2R1DA

Crystal structure of rat neurexin 1beta in the ca2+ containing form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
GHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurexin-1-beta
publication title Regulation of Neurexin 1beta Tertiary Structure and Ligand Binding through Alternative Splicing
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion, splicing
total genus 42
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, W
ec nomenclature
pdb deposition date 2007-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r1dA00
4Y1VA 4ZXKA 2D43A 5GZGA 1Q8OA 1B09A 3QCWA 2C5DA 2Z42A 3AP5A 1QOOA 2GN3A 3WLUA 2WJSA 4Y24A 2EXKA 2VW2A 3ATGA 1FNYA 2BQPA 2HYKA 1DQ0A 2A6WA 1UZZA 1LGNA 1AXKA 2ZGMA 1YO8A 2A6XA 1G8WA 4I30A 4YG6A 3ZXJA 1SBEA 2VU9A 1AX0A 1BZWA 4XJ8A 5H9QA 1WW6A 3V65A 1LOCA 2ZA9A 4M3CA 1V6IA 2DU1A 3VKNA 1CESA 1BJQA 1PZ7A 3AZWA 1W6PB 1JW6A 4IQPA 3MW2A 1G9DA 5LK5A 3M1HA 3OYWA 4XILA 5HCBA 1KRIA 1ULEA 5GZDA 2A6YA 1S0JA 1AVBA 4ITCA 1ENSA 3N7JA 1FATA 4FP3A 1FNZA 2ZHKA 5T50A 4WV8A 1NXD1 2SBAA 1W6NA 1I3HA 3TAYA 1DBNA 2GNTA 2YROA 1QNYA 1CPMA 4NO4A 3WG2A 3WDTA 2ZHNA 4AGRA 4C1WA 2ZMNA 4RL7A 1IKQA 2AYHA 3IPVA 1YIFA 2P3IA 5DZEA 3WUDA 5SV8A 2R0HA 4XTMA 3SH5A 4FVVA 4YZ5A 3D5OA 2PHUA 2D6KA 1Q8SA 4YLZA 2A3YA 1MS5A 3SISA 3ZXFA 1F5FA 1APNA 2ERFA 1S0GA 2ZAAA 4M3CE 5GLWA 1SACA 1W6PA 3WHUA 2JJ6A 5AVAA 2YMZA 2ZKNA 3N3HA 4GXLA 5IT6A 5JOWA 2ES3A 2EALA 3DGTA 1CONA 1V6KA 1WCSA 4XIKA 3VV1A 1UKGA 1GICA 1GV9A 3LSDA 4ZKTB 1G9BA 2JE7A 5JMCA 2PHTA 4NOTA 4PCRA 3AYAA 4FPJA 1GZ9A 1MACA 3WUCA 4YFZA 5IK8A 5DUVA 5GZCA 3BTAA 3JUUA 4YW3A 4YW2A 1WD3A 1DYKA 1MS0A 1LHOA 2A7AA 3IMNA 4XMIA 3VUOA 1ONAA 3T1MA 1BYHA 4XXPA 1GNHA 1V6LA 4Y20B 4YGDA 1QMJA 1WW4A 1CR7A 4XJAA 1LTEA 2EIGA 3ZSKA 3O0XA 4PF5A 4FOYA 4R9AA 5GM0A 5CNAA 4BMEA 1LOBA 1H9PA 1LOAA 4YGCA 4PBPA 3V0BA 2ZZJA 1IS5A 3AYEA 2EAKA 2R1DA 3NV4A 1GYKA 3AK0A 4AWDA 1ENRA 3R05A 4Z8BA 1LHNA 5E89A 4XIOA 4FOWA 2WT1A 3M2MA 2W52A 3GNEA 2I2SA 2LTNA 2PHWA 1AX1A 2ZGOA 5E8AA 3B00A 1CIWA 1UMZA 3CNAA 4YG3A 2CNAA 1JYCA 2GMMA 2NYYA 2WSUA 4FPLA 1N1SA 3ZSLA 2C9AA 1LOFA 1C1FA 5DG2A 1IOAA 3VKOA 5H9PA 3LCPA 4YM1A 5T52A 1VAMA 5DUXA 4K1ZA 3FBYA 4K20A 1FAYA 1G86A 1N3PA 4XBNA 1MVQA 1V6OA 4M01A 5HCAA 3PMEA 4FPCA 5DZGA 3ZXLA 4FPFA 4YGEA 2DURA 2WLQA 1LHWA 4XJ9A 1HKDA 3OGGA 1GSLA 5BYNA 1MS3A 4XBLA 4YW4A 5E88A 2A70A 3SLIA 1WW7A 2R49A 2E53A 5GLUA 3FLRA 2UWCA 1W0OA 1GZWB 1DGLA 1GZCA 2VY0A 4FPOB 4XDQA 1LECA 2ZGUA 4LBLA 2NMOA 4FPYA 1ULCA 3VKMA 1SLCA 4AVSA 4Y22B 1UAIA 1S0DA 3USUB 3WV6A 4XZPA 4BQ1A 1Q8VA 4BLJA 3WDWA 3Q9OA 1N47A 1WD4A 1G9FA 1C57A 2H0BA 2JKBA 3KM5A 3OJBA 4CTEA 2P3KA 4YZ4A 4CRQA 1ULFA 4Y1ZA 5IK7A 3V0AA 3HMYA 3N7KA 4FOVA 1QOTA 3WVJA 3ZPYA 2VW0A 3OY8B 5IK4A 3TB0A 3B01A 5JVVA 4GALA 2Q5TA 5T5JA 5KXDA 1BKZA 1LULA 1AXZA 1IS4A 3O5SA 3JU9A 1CN1A 2DUPA 1G9CA 1F31A 1FX5A 2UURA 4DQAA 4LBQB 1HLCA 5DXDA 3RS6A 5JOYA 1DQ2A 2ZHLA 1JOJA 2GMEA 3WG3A 3RRDA 1KJRA 5EYXA 3AP7A 5CA6A 4TZDA 1W0PA 1C4RA 2ZGLA 4OZXA 2ZGQA 1GNZA 1A8DA 1GBGA 3A4UA 4R9DA 4P14A 1MVEA 2LALA 2YV8A 5H9RA 1W6MB 3B69A 1UN1A 5GLZA 3UJOA 2R0FA 1MR5A 1JHNA 2A3WA 2EXJA 3QLQA 5CBLA 2DTYA 4LBQD 4DPNA 2RHPA 1HQLA 4BM8A 2AR6A 1BXHA 3AZXA 3C2UA 2P37A 2CY6A 2P3JA 1S0IA 1N1TA 1U0AA 1LODA 1Z0HA 3MW4A 1ENQA 4FPGA 1OKQA 1Q8QA 3I8TA 4ATFA 1G7YA 2DUOA 2D6LX 4WZFA 4FOQA 3IM0A 1VIWB 3BOPA 3L2YA 3OPZA 2WT0A 1S1AA 2AREA 1AXYA 2DV9A 3GALA 2ZGTA 3APBA 4FPEA 3RMYA 1LHVA 2D6NA 4Y26A 2D3PA 3IKWA 3UJQA 4U2AA 4Y1XA 4BLIA 3MEPA 4XXAA 2UWBA 3R4UA 1QOSA 1SFYA 4UW6A 1A78A 2D6PA 2EF6A 3AP6A 3ILRA 2UWAA 3FUQA 1DIWA 1LOFC 2DUQA 2EXHA 4KBBA 1R1ZA 3INAA 2A6ZA 1DHKB 2E7QA 4HL0A 4FPKA 4GKYA 2JD4A 3O0VA 1LEMA 1SLLA 1AX2A 2OUJA 1QU0A 1MZ6A 1QGLA 1GLHA 1V6MA 1LENA 4HANA 2CWMA 4JC1A 4SLIA 4XJZA 1UZYA 5KXCA 3UK9A 3AXEA 1GANA 5F5QA 3WOGA 3WDXA 1J1TA 3N7LA 4UW5A 3UL2A 3WDVA 1RITA 2E51A 2NN8A 3ZXEA 1KDMA 2NM1A 1DQ1A 1HQWA 1VLNA 1SLIA 1ULDA 1ULGA 2A71A 2P34A 3LSEA 1JYIA 1A3KA 2D6OX 1LOEA 2JE9A 4MYEA 4P9YA 2D3SA 2A3XA 2PHRA 1BQPA 1OQ1A 5DZFA 1LGCA 3POWA 1Q56A 2GNDA 2W68A 1NLSA 5DUUA 4BPZA 4AVVA 1WLWA 2JDZA 4AVTA 4LBKA 3SH3A 2VXRA 2VH9A 3POSA 4Y20A 1LCLA 1TEIA 4FPHA 1QF3A 1QNWA 2JECA 2OVUA 3MPPG 5CB7A 5JOZA 3AFKA 4YM2A 3W58A 3PJQA 2NP0A 1JN2P 3M3OA 4R9BA 4XHXA 1O4YA 2E6VA 2ZGNA 1O4ZA 1OFSA 2V5YA 2ZBJA 1W6QB 4FP2A 5T54A 3AX4A 1MS9A 3O0WA 2DYCA 1CPNA 1ZM1A 1DQ6A 1AF9A 1AJKA 1V6JA 4FQ4A 3AZVA 4M3CF 4YFWA 3ILNA 4ASMB 1RINA 2CTVA 5T5LA 3NV1A 3WCSA 1UPSA 2E7TA 2ZMLA 1GKBA 4BMBA 3B3QE 1JXNA 1SBFA 2KM2A 3BIWE 3M3CA 2A6VA 3ZYRA 1W6OB 5T5OA 3RSJA 2G4IA 1N1YA 4AGVA 2ARBA 2PHXA 2PELA 3PVEA 1LEDA 2DVBA 1SLTA 2D6MA 1WBLA 1URXA 2AGSA 4FQZA 2A5ZA 4W65A 4DFSA 3V64A 4Q26A 4PQ9A 5GZFA 3WCRA 4JCKA 1EPWA 3D4KA 2GDFA 4Y1UA 2CL2A 4ISRA 3POYA 4DRVA 4M3CB 4Q1RA 1DZQA 5FRAA 1JUIA 2ZMKA 3FUOA 3OBRA 4GWMA 2D3RA 3M3QA 4GA9A 4P9XA 4YM0A 4YZ1A 3OYWB 1HDKA 4YG0A 3RG0A 1PZ9A 1GZWA 1N3OA 1QDCA 3HN1A 4C1XA 2R1BA 3FLPA 4XTPA 1IS6A 3FFZA 2A75A 3BODA 4Y22A 1PZ8A 4XHBA 3USUA 3WDUA 1W6OA 2WT2A 1W6NB 2ZACA 3AJZA 2VW1A 3ZYPA 2YY1A 1S0CA 1LOGA 3N35A 5JDBA 4LBMA 2UU8A 3IPVB 3RQ0A 3WDYA 3SH4A 3ZSMA 2OW4A 1WW5A 3D6EA 1CVNA 3AJYA 1SLBA 3AZZA 3T1LA 2ZABA 4LBJA 4YM3A 3OY8A 2ENRA 4K1YA 4P9WA 2R16A 1F9KA 1SCSA 2WNEA 3RMXA 4UW3A 4YZ3A 2GMPA 3KQRA 3AZYA 1G9AA 2SLIA 3N36A 1FV3A 1MZ5A 5KXEA 4UW4A 4Y1YA 1IS3A 4GWNA 3NV2A 4L8QA 4LBQA 1KQRA 3OBTA 5H9SA 2GNMA 1RIRA 1AJOA 1DYPA 2P2KA 4U36A 5EXOA 4YZ2A 2DVAA 2TEPA 2XG3A 2YZ4A 2XB6C 1D0HA 1X50A 3WG1A 4M00A 1LHUA 2AENA 3ASIA 1LU2A 1CJPA 4TYSA 3ILFA 2ARXA 1N3QA 3SNMA 3VKFC 1Z78A 3AP4A 5IUQA 3ENRA 5CAZA 1W6MA 4XJWA 4DRRA 3U4XA 4XE9A 2V73A 5T5PA 4DS0A 3AYCA 3A0NA 1LGBA 3T2TA 4PBOA 1DQ5A 4GKXA 3V0BB 1SLAA 3H0OA 4BOWA 5GLVA 3WZ1A 1DFQA 3PVNA 5IK5A 1ZA4A 2ZGKA 1WBFA 5JOXA 1IKPA 1D2SA 5FREA 2CWSA 1WUVA 1QKQA 5DG1A 3WG4A 3W59A 3NV3A 2OUHA 2FHRA 2PHFA 5EYYA 4Q8LA 3R4SA 3HR9A 1KITA 4LBOA 1S0EA 2ZGPA 2CYFA 4XMAA 4YGBA 1C1LA 1UL9A 1MS8A 3A0KA 2DVGA 3NWKA 3SITA 5F9TA 2GALA 3PVOA 1VAVA 5EWSA 5JLVA 2DU0A 1QDOA 4Q2FA 4XYXA 1LU1A 3M3EA 3I4IA 1SBDA 2NMNA 3O12A 1V00A 5DUWA 5GLTA 1I1EA 4ATEA 1H9WA 4Q1PA 4H55A 2VUAA 1AZDA 1VALA 2B7YA 1FV2A 1MS4A 3AYDA 2ZHMA 4XJUA 3WNXA 1DQ4A 2DWRA 2GN7A 2ZGSA 1KDKA 4YW1A 2FMDA 4LBNA 4XBQA 4AGGA 3B9CA 3DUIA 3FLTA 3IN9A 1XQNA 4D69A 5GJ6A 2YXSA 4R9CA 2DTWA 4Q8KA 3ZVXA 1S0BA 1YXWA 2EXIA 2W08A 1WLDA 1MS1A 1DLLA 1WLCA 1KJLA 1LJ7A 2WSVA 3AXDA 5KXBA 4WVVA 4WVWA 4JRAA 1H30A 4AYUA 1V6NA 5L73A 4F83A 4RA0A 4ISQA 3V0AB 3AP9A 1YI7A 5HCFA 2DVDA 1Y7BA 2DVFA 5T55A 1SCRA 2ZGRA 3ZSJA 4CZSA 2D7FA 2GNBA 4XOGA 1LESA 3MW3A 1N1VA 2AUYA 2WKKA 2D44A 2W39A 5GZEA 4K21A 3WHTA 1Q8PA 2WQZC 3VKLA 1JBCA 1YRZA 2AH2A 3N7MA 1W6QA 4YW5A 5GALA 1CQ9A 1YYNA 1UX6A 1S0FA 1FYUA 4Q27A 2NZ9A 3ZXKA
chains in the Genus database with same CATH superfamily
3K3NA 1O3TA 4NPMA 1RUH2 3TN92 4ET7A 5FPXA 5FYTA 4BHPA 3ZN5A 2FCUA 3LAGA 3QCWA 2XVKA 3T30A 2X09A 2WJSA 3VZNA 3ZYFA 1AL0G 2VW2A 2AZ5A 2Y34A 1W8WA 5CKQA 1DQ0A 2V09A 5CKNA 3C7FA 1ODMA 4YVSA 1LGNA 3ZN6B 2ZGMA 4R52A 2YC0A 3I2GA 1VBB2 2A6XA 3WP5A 2VMGA 2GC0A 1ND3A 1BZWA 3THPA 2HWD1 5L7OC 1LOCA 2F17A 1W8UA 4M3CA 4AEMA 3LPFA 3RZGA 2DCTA 2KA3A 1BJQA 1G9DA 1W6PB 4META 5C3QA 1YFXA 2VTXJ 2WQ4A 4BH9A 1UYXA 3FHQA 4XILA 3KHCA 1RUNA 4A6OA 5GZDA 1JZ8A 1AVBA 3KVAA 4MADA 4CUCA 1FNZA 3KT1A 1EV11 3WINE 5C6CA 3DV8A 2SBAA 1F8VA 3TAYA 5C3PA 2GNTA 4MG2A 1JZ3A 1QNYA 1CPMA 3B5LB 4NO4A 3VDDB 2ZHNA 4KI5M 1CZVA 2P3IA 1Q43A 5DZEA 5SV8A 5I8SA 3SH5A 4L2NA 4QDSA 3OPTA 4IEUA 4O9GA 3PUHA 1Q8SA 4YLZA 1QJEA 2VZVA 5CKMA 1S2BA 4M3CE 1OUSA 2ZKNA 4Z82A 2HWE2 4CE8A 2ES3A 2JIJA 5C4WA 2R042 2WR9A 1V6KA 1WCSA 5FO8B 2R071 2RJ2A 3GHMA 3W20A 5JR2A 4COZA 1GICA 4QKDA 1G9BA 1BEV1 4ZKTB 4QGLA 1CAWA 5JMCA 2PHTA 3MHZA 5LBEA 3WF2A 1LAJA 1MACA 3RNSA 3JUUA 4YW2A 3WNPA 5A33B 4QXBA 2LM3A 4QPYA 2QJVA 2ZEXA 3IMNA 3VUOA 1BYHA 2R063 1GNHA 3VBOA 4XJAA 1UXZA 5G04L 4OFGA 1PO21 2J1AA 2HBTA 5FZAA 4CP9A 1LOBA 1LOAA 4KU7A 4BA6A 4LT5A 1QJX1 4PBPA 1GQGA 3K4AA 2R1DA 2P6CA 3NV4A 4XURA 2E9QA 4BQ2A 1VRH2 1WMEA 1ZNPA 1ENRA 3I3DA 1OXCA 2IVJA 2HWC1 4Z8BA 2MPFA 3IIAA 2K0GA 2WT1A 2EVXA 1JODA 2I2SA 2HWB2 2LTNA 3FZ3A 1WCKA 3GNEA 5FYZA 3RFRA 3S5QA 3UGHA 2J1SA 1CIWA 3OSDA 3IZOA 4IGPA 4A4AA 4OMCA 4YARA 2RG4A 3FN9A 1Y9GA 2CNAA 3ACLA 4FPLA 3ZSLA 2WSUA 5BNNC 3C7GA 1NOVA 1YHFA 4UFKA 2UY9A 3VBSC 2B9VA 4XW3A 4EROA 2DCKA 5FY8A 5K7PA 2YC4A 2BRTA 1NCRA 5FKBA 4LXLA 2QNKA 5FYBA 2QFEA 1VAMA 3Q8CA 5BNOC 3SCFA 5F7UA 1UW8A 4LUMA 4Y5SA 1RUD3 5HCAA 4CCCA 4DXZA 1HRV1 2XH6A 5A7SA 3ZXLA 5AC93 5JXGA 3BGAA 3A21A 2D98A 5F6KA 3VHNA 4RS5A 4DXTA 1FPN2 1W0NA 3MV01 4UFJA 3VDAA 3KD4A 5E88A 1UYYA 2XONA 5A7WB 5HXVA 2E53A 4LA3A 2UWCA 1W0OA 2XPJA 3I3EA 1WMFA 4XDQA 4CCNA 4HFSA 1S4CA 2ZGUA 2RS53 2NMOA 4Y4RA 4NE9A 1SLCA 4OLLA 1UAIA 4TTGA 1S0DA 3VBHB 4CDXC 4E8CA 2WYSA 4AQTA 1JOPA 1Q8VA 2BWAA 2WBKA 3Q9OA 1N47A 1WD4A 1JU4A 1OLRA 1RUF2 3E6BA 4ZS3A 3MF6A 1PVC3 3OJBA 1RUC1 2J1TA 2P3KA 1RVF3 1MEC2 1IG0A 3GM8A 5CISA 2VW0A 4E4DX 3EXUA 3AMHA 1VRBA 2E31A 4V2VA 3WR0A 3LDRA 5JVVA 1AR63 1RUG1 1W9SA 2GU9A 2Q5TA 5T5JA 3U4SA 5KXDA 1OA2A 5FMDA 2WZ8A 4CEYC 4GWJA 4PLMA 3O5SA 4L99A 1CN1A 2XDVA 1NT0A 3POIA 3U78A 1HLCA 2XLAA 4WVMB 4LE4A 1TMF2 2Y6JA 5DXDA 2NLRA 2V72A 4X8PA 4XAAA 2OT7A 5A7NA 4CYDA 5HPOA 5M0TA 4QPIC 2YU1A 4LLFA 3HNBM 1JOJA 1OBNA 3JZVA 5FZ1A 2RDRA 3J4UH 5EYXA 5ACA1 4OI4A 4OZXA 1H4GA 2PXJA 1GNZA 3K4DA 3WXPA 3A4UA 5BNPC 2RE9A 2I45A 5ISLA 1UIJA 2CGOA 1KGYA 4P14A 1MVEA 5IVYA 3T4VA 2YV8A 5EV7A 3RZKA 5H9RA 5KC6A 4I0WB 5IVFA 3GBWA 1W9YA 3ACFA 4F8AA 3ZLIA 1JHNA 1WA6X 1XYOA 2A3WA 3QLQA 1GOGA 4XVHA 2BBAA 2DTYA 4LBQD 4RHV2 5FXVA 4DPNA 4K6BA 5L7OB 3HN3A 3C2UA 1BXHA 1XE7A 2W0XA 2YUEA 2LUWA 4JQTA 2P37A 1IQAA 2CY6A 4IUGA 1S0IA 1LODA 5CEHA 1Q8QA 2JG9A 4Q0SA 4ATFA 2TBVA 4FOQA 4H7LA 1QJY2 3I7DA 2AREA 1POV3 4CEWA 1AL22 5HCHA 3IDEA 2A73B 4EJRA 3CKHA 3O14A 2HWD3 5LCWL 3U1XA 4Y5TA 5F32A 2UWBA 1WCUA 1QOSA 1RMU2 1RUJ1 3HT1A 4LIUA 4N43A 2D6PA 4C90A 1LOFC 2Y6KA 3ACHA 4LO8A 2A6ZA 1DHKB 2J1VA 2IZWA 3AL5A 4UFIA 3RZLA 1YFYA 5ANQA 1MQTA 2QUOA 3JBG1 4FPKA 1WWYA 2XQRA 3IB3A 4BXSV 2EAAA 1EUTA 5L9VA 1OF4A 1HRI1 1SMVA 4BWOA 3KMHA 1QU0A 1UY2A 1EV13 2XXZA 4UF0B 2C4XA 1WCQA 4XDPA 4BDVB 1LENA 4OHVA 3BUCA 4JC1A 1HJFA 2D5FA 4OMDA 2HWF1 1VBA2 4AOCA 2RS31 4P5YA 1YIPA 3AXEA 1EAH2 2BFUS 1QJU2 5D8AC 1J1TA 5LZ6A 4Q4V2 2QQJA 3TOJA 3ZXEA 2BOIA 3LDKA 1QXPA 2NM1A 5JPMB 1FMD2 3ZIXA 1R091 1ULGA 1JYIA 3CO2A 4EWAA 1C28A 4D8MA 2ZEWA 4KWLA 3HPNA 4MYEA 2RS12 2D3SA 2A3XA 1W28A 1BQPA 4XF9A 5A6XA 3POWA 2WZR2 1L3JA 2KR2A 4COVA 3OBZA 4P9IA 4BISA 2R073 2PA7A 1XE0A 4AVTA 5EJZB 4Q29A 3SH3A 1BEV3 2JG8A 1IQDC 1P8JA 5C3OA 1RUH1 3TN91 4Y20A 1LCLA 3D3AA 3RZHA 1QNWA 2OVUA 5JOZA 3R0RA 4YM2A 1ZZ8A 5BPXA 3AFGA 4X6QB 3S30A 2NP0A 2X53S 4Z07A 5FOJB 3M3OA 1S2KA 4QKNA 1UY1A 3P5BA 1OA4A 2ZGNA 1OFSA 1PGW2 1TZOA 4RFT0 4KQ7A 4LOTA 4V2WA 5HBAA 1W39A 1CPNA 1H4HA 3K75B 3KV9A 4YRDA 1VBB1 4M3CF 3ILNA 1PO23 1RINA 1OLQA 2CTVA 4GMP1 5T5LA 2H0VA 5FPZA 5BNNB 4IDZA 4XPVA 1IPKA 1CZSA 3VBSB 1QJX3 4PLOA 4RQPC 4GIQA 5E16A 1VAKA 3KGLA 2BFUL 3BIWE 4FTSA 2HWC3 3ITQA 2VO5A 3IT8A 2GP5A 3NAPC 2PELA 3R4DB 4B1MA 1YQ8A 2QDRA 3MIGA 3G6JB 1URXA 4FQZA 2A5ZA 3MLKA 5EIYB 5GZFA 5FLHA 4HT1T 1EPWA 3D4KA 2GDFA 4ZS2A 2RVAA 4JGYA 2Q8CA 5FLIA 4ZZ5A 4ORFA 2EICA 2ZX0A 4QDQA 5JXIA 2CL2A 3ZFEC 1E5SA 2VZSA 3POYA 1I5PA 4XF0A 3ZN4A 2ZMKA 3FUOA 4RGKA 3VBRB 1DGRN 2VJXA 4AZZA 5FYUA 2VL4A 3RG0A 1HV1A 1PZ9A 2TUNA 2G9ZA 1YWKA 2HJIA 2W47A 1H8VA 1GZWA 3AMQA 1HRV3 5FUIA 5A32A 3LKJA 3MUZ1 4IV1A 1RB8G 4CDXB 2FDHA 2R1BA 1W3VA 2ZEZA 2R30A 4NAMA 4AEDC 1JTZX 3WDUA 3SEEA 5FR3A 3ZSEA 5LBBA 5LA2A 3NNMA 4MLOA 2HWE1 2JWPA 3CZJA 4CVUA 1LOGA 2R041 3BIEA 4LBMA 2UU8A 3IPVB 4AHZA 1J83A 3RQ0A 4JGZA 2WNUC 1K5MC 2IVIB 3T2QA 1UX7A 4NIGA 4BCUA 4JRLA 5A1FA 2WN3A 3ZFGC 4B29A 2YBKA 3ZFFC 4CEYB 2OQ6A 3VN4A 2V4AA 4K1YA 2F6BA 4KWJA 3H8UA 2WNEA 3RMXA 4OHWA 4TN7A 5IYYA 2SLIA 5KXEA 4HN0A 4NWWA 1ZVFA 1VE0A 2WNOA 4LBQA 1KQRA 3BB6A 2GNMA 1WMXA 4AI1A 4HPKA 1BCXA 4CP0A 1SQ4A 2EIEA 5C8WA 4U36A 5FY4A 4YZ2A 2TEPA 5BNPB 1UYPA 2XB6C 1D0HA 1LNSA 3GCXA 2XQXA 2AENA 1DG6A 1LU2A 2XOMA 1CJPA 1VRH1 2Y33A 5FJKA 5FBZA 1XRUA 4W6YA 2HWB1 5IUQA 3MYXA 2WINB 3VZMA 4DRRA 4HKOA 5IHRA 4XACA 2VECA 5T5PA 4DS0A 2XVLA 2JIGA 2VOTA 4HVOA 3A0NA 1LGBA 3U0ZA 2XKPA 4GKXA 3I3QA 2OA2A 4O9EA 4BOWA 1W3XA 4IV3A 4OQ8A 4XETA 1GQPA 3AMMA 4N7IA 2XJVA 1JYNA 2Q1FA 1NZIA 5FREA 3CBNA 3ZOIA 1QKQA 5DAPA 4LO7A 3W59A 2OUHA 1E5HA 1TG7A 2FHRA 3MIDA 4NMIA 4IERA 1I9RA 5FWEA 5LRSA 4Q8LA 3R4SA 3HR9A 3T2PA 1FPN1 1W05A 2D40A 3N9MA 5F5CA 1UL9A 3QD6A 4LIVA 2XJUA 3NNFA 3A0KA 2X5IC 1VAVA 2ATFA 2PQSA 5FP8A 3DPRB 5F2SA 4HG6B 5BXXA 1LU1A 2ORZA 3ZO0B 1WMDA 3CZUA 4AFCA 2JD9A 3WQ0A 5CFCC 4L11A 5DUWA 1HJGA 1RUJ3 5KHKA 1OC1A 1OURA 1V70A 1ND2C 1ULOA 3H1MA 1KFXL 5D8AB 3TWIA 3ZM8A 4FFHA 1RUF1 2WUHA 2QKDA 3I2FA 2ZHMA 4XJUA 3JBG3 3URFA 3VZLA 3ZDSA 3H3UA 1HRI3 1MEC1 3B9CA 3DUIA 1R082 2JDNA 4K3UA 4AGGA 1XQNA 5DDJ2 3KCXA 4GULA 2X10A 4JKLA 2XKOA 4QKFA 4D69A 5FO9B 4EYUA 4QPGB 2HWF3 1CAXB 4BQXA 2E33A 2YPDA 2B39A 2RS33 2WSVA 4ASKA 1WLDA 3J7LA 4LITA 4G4FA 2EIDA 1XBFA 1OFNA 5FZ4A 1H6YA 2VMIA 5BY5A 3LFIA 1XYPA 2VMEA 1TMF1 2VCBA 4EQVA 3MUY1 5I0SA 1R093 3AP9A 1YI7A 3WF0A 2DVDA 3T08A 3ZSJA 1SCRA 4HKWA 1DYOA 5FWJA 4OUMA 2GNBA 2ZTNA 3GDBA 5CADA 3FMGA 4DMIA 3HQXA 4K21A 2BPA2 2O1QA 4CCJA 2V4VA 4LJHA 1US3A 4PI0A 4B7EA 3I97A 1RUH3 1W6QA 1QXRA 4YYOA 3TN93 2XJRA 2DBNA 2GC2A 1YYNA 3BI3A 3LOBA 1NCQC 2QBXA 4RHV1 4F3JA 4RQPB 5LA1A 5IVJA 4ZXKA 2D43A 1GFF2 2OIIA 2Q30A 2WNVC 2Z42A 4FI9A 1QOOA 4IXLA 2GN3A 3NAPB 2VCAA 3VL9A 1H8TC 4HMZA 4UI9L 1RHI3 4RR3A 4DNYA 1RTVA 5KHJA 3ATGA 1QJY1 3OF1A 1VBB3 1UWWA 2BQPA 1UZZA 2E63A 1AL21 4DB5A 2NPIA 1NA1C 4NR1A 3RI9A 4GH4C 3ZFEB 4CPBD 1PNFA 1RMU1 2W1WA 2G19A 2Y64A 3VDDC 4YG6A 4A44A 5A1AA 1VMHA 4XJ8A 1UMIA 1WW6A 1JYTA 1V6IA 5LATA 4UFHA 3VKNA 1LRHA 4MVTA 1HX6A 1CAUA 4IQPA 4XUQA 4QX1A 1RUE3 4LR4A 2WRAA 1ULEA 2WYFA 1Y9MA 3PLQA 4AEDB 1S0JA 4RYDA 1ENSA 3N7JA 4LEJA 1ST8A 3VBUA 1VBA1 2ZHKA 3WNMA 3U75A 2QQVA 3OUJA 4QXKA 5CZKA 5LB6A 1EAH1 1QJU1 1I3HA 2WNUB 1K5MB 1DBNA 1OKOA 4Q4V1 4KWKA 3OUIA 5CFDC 3UT0A 4AGRA 2ZMNA 3ZFGB 3SC7X 4RL7A 1FMD1 3KT7A 3MBWA 1YIFA 5FY9A 3WUDA 3ZFFB 4FFIA 4QQHA 5EZWA 1VBD2 1NYWA 3S6PA 2Z4FA 3JD73 3N4MA 4WM8A 2A3YA 2RS11 2HWE3 5JZGC 4JVAA 2ZAAA 2R043 2WZR1 2GC1A 4PQQA 1JHJA 1SACA 2OQ7A 1W6PA 5CG9A 2JJ6A 1JH5A 3N3HA 1O3RA 3S57A 5IATA 1DLCA 4I02A 2VOKA 4I3GA 5D2AA 5LEKA 3FWEA 4KMQA 3W21A 4CP2A 3DYOA 1C8NA 2RJLA 3GJBA 5LRRA 3LSDA 5BV6A 2QQPA 1UY0A 1YQCA 2VAUA 4QU2A 4PCRA 3POJA 3HQUA 3WUCA 5KHIA 4TSVA 5DUVA 5GZCA 1PGW1 1QWRA 1OSGA 1JZ7A 1IPSA 1WD3A 3ZKUA 1D7PM 1LHOA 5A7PA 1RXFA 4XMIA 4I01A 3H1WA 2WZPP 2RMU2 1CWPA 4JTNA 4QQOA 4UOJA 2B8MA 1SEFA 3F2ZA 1QMJA 4OHXA 1DF0A 1CR7A 5LBCA 4AVBA 2EIGA 4EN6B 3S0MA 4XCBA 1RJ8A 5CNAA 3WF4A 5L36A 5C4WB 1TQ5A 4CDUA 5ABJC 5IFPA 3V0BA 2CAUA 4IEWA 5F39A 2EAKA 1OOPA 5CIRA 3AK0A 4AWDA 3LZZA 1VBC2 1NLRA 2YFZA 3M2MA 1SZBA 4PI2A 1AX1A 2MEV2 3F95A 2LROA 4C91A 3B00A 3CNAA 5FMBA 4YG3A 2Y6LA 1ASJ2 3NJVA 5F37A 4QB2A 2ID4A 2VVDA 2X5IB 3WNKA 2F4LA 5F3CA 2B5HA 2BTVC 4CCEA 1ZZBA 5FCCA 5T52A 5CFCB 5DUXA 3M8LA 2YYOA 3FBYA 4QX2A 1W2AX 1VB4A 3ZYJB 1CD3G 1N3PA 1O91A 4IEQA 4XBNA 2Z2SB 3ZYGA 1ND2B 4YVSC 1FPN3 2ZX1A 4PJYA 3T4HB 4YGEA 1PMHX 4MXWB 1O8SA 3HIFA 3TEYA 1ND3C 1MS3A 4XBLA 1S2EA 3JCIA 4LE3A 4YW4A 3L9JT 2ADDA 5GLUA 1REDA 3EO6A 5A3NA 1GU3A 4FPYA 1O4TA 1ULCA 1W9TA 4JV4A 4MH0E 2OZJA 3K4ZA 3P6BA 4XFFA 3VKMA 4AVSA 4BU2A 2Q0AA 4D6QA 5C9AA 3WSOA 1RUF3 4LA2A 5D1IA 3WV6A 4XZPA 3W5MA 4HSJA 4K7JA 4A3XA 2I07B 3ALQA 4BLJA 4BK5A 4KL1A 1MEC3 4A3ZA 1G9FA 1C57A 3LA7A 5FP4A 4NAOA 2DCYA 4H14A 4CTEA 2PLV3 1GR3A 3X29B 1POV0 2PQQA 3HMYA 4FOVA 5J48A 1OT5A 1GP4A 5FQ0B 4B4RA 3RYRA 1HQNA 5IK4A 1HB4A 4GALA 2BOJA 5JIAA 1O5UA 4XFAA 2BNNA 4MHUA 1TMF3 1F31A 1NCQB 5IVBA 3VLBB 4HSLA 4JQRA 2GH2A 4COUA 4CPBA 1OVSA 3O1MA 4D6RA 2ZZQA 3RS6A 5C4WC 1W9WA 1ZRDA 2WNVB 1DQ2A 2E26A 2ET1A 2R6QA 1H8TB 2W9XA 3J8F2 4OUEA 2AEZA 4QHBA 4HBNA 4QX0A 3RRDA 2XJPA 3WG3A 5CA6A 1VBE2 1UZVA 2ZGQA 1GBGA 2PHLA 2VZTA 5FP9A 1R1A2 1NA1B 4RHV3 4GH4B 5GLZA 4TLGA 5ERLA 4B8EA 2EXJA 2EIBA 1W99A 4JAAA 3KF5A 1C8M3 2AR6A 3AZXA 3O1PA 1Z0HA 1U0AA 1QJY3 3MIBA 4CXYA 4QXCA 2DFBA 4BQWA 2D6LX 3KF3A 4J6GA 3PIJA 3RJRA 3OPZA 2JICA 3L2YA 2Q1ZB 4AW7A 3VD5A 2WT0A 1S1AA 1RMU3 4UYBA 5FZOB 2DV9A 2ZGTA 3APBA 4OQ9A 2VMFA 4Y26A 4YVWB 1KEXA 4INDA 3MF9A 2G9GA 4U2AA 1BK1A 3MEPA 3BPZA 5A6ZA 3R4UA 1SFYA 3ZMOA 5FIXA 3VDCA 3HBZA 4MO3M 4DZGA 5FPBA 3LWCA 3BPSA 1XB9A 3AP6A 4KBBA 2RR12 2UWAA 1DIWA 5CFDB 3FHAA 4Q4W2 1R1ZA 3UGGA 1R081 5DDJ1 1NCRC 3WP6A 3I49A 3O0VA 2EA7A 4GB32 4D0QA 2KD7A 4YPJA 1VBA3 5JZGB 3BN6A 3J26N 5LA0A 1CAVB 2VD7A 3BVCA 1QGLA 4BB3A 1V6MA 5FYHA 1V0AA 5KHHA 4P9GA 3AKQA 4HANA 1JZ4A 2I74A 3NVCA 3AVSA 5DAVA 4RS5C 4HVQA 2OS2A 5C8CA 3WP3A 2W95A 3WOGA 5F8PA 1FMD3 3MI8A 2UYBA 3ON7A 3N7LA 4AK3A 4DUWA 5HV0A 5G05L 4AQ6A 5FPAA 1RITA 1XXNA 1M06G 3GZUC 4BK4A 1PIV2 1VLNA 1SLIA 1ULDA 2A71A 3G7DA 2BP6A 2WO1A 4I0BA 4E2GA 2WZR3 1A3KA 2CGNA 4B1LA 2YBPA 4XUTA 1AYM2 4ZZ8A 1LOEA 1PK6B 4EN9B 2PHRA 3MIFA 4W50A 2W68A 5DUUA 5FYVA 4QX5A 4AVVA 1WLWA 4JHZA 1E5RA 4LBKA 4UF0A 3WQ7A 5ABJB 1S55A 5CB7A 3WW1A 1XNKA 3AFKA 5FZMA 3ZPOA 5TSWA 3PJQA 5IVVA 2ZXQA 4FP2A 2VQ0A 1MPXA 3AX4A 4FTBA 4JKMA 1QQP2 5FY1A 4P00B 3VBRC 1F15A 3WCSA 2E7TA 3B3QE 2JKXA 4IEPA 1DZTA 1J3RA 4DXSA 3THTA 5JI9A 2KM2A 1K45A 3BYWA 3I3BA 4N53A 1SDWA 5T5OA 4M4PA 1N1YA 4IW3A 4OYUA 4AGVA 2PHXA 3PVEA 2DVBA 4YVSB 1JMUB 1SLTA 2AGSA 4W65A 3V64A 4JCKA 2OZ6A 5FZEA 1O5LA 3DF0A 1ND3B 4D94A 5SV5A 2FD8A 4P02B 4ISRA 4M3CB 2WFF2 3AKSA 3NKTA 5FAXA 3OBRA 2D3RA 4R8HA 1A6CA 3M3QA 4GA9A 4YM0A 1HDKA 4YG0A 1GOFA 1HB2A 1CX1A 1W06A 1VBD1 2W5FA 2RV9A 4QQLA 3OCPA 1COV2 1ZYBA 3FLPA 4ZU4A 4XTPA 3JQXA 4C1XA 4CEWC 3FFZA 4Y22A 3BALA 5BNOA 5A3UA 1RJ7A 3USUA 1ZBA2 1UCXA 3M70A 4N43C 3AJZA 2L9LA 3LB9A 3D0SA 2YY1A 2CGPA 4GZ9A 1YEWA 1OH4A 2HEYF 5JDBA 3H8RA 1ACCA 1UKRA 4MZUA 3D0JA 3RWKX 1XSRA 4NHMA 2WDBA 2D5HA 3MICA 5FP3A 3SH4A 3VHPA 2OW4A 4AQSA 3KV6A 4EE2A 1MQTC 1SLBA 3UNPA 5C3RA 3GGLA 4YM3A 2QQNA 2R32A 3T0BA 1UXXX 3OY8A 4BIOA 4JX0A 2ENRA 4P9WA 4CCKA 1NQJA 1F9KA 3SMHA 5A7QA 4UW3A 4JHTA 1C3HA 2WC2A 2OX0A 2PAEA 3CJIA 1AUYA 3N36A 1POQA 1R64A 4MX3A 5LBFA 2ETEA 1LKNA 2JDUA 2RMU1 2BV4A 4IL7A 4GWNA 4UW4A 5DQ0A 3P3NA 2VZQA 2ZPXA 4BQ5A 1H1IA 4OHYA 4IGQA 1RIRA 1AJOA 1DYPA 3W9AA 2E32A 1CAWB 3C7OA 4CU6A 5EXOA 3GZAA 4KG0A 2XG3A 4Y3OA 1T6GC 2TNFA 4M00A 1J3QA 4BE3A 4FAGA 1YQ5A 4HXCA 3SNMA 1VBC1 3GBFA 4XFGA 3RGBA 2YB7A 2MEV1 1W6MA 3U4XA 3DYMA 3AMNA 1F35A 1ASJ1 1STMA 3EJKA 2JG8C 3K51A 3AYCA 4QB1A 1UZ0A 1PO12 2Z69A 3DPRC 4CP9B 1YJKA 4PBOA 3FX3A 2QQIA 3WD5A 1SLAA 1GP6A 3H0OA 5LEJA 1DFQA 3JB4C 2CU5A 1YFUA 2B4KA 5JPNB 5EPAA 1ZA4A 2ZGKA 1WBFA 4LKFA 4QPIA 4QD2A 1IKPA 2XL7A 4OI0A 2ZAHA 4WBBA 2P5BA 4Y4YA 1WCDJ 3WP4A 3DYPA 1REEA 2Y8KA 2JDKA 4YWAA 1QXJA 1M4WA 4LBOA 5JI7A 1S0EA 5LY1A 5K0UA 4EWDA 3C8XA 4NRQA 4EN8B 2DVGA 3NWKA 3AMPA 1NCRB 4XFCA 4QPGC 5A3TA 2XL9A 2VTFA 3ZR5A 5EWSA 5JLVA 2DU0A 4CCDA 1QDOA 2XMLA 1D4M2 2W1QA 3RZZA 2BZDA 3I4IA 3LIHA 2NMNA 3B7MA 3O12A 2XHKA 4QPWA 4AI3A 5JSOA 5DAQA 4ATEA 1CIYA 3LEGA 4HK8A 1H9WA 4AHYA 1BBT2 2G9FA 3PDQA 2B9UA 4RS5B 4JGYC 1FV2A 1MS4A 4XUOA 4DEQA 1R083 1JZ5A 2YG0A 1WKYA 1DGWX 1L7LA 2VOVA 5DDJ3 1XNTA 1DQ4A 3WNXA 4UT5A 1PGL2 5FZHA 4YW1A 3EHKA 2W46A 2FMDA 4LBNA 5I0RA 2B46X 1ENXA 2WAAA 4V1PA 4DIQA 1RUI2 3VB9A 2BU9A 3I2HA 2UY8A 3U07A 3SKJE 5IVEA 3I2IA 3I2KA 4IV1C 3FHIB 1B35A 1S0BA 1YXWA 3EMRA 2W08A 3S7IA 5IW0A 1LJ7A 4GAZA 4JRAA 4Z1VA 4BQYA 5B4XA 1V6NA 5L73A 5FYYA 2VNRA 5DN2A 5C71A 5T55A 4CZSA 2VZ3A 2DVFA 2J42A 2XGXA 4HVRA 2ZGRA 1ODNA 4JGZC 5CG8A 3J8F1 2VG9A 3KV5A 3OD4A 4YNIA 2YU2A 4XOGA 3QBQA 1VBE1 4XFHA 4AEKA 5AC92 2AUYA 2WKKA 4L97A 1OPMA 1UPIA 1CJDA 1UU5A 2LRPA 3E5XA 2DCZA 4LO5B 2ARCA 1Q8PA 1TE1B 1R1A1 2VGDA 3VKLA 1W8OA 1NG0A 3NL1A 1JOBA 4UFMA 3N7MA 1X33A 3IIIA 1BVP1 4Q5OA 5GALA 4CU8A 5DAWA 3ZXDA 1FYUA 2WN2A 1OH3A 3N9LA 2NZ9A 3ZXKA 3ES1A 2RS52 3TRSB 5GZGA 4QB6A 1Q8OA 1B09A 1SHWB 2WIIB 5A3OA 4KNCA 3RZJA 4L0PA 4LHNA 4B3NA 1A8MA 2ORXA 4S2FA 3WEZA 4E2QA 1FNYA 2A6WA 3QH7A 1US2A 4PT6A 4LHKA 2PAKA 1AXKA 2VUCA 3TYJA 1YO8A 4C0HA 1UOBA 3GZTB 1G8WA 4FXKB 4W8JA 2JDAA 1SBEA 2RR11 2E7AA 5H9QA 1AR62 4Q4W1 3V65A 1PNGA 2JG9B 2DU1A 2QQKA 1F5JA 5E1RA 3ZYHA 1PZ7A 2PMWB 3IBMA 4IV3C 4XAEA 3SCGA 3UKTA 5LK5A 3DECA 3M1HA 2K2SA 1RUC3 2ZKLA 3OYWA 4GB31 4RQPA 4CEWB 1KRIA 4CSWA 4PDWA 5FMCA 4ITCA 5T3NA 2VZPA 1AYN2 4JDOA 1ALYA 1FATA 3OBAA 2ZOEB 4N43B 1RUG3 2H6CA 2QZ2A 5T50A 2QQOA 4D6SA 3DL3A 4AVCA 2VR4A 4UAPA 3BTZA 1MZFA 1NXD1 1W6NA 2XUEA 2YROA 3ZXGA 3WG2A 1MQTB 1VBD3 2P6HA 4S2GA 2VC9A 4C1WA 4N7UA 1PIV1 4NVPA 1LB2A 3B02A 3GCWA 4PHZA 4QU1A 2R0HA 4XTMA 4FVVA 1ZZ9A 4YZ5A 3D5OA 4RSUA 2PHUA 2XLFA 2D6KA 1AYM1 4GQ7A 4XF4A 1J59A 3PMSA 1MS5A 4COYA 5ACA3 3SXWA 3HT2A 1APNA 4NHLA 3NQHA 2Y6GA 3NNJA 4NIDA 5GLWA 4NROA 5F5AA 3OGSA 2YMZA 1UD1A 5IT6A 4NJ4A 5JOWA 3DGTA 1CONA 5A7OA 4WM7A 5B2GB 5C70A 3VV1A 3AC0A 1H2NA 1V9U2 3ZIWA 3WNNA 1GV9A 5J09A 2JE8A 2JE7A 1BK0A 3PUAA 3BU0A 2WQ8A 4DY3A 2XBO2 2BNMA 1K42A 3AYAA 1GZ9A 4AHXA 4YW3A 2RMU3 4LPLA 1DYKA 4A7ZA 3PURA 5J1XA 1QQP1 1W8NA 5DABA 1ONAA 2GC3A 2JG8B 3I59A 3T1MA 1WZXA 1V6LA 3OGVA 3HNMA 4Y20B 3UGFA 4NWVA 1H1AA 4LKEA 2C6SA 1WW4A 3IWZA 4HETA 5FO7B 4I0AA 3WNOA 3OEBA 3K48A 4PF5A 4AR2A 4FOYA 1QY4A 1W2UA 4KG8A 1SDDB 4GWIA 4BMEA 3POFA 3CQOA 1VBC3 3T0AA 5EFUA 3CU7A 3S7EA 3ECQA 1IS5A 1GYKA 3GHNA 4A41A 3KGZA 3NSTA 2BGPA 1HB3A 5CYYA 1ASJ3 2DDUA 4XIOA 2W52A 5IJRA 2PHWA 2Q8DA 4E8DA 1JI6A 3PNAA 4QM8A 3GZEA 4QX7A 2GMMA 2NYYA 3LF7A 4LOSA 2WFF1 3KLSA 5CVRA 4Q0VA 4BXFA 4AI2A 3LEKA 3LCPA 2J1UA 4PF1A 4O61A 2VZUA 4I09A 4K1ZA 3KQ4B 1FAYA 1NQDA 3E6DA 1COV1 1MVQA 4M01A 4QX3A 4RFRB 4GD4A 1H2MA 4FPCA 4JGYB 5DZGA 3VGIA 5I0TA 3POBA 3KZ4C 2VVEA 4FPFA 5FZKA 3DXTA 3DCQA 1ZBA1 2DURA 1LHWA 3PU8A 3N9PA 4CUAA 5LW9A 4ARXA 1OLMA 3DKWA 3U10A 4XFIA 5EJ3A 2Q4SA 1GMMA 1WW7A 2R49A 3HOBA 4JDNA 3FLRA 3HBKA 1GZWB 1DGLA 5A32B 3H8OA 1I5ZA 4FPOB 1T6BX 4IV1B 1XPWA 5FJHA 1X7NA 2FQPA 5A80A 5FBJA 2C26A 1XU2A 3RJ2X 1PHMA 5IVCA 1QH6A 2AC1A 4QQ2A 3VBUC 5FP7A 2FZ1A 3FL7A 2XJTA 2QVSB 4JGZB 2H0BA 2JKBA 4IEVA 4LK6A 4IEXA 4AI9A 4CDWA 5F1RA 4YZ4A 1ND2A 4Y1ZA 1AR92 4CRQA 4XF3A 5IK7A 3PUSA 3V0AA 4GMP3 1QOTA 3ZPYA 5FZCA 4NUBA 5KBFA 2R7EB 5DMYA 4AFBA 3B01A 4OULA 5FMOS 4WM8C 2WWSA 1RXGA 5EP9A 3OD0A 2VOXA 4NHKA 1OLME 5D21A 1IS4A 3JU9A 3SCHA 2DUPA 4FOWA 1G9CA 4DQAA 2UURA 4LBQB 3L2HA 4AFAA 1PX3A 3J8F3 4Q4Y2 2Q8OA 1VBE3 1PO11 2BDRA 1Z7S2 2ZHLA 1BHGA 2WZEA 5HV4A 2GMEA 2ZCWA 2Y6FA 2PHDA 4CDQC 3AP7A 3AB0A 3VBFC 1R1A3 1SPPB 1C4RA 2ZGLA 1FOD2 1UOFA 2K46A 3BCWA 1A8DA 3MO4A 4YVWC 1L7RA 2LALA 2G1MA 1JZ6A 3ETQA 3MFCA 5C5TA 1C5IA 4LUKA 1KXGA 3AM2A 1MR5A 3K46A 1W03A 4LHSA 1VB2A 4EV0A 3ZN6A 5CBLA 2Y0IA 2RHPA 4OZOA 1HQLA 1QJFA 4BM8A 3W5NA 4ZXEA 3PVBB 3VD9A 1OF3A 2P3JA 4IV3B 1ZRIA 1N1TA 5FYSA 3MW4A 1ENQA 4FPGA 4CDUC 2JDPA 5KC5A 2Z79A 2BNOA 3RPQA 2DUOA 4CP1A 1D4M1 3J7MA 4WZFA 1OOPC 3IM0A 2RDSA 4JDMA 1JUHA 3T09A 3THDA 3GALA 4FPEA 2YBSA 3RMYA 3IDCB 1PM7A 1LHVA 1WLTA 1BBT1 1OPOA 2RR13 3KCYA 2D3PA 4XABA 4M4RA 4Q4W3 4NPLA 5FY0A 2N7GA 2XUMA 2FMYA 4UW6A 3QOPA 2VQAA 1RYYA 1PGL1 2DUQA 2XR4A 4HLTA 2IXLA 1CGPA 4GB33 1QJZA 2E7QA 3ZKYA 4XQDA 1RUI1 3VDDA 1PK6C 2WS92 1ZX5A 4EN7B 1LEMA 2VMDA 3PTYA 4KH9A 4XQWA 1NE6A 3PUQA 3VHRA 3MPBA 4FFFA 3Q8BA 1GLHA 1SG3A 1XC6A 2CWMA 4K9SA 4SLIA 1EUUA 2HEVF 5FYCA 4A2UA 2FZ2A 3OUHA 1ZRFA 1UZYA 1VRH3 2CDPA 4RD7A 5KXCA 1HXS2 1NE4A 3UK9A 4IGOA 1GANA 1Y43B 4NIHA 1VR3A 4HZFA 4UW5A 2BYVE 3UL2A 2HWB3 3I2JA 3ZR6A 3MIHA 2E51A 4LNVA 1ZBE2 2JXAA 4P9JA 1GWKA 1X9PA 1DQ1A 3H1YA 3CIHA 4NRPA 4PIZA 2P34A 4LULA 5EHDA 5J3UA 2BUKA 5C9AC 3C7HA 1HN1A 1UQXA 4Q0UA 3N9NA 1DP0A 5DZFA 1LGCA 3OPWA 1NLSA 5A33A 1EY2A 3ORJA 4BPZA 3WX5A 4ASLA 3I2DA 1FXZA 1HB1A 2QE3A 3CLPA 2VH9A 3CL1A 2RS51 1CAVA 1AR72 1OA3A 1TEIA 4FPHA 4R4XA 2JECA 3MPPG 2PN5A 1O7FA 3TBDA 1ZRRA 2ILMA 2JB4A 2VM9A 3A7QA 3SQOA 3VZOA 5BNQA 2ZJCA 1H2KA 2BVVA 1QQP3 2VCMA 4XHXA 5L19A 1O4YA 2E6VA 4G9SB 1O4ZA 5FYIA 2YFUA 2V5YA 4AAPA 4A7KA 1W6QB 5T54A 2PYTA 4NIAA 3WNLA 1GZTA 1T2XA 2HLEA 1DQ6A 1VMJA 5J96B 1V6JA 4NHXA 3AZVA 4C0BA 2D93A 3CJXA 2FDJA 3NV1A 3NKGA 1UPSA 2ZMLA 5FPUA 4BMBA 3RYPA 2W1SA 1AR61 1IGOA 3WQBA 2WA4A 3CHXA 4Q4X2 4RR3B 1UY4A 2RDNA 3M3CA 3A23A 2A6VA 3NJXA 4P5HA 1U12A 1W6OB 3ZYRA 3H9AA 2ARBA 3POEA 3ST7A 1YJLA 3RWNA 1NXMA 1UMHA 4DFSA 1XYNA 3WCRA 4PQ9A 4CUGA 1ZREA 1AYN1 3HAGA 2YGLA 5FK7A 2O8OA 1W8TA 5FZ7A 5J7MA 4AVAA 1W2OA 1GWLA 1RC6A 2JX9A 4OVEA 3J7NA 4Q1RA 3RYKA 1DZQA 4DRVA 1CAUB 4IESA 4UFLA 2IXCA 5F5IA 1COV3 2Y6HA 5A7WA 5IAVA 3WW2A 5DPNA 5FZ3A 1UU6A 1N3OA 2CHHA 4COWA 5LA9A 3O1UA 1ZBA3 5I0DA 4AHWA 1IS6A 3VBUB 3BODA 2X29A 5FDBA 1UF2C 2VXJA 3AVRA 3VBHA 1J58A 2WAOA 1W90A 2WT2A 4LKSA 5A3LA 1NY72 2XWBB 2PAMA 1KS5A 2VW1A 2VBPA 2XHNA 3HJRA 3KS7A 4DO0A 3U11A 5C7GA 1RHI2 1Y4WA 3N35A 4A6SA 5IAXA 4KGGA 3LGRA 3WDYA 3FFQA 2Q8EA 4NHYA 1V9U1 3ZSMA 1POV1 3D6EA 3AZZA 1DGWA 2ZABA 4WM8B 3T1LA 2XBO1 3HEIA 1UZWA 2GH8A 4MGYE 2BBVA 3VBOC 3P1IA 4OUSA 4AQ2A 2YC2A 1PX4A 3AZYA 3NMBA 2Q1MA 1C5HA 1FV3A 1MZ5A 5I8YA 5C8CC 1IS3A 3NV2A 4L8QA 2W3JA 4L9BA 1AL23 2CAVA 3OBTA 1RUE2 4MV2A 1IG3A 4WVMA 5F2WA 5JXHA 4CDQB 3VBFB 4QT6A 3B93A 2HBUA 5FXWA 3HNYM 1KS4A 2VZOA 2YZ4A 3CDZB 1F4HA 2GZWA 3C7EA 4XC9A 4XZUG 3PL0A 1LHUA 1U5XA 3ASIA 3WG1A 4CCMA 4FBFA 3ACGA 3BOWA 3ILFA 1N3QA 1E5IA 3E5QA 5BUVA 1Z78A 5K4LA 5FOBB 4ZHNA 3AP4A 2J7MA 1PO13 2MNGA 3ENRA 5CAZA 1DCSA 3IAPA 4QX8A 4XJWA 4XE9A 4GJYA 2V73A 5FUNA 4A7YA 1XNBA 5I93A 3ME2A 1Y3TA 4CDUB 4ES8A 3JD72 3T2TA 5L7OA 1DQ5A 4UBGA 5A3PA 1TVGA 3V0BB 3AL6A 5FPVA 4UXAA 3T0DA 1AR82 1EAH3 1I6XA 1OOPB 1QJU3 2VULA 3WZ1A 2LW8A 2DF7A 4Q4V3 4XUNA 4CXWA 5JOXA 5FYMA 2CWSA 1U5IA 3Q8EA 5FV3A 3ZXAC 3WG4A 4CA9A 4E9KA 4N8MA 3UETA 1K12A 2PHFA 3QH6A 5EYYA 1EPZA 2RS13 1GQHA 2ZGPA 4XMAA 4YGBA 1C1LA 3U37A 1D4M3 4MGZE 4XF1A 3WF1A 2GALA 4N53C 3LPGA 3POGA 4S2DA 2VQUA 5K9YA 3UKVA 2O8QA 4Q2FA 4XYXA 5FZFA 1XU1A 2O14A 3A22A 1BBT3 3M3EA 4QDRA 5JSRA 1SBDA 1OHFA 3V56A 2CDOA 5HI0A 4Q1PA 4QM9A 2VUAA 4PIYA 1VALA 2B7YA 3ZYIB 3AYDA 1X9TA 3JQWA 4D7SA 4BYYA 2AEYA 2P4EA 1RUI3 2VBDA 2GN7A 4IE5A 1KDKA 2HKXA 1DZRA 3ROUA 1AR91 4XBQA 3FLTA 2NQYA 1K5JA 5C9AB 2ADEA 4ONUA 5GJ6A 3Q8FA 3SHRA 3OGRA 4QHZA 3O1SA 3BKZA 4R9CA 3WW4A 4Q8KA 3ZVXA 3S5AA 1MS1A 3EBRA 1DLLA 1KJLA 3AXDA 2CSGA 2FCVA 2RM22 3LDBA 3VD3A 1GWMA 4AYUA 4IE0A 2VNGA 4F83A 4Q4Y1 4ISQA 1CX4A 4URTA 4AE2A 1ZZ6A 5IFTA 2J22A 1Z7S1 2WO7A 1CZTA 4KGQA 4JKKA 5FZGA 2D7FA 4A45A 3Q8AA 3MW3A 1FOD1 1N1VA 2BEOA 4DOUA 5C33A 3NRUA 4ARYA 2IXKA 3R6SA 1KFUL 2O0OA 1O3QA 3AKRA 1YC61 1O6UA 2OPKA 1XNAA 3CJIC 1YRZA 2OYZA 4YW5A 1UNBA 2QQLA 1CQ9A 4N9IA 4NIIA 4NRMA 1UX6A 1S0FA 2JG9C 3ES4A 2ZEYA 2WWUA 2JB8A 4Y1VA 5BNNA 3PHMA 2B45X 5E6HA 3VBSA 3WY6A 4MOAA 2C5DA 1TME2 3AP5A 3WLUA 3DEMA 4LORA 4Y24A 2C24A 3VBRA 2EXKA 3IMMA 5K8SA 4Z92B 2HYKA 2PFWA 2V5DA 5CU1A 4J25A 3WF3A 3O1VA 2PTMA 5LY2A 3TNQA 2PLV2 3TNPB 1VJ2A 4MGKE 4QGNA 4I30A 2FDIA 3ZXJA 3LIGA 3P3PA 2VU9A 1AX0A 1UU4A 1SFNA 4N90A 4DUVA 1FI2A 4IE4A 3UV9A 2ZA9A 5LASA 1CESA 1H0BA 3AZWA 4H2AA 4LMFA 1JW6A 3B9IA 3MW2A 4IE7A 2WS91 2Y60A 5FZDA 3C3VA 3HVDA 4MHRA 1AYN3 4HKLA 4MUVA 5HCBA 1D0GA 1PMIA 2A6YA 2QQWA 2FBEA 4CDXA 3H7YA 3KWVA 3USSA 5DAXA 1JYXA 4FP3A 1HW5A 1O8PA 3PJYA 1HXS1 1ULPA 3LE0A 1JYWA 4WV8A 5K0UC 3MV11 3WDTA 4G3YC 1W8HA 1ZBE1 5JUVA 2P3YA 4QXHA 3WW3A 1D2QA 1HN0A 1IKQA 1G6NA 2AYHA 2GP3A 2VNOA 3IPVA 5C3SA 2W91A 2QQMA 5F3IA 3VBOB 2Y0OA 5KHGA 4CEYA 1ZZCA 3SISA 3ZXFA 3U14A 1F5FA 2ERFA 1C8M2 1S0GA 1JZ2A 5C8CB 2VUJA 5L9BA 5FXZA 4MGIE 3WHUA 2IXIA 2J1RA 5AVAA 4GXLA 1V9U3 2EALA 1SFPA 4OCTA 4H7MA 3UESA 3TEWA 3MZHA 1AR71 1HIXA 2XBO3 4XIKA 1UKGA 2FCTA 2W87A 3AKTA 4PIXA 5AVPA 3WT3A 4DINB 3GJAA 5FLJA 4QAWA 1F4AA 4BQ3A 4NOTA 5BNPA 4FPJA 4YFZA 1W8ZA 4AFMA 5IK8A 1B35C 3BTAA 3K2OA 3PTRB 1XNDA 4AEJA 4I2OA 2XVGA 1MS0A 2JDYA 1YFWA 2A7AA 3O1RA 3LEIA 4XXPA 5JMOA 1REFA 4YGDA 4XFBA 1LTEA 5FY5A 4BQ4A 3ZSKA 3O0XA 1BMV2 5GM0A 4R9AA 2R062 3UYJA 4Q4X1 1H9PA 4YGCA 3O7OA 5APAA 5FZ8A 2ZZJA 4EWEA 3AYEA 2IFWA 3KT4A 3R05A 1LHNA 5E89A 5A3WA 2QDNA 5E8AA 5F6LB 2ZGOA 4GMP0 2VOWA 3J9SA 4LQRA 1UMZA 2WABA 3OGJA 4RN5A 1JYCA 4S2HA 1OI6A 5FKCA 3MLJA 1N1SA 1MZEA 1ZZ7A 2C9AA 1LOFA 2MHFA 2AACA 4JZRA 4LTAA 4N53B 4O65A 1C1FA 5DG2A 1IOAA 3VKOA 3E1F1 5H9PA 2WO3A 2IC1A 2BGOA 4LO4B 4YM1A 4OHZA 4DUXA 3H8XA 5AFBA 2HEWF 1XSQA 2VQTA 3DPRA 3LFMA 4K20A 4RGAA 3ZYBA 1G86A 4YW7A 4F7ZA 2WFPA 4WVZA 4Z2WA 1V6OA 3M3IA 1ZRCA 3PMEA 3E6CC 1NZCA 2WLQA 4Y5Z0 1RUD2 1ZA7A 1NY71 4XJ9A 2VNVA 1HKDA 3OGGA 1GSLA 4IEOA 5D8AA 5FY7A 4CCLA 1RHI1 1PVXA 1EYBA 1YCIA 2LS6A 5BYNA 2A70A 3SLIA 5JXJA 4LO6B 2VY0A 1GZCA 1TNRA 1LECA 5JSPA 4LBLA 5LK7B 3SEPA 1JYVA 1YI9A 2VZ1A 4Q0QA 4OI1A 2FDGA 1QEXA 4Y22B 4QPGA 3NNLA 4PDWC 5GKAC 2DCJA 3USUB 5BNOB 4ZY9A 1CAXA 4BQ1A 3D8CA 1OUXA 3WDWA 1AR93 4Q0PA 3RVHA 4W4ZA 3PUIA 1RUE1 5FXXA 3KM5A 5I8TA 3KB5A 3M7AA 3TEXA 4DY5A 1ULFA 3FJSA 1Q5OA 3N7KA 3ZX7A 3WVJA 5J36A 3I54A 2RJKA 1W9FA 3OY8B 1PVC2 3AKPA 3D82A 3TB0A 3THCA 2ZX3A 4KWUA 1RVF2 1W2TA 2JDMA 4QQPA 4UWDA 4ZONA 3CJIB 1BKZA 1LULA 2HYXA 1AXZA 4HN1A 4B7KA 5FZBA 4Q4Y3 4EZ4A 1FX5A 1PMJX 3J7HA 3IDAA 1Z7S3 2WA3A 4R4ZA 2VMHA 3FC0A 4LKDA 3VL8A 4WM7C 4UBHA 5JOYA 2W1UA 4FSJA 1FOD3 2H6BA 3JD71 4LK7A 5KWRA 1KJRA 4ZU5A 1AR81 4TZDA 3RDIA 4E4SA 1OVPA 1W0PA 3DKQA 3NAPA 4JTOA 5A6YA 1W04A 4R9DA 1J3PA 3NJZA 1W6MB 3B69A 1UN1A 3UJOA 2R0FA 2CV6A 5FZIA 4FCAA 5A3MA 3MFAA 4IEZA 3E97A 3ZFEA 4WZCA 1W2NA 3MLLA 4C8DA 4BJ0A 3GXUA 4TWTA 2ZS6B 3VZJA 1O59A 4AXOA 2C0ZA 1FT9A 1OKQA 4QPIB 3I8TA 1G7YA 4B4QA 5LWBA 1W8FA 4AI8A 4FT8A 1VIWB 3BOPA 3VZKA 4LLOA 3HWJA 5J98B 1AXYA 3CMGA 2B42B 5JAXA 4ZPIA 4HK9A 2D6NA 4QWNA 4AEDA 3IKWA 5I0UA 3UJQA 4BLIA 1J1LA 2BERA 4XXAA 4Y1XA 1GP5A 4P9LA 1SPPA 5EQUA 5K0UB 1A78A 2EF6A 3LEMA 3MGUA 1DDLA 3ILRA 2WS93 3FUQA 2EXHA 5ANNA 1OD5A 2HWD2 3INAA 3LA2A 4BIFA 1J84A 3N9OA 2WNUA 1K5MA 2C1FA 4HL0A 1K3IA 1YQ6A 4GKYA 3ZFGA 2JD4A 4CUBA 5B4NA 1OD3A 1SLLA 2QZ3A 2YPJA 3EYPA 1AX2A 1DGRA 2OUJA 3ZFFA 1MZ6A 2IFRA 1HXS3 1LR5A 2JDHA 2RM21 4CCOA 4FXGB 4XJZA 4IE6A 4XDOA 3CEWA 5AFEA 1GUIA 1EV12 2IWGB 1ZBE3 3HQRA 5F5QA 3WDXA 3WDVA 2MEV3 4MGQA 3ETPA 1JU3A 2NN8A 1NX9A 1KDMA 2Z5WA 4J1WA 3OB8A 4Z2AA 1HQWA 3LSEA 3FE5A 1B35B 2D6OX 1EP0A 5KR7A 3RI8A 3NNGA 2JE9A 4P9YA 3T3YA 1OQ1A 5EJ1B 3MDPA 1Q3EA 1OMIA 1Q56A 2GNDA 3VD7A 1AR73 2ARAA 2JDZA 4XEZA 4RR3C 2VXRA 4CDWC 1BLZA 2KXLA 3POSA 4X8NA 1D4VB 2FDKA 2R072 2OKXA 3E5UA 1QF3A 3OTFA 1TME1 3KV4A 2DFCA 1BEV2 2VVFA 4RGGA 1JS9A 1YUDA 2HH9A 2IUWA 2QTWB 3W58A 4FTEA 1JN2P 1NUKA 4R9BA 4YW6A 2WL1A 2ZBJA 3LA3A 1MS9A 3O0WA 2DYCA 1ZM1A 2VMCA 4I3PA 2C9KA 1AF9A 1AJKA 2PLV1 4FQ4A 4YFWA 4HOOA 4XUPA 4ASMB 4Q4X3 5L9RA 3ELNA 4IETA 3UKNA 4DXRA 1NKGA 1O3SA 1GKBA 1XNCA 2VE1A 1UO9A 4KU8A 1JXNA 1SBFA 1PO22 2X5IA 2ZX4A 2JEMA 5FZ9A 2BVBA 1QJX2 3RSJA 2G4IA 4BZ4A 3ACIA 4DEVA 2J1EA 3SKVA 1LEDA 2XJQA 5IWFA 2D6MA 1WBLA 3K3OA 5CFCA 2HWC2 4Q26A 2XLGA 2BJSA 2XWJB 4Y1UA 4M0NA 2K9ZA 3NJYA 4H3WA 3KVBA 4PLNA 3K77A 2BWCA 4MXWA 4E2SA 5FRAA 1E57A 1JUIA 4GWMA 4AFDA 3MIEA 1RUOA 3I2OA 4FFGA 4P9XA 4YZ1A 2Y38A 3OYWB 2BW8A 3H42B 3FBMA 1X82A 1WGPA 3H3LA 1AHSA 1YNAA 3LOIA 2IXHA 4PDWB 1QDCA 2JENA 3HN1A 5FZ0A 3O1TA 4HPKB 2A75A 3WQ1A 1C8M1 1HRV2 5A6QA 1QH7A 4YSFA 1PZ8A 4XHBA 5JWPA 3KHBA 1W6OA 3EQEA 1W6NB 3VD4A 5FTTC 2ZACA 3ZYPA 1OQEA 1S0CA 3T2OA 3GF6A 1L7QA 5FPLA 5F3EA 5FK8A 2UYAA 5FFOC 1WW5A 3NO8A 1CVNA 3AJYA 3ZMNA 2W2IA 5C5UA 1QHDA 2A1XA 4LBJA 1PM4A 4M0HA 1X36A 5FQ0A 1UY3A 5I91A 3JB8A 2OXBA 3BTXA 2R16A 1SCSA 2WO2A 2QCSB 4X6RB 4YZ3A 2GMPA 2VPVA 4EN0A 3KQRA 1G9AA 4GJZA 5JCTA 2W92A 4WM7B 4Y1YA 1NCQA 1UYZA 2Y26A 5H9SA 1OQDA 1RUC2 1BMV1 4O7XA 2IXJA 3QACA 4B4PA 2P2KA 2R061 2WNVA 3GBGA 4AI0A 2QQUA 2YHJA 2DVAA 4CU9A 1XJAA 1H8TA 4MGSA 5FMOL 3LD8A 1H2LA 2VBBA 1X50A 1H6XA 1RUG2 4E4ZA 4D3WA 3VHOA 1H1MA 1RL3A 4TYSA 4J1XA 4KBZA 2ARXA 3VKFC 4AF9A 2F4PA 2VCCA 1U5ZA 3H7JA 3I59B 4W6XA 4CXXA 1NA1A 4GH4A 4AAXA 1NLQA 4QGMA 1F2NA 4NPRA 1UIKA 1IHMA 2WLPA 3CF6E 1AR83 3IDBB 5FZLA 4MGTA 4AL9A 1GNYA 2GAUA 1IZ3A 2P1BA 2DBIA 2VTXA 5GLVA 5ACA2 3PVNA 5IK5A 4E4HA 5JIUA 4LHLA 1VP6A 4XCAA 3HD8B 5A1LA 2GSYA 3RZMA 2D97A 1IPJA 1D2SA 3LQCA 1PIV3 5FZ6A 4CDQA 1WUVA 5DG1A 2BGCA 3VBFA 3BTYA 4FAHA 3GYDA 3NV3A 5FZOA 1YQ2A 5JR7B 4E27A 1X8MA 3OOXA 4YVWA 1AYM3 1RUD1 1QIQA 1KITA 1YLLA 4QHOA 2CYFA 1Y9QA 5AC91 5J37A 4HONA 3M4FA 3VDBA 1MS8A 3SITA 4TXWA 5F9TA 5CFDA 5HXMA 3PVOA 4SBVA 2VZRA 1XOYA 2ET7A 2YGMA 1U5YA 4N9HA 4D7TA 5A70A 1NAEA 1UOGA 1VMFA 1X8EA 1V00A 2XJSA 4IEYA 5GLTA 4URAA 4CU7A 1I1EA 3IAQA 3NW4A 4QKBA 1RGSA 2X8KA 3OEAA 3H50A 5JZGA 4H55A 4P08A 1AZDA 1HV0A 2WWJA 1RUJ2 2ZX2A 5FUPA 2VUDA 3JXSA 3B94A 2YDEA 2DWRA 3BU7A 2ZGSA 2X05A 4MSVA 2FDFA 3IN9A 4ES9A 4K40A 3JBG2 3PIGA 1PVC1 3EB7A 4K8FA 4L92A 4K8RB 3TEZA 2RM23 1RVF1 1WA4A 2OPWA 1HRI2 2YXSA 1KD7A 3N9QA 2DTWA 1DU3D 4D7YA 2EXIA 5KXBA 1WLCA 1PK6A 4WVVA 4WVWA 3VBHC 2HWF2 1H30A 3DN7A 1BVVA 4QMAA 4EZHA 3I3MA 1VPHA 2RS32 4A42A 4CDWB 4RA0A 4Y33A 3KCCA 3V0AB 2W94A 3PU3A 5HCFA 1Y7BA 3ZDVA 3H3ZA 5F3GA 1TNFA 1R092 5ABJA 1LESA 2WFF3 4ZU7A 4OI2A 4W6WA 2D44A 4MXVA 2W39A 5GZEA 3DXUA 2P17A 3WHTA 1A34A 2WQZC 4NN0A 4XQ4A 1XE8A 4AG4A 1JBCA 3ABZA 4TLFA 3O1OA 1UOJA 2AH2A 3KSCA 1GOHA 3OG2A 4FO9A 2RDQA 1TME3 1PGSA 4Q27A
chains in the Genus database with same CATH topology
1O3TA 1RUH2 3TN92 5FPXA 4BHPA 3ZN5A 3LAGA 3QCWA 2XVKA 2WJSA 3VZNA 1AL0G 2VW2A 2AZ5A 1DQ0A 2V09A 4YVSA 1LGNA 3ZN6B 2ZGMA 4R52A 2YC0A 3WP5A 1VBB2 2A6XA 2VMGA 2GC0A 1ND3A 1BZWA 3THPA 2HWD1 5L7OC 1LOCA 4AEMA 4M3CA 2DCTA 2KA3A 1BJQA 1G9DA 1W6PB 4META 1YFXA 2WQ4A 4BH9A 1RUNA 4XILA 5GZDA 1AVBA 1FNZA 3KT1A 1EV11 3WINE 5C6CA 3DV8A 2SBAA 1F8VA 3TAYA 2GNTA 1QNYA 1CPMA 3B5LB 4NO4A 3VDDB 2ZHNA 2P3IA 1Q43A 5DZEA 5SV8A 5I8SA 3SH5A 4L2NA 4IEUA 4O9GA 1Q8SA 4YLZA 1S2BA 4M3CE 2ZKNA 4Z82A 2HWE2 2ES3A 5C4WA 2R042 1V6KA 1WCSA 5FO8B 2R071 3GHMA 4COZA 1GICA 1G9BA 1BEV1 4ZKTB 4QGLA 1CAWA 5JMCA 2PHTA 1MACA 3RNSA 3JUUA 4YW2A 5A33B 2LM3A 4QPYA 2QJVA 3IMNA 3VUOA 1BYHA 2R063 1GNHA 3VBOA 4XJAA 4OFGA 1PO21 1LOBA 1LOAA 4KU7A 4BA6A 4LT5A 1QJX1 4PBPA 1GQGA 2R1DA 3NV4A 2E9QA 1VRH2 1WMEA 1ZNPA 1ENRA 2HWC1 4Z8BA 2MPFA 3IIAA 2K0GA 2WT1A 2EVXA 3FZ3A 2I2SA 2HWB2 2LTNA 3GNEA 1WCKA 3ZXDA 4YARA 1CIWA 2CNAA 3ACLA 4FPLA 3ZSLA 2WSUA 5BNNC 1NOVA 1YHFA 3VBSC 2UY9A 4XW3A 4EROA 2DCKA 5K7PA 1NCRA 2QNKA 5BNOC 2QFEA 1VAMA 3SCFA 1UW8A 4LUMA 1RUD3 5HCAA 4DXZA 1HRV1 2XH6A 3ZXLA 5AC93 5F6KA 2D98A 3VHNA 4RS5A 1FPN2 3KD4A 5E88A 5HXVA 2E53A 4LA3A 2UWCA 1W0OA 2XPJA 1WMFA 4XDQA 4HFSA 2ZGUA 2RS53 2NMOA 1SLCA 4OLLA 1UAIA 1S0DA 3VBHB 4CDXC 4AQTA 1Q8VA 2BWAA 3Q9OA 1N47A 1WD4A 1RUF2 1OLRA 3E6BA 3MF6A 1PVC3 3OJBA 1RUC1 2P3KA 1RVF3 1MEC2 2VW0A 4E4DX 3EXUA 3AMHA 3WR0A 5JVVA 1AR63 1RUG1 2GU9A 2Q5TA 5T5JA 5KXDA 1OA2A 4CEYC 4PLMA 3O5SA 4L99A 1CN1A 1HLCA 2XLAA 4WVMB 4LE4A 1TMF2 5DXDA 4CYDA 2NLRA 4X8PA 4QPIC 4LLFA 1JOJA 3JZVA 3J4UH 5EYXA 5ACA1 4OI4A 4OZXA 1H4GA 1GNZA 3WXPA 5BNPC 3A4UA 2RE9A 2I45A 1UIJA 2CGOA 4P14A 1MVEA 2YV8A 5EV7A 5H9RA 5KC6A 4I0WB 3GBWA 4F8AA 1JHNA 1XYOA 2A3WA 3QLQA 2DTYA 4LBQD 4RHV2 4DPNA 4K6BA 5L7OB 3C2UA 1BXHA 1XE7A 2W0XA 2YUEA 2LUWA 2P37A 1IQAA 2CY6A 1S0IA 1LODA 1Q8QA 2JG9A 4Q0SA 4ATFA 2TBVA 4FOQA 4H7LA 1QJY2 3I7DA 2AREA 1POV3 4CEWA 1AL22 3IDEA 2A73B 4EJRA 3O14A 2HWD3 2UWBA 1QOSA 1RMU2 1RUJ1 3HT1A 4N43A 2D6PA 4C90A 1LOFC 4LO8A 2A6ZA 1DHKB 2IZWA 1YFYA 1MQTA 2QUOA 3JBG1 4FPKA 2EAAA 4BWOA 1HRI1 1SMVA 3KMHA 1QU0A 1EV13 1LENA 4OHVA 4JC1A 2D5FA 2HWF1 1VBA2 2RS31 1YIPA 3AXEA 1EAH2 2BFUS 1QJU2 5D8AC 1J1TA 4Q4V2 3TOJA 3ZXEA 5JPMB 1QXPA 2NM1A 1FMD2 3ZIXA 1R091 1ULGA 1JYIA 3CO2A 4EWAA 1C28A 4KWLA 4MYEA 2RS12 2D3SA 2A3XA 1BQPA 4XF9A 3POWA 2WZR2 1L3JA 4COVA 4P9IA 2R073 2PA7A 4AVTA 4Q29A 3SH3A 1BEV3 2JG8A 1RUH1 3TN91 4Y20A 1LCLA 1QNWA 2OVUA 5JOZA 3R0RA 4YM2A 1ZZ8A 5BPXA 3AFGA 4X6QB 3S30A 2NP0A 2X53S 4Z07A 5FOJB 3M3OA 1S2KA 1OA4A 2ZGNA 1OFSA 1PGW2 4RFT0 4KQ7A 5HBAA 1CPNA 1H4HA 1W39A 4YRDA 1VBB1 4M3CF 3ILNA 1PO23 1RINA 1OLQA 2CTVA 4GMP1 5T5LA 2H0VA 5FPZA 5BNNB 4XPVA 1IPKA 3VBSB 1QJX3 4PLOA 4RQPC 4GIQA 5E16A 1VAKA 3KGLA 2BFUL 3BIWE 4FTSA 2HWC3 3IT8A 3NAPC 2PELA 3R4DB 2QDRA 3MIGA 3G6JB 1URXA 4FQZA 2A5ZA 3MLKA 5GZFA 5FLHA 4HT1T 1EPWA 3D4KA 2GDFA 4JGYA 5FLIA 4ORFA 2ZX0A 2CL2A 3ZFEC 3POYA 4XF0A 3ZN4A 2ZMKA 3FUOA 3VBRB 1DGRN 3RG0A 1HV1A 1PZ9A 2TUNA 1YWKA 2HJIA 1H8VA 1GZWA 3AMQA 1HRV3 5A32A 3LKJA 4IV1A 1RB8G 4CDXB 2R1BA 2R30A 4AEDC 1JTZX 3WDUA 3ZSEA 4MLOA 2HWE1 1LOGA 2R041 4LBMA 2UU8A 3IPVB 4AHZA 3RQ0A 4JGZA 2WNUC 1K5MC 4BCUA 4JRLA 3ZFGC 4B29A 3ZFFC 4CEYB 3VN4A 4K1YA 2F6BA 4KWJA 3H8UA 2WNEA 3RMXA 4OHWA 2SLIA 5KXEA 4HN0A 4NWWA 1ZVFA 4LBQA 1KQRA 3BB6A 2GNMA 4AI1A 4HPKA 1BCXA 4CP0A 1SQ4A 5C8WA 4U36A 4YZ2A 2TEPA 5BNPB 2XB6C 1D0HA 2AENA 1DG6A 1LU2A 1CJPA 1VRH1 5FBZA 1XRUA 4W6YA 2HWB1 5IUQA 3MYXA 2WINB 3VZMA 4DRRA 4HKOA 2VECA 5T5PA 4DS0A 2XVLA 4HVOA 3A0NA 1LGBA 3U0ZA 2XKPA 4GKXA 2OA2A 4O9EA 4BOWA 4IV3A 4XETA 3AMMA 4N7IA 2XJVA 5FREA 1QKQA 4LO7A 3W59A 2OUHA 3MIDA 2FHRA 4IERA 1I9RA 5LRSA 4Q8LA 3R4SA 3HR9A 1FPN1 2D40A 1UL9A 3QD6A 2XJUA 3A0KA 2X5IC 1VAVA 2ATFA 3DPRB 5BXXA 1LU1A 3ZO0B 1WMDA 4AFCA 3WQ0A 5CFCC 4L11A 5DUWA 1RUJ3 5KHKA 1V70A 1ND2C 3H1MA 1KFXL 5D8AB 3TWIA 1RUF1 2QKDA 2ZHMA 4XJUA 3JBG3 3URFA 3VZLA 3ZDSA 3H3UA 1HRI3 1MEC1 3B9CA 3DUIA 1R082 4K3UA 4AGGA 1XQNA 5DDJ2 3KCXA 4GULA 4D69A 2XKOA 5FO9B 4QPGB 2HWF3 1CAXB 2RS33 2B39A 2WSVA 1WLDA 4G4FA 1OFNA 2VMIA 5BY5A 1XYPA 1TMF1 5I0SA 1R093 3AP9A 1YI7A 2DVDA 3ZSJA 1SCRA 4HKWA 4OUMA 2GNBA 2ZTNA 5CADA 3FMGA 4DMIA 3HQXA 4K21A 2BPA2 2O1QA 4B7EA 1RUH3 1W6QA 1QXRA 4YYOA 3TN93 2XJRA 2GC2A 3LOBA 1YYNA 1NCQC 4F3JA 4RHV1 4RQPB 4ZXKA 2D43A 1GFF2 2OIIA 2Q30A 2WNVC 2Z42A 4IXLA 1QOOA 3VL9A 2GN3A 3NAPB 1H8TC 4HMZA 1RHI3 4RR3A 4DNYA 1RTVA 5KHJA 3ATGA 1QJY1 3OF1A 1VBB3 2BQPA 1UZZA 2E63A 1AL21 4DB5A 2NPIA 1NA1C 4NR1A 3RI9A 4GH4C 3ZFEB 1PNFA 1RMU1 3VDDC 4YG6A 4XJ8A 1WW6A 1V6IA 3VKNA 1LRHA 4MVTA 1HX6A 1CAUA 4IQPA 1RUE3 4LR4A 1ULEA 3PLQA 4AEDB 1S0JA 1ENSA 3N7JA 4LEJA 3VBUA 1VBA1 2ZHKA 4QXKA 1EAH1 1QJU1 1I3HA 2WNUB 1K5MB 1DBNA 4Q4V1 4KWKA 5CFDC 4AGRA 2ZMNA 3ZFGB 4RL7A 1FMD1 3KT7A 3WUDA 1YIFA 3ZFFB 4QQHA 5EZWA 1VBD2 1NYWA 3S6PA 3JD73 3N4MA 4WM8A 2A3YA 2RS11 2HWE3 5JZGC 4JVAA 2ZAAA 2R043 2WZR1 2GC1A 1SACA 1W6PA 5CG9A 2JJ6A 1JH5A 3N3HA 1O3RA 4I02A 2VOKA 4I3GA 5LEKA 3FWEA 4CP2A 1C8NA 2RJLA 5LRRA 3LSDA 5BV6A 2QQPA 4QU2A 4PCRA 5KHIA 3WUCA 4TSVA 5DUVA 5GZCA 1PGW1 1QWRA 1OSGA 1WD3A 1LHOA 4XMIA 4I01A 3H1WA 2WZPP 2RMU2 4JTNA 4QQOA 2B8MA 1SEFA 1QMJA 4OHXA 1DF0A 1CR7A 4AVBA 2EIGA 4EN6B 3S0MA 1RJ8A 5CNAA 5L36A 1TQ5A 4CDUA 5ABJC 3V0BA 2CAUA 4IEWA 2EAKA 1OOPA 5CIRA 3AK0A 4AWDA 3LZZA 1VBC2 1NLRA 3M2MA 1AX1A 2MEV2 4C91A 3B00A 3CNAA 4YG3A 1ASJ2 2VVDA 2X5IB 2B5HA 2BTVC 1ZZBA 5FCCA 5T52A 5CFCB 5DUXA 3M8LA 2YYOA 3FBYA 1VB4A 3ZYJB 1CD3G 1N3PA 1O91A 4IEQA 4XBNA 2Z2SB 3ZYGA 1ND2B 4YVSC 1FPN3 2ZX1A 4PJYA 4YGEA 4MXWB 3HIFA 1ND3C 1MS3A 4XBLA 3JCIA 4LE3A 4YW4A 3L9JT 5GLUA 1REDA 3EO6A 4FPYA 1O4TA 1ULCA 4JV4A 4MH0E 3VKMA 2OZJA 4XFFA 5C9AA 4AVSA 2Q0AA 1RUF3 4LA2A 5D1IA 3WV6A 4XZPA 4HSJA 4K7JA 4A3XA 2I07B 3ALQA 4BLJA 4KL1A 1MEC3 1G9FA 1C57A 3LA7A 2DCYA 4H14A 4CTEA 2PLV3 1GR3A 3X29B 1POV0 2PQQA 3HMYA 4FOVA 5J48A 5FQ0B 4B4RA 3RYRA 1HQNA 5IK4A 4GALA 5JIAA 1O5UA 4XFAA 2BNNA 1TMF3 1F31A 1NCQB 3VLBB 4HSLA 4JQRA 2GH2A 4COUA 2ZZQA 3RS6A 5C4WC 1ZRDA 2WNVB 1DQ2A 2R6QA 2ET1A 1H8TB 3J8F2 4QHBA 3RRDA 3WG3A 4AQ2A 4HBNA 2XJPA 5CA6A 1VBE2 2ZGQA 1GBGA 2PHLA 1R1A2 1NA1B 4RHV3 4GH4B 5GLZA 4B8EA 2EXJA 4JAAA 1C8M3 2AR6A 3AZXA 1Z0HA 1U0AA 1QJY3 3MIBA 2DFBA 2D6LX 4J6GA 3RJRA 3OPZA 2JICA 3L2YA 2Q1ZB 4AW7A 2WT0A 1S1AA 1RMU3 2DV9A 2ZGTA 3APBA 4Y26A 4YVWB 4INDA 3MF9A 2G9GA 4U2AA 1BK1A 3MEPA 3BPZA 3R4UA 1SFYA 3ZMOA 3HBZA 4DZGA 3LWCA 5CFDB 3AP6A 4KBBA 2RR12 2UWAA 1DIWA 4Q4W2 1R1ZA 1R081 5DDJ1 1NCRC 3WP6A 3O0VA 2EA7A 4GB32 1VBA3 5JZGB 3J26N 1CAVB 1QGLA 1V6MA 5KHHA 4P9GA 3AKQA 4HANA 2I74A 3NVCA 4RS5C 4HVQA 5C8CA 3WP3A 3WOGA 1FMD3 3MI8A 2UYBA 3N7LA 4AQ6A 1RITA 1XXNA 1M06G 3GZUC 1PIV2 1VLNA 1SLIA 1ULDA 2A71A 3G7DA 4I0BA 4E2GA 2WZR3 1A3KA 2CGNA 1AYM2 1LOEA 1PK6B 4EN9B 2PHRA 3MIFA 2W68A 5DUUA 4QX5A 4AVVA 1WLWA 4LBKA 3WQ7A 5ABJB 1S55A 5CB7A 3WW1A 1XNKA 3AFKA 5TSWA 3PJQA 4FP2A 2VQ0A 3AX4A 4FTBA 1QQP2 3VBRC 3WCSA 2E7TA 3B3QE 4IEPA 1DZTA 1J3RA 3THTA 5JI9A 2KM2A 4N53A 1SDWA 5T5OA 1N1YA 4AGVA 2PHXA 3PVEA 2DVBA 4YVSB 1SLTA 2AGSA 4W65A 3V64A 4JCKA 2OZ6A 1O5LA 3DF0A 1ND3B 4D94A 5SV5A 4ISRA 4M3CB 2WFF2 3AKSA 3NKTA 5FAXA 3OBRA 2D3RA 4R8HA 1A6CA 3M3QA 4GA9A 4YM0A 1HDKA 4YG0A 1VBD1 4QQLA 3OCPA 1COV2 1ZYBA 3FLPA 4ZU4A 4XTPA 3JQXA 4C1XA 4CEWC 3FFZA 4Y22A 3BALA 5BNOA 1RJ7A 3USUA 1ZBA2 1UCXA 3M70A 4N43C 3AJZA 3LB9A 3D0SA 2YY1A 2CGPA 5JDBA 2HEYF 1UKRA 4MZUA 3D0JA 4DINB 3SH4A 4NHMA 3VHPA 2D5HA 3MICA 4AQSA 2OW4A 1MQTC 1SLBA 4YM3A 2R32A 3OY8A 4BIOA 2ENRA 4P9WA 1NQJA 1F9KA 3SMHA 4UW3A 1C3HA 2WC2A 3CJIA 2PAEA 1AUYA 3N36A 4MX3A 5C4WB 2ETEA 1LKNA 2RMU1 4IL7A 4UW4A 4GWNA 3P3NA 2ZPXA 1H1IA 4OHYA 1RIRA 1AJOA 1DYPA 3W9AA 1CAWB 5EXOA 3GZAA 4KG0A 2XG3A 1T6GC 2TNFA 4M00A 1J3QA 4BE3A 4FAGA 3SNMA 1VBC1 3GBFA 4XFGA 2MEV1