 4M00A 1OPOA 1AYM2 4Q0QA 1V70A 1FMD1 1PX3A 1W2UA 4R52A 1QMJA 4OI4A 1MVEA 5FLIA 5FWJA 1WMXA 1QEXA 3MZHA 2W5FA 1QJU2 2PHRA 3GF6A 3I54A 4UF0B 1MS0A 4OHYA 2PHDA 4W6YA 2JDKA 3ACIA 2OQ6A 4LBQB 2RVAA 5DPNA 2HYKA 1FNZA 3WSOA 4PJYA 2OQ7A 1ZZBA 5T5OA 2R062 1PMHX 2BV4A 3LCPA 5F2SA 5C8CA 3APBA 1HQNA 2AR6A 4KG0A 1VAKA 4UBGA 5GLWA 4XOGA 4FOQA 4CDXC 1OHFA 1H1MA 1REEA 4DMIA 2ZGNA 1DGLA 1QH7A 4S2GA 3VDCA 1AR83 4KGGA 4WM8B 1REFA 1XC6A 3A0NA 4CEWA 3M1HA 2W68A 4I3GA 3OUJA 1UU4A 4QPGC 4JQRA 1EYBA 2XKPA 3UESA 3UJOA 4AGGA 5L7OC 1LAJA 3Q8AA 3TEWA 2RMU1 2HWB3 4AFCA 3AM2A 4FPYA 4PDWA 4UW6A 3VBOB 4D6RA 2OS2A 2A6VA 1U5XA 2BGOA 5DABA 4AQ2A 4JHTA 3H3LA 2DVFA 5T5JA 2Y38A 4PQQA 5F5QA 3FL7A 5CFCB 1KFUL 1IZ3A 1JZ3A 2K46A 3HNMA 3TYJA 2JWPA 3KGZA 4GA9A 2HEVF 2YGMA 3I3EA 3QH6A 3TEZA 1J3QA 1RMU1 2R073 2XLFA 2R32A 2WLPA 2ZGLA 4M3CF 5KWRA 4XETA 5FY4A 2JECA 3T08A 3KHBA 3O12A 4DPNA 5F1RA 1AYM3 4UFMA 4CP9B 5JLVA 1SBDA 1H8TA 2FHRA 1M06G 3WG2A 2GN3A 1WMEA 5BNPB 1A78A 4XJUA 1UNBA 4LUMA 3AKTA 1V6KA 3ITQA 4UFJA 4CXYA 4X6RB 1PVC3 4GWMA 1FMD2 2WUHA 2VNGA 2AUYA 3AP9A 1R1ZA 3NVCA 3VBRC 5A70A 1XNTA 1Q5OA 3E5XA 2K2SA 3VKNA 3H8UA 4CXXA 4E4HA 1YJLA 2EAAA 4YM3A 2JXAA 4Q4W1 4ATFA 4WVMA 1KFXL 1L3JA 3M3CA 3SQOA 2R063 3OF1A 3WDTA 5F9TA 1LOEA 2VTFA 1PM7A 3ZN6A 5FP4A 2ILMA 1PGW1 4R9BA 3VZNA 5KHGA 1NLQA 5JSOA 4HN0A 4FOVA 3ZLIA 2BU9A 2ZMKA 4K8FA 3HQXA 1TMF1 5JIAA 3RZGA 3MIGA 1I6XA 1MZFA 4QPIB 4YW1A 3HNYM 5JDBA 2FMYA 4PBPA 5A1LA 1XU2A 1PGL1 1YEWA 4Q8KA 4K7JA 3ZR6A 5FY0A 1RXFA 5IVBA 3I2KA 4X6QB 3PURA 2PHXA 4GH4B 1SDWA 1C57A 1AXKA 4IV1A 2VOKA 4A3ZA 4FPHA 2VUJA 5HCBA 3RYRA 4AVCA 5L19A 4RFT0 3OGGA 5G04L 2XQRA 3VDBA 1OH4A 1US2A 2QBXA 5FMDA 4BQ1A 5AFBA 2RS13 4Q0UA 2RMU2 1O8SA 2VXRA 2OKXA 1ZRRA 3P3NA 1QNYA 3FZ3A 1XNCA 4AGVA 1YI7A 1YRZA 2RS52 4QGLA 4Y5TA 4ASKA 4WM8C 4Y5Z0 4XPVA 1OH3A 4FOWA 1ZBA3 3AMQA 2XJQA 3LIGA 1KDMA 4JRLA 5CFDA 5T5PA 4LBMA 5ISLA 5ABJA 1SBEA 2JE8A 3CU7A 3VBOC 1RUE2 2J22A 4PIXA 5C71A 5DQ0A 3WW3A 4FXGB 1FMD3 4HK9A 5CKNA 2PFWA 3RJRA 4AFAA 1RUH1 3IMNA 5CFCC 4Y20B 2F6BA 2P3IA 2WSVA 1KS5A 1C8M1 3K3NA 3N7KA 1O4TA 5CVRA 3TEXA 2VUCA 5FZBA 5A80A 4NAOA 4OUSA 2D43A 1LTEA 1OSGA 2G1MA 4XABA 4Q4W2 5FAXA 3BTAA 1CVNA 2VZOA 4ES8A 2RDRA 3IDAA 3AYAA 5BNPC 3SLIA 1X7NA 2BOIA 2E9QA 4JKMA 5E8AA 1G9FA 2ZGKA 2UY8A 1IPSA 3ASIA 4EZ4A 3THDA 4LT5A 4V2WA 1TMF2 4BK5A 3ZXKA 2VOXA 5C8CB 3A4UA 3DUIA 2UWCA 3MICA 2YC4A 5C7GA 1H2MA 3POEA 1HRI1 1W6MA 2QQVA 2AH2A 2Q8DA 3FE5A 2RMU3 5A3NA 1O5UA 1GZCA 1RIRA 2Y26A 2ZEYA 5T55A 1ULPA 5DUWA 2WA3A 4RGAA 2RS53 2DVBA 4UOJA 1LNSA 1H4HA 4M0NA 5AVAA 1MZEA 1DLCA 5FP7A 2NM1A 1YHFA 1ZZ6A 1YIFA 2G4IA 4PDWB 3HN3A 4IE6A 4UFHA 5E6HA 5BV6A 5LA1A 4GH4C 4XFFA 2BBVA 1RUE3 4JRAA 2VU9A 3V0AA 1K45A 2VMEA 4J25A 1R1A1 5JI7A 4A7ZA 3LB9A 5A1AA 4B1LA 3IB3A 1WW6A 5CIRA 3MEPA 2FQPA 3AFGA 5EHDA 2RE9A 4NUBA 5FZ0A 5FP8A 3W5NA 2D6OX 4FTBA 2WS91 4AEKA 4BE3A 3ZDSA 1YWKA 4LPLA 1GUIA 2QQLA 1J58A 1O8PA 4MGZE 1UD1A 4XACA 5DDJ1 4QXHA 2WLQA 3RI9A 1RUH2 1WZXA 3VHOA 5CEHA 2CWMA 1UX7A 2IWGB 3DF0A 4INDA 1JOPA 1H8TB 4Q4W3 3VBFA 1XNDA 3DKQA 1C8M2 3BIWE 2UY9A 1I9RA 1HQWA 1X82A 3LGRA 3LDKA 2F4LA 2NPIA 3ETPA 2WZ8A 1PGSA 1PMIA 1XYNA 2XDVA 1RL3A 1UZWA 3MBWA 3K2OA 2Y0IA 5C9AA 2VZPA 2GMPA 3J7NA 1DBNA 4XILA 2VZSA 2Q5TA 3EJKA 3DKWA 3KT4A 5GLZA 5HXVA 1TMF3 4WVMB 1BCXA 4KBZA 3IN9A 5DG2A 5SV5A 4MUVA 4OHVA 3ZSEA 2XHNA 2J1AA 4QQLA 4UW5A 3ZN6B 1NCQA 1AX2A 2P17A 5ERLA 1HN0A 1UY1A 3WP4A 1MZ5A 1OQEA 1K12A 1A8DA 1SFPA 4FFFA 4QXBA 5LBCA 3BN6A 1FI2A 1FT9A 2YFUA 3OG2A 1HRI2 1DLLA 4IE5A 3K46A 2VGDA 5F3GA 4AI8A 4MYEA 5BNOA 1DZRA 1JN2P 2MEV1 1ENSA 4LXLA 2V4AA 5B4NA 2JENA 1O7FA 4RQPA 4IV1B 1VPHA 1FNYA 5HCAA 5I0RA 4YZ5A 3QLQA 1OPMA 5C8CC 4Y3OA 1U0AA 2D6PA 3VZJA 2BNOA 5IATA 1FATA 3NWKA 3ZYFA 3ZMNA 5FREA 1F31A 3ZXGA 4CCMA 4COWA 2Q30A 1LB2A 4OI0A 4LE3A 5E1RA 1LGBA 1LOFC 1QF3A 5I91A 3GJBA 4BIOA 1WA4A 1JZ2A 3FFZA 2VVEA 3WDYA 4D7SA 1QQP1 1VAMA 1POV1 1R1A2 1N3OA 3QCWA 5EFUA 2AGSA 1RB8G 2YBSA 4YM0A 1GOFA 1RUH3 3IAPA 5LA2A 1RUI1 2WS92 2CGPA 5CZKA 2DYCA 3SEPA 2FDJA 4FQ4A 1C8M3 4OZXA 5CG9A 5DDJ2 5ABJB 4ATEA 1HV0A 3R4UA 1G8WA 4IL7A 4NROA 4A44A 5A3UA 1EV11 5IYYA 5B4XA 3ALQA 1PO11 3WF2A 4CCCA 5KHJA 3E1F1 3KV5A 2YBKA 4NHMA 1O91A 2O8QA 4G9SB 4AR2A 3IIAA 3SKVA 4BWOA 1R091 1BVP1 3T4HB 3LD8A 3ZOIA 5F3IA 2QQWA 5T54A 2DF7A 4C91A 1U5YA 4ES9A 3DECA 4HPKA 1GZWA 3CO2A 1LGNA 5BYNA 4QKNA 4XDQA 3VBUA 2Y6JA 4BQ5A 2OW4A 3KF5A 4L99A 3E5QA 5LRRA 1AHSA 1H8TC 3T0DA 2JDAA 1IPJA 5LBFA 4COUA 5K9YA 5I93A 1B35A 4FPFA 4AEMA 1ONAA 3B5LB 4GMP1 2RHPA 1JYCA 1QWRA 5A1FA 1CIWA 4LIVA 4YYOA 1S0IA 2GZWA 2HWC1 1PX4A 3ES1A 1X33A 2VW2A 1DF0A 4PHZA 3ZXAC 4AW7A 2YV8A 4AEDC 4UW4A 3RMYA 4I2OA 1LOGA 2YC2A 4NIDA 1CQ9A 3VL8A 5FZ4A 2WN2A 3AB0A 3MW4A 2WNVA 1C5IA 2CYFA 1VIWB 1W6MB 2D6KA 2MEV2 3RI8A 4FPOB 1VRH1 1GNYA 1OI6A 4YSFA 3ILRA 2YHJA 4BB3A 1L7LA 2VBDA 1SDDB 4HSLA 2VCBA 3CZJA 2WN3A 3POIA 5FV3A 2B45X 3PMEA 4Y1YA 1URXA 4BYYA 1FPN1 2XWBB 4QX2A 5DXDA 1QKQA 3BTZA 3AXEA 2VZRA 4LO4B 5EP9A 1XYPA 1VBD1 5FZEA 2OIIA 2Z4FA 2WS93 2ARBA 4OHWA 2RJLA 4I0WB 1QQP2 3A22A 2FZ1A 5EZWA 4BZ4A 3NKGA 1JOBA 3R4SA 1SPPA 3KCYA 4URTA 2HWD1 2Y6LA 3VZLA 4IV1C 1V00A 3VHNA 3V0AB 4Y33A 4Q27A 2HLEA 1AR91 4C90A 1QJY3 3MUZ1 3ZO0B 1H9PA 4AL9A 1RUD1 3AX4A 2ZX3A 4HT1T 4U36A 4XZUG 5FJHA 2GALA 3AVSA 4QGNA 4AWDA 4OMDA 2JG8B 5HCFA 4A4AA 3USSA 4XF4A 1EV12 3R05A 3N7JA 5JMCA 1PO12 3ME2A 4D94A 3TEYA 3NSTA 3KCXA 3ACFA 5KR7A 3S0MA 2E33A 4QB6A 1R092 4B29A 5KC6A 3GHMA 3IM0A 3POYA 5KHIA 3QD6A 2D98A 1XNBA 2ID4A 3SCFA 1PZ9A 1K42A 1YXWA 2TUNA 1UCXA 5GJ6A 4UFLA 5ABJC 3WF1A 5L7OA 5IT6A 1ASJ1 1S4CA 5C9AB 1RUF2 1DGRA 2DCYA 1TE1B 2PHLA 3MIHA 2VO5A 2XHKA 4RL7A 2KR2A 2FCTA 2J1EA 1Y9MA 1NE6A 4YWAA 1W2NA 1LEMA 2BDRA 4PLMA 1C28A 3L9JT 3OBRA 2J1UA 3U0ZA 3OBAA 3WCSA 4WBBA 1W6OA 3KMHA 4A6SA 4HVRA 1NCQB 2O1QA 2WNOA 2HWC2 2XJPA 3OGSA 4CU8A 2MEV3 2NN8A 1JZ4A 1G9AA 3MIDA 2A1XA 2VOVA 3FHIB 3ZYHA 4FPKA 4CRQA 2IXHA 3PNAA 1Z78A 3M7AA 2A6XA 3OPTA 4FBFA 3NJXA 1XSRA 1VRH2 4JDMA 4EN9B 5BNOB 2GH2A 2X29A 4XHXA 3WQ1A 1NXD1 1E5HA 3GBGA 4RQPB 1GSLA 1QQP3 3O5SA 3VZOA 2VZ1A 3THTA 4MG2A 1POV3 3ZXJA 3B69A 2RJ2A 1ZRCA 3J7LA 1FPN2 3VBRA 5HV4A 3B00A 2VJXA 3HNBM 4YW7A 1REDA 1BKZA 1D0GA 2Z69A 4JGZA 3EB7A 4LBKA 2XKOA 1YJKA 1VBD2 3I2HA 4BXSV 2MPFA 1X9TA 1JHNA 5FMBA 4Q4X3 4XUQA 1BXHA 1ND3A 1PHMA 2C26A 2VL4A 4M3CE 4Y5SA 2FDIA 2IXIA 1NLSA 2HWD2 4HN1A 2IXLA 4NVPA 1AL21 1EAH1 1PO13 5FJKA 1AR92 2Y0OA 3O1OA 1DQ6A 3N36A 1HB1A 2JX9A 1T2XA 1QOOA 1O3SA 2PQSA 3WW1A 5FLHA 1R093 1G7YA 1POQA 1DZTA 1GQHA 1QJEA 4ZXEA 4CP2A 2IUWA 2P6CA 3BPSA 4EV0A 2WT0A 3WEZA 3KGLA 1WLWA 3OYWA 1E5RA 1UKRA 3K75B 3RZMA 1RUF3 5IFPA 4E2SA 5HPOA 4XFGA 3POFA 3ZM8A 1PM4A 2ZZQA 1VP6A 2GAUA 2VCAA 2JG8C 4W65A 5D2AA 1ASJ2 1BEV1 4KQ7A 4LO8A 5LY1A 4GMP3 4HPKB 2A3XA 4QPWA 5BNQA 1JZ8A 1XE0A 4NRQA 2HEYF 3NMBA 2HWC3 3JXSA 2VVDA 3VBUB 1OLQA 1HX6A 3FC0A 3QBQA 3ZYPA 2G9GA 3WW4A 5JIUA 4JCKA 4WM7C 2EXIA 1N1TA 1B35B 4B8EA 1QXRA 4FCAA 5FXWA 1S0JA 1VRH3 2PTMA 3O0VA 4CUGA 3ZSKA 5C9AC 3WW2A 3K4DA 5FZGA 2BRTA 3FHQA 3PVBB 1GNZA 3N9PA 2DUPA 4COVA 1W6QA 4M01A 4S2FA 5H9QA 2WNVB 1FPN3 4Z8BA 2CHHA 4LA2A 3C2UA 4O9EA 5CFCA 1UU5A 3K4ZA 4XFCA 1LHUA 2ZX0A 1VBD3 2WO3A 1NCQC 3VD9A 1PK6A 4KH9A 5FLJA 1RUC1 2WO7A 3VZMA 1SHWB 3VN4A 2JG9A 2QDNA 3O1PA 3WNNA 1VRBA 5LWBA 4GIQA 5IVEA 4JQTA 2VMCA 3PUAA 1C1LA 1S0CA 4ZKTB 2KD7A 4P9LA 1AR93 4TYSA 2Y8KA 2ZAAA 3KT7A 4E9KA 4LITA 1KJLA 2D97A 4N43C 4CDUA 5HBAA 4LNVA 5LATA 1PNGA 3ZPYA 1YQ8A 3HOBA 5A6QA 2J1TA 3EQEA 1NUKA 4GD4A 1AYN1 1H6YA 1AL22 1EAH2 2J1RA 1SPPB 1NCRC 4RQPC 4RS5A 5FBZA 3FLRA 4EN7B 1JZ6A 3HQUA 2W91A 4QU1A 3QACA 4IEQA 1W05A 4CP1A 1OT5A 2BW8A 3WVJA 4FTEA 4DOUA 3E6BA 1RUOA 1OLRA 4F3JA 2VTXA 4Q1RA 3WNPA 1YQ2A 2P2KA 3D82A 4FP2A 5BNNA 3KHCA 1DCSA 3JD71 3IDBB 3KT1A 1JYNA 5L36A 1DGWX 2J7MA 4Q2FA 3FJSA 5FPAA 1SLLA 5FWEA 5A33A 3H8OA 5CKMA 3ZKYA 4JKLA 4XUOA 2BWCA 3AMNA 3KM5A 1QXPA 3SCGA 3GDBA 3IIIA 2X05A 1IOAA 1BEV2 3A23A 4Q8LA 4QDSA 4RGKA 1CR7A 3WUDA 4K1YA 2W39A 2FDKA 3PU3A 1HXS1 5CADA 1UMZA 2ZA9A 3ATGA 5IVJA 4H55A 3PVEA 3WG4A 3EMRA 1RJ8A 1ULCA 2H0VA 2VQTA 1W6OB 3A0KA 3VLBB 1VBA1 2LTNA 3CQOA 2NLRA 1CZSA 5FXVA 4N90A 3RVHA 1LU1A 1C5HA 3RSJA 3VBUC 4Z2WA 1MVQA 4XUPA 4ASLA 1YFXA 2B8MA 1RITA 3S7IA 2LRPA 1PZ7A 4R9DA 4QGMA 3SH4A 5JR2A 1ZREA 4CXWA 3OCPA 4HKOA 1CZVA 2QQNA 4WZCA 4CCJA 5AFEA 1WLDA 2PELA 4FXKB 4IGOA 2YZ4A 4AK3A 4CUBA 4ZY9A 1RUC2 1L7RA 5FZIA 3OD0A 1ZZCA 2YXSA 2ATFA 3I2IA 3WCRA 1W9TA 1EAH3 3VBRB 3MIBA 4HVOA 2WFF3 4JGZB 2RG4A 4LHLA 3WUCA 3H3UA 2VW1A 3W58A 4L92A 4YW6A 2OPWA 4HMZA 4LBOA 1ND3B 3H1WA 4GJYA 2JDPA 2D3PA 3ECQA 4Y20A 2KM2A 3AVRA 5FZ9A 1ALYA 4OZOA 2WO1A 5CU1A 1I3HA 3UJQA 2A73B 4XXAA 2VZ3A 4DB5A 3CJIA 3FX3A 4IGQA 4UT5A 5EQUA 5F2WA 2ZX2A 3GYDA 3KV6A 3MIFA 2H6CA 1OQ1A 2OYZA 3MLJA 3JD72 4XW3A 3WHUA 1IKPA 1BEV3 3FBYA 1COV2 3R0RA 3ACHA 1UY2A 1UIJA 1V6JA 1V6OA 3H50A 1HRV3 4OLLA 1ZNPA 3OYWB 2DU1A 3AZYA 5HV0A 4TXWA 4Q1PA 2QQJA 1F35A 5GZEA 2IC1A 1AR71 1C1FA 4YGEA 2B39A 1JYTA 4XFIA 5IUQA 4XC9A 1W06A 5LK5A 5JOWA 4UBHA 1UPIA 3OEAA 5JPMB 1BJQA 1SCSA 2X5IA 4K20A 1HXS2 5FPBA 1LOFA 3ZN5A 3WNMA 1UOJA 1X9PA 2WJSA 4GWNA 3SH5A 2PLV1 2GNDA 3I2JA 1W0NA 3LSEA 5C70A 5JSPA 1OA2A 3KVAA 1OC1A 3M3OA 1O3QA 1VBA2 4BHPA 1TNFA 4BMBA 4KWJA 1HV1A 3CBNA 1DQ5A 3E6DA 3PHMA 5IVVA 4MGTA 3LEMA 1OXCA 5H9SA 5IW0A 5EYXA 4P5HA 3VBSA 4FI9A 1VBB2 3WNKA 3CL1A 3FWEA 1W6QB 4YZ3A 4CE8A 4HKLA 1UX6A 1MPXA 2R6QA 2VPVA 2WRAA 2VQUA 4YLZA 5A7QA 1F4HA 2MHFA 3V64A 4LHKA 4BPZA 4YFZA 1UOGA 1PK6B 1WCKA 2R7EB 3KQRA 5FP9A 3R6SA 4LLFA 2ADDA 4E8CA 5FQ0A 3N9QA 1O3TA 2YY1A 1ZRDA 4LLOA 2JG9B 4XJAA 4YNIA 5FZ3A 1AUYA 2QVSB 4MH0E 4XIOA 2JDUA 1FX5A 1UOFA 1VAVA 2QQMA 3ETQA 2P34A 3IBMA 2XQXA 4RHV1 3O1TA 4QAWA 3WG3A 4CDUB 4DXSA 4J6GA 1QJFA 4XQDA 2XG3A 4HETA 1R081 4XUNA 1KXGA 1TME1 3ABZA 4GXLA 4RS5B 5A32B 3NL1A 1QJU3 1JYVA 1COV3 2AYHA 4LQRA 2D44A 5TSWA 3EXUA 4K8RB 3A21A 1OQDA 4JGZC 3VDDC 4AEDA 5FY1A 2I45A 1S0EA 4DNYA 1S0FA 3ZDVA 1ZYBA 3WOGA 1ND3C 5L9BA 3OJBA 5BNNB 5DG1A 4R4XA 3I2OA 4JDOA 4DRVA 2VAUA 2KXLA 2BFUS 3KB5A 5GZFA 3U07A 5A33B 1S2KA 4UWDA 1AR72 4C8DA 2WYFA 3FMGA 3DL3A 5FO9B 2RR11 3I97A 3X29B 3RYPA 1GFF2 5JZGB 3UETA 4O61A 2ZMLA 3JUUA 1VBA3 1SCRA 2VR4A 1F9KA 3FHAA 4LMFA 3LE0A 4NHLA 1P8JA 2PLV2 5FY9A 3ZSMA 2Q8CA 3ACGA 2QZ3A 2H6BA 1VBB3 4LK7A 1DG6A 2EICA 1AL0G 4YG6A 2ZJCA 4BQWA 1VBE1 4HOOA 2ENRA 3RFRA 4FAGA 5F6KA 3LPFA 4BLIA 3OGVA 4LJHA 4CEYA 3LA3A 1UIKA 2BJSA 2RDNA 3FBMA 3MFAA 1H2NA 3FLPA 5AVPA 2QQIA 1SACA 2Q4SA 3WF4A 3ORJA 3O7OA 2E51A 1GP4A 3E5UA 3CJXA 2C24A 4KU7A 2GP3A 2QFEA 4I09A 4MXWA 2JDHA 1RMU2 1W2TA 1RVF1 2BFUL 5FMCA 4MGKE 2W46A 5CG8A 4GALA 2QNKA 1A34A 1UZ0A 3RYKA 2D5HA 2W52A 3WQ7A 2DBNA 4ZU4A 2WNUB 3AP4A 2VULA 5FUNA 4RHV2 2Z2SB 2ZHMA 1KJRA 5GLTA 4LKFA 1JTZX 4QXCA 1ODNA 1ZA7A 1WCDJ 3RNSA 4S2DA 1ND2A 3Q8BA 1R082 2BP6A 3WR0A 1GBGA 4RSUA 2WSUA 1TME2 1ZRIA 1RUJ1 1PO21 1GWLA 1NZIA 1PK6C 2IFRA 2IXJA 2UWAA 2WWJA 3WG1A 3NNLA 3I3BA 2VCCA 1Y4WA 2JG9C 2V5YA 2JIJA 2ZGPA 3U4SA 5FZDA 1UY0A 4TSVA 2ARAA 4BQYA 1BLZA 3CJIB 2VBPA 1H1AA 3OGJA 1PZ8A 3I59A 1AR73 2BYVE 3AKPA 3URFA 1FXZA 4FP3A 4Y26A 4CDUC 2IZWA 1H1IA 3F95A 1MS3A 3OUHA 3BPZA 4PIZA 2VMHA 1T6BX 1PGW2 4MOAA 5DAPA 4YW3A 3ZXEA 1MS8A 3UKVA 3MFCA 1YLLA 2D93A 2ZHNA 3I3DA 4RS5C 3WQBA 5FZ6A 1BMV1 1DDLA 4CVUA 1SLTA 2OUJA 2R0HA 2VMFA 2XOMA 1N47A 5FYYA 4Y1UA 2WO2A 2RR12 1XOYA 2PLV3 4XAAA 2E63A 2YU2A 1OURA 2P3YA 2QUOA 4JGYA 5C5TA 3ZYGA 1PGL2 3SCHA 4UW3A 3AXDA 3MPBA 4MX3A 4NO4A 1CZTA 2X5IB 5BNNC 4EWEA 3LDRA 2O0OA 4M0HA 4DUXA 3DV8A 3SXWA 4AVVA 2MNGA 2RJKA 2VUAA 4FO9A 3I8TA 1OA4A 4P9WA 1JYIA 2B9UA 3IPVA 5LEKA 4DINB 1PIV1 2XLAA 4EWDA 1IKQA 1O4YA 1VBE2 2Y34A 1LULA 2D5FA 2DCTA 2Q1ZB 3ST7A 3ZXFA 1WCQA 5IHRA 2FCUA 5JZGC 5FFOC 2XVLA 4YGCA 4BJ0A 1WW4A 1RMU3 4A7KA 3C7EA 3VBSB 4XF3A 1YNAA 4YFWA 3LEIA 4CTEA 2F17A 2I74A 4KWUA 4Q0VA 3S5AA 4PF1A 5HXMA 1Y9GA 2W9XA 4RHV3 1TG7A 5FPLA 2ZACA 2VOWA 1RVF2 3NNJA 4KL1A 1TQ5A 1MZ6A 1QY4A 1R083 2VOTA 1XXNA 5FQ0B 2JG8A 2WZR1 1AVBA 1TME3 4P02B 4XCAA 1BYHA 2E26A 2VC9A 4LOTA 1DQ4A 2W47A 2R16A 2DDUA 2VD7A 5LBEA 3MUY1 4YM1A 1MR5A 4OHZA 5J48A 5EJ1B 1PO22 4WM7A 3T3YA 5J09A 2WA4A 3PUQA 2DVGA 2EIEA 3KV4A 5FXZA 2N7GA 3S7EA 5FYCA 2WNUC 4GKYA 4QD2A 5F32A 3ZPOA 3AYDA 1XPWA 4OQ8A 1N3PA 4DY5A 4AEDB 2GN7A 4P14A 4CCEA 1LOAA 1PVXA 5J96B 2RR13 1OKQA 2VNOA 3N3HA 2YUEA 3N9LA 1SLAA 2P3KA 3CDZB 2UU8A 2XJRA 1OLMA 2LUWA 5F6LB 3I4IA 4CUCA 5JXHA 2XPJA 2E32A 3T4VA 1GLHA 3M3EA 3BGAA 3T2QA 1NY71 1LOCA 3JB8A 3S5QA 2OXBA 4TZDA 1V6MA 2XMLA 1L7QA 4IEXA 4QQOA 5CFDC 3DYOA 5C3QA 3O1RA 2EIBA 4QHBA 3M3IA 3CJIC 4RR3A 5FBJA 3P6BA 1CAXA 2HWE1 2FD8A 2LM3A 1LHOA 4N43A 1XJAA 3MO4A 4FPLA 1OOPC 1AJKA 3JU9A 5FUPA 1JUHA 1PIV2 1ZZ7A 2Y60A 3NNMA 4NHKA 4A6OA 4E8DA 1EY2A 1NCRA 1YFWA 2L9LA 3NAPB 1WWYA 3MW2A 3SNMA 3U14A 5J1XA 4Y1XA 4AVSA 4AEJA 1LECA 2XL7A 4NAMA 5C8WA 4PI2A 3TN91 5A7WA 2NYYA 2X5IC 3PJQA 4AHYA 3UL2A 1J3RA 3RS6A 2ZEXA 4CEYB 1WA6X 3POJA 2AACA 2JE9A 4FFHA 4D0QA 4E27A 3OB8A 4NR1A 2VMGA 1NA1A 1W03A 2K9ZA 4EE2A 2DURA 4FPCA 5C3SA 1KRIA 4K40A 1DQ1A 1HQLA 1LHNA 2VMDA 2W95A 4IEUA 4L97A 2ZX4A 4MXWB 2WZR2 1Q3EA 1O6UA 1UKGA 3MI8A 1PO23 3VHRA 1X8EA 3DYPA 2WT2A 1FOD1 1UOBA 2GNTA 4BH9A 3PLQA 3CLPA 3O0WA 4GB31 5H9PA 3VBSC 1UQXA 3GBWA 5FKCA 4LEJA 2PAKA 3UNPA 2XB6C 3PVNA 3WDWA 2WINB 5FZHA 2VZQA 2D6NA 5DUVA 4AFBA 3WNXA 1BVVA 1ND2B 5HCHA 5IK7A 2I07B 3C7HA 1RHI1 2E7TA 1UO9A 2PHWA 3PIGA 3BOWA 2XGXA 1TZOA 2RS31 1OFNA 2Z79A 1Q8VA 1N1VA 4D69A 1QOTA 2B5HA 5F5IA 4ZZ8A 2VBBA 4M4PA 4IW3A 3BALA 5FUIA 4A41A 3I59B 1GWMA 4KI5M 1UXZA 3SHRA 1RJ7A
chains in the Genus database with same CATH topology
4J1XA 4XF9A 1BQPA 2GC3A 1DFQA 1NY72 2OVUA 1HRI3 3HT1A 3OD4A 3VBHB 3LOBA 2GMMA 3MIEA 3AMHA 4O9GA 3D5OA 1PIV3 3T2TA 2HWE2 3ILFA 3N4MA 1SFYA 3AP7A 4JGYB 2EAKA 4X8NA 4YM2A 2JICA 4LBLA 3PJYA 2D3RA 1CAUA 3IPVB 3JCIA 4XTMA 4YVWA 2K0GA 4N53C 1R1A3 3TN92 4LBQD 3LZZA 1AF9A 1QH6A 5BPXA 4E2QA 3WXPA 3HWJA 1AX1A 1BBT1 2WZR3 4P9XA 2WKKA 3IDCB 5DDJ3 3NAPC 4B4PA 1YFYA 4YARA 2A3WA 3WQ0A 4KGQA 5LRSA 1RUI2 3M2MA 4ISRA 2D7FA 1FOD2 2JKBA 4MZUA 1S1AA 4GB32 1DGWA 4CEYC 1MQTA 5FDBA 1HLCA 5FPZA 4YRDA 2UURA 1OMIA 1J59A 4BLJA 4FTSA 2PAMA 4RA0A 4XQWA 5K7PA 4HBNA 1RHI2 5J98B 4C0BA 3ZYIB 2GNBA 4WM7B 4Q26A 5GKAC 4E4SA 2XJSA 1D4M1 3EO6A 2DTWA 2RS32 3BB6A 2GNMA 2VMIA 4CP0A 4XE9A 3TNPB 4XJZA 1QHDA 4LO6B 1ENQA 3TNQA 4Y4YA 1JW6A 1X50A 2JDZA 3OPZA 5IK4A 1ND2C 2HWE3 3AYEA 3ZYJB 2GH8A 1IS6A 1OD5A 5I8SA 3OTFA 3AKRA 3GZAA 4RR3B 1CAXB 5FO7B 2ZAHA 1LENA 4FPGA 2QKDA 4R4ZA 4N43B 1N1YA 3TN93 2EXHA 4PIYA 5E16A 1XQNA 3R4DB 4DRRA 2ZOEB 1Q8SA 3MYXA 3VBHC 1NCRB 2VVFA 3D6EA 3ELNA 3N35A 2XLGA 3S30A 1M4WA 5DZFA 1APNA 3AZZA 5GLVA 4JGYC 3VDDA 2ZGSA 3W59A 5KXEA 1RUI3 2AENA 1BBT2 2YPJA 2IFWA 4IEYA 1RUG1 1WBLA 1MS4A 4G4FA 4GB33 5I0UA 1NA1B 2ZPXA 4MLOA 1EV13 3B93A 4Y24A 5T3NA 1SLBA 3WP3A 1MEC1 3L2HA 4LHNA 1RUD2 3DGTA 3BU7A 5CBLA 1RHI3 1TNRA 3ES4A 3H0OA 4AVTA 4ZXKA 3LA7A 4KU8A 5JOZA 5EYYA 3ZSJA 4B7EA 2BQPA 3WHTA 3QOPA 1QU0A 2GC1A 2X53S 1CX4A 1D4M2 4ITCA 1WUVA 2B42B 4OFGA 3H7JA 1CJDA 3P3PA 4S2HA 4LA3A 3TB0A 4XMIA 4YG3A 5JVVA 4NWWA 3RMXA 1QNWA 3VGIA 1V6IA 3ZSLA 1D0HA 4LULA 2ZBJA 1KS4A 4B3NA 2DVAA 3ZMOA 3LSDA 1IS3A 1A8MA 4MGYE 4U2AA 1QDOA 5I8TA 2ES3A 2NQYA 1GICA 2O8OA 2CGOA 1IPKA 3SMHA 2BVVA 1MS1A 2ET7A 3AK0A 3FUOA 1AJOA 1WW5A 1F8VA 1K5MA 1CAUB 4YW5A 5I0TA 4YVWB 4HL0A 4BM8A 2HWD3 4RR3C 1TEIA 1GNHA 1LOBA 4YG0A 4DFSA 2DU0A 5I8YA 2A5ZA 2VQAA 5KXBA 1RUD3 1MS5A 1RUG2 3WDXA 1AR81 2XH6A 4P9JA 4YW4A 2XWJB 5A32A 5KHHA 2DFCA 5J3UA 1MEC2 1SLIA 4Q29A 4COYA 4QQ2A 3GNEA 1IS4A 3B9IA 4FPEA 4JVAA 1CONA 1D4M3 3V65A 3O14A 1MQTB 4FQZA 5T52A 1ASJ3 1NA1C 5C4WA 1ULEA 1EPZA 3KS7A 1H8VA 2ZGMA 2A7AA 4A3XA 3HN1A 3H7YA 5JZGA 2CAUA 4LE4A 4ORFA 4Y22A 4C1WA 1X8MA 1F5JA 4YGBA 3CEWA 4Q0SA 2ZHKA 1D2SA 2R49A 3WP5A 1U12A 1LHVA 4H7LA 3DN7A 1PVC1 4KBBA 1DZQA 3AZXA 3JBG1 3TAYA 4QT6A 2NP0A 3H9AA 2PQQA 4HANA 4IETA 4XBQA 2YDEA 4BA6A 1JBCA 1FV2A 1IQAA 1DU3D 3RZZA 3HMYA 3JQXA 1NOVA 3GALA 3WY6A 1WGPA 4W6WA 3UKTA 1S2BA 5DZEA 2GC2A 2R1BA 1ULFA 1J3PA 1RUG3 1V6NA 1G9CA 3PTYA 3DPRB 5IK8A 3IDEA 2WIIB 4XMAA 2A6YA 1Y3TA 2WNUA 1AL23 3ZFGC 5GZGA 1VBC1 2BWAA 5C33A 5JCTA 3VDDB 1Z7S1 3MF9A 4AQ6A 2E7QA 4B4QA 1NYWA 4G3YC 1AXYA 1AYN2 4IEPA 5B2GB 1GKBA 4AHZA 2ZZJA 4QMAA 3ZN4A 2JJ6A 4XBNA 1QOSA 4I0AA 5A3LA 3H1MA 3B3QE 3AKSA 3GZTB 4YVWC 4XFAA 2RS11 1O3RA 2QQPA 2W0XA 1DQ2A 4K6BA 4XBLA 4FT8A 2DCZA 2BGCA 2NZ9A 1ULDA 1H2LA 4ONUA 1Q8OA 2ARXA 4I02A 4N9IA 4AI3A 5A3MA 2E53A 1OOPA 4YZ2A 1ZBA1 3ACLA 1YYNA 4Z82A 4GMP0 1LKNA 2G9FA 3BOPA 1G6NA 2NMNA 2EA7A 5JSRA 5CNAA 1RTVA 3V56A 2ETEA 1MQTC 1U5ZA 2KA3A 3UV9A 4LUKA 1U5IA 5CA6A 1VR3A 4KNCA 1IHMA 3J4UH 2DUOA 1DQ0A 2X8KA 2JD4A 4TLFA 1PVC2 2D6LX 1N1SA 4DS0A 1KQRA 2C5DA 2EXKA 3JBG2 1VB2A 2CTVA 2VY0A 3E97A 2CAVA 2PHUA 1CAVA 1RUC3 4IEZA 1QXJA 2RM21 5EWSA 3FUQA 2D40A 4YVSA 2XUMA 3USUA 3NKTA 5C6CA 2A71A 4SBVA 3NO8A 3B9CA 5DZGA 4AHXA 4R9AA 3J8F1 1S0DA 4WVZA 2A3YA 1K5MB 4P9IA 1WW7A 1AYN3 3ZFEA 3IKWA 1VBC2 2OZ6A 1Z7S2 3Q9OA 1ULGA 1G86A 1LU2A 3ZXDA 1F2NA 2CL2A 1CPMA 4BOWA 4AQTA 5FMOS 2DCJA 1HKDA 1D2QA 2RS51 3WT3A 3JD73 5E88A 3DPRC 4QQHA 2RS12 4AFMA 4F7ZA 2R30A 4ASMB 4XFHA 4J1WA 2WC2A 3OY8A 2YGLA 5JWPA 1CPNA 4AYUA 4RGGA 1EPWA 2W08A 4W6XA 1UF2C 4CDWA 2HWF1 2WZPP 5JOYA 1RUE1 1ZBA2 3B02A 2HJIA 5C4WB 1HXS3 1Y43B 2F4PA 3UK9A 3J9SA 4N53A 3D8CA 3J26N 4Q4Y1 1LHWA 4QU2A 3JBG3 4Y22B 1AX0A 4H7MA 4OI2A 4JDNA 3H1YA 3RJ2X 3IT8A 3NAPA 5FMOL 1HDKA 3ZVXA 5JI9A 5JOXA 1FYUA 3WP6A 4YW2A 1YO8A 5KBFA 1NG0A 3ZFFA 4PCRA 2ZX1A 2HEWF 2RM22 4H14A 1Q56A 3WZ1A 4CYDA 1V9U1 1VBC3 2SBAA 3CF6E 3AFKA 3VUOA 3J8F2 4FOYA 5KXCA 1Z7S3 1WBFA 1SMVA 1LJ7A 2A6WA 5HI0A 4IXLA 2QJVA 1ENRA 4RD7A 4E2GA 3HD8B 4D3WA 4DXZA 5E89A 5J7MA 1GQGA 1X36A 3MF6A 1HW5A 5FRAA 4HSJA 2CV6A 1F5FA 2C1FA 3VL9A 1K5MC 4META 1DHKB 4N9HA 1H30A 2H0BA 4XIKA 1CGPA 3AZWA 3D0SA 4AHWA 4DZGA 2HWF2 1H9WA 5KC5A 4PLOA 1CD3G 3TWIA 1OFSA 2QCSB 3V0BB 1OOPB 3H3ZA 5LEJA 5EJ3A 3VBHA 4COZA 1W0PA 5GM0A 1QGLA 1NE4A 4Q0PA 3TBDA 1UW8A 4CDQA 3M4FA 3AJYA 4Q4Y2 1GZ9A 2DTYA 2EALA 2FMDA 2ZGRA 4Y1VA 1C3HA 1S0GA 4P9YA 1SLCA 5C4WC 2Z42A 2EXJA 2D3SA 2RM23 2TNFA 1N3QA 4YGDA 5AC91 4V1PA 5JAXA 3AMPA 3IWZA 4FVVA 3J8F3 1LRHA 4NWVA 3LAGA 2PHFA 4C1XA 1CAVB 2PA7A 1V9U2 1S0BA 1DIWA 3VHPA 1H0BA 4YVSB 3USUB 4EROA 3KZ4C 3T1LA 3BCWA 1RUNA 1DGRN 4CZSA 2XVGA 3LOIA 4AF9A 1UAIA 4K9SA 3RPQA 2UWBA 4MSVA 2BVBA 1JH5A 2IXKA 3ZFEB 4CEWB 1C4RA 4KG8A 4Z1VA 4QPIC 5BY5A 3I2DA 1H4GA 4DY3A 4D7YA 2XBO1 3AYCA 1LESA 1UN1A 1RUJ2 4K3UA 1RINA 2HWF3 2UYAA 4R8HA 3ZYRA 4YZ1A 5SV8A 5L73A 4XF1A 4MV2A 3OY8B 3WV6A 2NMOA 4JV4A 4DQAA 4HLTA 4EN8B 5FOJB 4MVTA 2CY6A 4CDWB 4Q4Y3 4I01A 1HIXA 4WZFA 5FOBB 1BMV2 2CNAA 1QJX1 1LEDA 4AI1A 1QJY1 2OZJA 4FPJA 3MLLA 2JE7A 1Q8QA 2WL1A 4LBJA 4N53B 3ENRA 4QM9A 5CAZA 1KITA 1VBE3 1UL9A 2I2SA 1BK1A 2D6MA 3WD5A 1WMDA 3M70A 1V9U3 3B7MA 3ILNA 5GALA 5AC92 1EP0A 2P37A 5JR7B 2ZKLA 1W39A 5EXOA 1CN1A 1ZA4A 2A70A 2OUHA 1OA3A 1RVF3 3ZFFB 4AI0A 5ACA1 2YYOA 4Z92B 2ZGQA 4XYXA 3S6PA 4I0BA 3LKJA 2BTVC 3K48A 4M3CA 3M3QA 3AKQA 5GLUA 4FSJA 3MDPA 4TWTA 2FZ2A 4OVEA 1YUDA 1RUJ3 1NQDA 4IV3A 4AE2A 4HKWA 1DYPA 1ZX5A 3E6CC 1I5ZA 5DUUA 3VKOA 1V6LA 4PQ9A 2CGNA 1LCLA 1VALA 1W6NA 4H3WA 4YVSC 3JQWA 4B4RA 2XBO2 4KWLA 4JTOA 3NV2A 5J36A 3WDVA 2WFPA 3GZUC 4AXOA 2DFBA 4I30A 3B01A 4QX5A 1S55A 1B09A 1XRUA 2XJTA 1LGCA 3ZFEC 2TBVA 4CEWC 5K0UA 2IXCA 1CAWA 4E4DX 3LWCA 1W6PA 2BPA2 5CFDB 2ZGOA 4Q4X1 2V73A 2R0FA 4PDWC 4ISQA 2B7YA 3AJZA 2EVXA 4L8QA 4BIFA 3EHKA 1QJX2 1G9DA 1QJY2 4JAAA 1NLRA 1XE8A 1ZBE1 1YIPA 1IGOA 3SITA 4CDQB 2YC0A 5DUXA 2GC0A 2C0ZA 3ZFGA 1WLCA 5LK7B 4XZPA 5AC93 1ZRFA 2BUKA 4WVWA 4CDWC 4IEVA 5D8AA 4WVVA 3U4XA 1RUF1 2PYTA 4N7UA 5T5LA 3RRDA 3NV3A 4JC1A 3TRSB 2ZHLA 1ZZ8A 4IESA 3MPPG 2XL9A 1C8NA 1A6CA 1XU1A 2C9AA 5ACA2 2B46X 3C3VA 1GV9A 2ZKNA 2ZS6B 1J1LA 4FAHA 3I7DA 1Y9QA 3HBZA 2XBO3 1ZVFA 2VECA 4Y1ZA 5T50A 4XJ9A 3RQ0A 3ZFFC 2A6ZA 4MGIE 4K1ZA 1UZYA 3FFQA 4QPYA 1VLNA 3RWNA 2ZGUA 1D4VB 1J1TA 4IERA 3FLTA 4XTPA 1CESA 4YZ4A 1QJX3 4E4ZA 2QE3A 1XE7A 4Q4V1 1ZM1A 4Q4X2 4X8PA 1LODA 3T1MA 4AG4A 4QQPA 1AR61 4EJRA 4EN0A 3D0JA 4ZU7A 4ZU5A 1WCSA 4AVBA 2WNEA 2XVKA 4PBOA 1JUIA 2A75A 5BXXA 4CDXA 1ZBE2 1KDKA 3VBFB 2ET1A 3K51A 2XJVA 5JPNB 1W0OA 2GDFA 2HKXA 3AMMA 4LBNA 1JOJA 3L2YA 3MLKA 4L9BA 4EN6B 5CFDC 4QPGA 4MXVA 2DV9A 1T6GC 4HFSA 4A2UA 3N7LA 3HT2A 3VZKA 1ENXA 2VNRA 3VKMA 1PNFA 5ACA3 3VKFC 1VB4A 3NW4A 3DPRA 4CDQC 3W9AA 4AVAA 4BMEA 1UPSA 1Q43A 1MS9A 1Y7BA 1E57A 3WX5A 1FAYA 1VJ2A 5KHKA 4QXKA 3KLSA 4XXPA 1FOD3 5EV7A 2TEPA 3MW3A 4IEOA 3AP6A 2ZCWA 4BCUA 2E7AA 5FPXA 4M3CB 3NV4A 4SLIA 4AFDA 5KXDA 3NV1A 3KD4A 2E6VA 1IS5A 4IV3B 1Q8PA 2RS33 5GZDA 2EF6A 3RDIA 4R9CA 1W6NB 1AZDA 4XF0A 1I1EA 3PVOA 4LTAA 2DCKA 2R041 3THPA 4C0HA 4A7YA 4UXAA 1LR5A 5H9RA 2WFF1 4Q4V2 5K0UB 1XYOA 1CAWB 1ZBE3 1W6PB 3KSCA 2JEMA 3POSA 1GYKA 1AR62 3M8LA 5J37A 2OA2A 4NPRA 3O0XA 3N7MA 4GULA 1CJPA 2QDRA 5K8SA 3G7DA 4LBQA 4NOTA 2ZMNA 4AQSA 2VW0A 2DUQA 4PLNA 4L2NA 3ZFGB 5FCCA 4K21A 1WMFA 1YCIA 2P3JA 2ERFA 1QJZA 1KD7A 3B94A 1GZWB 1HRV1 4XFBA 2VH9A 4GKXA 5D8AB 3MGUA 3ROUA 2VQ0A 5FO8B 4LO5B 1BBT3 1A3KA 3VBFC 4OHXA 4WM8A 1ZZ9A 1WD4A 2FBEA 1RGSA 3ZIWA 2BNNA 1BZWA 4AGRA 3EBRA 3VBOA 2GU9A 2SLIA 3POWA 3GHNA 1FV3A 3JB4C 1UZZA 5BUVA 4HK8A 2QZ2A 3OBTA 1GR3A 2HWB1 3AZVA 4PF5A 3LA2A 4HZFA 2Q1MA 3ZIXA 4OUMA 2YROA 1QDCA 3D4KA 1UU6A 4I3PA 1YFUA 4F8AA 4IEWA 4Q4V3 4XJ8A 2EIGA 4QM8A 2R042 1SEFA 5CB7A 1WLTA 5BNOC 1AR63 4XJWA 1SFNA 2R071 5BNPA 5IK5A 3KCCA 3NJZA 3RG0A 3ZXLA 3JZVA 2WFF2 1YI9A 3AP5