2R1DA

Crystal structure of rat neurexin 1beta in the ca2+ containing form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
GHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurexin-1-beta
publication title Regulation of Neurexin 1beta Tertiary Structure and Ligand Binding through Alternative Splicing
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion, splicing
total genus 42
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, W
ec nomenclature
pdb deposition date 2007-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r1dA00
1LOBA 1UX6A 3PVOA 1SFYA 1JUIA 5IUQA 2ZGTA 3AP5A 1JXNA 4Y22B 1LHUA 4XHXA 1W6MA 1NXD1 5IK8A 3WDVA 3U4XA 1AJKA 2A3YA 5EYXA 1CVNA 3VKNA 4DRRA 4Z8BA 2D3PA 2LTNA 3R4SA 1N47A 3PJQA 4AGGA 4YGCA 3HR9A 4K20A 4YGBA 1F9KA 3ILRA 1GBGA 4I30A 4ASMB 4AYUA 1YYNA 2E6VA 5GZEA 4D69A 4L8QA 1G8WA 3VKOA 4FPKA 2ES3A 1N1SA 3POYA 3V65A 2NM1A 1LU1A 1YI7A 2DTYA 3AYDA 1FX5A 2G4IA 1ENRA 2SBAA 5DG1A 4P14A 4YM2A 3ZSKA 4WV8A 4W65A 4C1XA 2P3IA 4XJWA 1LESA 1W6NA 3GNEA 2W08A 4XJAA 1GICA 2AUYA 2DVGA 2E51A 1CR7A 2AYHA 2E7QA 3M3OA 2ZAAA 1A3KA 2A71A 3N7LA 5GZDA 3AYAA 1VAVA 4XHBA 2YROA 1FNZA 2UURA 2W68A 4YFWA 4FPYA 2ERFA 3FLRA 3M1HA 2D6MA 1QMJA 1W6PB 1IKQA 3WG4A 2ZGSA 3WUCA 1SLBA 1QOSA 4YG0A 4AVTA 5GZFA 2NN8A 2YZ4A 5T5PA 1BXHA 1N3OA 3RSJA 2A6XA 2ZHNA 1DQ1A 1DZQA 1VIWB 5GALA 4AGRA 1UZYA 3IMNA 5T55A 2D6OX 4FP3A 4FPCA 1UZZA 1KJLA 4M3CF 4PF5A 3QCWA 5FREA 1GV9A 2VH9A 1IS6A 1N1TA 2CL2A 3USUB 5E88A 2OVUA 3R05A 5F9TA 2DUQA 3WV6A 1HQLA 3NV2A 4YG3A 2AGSA 1QKQA 2H0BA 4GWMA 1W6QA 4ISQA 2UU8A 1MZ5A 1DQ5A 4FVVA 2A3XA 3N35A 4YZ3A 5EYYA 3MW3A 4UW6A 1DGLA 2OUJA 3SLIA 1KQRA 3ILFA 5E8AA 1JBCA 1LGCA 5IT6A 4YGDA 3AZWA 4BLJA 2R49A 3AJYA 1LGNA 2GNTA 1Q56A 1WUVA 1MS1A 2A5ZA 3ZXEA 5CBLA 1Q8SA 1A8DA 1DFQA 5H9QA 3RRDA 1OQ1A 1WW7A 5FRAA 4DFSA 1Q8OA 3VUOA 3AK0A 1H9PA 1SLLA 4PBOA 3QLQA 4HL0A 3N7MA 4FQ4A 4YZ4A 1GZWB 3B00A 2A7AA 2YXSA 4XJZA 3D6EA 5GLZA 2Z42A 3IPVB 2LALA 4NOTA 4LBOA 3D4KA 3L2YA 5CAZA 3LSDA 5T52A 3HMYA 2YMZA 1RIRA 2P2KA 1LULA 3AXDA 1GNZA 3VV1A 2GMMA 1O4YA 1FYUA 4FOVA 2NZ9A 2XB6C 3MEPA 4LBLA 4SLIA 1MVQA 3N7KA 2OUHA 4R9DA 1MS4A 1WW5A 2DU0A 2TEPA 1FV2A 3FBYA 3FLPA 3AYCA 3OPZA 1ONAA 1Z78A 4ATFA 4XIKA 1MACA 4DS0A 3IN9A 1MS5A 4FP2A 2JE7A 2XG3A 1MZ6A 1WLWA 1Y7BA 3BIWE 1QU0A 1VALA 1G9BA 1XQNA 3LCPA 2ZGPA 1ENQA 2VU9A 4YM1A 3V64A 1C1FA 1W6OA 1G9AA 4C1WA 3UJOA 2R16A 4YW1A 1KRIA 1S1AA 5CNAA 2OW4A 3B9CA 2PHTA 2UWAA 2WNEA 1AJOA 1AX1A 1LJ7A 1AZDA 1SLAA 2A6YA 1WD3A 2ZGRA 3BODA 1IS3A 2ZGOA 1HDKA 4XXPA 1LODA 1DQ4A 3I8TA 4P9XA 4LBQB 4YM3A 5HCAA 2ZHLA 3PVNA 2WT1A 2GNDA 1TEIA 3M3EA 2EAKA 3V0BA 3OYWB 4FOQA 1UPSA 2VW0A 4GALA 4H55A 4DQAA 4RL7A 1IS5A 1GANA 2WT0A 3ZYPA 1SBDA 1OFSA 2NP0A 3O0XA 3GALA 3O12A 1CJPA 2DURA 2W52A 3OBTA 4BMEA 2P37A 1ULCA 1YRZA 2DUOA 3OY8B 4MYEA 4Q27A 5DZFA 1KITA 1N1VA 2ZHMA 1SACA 1Q8PA 2ZGLA 3WCSA 1MS3A 3FUQA 4FPOB 2SLIA 4AVSA 1SLIA 4JCKA 1CPNA 2E53A 4U2AA 4YZ5A 3BTAA 1IKPA 1U0AA 1FATA 2D44A 4M3CA 2PHFA 2ZZJA 2P3JA 3UK9A 2GN3A 2FMDA 5DG2A 3VKLA 2VXRA 2D6PA 2DUPA 1JN2P 2HYKA 2WKKA 3PVEA 3WUDA 4ZKTB 1AXZA 2WQZC 1GKBA 2ENRA 1V6JA 4FOWA 2NMNA 1IOAA 4P9WA 1F5FA 2PHXA 1CQ9A 4XXAA 2ZMKA 4K1YA 2EXJA 3AZVA 2V5YA 4FPGA 4LBJA 3M2MA 4XMAA 1UL9A 5H9PA 4TYSA 1BQPA 2V73A 5F5QA 2ARBA 4K1ZA 3JU9A 4AGVA 4GA9A 4WZFA 2P3KA 3KM5A 2CNAA 2EXHA 3NV1A 3WG2A 5T50A 3MPPG 4Y20A 4BMBA 1FNYA 1BYHA 3CNAA 4Q8LA 1RINA 3V0AA 4YFZA 3IM0A 1ZA4A 3OBRA 4BQ1A 2WJSA 2WSUA 3AZYA 1DLLA 3AP4A 1ULFA 1VAMA 3DGTA 5DUUA 3TAYA 1KDKA 1DIWA 1JHNA 1GZ9A 1MS9A 3ASIA 3D5OA 2A6VA 3B01A 1C57A 4Y22A 5DUXA 1A78A 5GM0A 4FPLA 1AF9A 1DYPA 3POSA 4JRAA 1S0CA 4CTEA 3R4UA 5JOZA 2PELA 3WDXA 3JUUA 3A0KA 1MS0A 4XBLA 4BLIA 5GZCA 5BYNA 3WOGA 1S0GA 1GLHA 1LOAA 1WD4A 1Q8VA 2D3RA 4AWDA 1MR5A 1W6MB 3M3CA 1NLSA 4GWNA 3WDWA 1G9CA 3AYEA 2EALA 5JDBA 1QF3A 1APNA 4ATEA 2DVBA 2VW1A 4Y1ZA 1S0BA 3WNXA 2A3WA 2ZMLA 1FAYA 4GKYA 1S0FA 3LSEA 5KXCA 3WZ1A 4XILA 2AENA 5T5LA 3ZSLA 1AVBA 1BZWA 5CA6A 1PZ9A 1CN1A 1UAIA 4M01A 3SH4A 1O4ZA 2BQPA 4R9BA 1JW6A 4R9CA 4PBPA 4XBQA 3TB0A 1ULEA 4FQZA 2E7TA 3A0NA 4XE9A 1CPMA 3FLTA 1OKQA 4XDQA 3UJQA 5AVAA 4JC1A 1R1ZA 1WW4A 1UN1A 1AX2A 1LOCA 1W6NB 1V6IA 1LHOA 4KBBA 2D3SA 2WSVA 4M3CB 4Y1UA 4XOGA 1W6PA 1N3QA 1AX0A 2ARXA 2CYFA 5LK5A 2PHUA 5KXDA 4XJ8A 3ZYRA 2JE9A 1HLCA 3MW2A 3O0VA 4DRVA 3VKFC 3FUOA 4DPNA 4XBNA 5JLVA 2RHPA 1S0IA 3N36A 3OGGA 4YW3A 1WCSA 4YZ2A 1LHNA 1SCRA 4F83A 2YY1A 3N3HA 3NV4A 5E89A 2DTWA 2ZABA 3RQ0A 3WVJA 1G9DA 1ENSA 1G9FA 5SV8A 2VY0A 3WDYA 1D2SA 3ZXJA 2KM2A 4M3CE 3WHUA 5HCBA 3USUA 4XIOA 3O0WA 1ULGA 2I2SA 1DBNA 3WHTA 2DVAA 1QNYA 4Y1VA 1DQ2A 5EXOA 3SH3A 1YO8A 3ENRA 1GSLA 1ULDA 4BPZA 1DQ6A 2P34A 4OZXA 1MVEA 3AP6A 2D6LX 4ITCA 4WVWA 3ZPYA 4YG6A 1V6NA 2ZGKA 3B3QE 2PHRA 1QDCA 1LHVA 5HCFA 2AREA 5H9RA 1J1TA 1V00A 5DZGA 2A6ZA 1WLDA 2DVDA 4Q2FA 1Q8QA 2EIGA 3SNMA 3RG0A 1W6QB 2ZA9A 2DVFA 4Q1RA 1RITA 1D0HA 1W0PA 3FFZA 3T1LA 3O5SA 3T2TA 5JOWA 2UWBA 3ZSJA 5GLTA 1DYKA 1CONA 2NMOA 4K21A 4PCRA 1LEMA 2GDFA 1IS4A 2GNBA 1GZWA 4GKXA 1SBEA 2B7YA 4GXLA 4LBKA 5L73A 2W39A 3IPVA 4AVVA 2D6NA 2R1DA 4LBMA 2ZMNA 4PQ9A 1N3PA 1KDMA 4YGEA 4CZSA 3KQRA 1LOEA 1UKGA 1VLNA 2A75A 5CB7A 5KXEA 1LOFA 5EWSA 2VW2A 2R1BA 5GJ6A 1QOTA 1F31A 4U36A 1H30A 3AJZA 1W0OA 2A70A 4XTPA 5DUVA 3AZZA 5JOXA 2DV9A 1S0EA 4CRQA 3AZXA 1WW6A 1WLCA 3SH5A 4HANA 4ZXKA 3BOPA 2DYCA 5IK5A 1JYIA 2JECA 1X50A 2C9AA 4UW4A 1PZ8A 5T5JA 3MW4A 3T1MA 5JOYA 1QGLA 3SITA 2EXKA 4BM8A 3AFKA 2VUAA 2C5DA 2CTVA 1EPWA 1FV3A 3AP9A 2D7FA 3NV3A 4YLZA 2CWSA 4Y24A 1YXWA 4YM0A 1GYKA 1N1YA 2YV8A 3VKMA 5GLUA 2ZHKA 2WT2A 4Q26A 4XTMA 2PHWA 1MS8A 4YW4A 2NYYA 1QDOA 1LTEA 3WCRA 5JMCA 4RA0A 1PZ7A 4UW3A 3WDTA 4ISRA 1W6OB 1LCLA 1GNHA 2R0FA 4FPHA 1AXKA 3IKWA 1LU2A 4LBQA 3ZSMA 3H0OA 3W59A 1DQ0A 3WG1A 4XMIA 1S0DA 3ZXLA 3AX4A 4WVVA 5DUWA 1C1LA 3Q9OA 3OYWA 5DXDA 4Y1YA 3I4IA 1BKZA 4NO4A 1UMZA 1CESA 5IK4A 4BOWA 3RMXA 1LOGA 2GMEA 2A6WA 2AR6A 3OY8A 2GNMA 5DZEA 2D6KA 1S0JA 2AH2A 2EXIA 1SLTA 2ZBJA 3NWKA 1LGBA 4Q1PA 3V0BB 3C2UA 3PMEA 1ZM1A 4Y1XA 4FPFA 4XJ9A 5IK7A 4XZPA 1CIWA 1JOJA 5T54A 1URXA 5KXBA 4YW2A 2JKBA 2GN7A 2JDZA 3ATGA 3APBA 4Q8KA 5H9SA 4YZ1A 1DHKB 1I3HA 2DWRA 4R9AA 1Z0HA 5GZGA 1SBFA 1AXYA 1LEDA 1JYCA 2JD4A 2UWCA 3INAA 5GLVA 2Q5TA 3WG3A 5GLWA 1I1EA 3AXEA 5T5OA 2D43A 1WBFA 2ZKNA 2CY6A 3POWA 1SLCA 4M00A 2ZGQA 3AP7A 1LENA 3UL2A 4YW5A 1V6MA 3ZXKA 1V6KA 4XJUA 1BJQA 1YIFA 3DUIA 3ZVXA 3ZXFA 1B09A 1WBLA 1QNWA 1QOOA 4UW5A 4FPEA 2FHRA 4FPJA 1V6LA 2EF6A 3WDUA 3RS6A 1LECA 1SCSA 1HKDA 1LHWA 1LOFC 1HQWA 2GMPA 2R0HA 3M3QA 2WLQA 1GZCA 3N7JA 1G86A 2DU1A 4IQPA 3SISA 1KJRA 2CWMA 3ILNA 3A4UA 3HN1A 1G7YA 2ZGNA 2ZGUA 4Y26A 3W58A 2GALA 2ZACA 5JVVA 4TZDA 4XYXA 4FOYA 3OJBA 4Y20B 1V6OA 4LBQD 1H9WA 4P9YA 4LBNA 2ZGMA 1C4RA 2JJ6A 3B69A 3V0AB 3RMYA 3WLUA
chains in the Genus database with same CATH superfamily
1LOBA 1RUG3 1UX6A 2EA7A 1SFYA 2QZ3A 3RYRA 2VOWA 1DGRN 4NIIA 2NP0A 3VHPA 5JWPA 1KEXA 3KCXA 1JYWA 5FP3A 3HT1A 1LHUA 5FBJA 1CAXB 1DCSA 1ND2A 1XNDA 4MGQA 4KU8A 4QDSA 4AFBA 3N9MA 1VMJA 3PUIA 2D3PA 1NXMA 3VBSA 3R4DB 5JXHA 4XAEA 3OUIA 4Q4W1 4IEQA 3UETA 5JPMB 2E6VA 1E5RA 3T4HB 4D69A 2RS11 4L8QA 1H1IA 4EWEA 3D3AA 3VKOA 3WW1A 4B1MA 3WP5A 5EHDA 4CCEA 2YBKA 4YWAA 5JCTA 3BTZA 3AYDA 4MHRA 2GH8A 4MVTA 4MGZE 1JZ3A 1AYM1 4GAZA 1R081 2SBAA 2WZR3 2EIEA 2R043 2X09A 3PHMA 5DG1A 5LY2A 3SC7X 3WQBA 4W65A 3WNLA 4C1XA 4XJWA 2Y6LA 3ACHA 3QBQA 2W08A 4GB32 4RQPC 4PT6A 2VZPA 2XL7A 4AI1A 2WNVB 1SDWA 2AYHA 3JXSA 3ZYHA 2XGXA 1A3KA 2XUEA 4HK9A 4D6RA 2BRTA 1SEFA 1NE6A 2ARAA 3LDBA 3NNLA 3OSDA 4MGYE 5EPAA 4AAPA 2A1XA 3DL3A 3KWVA 4P9JA 1DGWA 4XHBA 5B4XA 1O7FA 5C3PA 1JYXA 4XAAA 3DF0A 3FLRA 4CCOA 1UPIA 5F3EA 3C7FA 4JV4A 5D8AB 1K3IA 1VBB2 3I3DA 3K77A 2IFWA 4IEYA 2YG0A 2AEZA 5CYYA 3WG4A 1SLBA 2XVKA 4AVTA 3LEKA 2D40A 1D4M1 1VP6A 5F8PA 1BXHA 2O14A 5AC93 1DDLA 4RHV3 2VOTA 1HXS2 4PF5A 1KJLA 3QCWA 1GV9A 2WS91 2CL2A 3DCQA 4GQ7A 4DZGA 4CEWC 2GP3A 2OVUA 4O65A 4QB6A 3HD8B 4FT8A 4QHZA 4BZ4A 4CSWA 3NV2A 4IEZA 4YG3A 2AGSA 2RMU2 5D21A 3S57A 1GWKA 5F5AA 2WZ8A 1W0NA 4FVVA 4NAMA 3I2OA 2IC1A 2W2IA 2PXJA 3N35A 4PLNA 4YZ3A 1VRBA 5CFCA 4OMCA 5HV0A 5J37A 3FN9A 3EQEA 3SLIA 2DBIA 4XFIA 1FXZA 4K3UA 4IERA 5E8AA 3AZWA 2JWPA 1Z7S2 4RYDA 4LQRA 2VZTA 5CBLA 1Q8SA 2R7EB 5H9QA 2VZ1A 1DZTA 3ZFGC 1J84A 1WW7A 4DFSA 1KFXL 3AVSA 4IDZA 1COV2 3VUOA 3KV9A 2QQVA 1CIYA 5C3OA 2QQJA 4OI1A 2JG9C 3B00A 4KG0A 1ZBA3 3ZN6A 4QWNA 2XQRA 2Z42A 2ZOEB 2LALA 5L7OC 3D4KA 2X10A 4CCKA 3ETPA 4LHSA 3HMYA 3I54A 5C9AC 3S0MA 1QH6A 4HPKB 3VBUC 4QPGA 5SV5A 1W8UA 2YDEA 2HWE1 4EN7B 2GMMA 3QH7A 2IUWA 4FOVA 2NZ9A 2XB6C 4IL7A 2CHHA 3N4MA 3N7KA 4EZ4A 3E5QA 4K8RB 5FZ9A 3WQ7A 1MS4A 1WW5A 4XFBA 4KU7A 5EIYB 1FV2A 1I5ZA 1QY4A 5LZ6A 4NRMA 3CZJA 1W8OA 2LRPA 3OD4A 3IN9A 2JIGA 2G9FA 4FP2A 5K8SA 1H8TA 5FXXA 5ERLA 3OPTA 5AFBA 5CFDA 2V4AA 2VU9A 3V64A 1E5IA 2MPFA 3T0BA 4FSJA 3SXWA 2DCTA 4LA3A 4Y5TA 4W8JA 2WFPA 2B4KA 2R16A 2Z5WA 5D2AA 5F37A 5JI9A 2G19A 2OW4A 2R072 3B9CA 4PLOA 2WNEA 2Y6KA 3AKTA 1VE0A 1SLAA 1AX1A 3DXUA 2ZGRA 3BODA 1IS3A 4RS5A 1RGSA 4NROA 4BQ4A 5L19A 3I8TA 4URAA 2X53S 1EUUA 1KXGA 4LBQB 5J98B 3C7EA 1JHJA 3W21A 4JGZB 3VZNA 5FZFA 5HCAA 1Q43A 3PVNA 2WT1A 2VMEA 2E31A 4LUMA 4A2UA 2BOJA 4DUXA 1UPSA 4HOOA 1V9U1 3M4FA 3GCXA 4GALA 4RGAA 2Q30A 4AQTA 4GJYA 4CCLA 1JU3A 3VBRA 2QTWB 1SFPA 2K2SA 1VPHA 2HWB2 4XCAA 5CKMA 5EJ1B 1C8M1 3JB4C 1VAKA 3ZYFA 5CEHA 1YRZA 4JGYC 3LAGA 1OI6A 2L9LA 1ZNPA 1SACA 1Q8PA 2ZGLA 3WCSA 2VNRA 4DIQA 1CGPA 2SLIA 5FMBA 2BTVC 1IG0A 4JCKA 5A33A 4V2WA 1H6XA 1C5HA 1NCRB 4JKKA 2OT7A 1STMA 4LHLA 1AR71 5FLIA 5JZGB 1HRI3 2P3JA 5JSRA 3CO2A 1Y9QA 3OCPA 5FAXA 1RJ8A 1YCIA 3WUDA 1RHI3 2WKKA 3HNMA 3KSCA 4P5HA 4CCCA 4OUSA 3LKJA 4W50A 4ZKTB 2WZEA 2ENRA 1SQ4A 3MLLA 4P9WA 2V4VA 3IIAA 1J3RA 2R6QA 4KH9A 3IDCB 3H8UA 3VBFA 4UBHA 4XXAA 2W9XA 3OUJA 3UGFA 3AZVA 2V5YA 4D0QA 3J4UH 3JBG1 1W39A 4Q4X2 5K0UB 1UL9A 1UOFA 3HT2A 4NUBA 4Y4RA 4NIHA 1AR92 5FP4A 2PTMA 4BQYA 2LS6A 3HJRA 4HKOA 1NY71 3ROUA 2VZ3A 4K1ZA 4E2GA 2C1FA 1ASJ2 1NCQC 3KM5A 5HXVA 3NV1A 3OB8A 1GP4A 3FJSA 4AHWA 4H2AA 2XJVA 5FMOS 1FNYA 1BYHA 1FPN3 1GQPA 3CNAA 1DP0A 4A44A 5AC91 2IVIB 3TEWA 4RHV1 3IM0A 1DGWX 1ZA4A 2QQUA 4OULA 1PGL1 3MF6A 2WJSA 2WSUA 2VAUA 3DGTA 2XL9A 4RFT0 2J42A 1JHNA 2D98A 3ASIA 3ABZA 3BVCA 5LK5A 2J1RA 2QZ2A 3KGZA 4YVWB 1K12A 4FPLA 4QPIC 1DYPA 1REDA 5JOZA 3WF4A 3R4UA 1CAXA 2VECA 2RDRA 2VQTA 4LITA 3CJIC 3ZXGA 4RD7A 5FP9A 3U0ZA 1EV12 5JXGA 2JDAA 4OFGA 1RUF3 1WCUA 2DFBA 4CEYB 3F95A 3HWJA 3K4ZA 2XJTA 4XF1A 5C5TA 1S0GA 3MHZA 1DU3D 2BDRA 1W6MB 3M3CA 2JG8B 3MGUA 5F6LB 2EALA 1QF3A 3THPA 1O6UA 2A3WA 5I0DA 4GKYA 3UESA 2XMLA 4OUEA 5DABA 2BZDA 3LA2A 2AENA 5FMDA 4QT6A 3ZSLA 3BTXA 2VZQA 1B35C 1PZ9A 3AL5A 3QH6A 4FO9A 4M01A 1ENXA 3ZR5A 2ILMA 1O4ZA 4R9BA 3SH4A 2VQUA 4D7TA 4R9CA 5IW0A 2FD8A 2WNVA 4JX0A 1ULEA 3A0NA 3ZSEA 1D7PM 1LR5A 2WFF3 4XE9A 4ASLA 3KHBA 2W1UA 3FC0A 4CU9A 5FYSA 3UJQA 4IESA 5JIUA 3W5MA 4JC1A 1XPWA 1FMD2 4AHYA 1RUOA 3ZPOA 3PVBB 1LHOA 1CX4A 2OXBA 4LKSA 1RMU3 5D8AA 4XOGA 1VBA2 1X82A 2WUHA 1HLCA 1OLQA 3O0VA 3VZOA 3ZFEB 3FUOA 4DPNA 5FXWA 5JLVA 5KHKA 2YU1A 3KCYA 4Y5SA 4Y4YA 3OGGA 2HEYF 4YW3A 2VNGA 4E4SA 1I5PA 3RQ0A 3WVJA 2J1AA 1W8NA 2GH2A 3PL0A 5FYCA 4C90A 1AR81 4XIOA 3VD7A 1RVF1 4Y1VA 1DQ2A 5CIRA 4IE4A 4LE4A 4CCJA 2P1BA 1GSLA 4PI2A 5FY4A 4X8PA 4AEJA 4E4DX 4AVAA 1DQ6A 4OZXA 1POQA 1MVEA 2HWC1 2D6LX 3KT1A 4WVWA 5AVPA 4NWVA 1V6NA 5I0TA 3ZPYA 4ES9A 4AG4A 3CBNA 5L9BA 1LHVA 1POV3 1SMVA 3D0SA 1J1TA 2HBTA 2YB7A 2MEV3 5KHHA 4LO5B 3KCCA 3RG0A 2ATFA 2DVFA 5JUVA 1OMIA 3EJKA 3FFZA 3O5SA 3ZSJA 4PDWC 4I3GA 5CKQA 2VOKA 5ABJB 4GKXA 2JENA 1YFWA 5L73A 1ZZBA 4LBMA 1ACCA 2CGPA 1KDMA 3MPBA 1UKGA 2TNFA 1VLNA 3W9AA 4HPKA 2BNNA 5FY7A 2PLV2 1F31A 3ZDVA 1AYN1 2HBUA 3AZZA 5JOXA 4TLGA 3AZXA 1T6GC 3LEIA 5FZ1A 1U5YA 4HANA 4YVSB 2VVEA 4I0WB 1HV0A 2OQ7A 1JYIA 3LOBA 2P6HA 4M4RA 2WZR2 4HG6B 5FZGA 4BQ3A 1L7QA 1PZ8A 4JDMA 4NWWA 4R4ZA 5A6YA 1HB2A 1YFXA 2W47A 1W9TA 4UFLA 2JDNA 1BMV2 3VBOC 1W9YA 1UWWA 4BM8A 3AFKA 4BU2A 1CX1A 2AC1A 2VUAA 4A4AA 1EPWA 3K4DA 1FV3A 2X5IB 1L7RA 4DB5A 5J7MA 1N1YA 2OZJA 1OUXA 2OA2A 4XUPA 1XYNA 2K0GA 3ZMOA 1QDOA 2WNUB 3WCRA 1BBT3 2F4LA 4RA0A 5JR2A 3DECA 1NUKA 1GNHA 4FPHA 1AXKA 4LBQA 3ZSMA 3VHNA 2RV9A 3C7OA 1FPN1 3W59A 4XMIA 3WG1A 4JGZA 2Y64A 1A34A 2WYFA 1MEC1 3NKGA 3ECQA 4UT5A 2OS2A 4WVVA 1ND3A 4EQVA 4YSFA 1VBC1 3Q9OA 4OI0A 1OSGA 1XJAA 2K46A 1TG7A 2BGCA 2JB4A 4P9IA 5FKCA 1UMZA 4XFHA 1H2MA 1VBE3 2E63A 4KWKA 1OT5A 2A6WA 4UFKA 1REFA 1H0BA 2YU2A 5DZEA 3WF2A 1RUF1 1SLTA 2ZBJA 3NWKA 1AR63 3ZIXA 1JI6A 3BUCA 1IGOA 1JOJA 2VQAA 1QJFA 1KD7A 4DXZA 2Y0IA 1NCRA 3ATGA 2G1MA 4CPBD 1H2LA 3LQCA 5L9RA 4Q4V2 2P5BA 3KZ4C 5JZGA 1SBFA 1OH4A 1R1A3 4CDUC 1FOD3 2JD4A 3INAA 2ZEYA 4JQRA 4ZZ8A 3NJZA 3HPNA 3OTFA 5GLVA 3D82A 2LM3A 4R4XA 4C91A 5FUNA 1ZBE3 4P00B 5FOBB 4OYUA 1X7NA 1ZZCA 3RDIA 5LEKA 2BNOA 1WBFA 2CY6A 2RM21 5K7PA 4XF9A 2EIBA 1CJDA 2Q1ZB 1JUHA 1LENA 3AP7A 1V6MA 4IV3B 4YW5A 5K0UA 3S7IA 4QHBA 1BJQA 5CZKA 1TMF1 4HKWA 4CP1A 5A3UA 1B09A 5BY5A 4AQSA 3KB5A 4XURA 1PK6B 3N9PA 3I3MA 2VCAA 1YI9A 3ACIA 3O1PA 1V6LA 2EF6A 3BTYA 1NA1C 1Y3TA 3WDUA 3RS6A 1LECA 1OVSA 4CXYA 2R0HA 4PF1A 5A3PA 1PIV3 2Y6JA 3IDBB 4IQPA 2IXJA 3SISA 3HN1A 4H14A 1AL23 3TWIA 2FDGA 4Y26A 4GH4C 5DDJ2 3I2DA 3W58A 1HB1A 2P6CA 4YVWA 4KGGA 2O1QA 1GFF2 1V6OA 3CQOA 1H9WA 1RXFA 2ZGMA 2F6BA 2CAVA 4CEYA 4QQ2A 2QBXA 3RMYA 4Q4W3 2IXIA 4QQPA 3WLUA 4ET7A 5A7PA 4CDQC 4FI9A 3AP5A 2JDMA 3FHIB 3VGIA 5IVCA 2RS13 1W6MA 2JG8A 1POV1 2YGLA 2ZEZA 3U4XA 1VBD2 4ZU4A 1ALYA 1PMJX 1CVNA 4N90A 3VKNA 4DRRA 1TME1 3TNPB 4FAGA 2YFZA 2ZX2A 3K51A 1YEWA 4N53C 3IB3A 4K20A 1S2BA 4IE5A 4W6XA 4YGCA 1R083 4YGBA 4NIAA 1X36A 3TRSB 1YYNA 2GZWA 2IFRA 5GZEA 4CVUA 5J09A 3MIGA 5LRRA 4FPKA 4BQ5A 3PDQA 3VHRA 4L2NA 1N1SA 5BNOC 2XR4A 2VM9A 1XSRA 4G3YC 2ADEA 2NM1A 4ZY9A 4X6QB 4GMP3 2Y6GA 5DN2A 4F7ZA 5C33A 3PTYA 1BK1A 3J9SA 2C0ZA 2C9KA 2HWF2 1O3TA 4P14A 5A32B 3BKZA 5FY1A 1RUI2 4H3WA 1OLME 4LR4A 3GHMA 4XJAA 2AUYA 1MQTC 3KF5A 4NPLA 4S2DA 5FZ4A 1OA3A 3M3OA 2E7QA 4LA2A 3WP3A 1W90A 1UIKA 3N7LA 5GZDA 1OD5A 2A73B 1O3QA 3ZFEA 1CD3G 3Q8FA 1D4M3 1OOPB 2UURA 5BXXA 1V0AA 4GB31 1PMIA 3SHRA 3LA3A 3I97A 5IJRA 2D6MA 2Y33A 3BPZA 1W6PB 3G6JB 3WR0A 2JEMA 3WUCA 3WP6A 3WF1A 1QOSA 2BFUS 3HQXA 1OUSA 3Q8CA 5IATA 2NN8A 4JHTA 3GXUA 5T5PA 1EAH2 1XNAA 1DQ1A 1VIWB 1VBB1 1ULOA 5GALA 4AGRA 3IMNA 4IXLA 5T55A 4OHVA 4FP3A 4OHZA 5LY1A 3H8RA 3QD6A 1BBT1 3PTRB 5FREA 2VH9A 1N1TA 2I07B 1W2OA 4WM8C 2JB8A 1O8SA 4QPGC 1UMHA 3R05A 4IEWA 5F9TA 5LBFA 1HQLA 1R092 3NJVA 3ST7A 2J1UA 1WKYA 3K46A 4QKFA 2X29A 1QKQA 3N9NA 1RUD3 1VR3A 2UU8A 1DQ5A 1PHMA 1XNTA 2A3XA 3ZX7A 4LIUA 3A7QA 1RUJ1 2UY8A 1DGLA 2XLFA 3NAPB 4H7MA 5C3RA 3H8XA 1YWKA 3C3VA 1CAVB 1KQRA 2QQMA 4IGOA 5ABJA 2DCYA 1JBCA 1NOVA 1Y4WA 4YGDA 4BLJA 3OBAA 2GNTA 4LKDA 3MLKA 3T09A 1WUVA 2A5ZA 3ZXEA 5KC6A 5LK7B 3RRDA 1Q8OA 1AR61 2MNGA 1SLLA 3QLQA 1QQP3 4HL0A 2EAAA 2R062 2HWE3 4XABA 2I45A 4LUKA 3OUHA 4F3JA 5DMYA 1NLQA 3D6EA 4JVAA 3POBA 2XJUA 4YVSA 3VZKA 5FZHA 3L2YA 5CAZA 3LSDA 5T52A 4CP9B 2YC4A 1RIRA 2IVJA 1OA2A 4RS5C 1FOD1 3KVAA 3AXDA 1OA4A 5JR7B 4K8FA 4O61A 1GNZA 1O4YA 1GWMA 4CDWB 2JICA 4D7SA 4DY5A 3NRUA 1RUNA 1ZBE1 4WZCA 4CU6A 1TVGA 3O1RA 1JH5A 4AVBA 2DU0A 5K4LA 2X5IA 1JZ4A 3AYCA 5LRSA 1UY0A 5C70A 1Z78A 2W5FA 3A23A 5FIXA 4ATFA 2W92A 4B7EA 2XG3A 1MZ6A 1WLWA 3LIHA 2WNUA 3JQXA 5FYYA 1RMU2 2C26A 3J7NA 4Q4Y2 1XQNA 1EYBA 3LCPA 4AEDC 1X33A 5FZ3A 1C1FA 4TWTA 4LHKA 2WIIB 2YC0A 1G9AA 4QX2A 2RR12 4C1WA 3UJOA 1HIXA 1S1AA 3WNKA 2WLPA 1PIV1 3U10A 1AJOA 3DKWA 1OF3A 1AZDA 1GQHA 1SPPB 2FCTA 4Y3OA 3V56A 4BH9A 1V9U3 4CUCA 4FTSA 1AL21 4IEVA 4LT5A 1DQ4A 1OLRA 5F2SA 1RUH3 4GZ9A 1C8M3 2VMCA 4XQ4A 3URFA 1L7LA 4MG2A 2ZHLA 2WO2A 4YNIA 5F6KA 2XKOA 2E33A 3GZTB 5A1AA 2RG4A 2EAKA 2JX9A 3OYWB 2C4XA 5IAXA 3ZYPA 1P8JA 4FFFA 1SBDA 2YUEA 4RQPB 5FPBA 3P3NA 3TYJA 2ZX1A 2RVAA 4AEKA 2MEV2 4XUTA 2ORXA 4BMEA 1AR73 3MFAA 1ULCA 1XU2A 5FYUA 3A22A 1KITA 4AL9A 1N1VA 4DXRA 1DYOA 4AVSA 4FPOB 3MIFA 1W04A 3Q8EA 2Q8EA 2NPIA 4U2AA 4YZ5A 1D2QA 2IZWA 4AE2A 4R52A 4BCUA 4E4HA 3BTAA 4EN8B 5A7NA 1IKPA 2VBBA 5FUIA 1UYXA 1X9TA 2QQLA 4GMP1 5FYHA 3UK9A 1ZRDA 3JBG3 3ACFA 2Q1MA 4KWLA 4NRQA 4ZONA 4IV3A 1JN2P 2WAOA 3AL6A 2UYBA 4NHLA 5FZDA 1GP6A 4RR3C 1GKBA 1PVC2 4KG8A 1V6JA 2NMNA 1HW5A 3KD4A 1F5FA 1PK6A 3OGJA 3BN6A 2B9VA 2ZMKA 4K1YA 4L97A 4KWUA 5F39A 1XE0A 3RI9A 4ZHNA 1IZ3A 5CVRA 2QFEA 4LBJA 5A80A 3VBHC 3M2MA 4CEWB 2BVBA 3EBRA 4AF9A 5A3OA 4QQLA 1BEV2 1ZA7A 5D1IA 1HV1A 2YBPA 5F5QA 3THCA 3EO6A 4PQQA 3O1VA 2OPWA 2Q8OA 2QDRA 1PO11 5FY8A 4BXFA 4QPWA 1V70A 1GNYA 2V5DA 4QX5A 2XWBB 2WO1A 3MPPG 1AR91 3WQ1A 2WN2A 2QUOA 5FV3A 4L11A 4CCNA 3OOXA 4Q8LA 2GC0A 3T2PA 4LEJA 3OBRA 1W8TA 3T08A 1ODNA 3ZFGB 4BQ1A 1UOJA 2BGOA 3AZYA 1DLLA 5DUUA 1ULFA 3RVHA 3TAYA 1H6YA 1VRH1 1MS9A 4B8EA 3D5OA 5FZ7A 3G7DA 2FZ2A 4EN0A 3B01A 1A78A 2VZOA 4P9LA 1AF9A 1XNBA 2JG9B 3POFA 4WM7C 5EP9A 1TNFA 5J48A 1YQCA 3ZDSA 5L7OB 4IE7A 4XBLA 5BYNA 5C9AB 4IUGA 4LO8A 1RUD1 1GOFA 5D8AC 3VBUB 2HKXA 3WOGA 3WNNA 4W4ZA 3I2KA 1GLHA 1LOAA 3ZLIA 2D3RA 4QM8A 5IFTA 1MR5A 4XFFA 1WLTA 3GZEA 1NLSA 1W8HA 3WDWA 4QXKA 4GD4A 2WINB 2DVBA 2VBDA 4Y1ZA 1S0BA 1QJX2 2ZX3A 2R32A 2ZMLA 4QU1A 1JZ2A 3GJAA 1S0FA 2FDIA 3LSEA 5BNNC 5JIAA 3U14A 4XILA 1AVBA 1BZWA 2HEVF 4Z82A 5CA6A 1CN1A 5A32A 1LKNA 1NZIA 1QQP1 4AVCA 4COZA 1JW6A 2FDKA 1CAWB 3H3ZA 3IZOA 3TB0A 4XF3A 4M4PA 4BDVB 2E7TA 4CUGA 1J3QA 4KGQA 1CPMA 3FLTA 4QKBA 3NW4A 4XDQA 4KNCA 1R1A2 4UFIA 4XUNA 5HBAA 3FFQA 5DAPA 1R1ZA 2P17A 3DPRC 3K48A 2YYOA 1LOCA 2EICA 2QQNA 3RFRA 5IVJA 1V6IA 3SCFA 5I0RA 4KBBA 5KR7A 4M0NA 4D3WA 4M3CB 5ACA2 4JTOA 1W6PA 3H42B 4J1XA 2ARXA 3MIHA 1RUC2 5KXDA 1UIJA 4Q0PA 5EJ3A 1M4WA 1XNKA 3E97A 1AR83 4DRVA 1FMD1 2QJVA 3GBWA 1EY2A 2RHPA 1WMXA 1RVF3 4DOUA 3KV5A 1OBNA 2VUDA 4A7KA 1YC61 2NQYA 2HWC3 5M0TA 1G9DA 2VY0A 5BNQA 1D2SA 2TBVA 3WHUA 3WF3A 1ULGA 2I2SA 3WHTA 3T0DA 2DVAA 3UYJA 3VHOA 4JGYB 1YO8A 5FY5A 3ACGA 4BPZA 1H2NA 2E26A 2H6CA 1DGRA 2DCKA 1J3PA 3LOIA 1UY1A 4R8HA 5F3IA 4N9HA 5FWEA 3LFIA 3B3QE 2PHRA 1QDCA 2H6BA 3NAPA 4FAHA 1BLZA 2AREA 2QE3A 1CAVA 1RUH1 2W3JA 4MH0E 5JPNB 2JDPA 2A6ZA 3PNAA 2DVDA 5C4WB 4LO4B 3SNMA 1W6QB 2H0VA 3U1XA 3TEZA 4N43C 2WDBA 1RITA 4Q4W2 3T1LA 2ORZA 4XFCA 4MGIE 5F3CA 1RJ7A 2Q4SA 3T2TA 5FTTC 1DYKA 3JD73 4HN0A 3B7MA 2ZAHA 4LJHA 1IS4A 2GNBA 2RS12 4YW7A 1AYN3 4CPBA 1YJKA 3ZXDA 2Z2SB 2D6NA 4DMIA 4YW6A 2EIDA 1LNSA 5ANNA 4CP9A 1AYM2 1JOBA 2W46A 1LOFA 1S2EA 2OQ6A 2GC2A 5GJ6A 2YPDA 4Q29A 3E6CC 1H30A 4XTPA 4CDWA 1UQXA 3B94A 2DV9A 1S0EA 2W91A 2XUMA 2BERA 1K5MC 1WLCA 3VDDC 3NNJA 3BOPA 4IV1C 1NCQB 3M7AA 4ZXKA 1CZTA 3ZN4A 1ND3C 1IPSA 1NX9A 4D6QA 5F1RA 1CWPA 3ELNA 2W95A 3S5AA 5LBCA 3I2FA 5A7SA 3UKVA 4OHXA 1K5JA 4TSVA 3WW4A 3I3BA 3DYMA 5LA9A 5JOYA 1YIPA 3P3PA 2FDHA 3E6DA 1PO21 3FL7A 3MI8A 2Y26A 2VO5A 4XZUG 5DAQA 4QPIB 1ZZ9A 5A1LA 2D7FA 3NV3A 4YLZA 3CJIB 2CWSA 1D4M2 4YM0A 1GYKA 3M8LA 3VKMA 5GLUA 3NNGA 2PHWA 3AMHA 4QGMA 1MEC3 4D6SA 4E8DA 5J3UA 1BMV1 4LK7A 4MSVA 1LTEA 4XACA 1VBC3 2UY9A 1UMIA 1SPPA 3SEPA 3TN93 1XYPA 4N9IA 3WDTA 1XNCA 2UYAA 4JHZA 1LCLA 2WS92 1D4VB 2R0FA 5I0SA 3IKWA 2LUWA 4NHYA 4QKNA 2RS51 3H0OA 1DQ0A 1S0DA 3GJBA 3OGVA 3JB8A 2VVDA 1C1LA 5DAXA 3T30A 3OYWA 1B35B 2HWD3 5DXDA 1OLMA 3I4IA 1BKZA 2J22A 5BNPC 2X8KA 4NO4A 4QMAA 1IG3A 3NJXA 4RQPA 1UYYA 3U4SA 3ORJA 3RMXA 2VCBA 3FX3A 3I2GA 3P5BA 2GNMA 1HRV3 1I6XA 2VCCA 3P6BA 2EXIA 4AI3A 1SDDB 1E5SA 4Q1PA 3V0BB 3C2UA 3PMEA 5FZLA 3KF3A 4Y1XA 2RDNA 2V72A 3CZUA 5IK7A 3U37A 1JYTA 5T54A 4I09A 5HCHA 5JAXA 1H4GA 1PVXA 3APBA 4XUOA 4Q8KA 1H8VA 1UY4A 5H9SA 1DHKB 4R9AA 2JDUA 1Z0HA 1W3XA 2FQPA 1LEDA 2RM23 5GZGA 2WN3A 2Z69A 5FYIA 4QX1A 3ZR6A 2UWCA 5FJHA 2PA7A 2QQKA 5FXZA 3WG3A 1TMF3 1L3JA 1POV0 4JQTA 2HWE2 5L36A 4Q4V1 1O3SA 4NN0A 4S2HA 1W06A 5EJZB 1X8EA 3LEMA 4LXLA 2ZKNA 3KHCA 4P02B 3VB9A 4NIGA 2HLEA 4CEWA 3RYPA 3GF6A 4MXWB 2NLRA 4CP2A 4WVZA 3ZVXA 3T2OA 3ZXFA 5EFUA 4AI8A 5F3GA 4AFMA 1R64A 1WBLA 5K9YA 1IQAA 1OURA 4FPEA 3EMRA 2GU9A 4LO7A 1SCSA 2RS32 3CKHA 1HJGA 1HQWA 3I3QA 4QX3A 3ZN5A 4D94A 2OYZA 4XETA 3S6PA 1G86A 4CP0A 5C6CA 3ZFGA 1KJRA 3A4UA 2WRAA 1G7YA 4M0HA 4PDWB 2BVVA 2ZGUA 3J8F3 5A3NA 2XQXA 5I93A 2GALA 4FOYA 3OJBA 2JG9A 1H4HA 3BB6A 5C8WA 2VMIA 4P9YA 1TME3 3B69A 2JJ6A 5L7OA 5C9AA 1FI2A 1Y43B 3LGRA 4AHXA 3PVOA 2Q8DA 1JUIA 1QJU2 2IXLA 3VBUA 2ZGTA 2ZS6B 1RUG2 3ZXKA 4AI2A 5FPAA 2W87A 1V9U2 4Y22B 4BISA 5FWJA 4OI2A 4XHXA 1OVPA 2BBVA 5IK8A 1YJLA 2IXKA 3ZFFC 1AJKA 2IXCA 3K4AA 3N9QA 1W2UA 3K75B 4HONA 4AQ2A 1C8M2 4E2SA 3POIA 2AEYA 4Z8BA 3OBZA 3K2OA 3OG2A 4OQ9A 5J1XA 1N47A 3PJQA 4AGGA 4FFGA 4ASMB 3E5XA 1F9KA 1J1LA 4I30A 3D8CA 4KBZA 1WA4A 3C8XA 1QJEA 1G8WA 3JD71 4HZFA 4LKEA 4WVMB 2XBO1 3NNFA 1CAWA 3VBOB 4TXWA 1UZ0A 5C71A 1AR72 3UKNA 1FX5A 2G4IA 4SBVA 3WF0A 3WY6A 3HEIA 1JOPA 1GWLA 3ZSKA 2R042 2ZCWA 2HEWF 4GB33 4WV8A 3OF1A 4UFHA 3O1OA 4PJYA 3GNEA 3JQWA 4HLTA 1GICA 4QDRA 2DVGA 5E1RA 1CR7A 4BXSV 3ZYBA 3UGGA 2XKPA 3RZJA 2A71A 4I0BA 5IYYA 3LE0A 3JBG2 1NE4A 5A7WB 4NPMA 1UXXX 4MADA 2YROA 1FNZA 1RUI1 5FZOB 1QJY1 2BU9A 2VZVA 1YQ8A 2QDNA 3M1HA 1VBB3 1H1MA 3J26N 4XC9A 1IHMA 1QMJA 2TUNA 1NY72 1UCXA 4RSUA 3VN4A 4AXOA 1YNAA 3H9AA 1OPMA 2BOIA 2ZGSA 4PIYA 4E27A 3U78A 1S2KA 1N3OA 2XHNA 3RSJA 2A6XA 2FZ1A 3WNPA 4B4PA 4JGYA 1EPZA 1UYZA 2IXHA 5AC92 3ZYIB 4RHV2 5LA0A 3FWEA 3NNMA 1XBFA 4CDXC 4M3CF 1UZZA 3TN91 3RZMA 3B02A 1RUJ3 3KVBA 1IS6A 1BHGA 3IBMA 5E88A 4AI0A 4CE8A 1EAH1 5I0UA 3R6SA 2QKDA 5C8CC 2DUQA 4UWDA 4BHPA 5C4WA 3PIJA 3DN7A 4ISQA 2WWSA 1W6QA 2WZPP 4CDUB 1MZ5A 2QQPA 2VCMA 3AC0A 4Y33A 5EYYA 1RUE1 2CV6A 2I74A 3MW3A 2HWD1 1W2AX 4UW6A 3TBDA 5FBZA 3ILFA 1LGCA 1Z7S3 3IDEA 1RTVA 3FE5A 2R49A 4GWIA 3AJYA 1LGNA 4N8MA 4B7KA 1Q56A 1HRV1 1MS1A 1A8DA 1UX7A 3OGSA 5FRAA 3ES4A 1BK0A 3SKVA 5I8YA 3AK0A 3I49A 3BIEA 4YZ4A 1GZWB 2C24A 4Q0QA 3LB9A 1OC1A 1ZVFA 3KQ4B 2A7AA 2FCVA 2YXSA 2VBPA 3KMHA 3IPVB 4XJZA 5FCCA 5GLZA 1ZBA2 2GC3A 1NCQA 1NA1B 4XUQA 3C7HA 2W1SA 2P2KA 3MLJA 4CUBA 1H1AA 1LULA 4BB3A 4E8CA 2VTXA 3VV1A 1EP0A 1WMFA 2CU5A 1ND2C 3MEPA 4LBLA 1MVQA 2WWJA 2ET7A 4GH4B 3VBSC 4R9DA 1H2KA 2XJPA 4QPIA 3FBYA 3OPZA 3CJIA 3ZMNA 1A6CA 1HJFA 5A6QA 1MS5A 3BIWE 1QU0A 4CDQB 2PHDA 5B2GB 4ES8A 1G9BA 2PHLA 2RJKA 2RDQA 1UU4A 1XB9A 4GMP0 1NG0A 2CDPA 4QAWA 2OIIA 3DXTA 5T3NA 2CDOA 1AR82 3NJYA 3RWKX 1S4CA 1RL3A 4HK8A 4YW1A 1MZEA 2BPA2 2VUCA 4N53B 5EQUA 2LW8A 2PHTA 2UWAA 4L0PA 3FMGA 4Q4Y1 3ZO0B 1O59A 2A6YA 4S2GA 2HWC2 1B35A 2ZGOA 3E1F1 1HDKA 4XXPA 5A3TA 3J8F1 1RC6A 3WEZA 3VD9A 1DG6A 2VOXA 2JD9A 2VMGA 2VMHA 4IGQA 5BNOB 1CAUB 1US3A 3CDZB 5KC5A 3IAQA 3LDRA 3V0BA 4FOQA 4HSJA 5HI0A 4DQAA 1GANA 1SG3A 2WT0A 2XWJB 4V1PA 5CADA 3DKQA 1OFSA 4MX3A 2ET1A 1MQTB 5FR3A 3O0XA 3GALA 2WO3A 3O12A 2HJIA 2W52A 4KMQA 3OBTA 3WQ0A 3OY8B 1SZBA 2DUOA 4RFRB 3BOWA 2ZHMA 4NE9A 1MS3A 3FUQA 3J7MA 5A7OA 4LMFA 4QXBA 3LFMA 2E53A 5C5UA 4COVA 3ZIWA 1AYN2 3EHKA 2BBAA 1FATA 1ULPA 1O5UA 2RJLA 5FZCA 2ID4A 1RXGA 2GN3A 1HRI2 1F15A 1PMHX 2DUPA 5FMCA 4MXWA 4JDOA 5CFCC 1E57A 1UXZA 2B8MA 3MUZ1 4X6RB 5FYBA 1RHI2 4EE2A 3CMGA 5DQ0A 1IOAA 3PLQA 4IEPA 4QU2A 2VOVA 1IQDC 1PO13 1UY2A 2AZ5A 4E2QA 4FPGA 4WM8B 5FZMA 2XPJA 4QQOA 4QPGB 4QM9A 5FXVA 1AR93 1UY3A 1OD3A 1PVC1 3N9OA 3PU8A 4XCBA 5FK7A 2DDUA 3MO4A 3VZMA 5LBBA 2BYVE 4HVQA 2V73A 1ASJ3 2ARBA 3FBMA 4HN1A 4BIFA 1PGW2 1VRH3 4WZFA 4PDWA 4EV0A 4CCMA 1KS5A 3AKRA 2EXHA 4JTNA 2BEOA 1NZCA 2DFCA 3D0JA 2CSGA 4UF0B 2G9ZA 1WCDJ 2YGMA 2X05A 1W3VA 1FPN2 1HXS1 1MEC2 1JMUB 2VPVA 3AP4A 1VAMA 1BCXA 1Q3EA 2W94A 1DIWA 1GZ9A 2JXAA 2BW8A 3H50A 3LEGA 4Y22A 1J83A 4CXXA 1OXCA 4CTEA 1S0CA 1I9RA 2PELA 2RMU1 4PHZA 1MS0A 5GZCA 2QQWA 2DCJA 1H8TC 4EN9B 1RUF2 2VG9A 1DF0A 4Q0SA 4RS5B 3LWCA 1WD4A 1XE8A 4B4RA 4F8AA 5CFDC 4FBFA 4BA6A 3AMPA 4WVMA 5JDBA 1APNA 1GR3A 3POJA 4ATEA 2CGOA 2VW1A 4TLFA 1Z7S1 3VBOA 4QXCA 2D5FA 4WBBA 1O4TA 2XONA 2VXJA 3HNBM 1JYNA 5KXCA 1LAJA 2ZJCA 5T5LA 1COV1 5F5IA 5TSWA 1UAIA 1W9SA 4E9KA 5DPNA 3O14A 4QX7A 1QJX1 3GBGA 1HN1A 4HSLA 1WWYA 4DUWA 2ZTNA 1QHDA 2PN5A 2DCZA 3B5LB 3Q8AA 4FQZA 1W8ZA 4QXHA 4AEDB 4Q0VA 2C6SA 2RM22 4URTA 3ZKYA 2WFF2 5A7WA 5AVAA 1FMD3 1TQ5A 4GWJA 1WW4A 2XOMA 5JI7A 4AHZA 5FDBA 1WCKA 1UN1A 1UYPA 1AX2A 3CF6E 5FZOA 1W6NB 3PURA 3SQOA 3U07A 3VBRC 1JZ5A 1VBA3 1TMF2 2D3SA 1TE1B 5CG9A 2OZ6A 4Y1UA 3S5QA 1AX0A 3UGHA 3CEWA 2CYFA 2PHUA 4XJ8A 3RZZA 3WD5A 4A7YA 3CHXA 5I91A 2JE9A 3MW2A 3VKFC 4ZU7A 1S0IA 4HBNA 1WCSA 4YZ2A 3BGAA 3HIFA 3VL9A 1RUC1 2DTWA 2ZABA 4BK4A 3VDAA 5FZAA 1G9FA 3UV9A 3WDYA 4A3XA 3ZXJA 2KM2A 4M3CE 5FQ0B 2XVGA 1G6NA 4IE0A 3O0WA 2PAMA 4QDQA 1UW8A 1DBNA 1UOBA 4INDA 3QOPA 2R071 3ENRA 1S55A 4QHOA 4CDUA 2P34A 2ZXQA 3WP4A 3AP6A 4MLOA 4ZU5A 3JCIA 3VBFC 4W6YA 2ZGKA 1EUTA 2VL4A 4NRPA 5HCFA 5FO9B 4GIQA 2FMYA 5H9RA 4AQ6A 1V00A 3UKTA 5DZGA 2BWCA 3J7LA 4NAOA 1WLDA 3I7DA 1Q8QA 2EIGA 2F4PA 4OHWA 2ZA9A 2B46X 4Q1RA 4MUVA 3GGLA 1D0HA 3H7YA 3PU3A 2B45X 5GLTA 1ZYBA 2ADDA 1CONA 2NMOA 2HWB1 4MO3M 4PCRA 3E5UA 2GDFA 4RR3B 3T4VA 5J96B 1GZWA 4L99A 3GBFA 4AVVA 2XJQA 3IPVA 4PQ9A 3VD5A 1NA1A 3NVCA 4BYYA 3VBHB 1YUDA 5FFOC 4LLFA 2A75A 2PLV3 5KXEA 5CB7A 5EWSA 2VW2A 2R1BA 2JIJA 2YFUA 4BE3A 4U36A 3AJZA 1W0OA 5DUVA 5ANQA 5FZKA 4CRQA 3OGRA 2N7GA 1WW6A 3TNQA 2GAUA 4GH4A 2DYCA 1PO23 2BJSA 4NPRA 5IK5A 5FO8B 4FTBA 1NAEA 4LTAA 5LW9A 4OUMA 2C9AA 2YHJA 4QQHA 4BQXA 3M3IA 4IEUA 4UW4A 3VD4A 5T5JA 1PM4A 1WMDA 3BU7A 3DYPA 1KGYA 1U5ZA 3MW4A 5JXJA 4CDQA 2EXKA 3MDPA 2C5DA 4L9BA 4Q4X1 4WM7B 2Y6FA 3ZYJB 5LCWL 3AP9A 3SEEA 2F17A 3OEAA 1HB4A 4EWDA 5BUVA 4OI4A 4Y24A 2RS53 1VJ2A 2ZEXA 2ZHKA 4XTMA 5G05L 5KHGA 4N53A 4JKMA 4B4QA 2NYYA 1UZVA 1ASJ1 2VZSA 4AOCA 1XOYA 4UW3A 2WNVC 1PM7A 4KL1A 5BV6A 3I2HA 1BBT2 4NHMA 3TOJA 1UO9A 2XLAA 3MBWA 1F4HA 1W6OB 2B39A 3WXPA 3U11A 5BNOA 1LU2A 4DXTA 1CAUA 2VNVA 4HETA 4DEQA 2OPKA 4IGPA 5A70A 5BNNB 1A8MA 2VVFA 4MXVA 4G4FA 5DUWA 5LBEA 4FFIA 4G9SB 3H1YA 3AMMA 3SKJE 1RUJ2 4C8DA 3HQRA 3KT4A 1MQTA 1YQ5A 4BOWA 1LOGA 1EV11 1VBE2 2GMEA 3I59B 5LB6A 3SCGA 3OY8A 1UF2C 1T6BX 1W03A 3UT0A 2IWGB 1S0JA 4LKFA 2ZX0A 1LGBA 4A7ZA 2RDSA 5F7UA 2D93A 3CLPA 3NO8A 2WO7A 1BVVA 3DPRB 4MV2A 1ZM1A 4FPFA 1AR62 2Y0OA 3HAGA 4XZPA 5FYTA 1CIWA 2ZX4A 5FK8A 1XU1A 5KXBA 2JKBA 1IPJA 3GCWA 2JKXA 4Q4V3 1ZRIA 4YYOA 1I3HA 2DWRA 1US2A 3GZAA 4NIDA 5FYZA 1AUYA 4LULA 4EWAA 1OOPA 1FOD2 2VTXJ 3EB7A 5A3LA 2XDVA 3ME2A 3THDA 5GLWA 1I1EA 1MZFA 5T5OA 5F2WA 1YFUA 4ZS3A 3WX5A 4BQWA 1ZBE2 2EVXA 4WM8A 5LATA 5DAVA 5IFPA 4Z2WA 1JTZX 1V6KA 4XJUA 3JZVA 4BK5A 5FZ8A 3ZYGA 4AEMA 1ZRRA 3USSA 3O1UA 2XHKA 1VBA1 3MF9A 1QNWA 3SCHA 5IVBA 4BJ0A 2FHRA 1QIQA 1C3HA 4FPJA 2J1SA 4UYBA 1QWRA 3RGBA 2DF7A 3ACLA 3NMBA 1LHWA 2GMPA 4LIVA 3M3QA 4UF0A 1CZSA 1W05A 3GDBA 1KS4A 1JYVA 3AB0A 1GZCA 2O8QA 2DU1A 3N7JA 4N43B 4QB2A 1PIV2 2BNMA 4XQDA 4B29A 5HPOA 5DDJ3 2VJXA 2FBEA 4LLOA 1UU5A 4COWA 2RS31 1AL22 2ZACA 1PNFA 5JVVA 4XYXA 4TZDA 3IWZA 4Y20B 4I0AA 3MFCA 5I8SA 3V0AB 4W6WA 1C4RA 4LHNA 4MGSA 1OF4A 1W99A 1ZREA 5IUQA 5F5CA 1JXNA 4NJ4A 5KBFA 1VBD3 2BWAA 4RGGA 1NXD1 3WDVA 2A3YA 2XBO3 1K5MB 1QXJA 5EYXA 3VDDB 4IV1B 4A41A 2LTNA 1ND3B 3R4SA 1QJU1 1OHFA 4HKLA 4TN7A 3HR9A 1RUG1 3ILRA 4AYUA 1GBGA 4J25A 3LA7A 1R082 2VZUA 2B9UA 3FHQA 3VL8A 2ES3A 1E5HA 3ETQA 3LIGA 3POYA 4HVOA 4Z07A 1LU1A 3V65A 1YI7A 2DTYA 4JGZC 4AEDA 1C8NA 2HWF3 1ENRA 5EZWA 2OX0A 1GOHA 2PLV1 3KV6A 1RUI3 4YM2A 1QJY3 2P3IA 4XPVA 3ALQA 1LESA 1W6NA 2XVLA 4QX0A 3KLSA 2WQ8A 3J7HA 5A6XA 2J1TA 5C4WC 2E51A 4XEZA 5IVEA 2ZAAA 3O1SA 3AYAA 5FPZA 2WZR1 3E6BA 4UAPA 2R041 5HV4A 4NHKA 1VAVA 3GM8A 2W68A 4OCTA 1ZRCA 4YFWA 3T2QA 4FPYA 2ERFA 4OQ8A 2WABA 1NCRC 1IKQA 1PO12 1QEXA 5BNPB 5JZGC 1W2TA 1XSQA 1W2NA 5FQ0A 4YG0A 2BV4A 5GZFA 1EAH3 1RYYA 2YZ4A 3MV01 3POEA 2B42B 2ZHNA 2BFUL 2PMWB 2XJRA 1DZQA 1WA6X 2VTFA 3TEXA 5IHRA 3EXUA 1UZYA 3BYWA 1Y9GA 2D6OX 5LA2A 3CU7A 1RUE3 3I2JA 4FPCA 4O7XA 4DEVA 1K42A 1VRH2 2YBSA 1X8MA 3USUB 3IAPA 3HQUA 5FP8A 3OD0A 1WMEA 1R093 5K0UC 2FDJA 5GKAC 3WV6A 5KHJA 5CU1A 4Y5Z0 2ZEWA 3O1MA 1TZOA 2E32A 2H0BA 4GWMA 3KT7A 4CU8A 2E7AA 1RUD2 3U75A 3PIGA 3VDCA 2WL1A 3FHAA 4LORA 2OUJA 4RR3A 4C0HA 2CAUA 1Y9MA 5FPLA 1GP5A 4IETA 5IT6A 3LF7A 1U5XA 4HFSA 1AHSA 3WNMA 4CUAA 2G9GA 4MOAA 3WW2A 2QNKA 1DFQA 3VBHA 1OQ1A 4S2FA 2R063 1H9PA 4PBOA 3N7MA 4FQ4A 4QGLA 4V2VA 4YVWC 3VZLA 1QQP2 1C28A 1QXRA 5FY0A 4IW3A 5A6ZA 4UXAA 4NOTA 4LBOA 2VR4A 3NL1A 5IAVA 3H8OA 4CEYC 3IMMA 1KFUL 5FJKA 4K40A 4ORFA 2J1VA 2YMZA 4CU7A 3RZLA 4IEOA 3RPQA 2VC9A 2XJSA 4DO0A 4LNVA 5BPXA 2JG8C 1FYUA 3R0RA 1ZBA1 4OLLA 4SLIA 5FKBA 4NMIA 1O5LA 3GYDA 2OUHA 1NQDA 3S30A 5FZIA 2VMDA 1U5IA 4EJRA 4OMDA 4WM7A 2QQOA 2TEPA 3C7GA 2BUKA 3H3UA 2VUJA 2Y38A 4XFGA 2Q8CA 1W28A 3FLPA 1WZXA 1ONAA 1TNRA 4XIKA 1MACA 3P1IA 4DS0A 5L9VA 2YPJA 2PAEA 1OPOA 2JE7A 3CJXA 1VB4A 4CXWA 1Y7BA 4Q4Y3 1VALA 1HX6A 2O0OA 4GJZA 1DLCA 2ZGPA 4JRLA 3PJYA 1ENQA 3KGLA 4YM1A 2D97A 5FPVA 2KA3A 3ZFFB 4FCAA 1W6OA 2RR13 3RJ2X 2PQSA 5LASA 1KRIA 1F4AA 2MHFA 5CNAA 5BNNA 4ASKA 5DAWA 4MGKE 1LJ7A 1JU4A 2HH9A 1WD3A 4QX8A 4COUA 5DDJ1 3Q8BA 3AMNA 5C7GA 3POGA 1LODA 1FT9A 4P9XA 3ZFEC 4YM3A 4LO6B 1RUH2 4XFAA 4AZZA 4ZZ5A 3I59A 5FP7A 5C3QA 4FXKB 1PX3A 2GNDA 1TEIA 5FYMA 1W9FA 3M3EA 4XDPA 3DPRA 2VW0A 4H55A 2PYTA 2LROA 1LRHA 4P9GA 1HQNA 4RL7A 1IS5A 3MIEA 4LE3A 1VBD1 3VLBB 2KD7A 4A42A 3TEYA 4P5YA 4FFHA 2D5HA 3K3NA 1CJPA 2DURA 5IWFA 3WT3A 1VMFA 2P37A 5DZFA 4MYEA 1OQEA 2WAAA 4Q27A 2YC2A 2E9QA 3L9JT 4H7LA 4N7IA 3BALA 1SLIA 5FLHA 3CL1A 1CPNA 1PGSA 2ARCA 3I3EA 1YQ2A 1WGPA 4PIZA 3IT8A 1T2XA 1U0AA 2D44A 4M3CA 3T0AA 2PHFA 2ZZJA 3K3OA 5A1FA 4J6GA 2FMDA 2HWF1 5DG2A 3VKLA 4A3ZA 2VXRA 2D6PA 2HYKA 1J59A 4I2OA 3PVEA 1PVC3 1AXZA 3AKQA 2WQZC 5JMOA 3DYOA 2WYSA 4YARA 4FOWA 4C0BA 5ABJC 3W5NA 3AVRA 4CDXB 4ARYA 2PHXA 1CQ9A 1HRI1 2GC1A 2EXJA 5IVVA 1PO22 3THTA 4J1WA 4DY3A 4FXGB 5C8CB 4XMAA 2ZZQA 1RHI1 1BEV3 2FCUA 3AFGA 3KV4A 5H9PA 3AM2A 4TYSA 1BQPA 2WWUA 1PNGA 4JAAA 2W0XA 1HXS3 1OH3A 1OFNA 3BCWA 4N43A 4YRDA 3ZOIA 3JU9A 4AGVA 2XLGA 1PGL2 3KS7A 4GA9A 4META 1O8PA 4YVSC 2P3KA 4AI9A 4TTGA 2CNAA 2J1EA 3OEBA 3WG2A 3X29B 3O1TA 5T50A 4Y20A 2WBKA 4BMBA 2WR9A 4B3NA 1XE7A 2RMU3 1RINA 2RS52 4HMZA 4A45A 4YFZA 5FPUA 4DINB 3V0AA 2BP6A 3BU0A 1PGW1 1ODMA 2QQIA 1QJZA 3EYPA 5I8TA 1KDKA 3LD8A 5DUXA 2JDHA 2A6VA 1OKOA 1C57A 2J7MA 4XF0A 4AK3A 5GM0A 2Q1FA 3POSA 2O8OA 4JRAA 4HVRA 2X5IC 1R091 1HB3A 3W20A 1K5MA 5CG8A 3VDDA 4IV1A 3JUUA 3A0KA 3WDXA 4BLIA 3ZM8A 1RB8G 4XF4A 5EV7A 4JZRA 3PUAA 1NT0A 3RNSA 5FPXA 2WNUC 1COV3 3RWNA 5HXMA 5IVFA 4AWDA 1Q8VA 4EYUA 4GWNA 2Z4FA 1U12A 1VB2A 3DV8A 3NSTA 4K6BA 3AYEA 1G9CA 1ND2B 1QJX3 2VE1A 5E16A 2ETEA 4L92A 3WNXA 3VBSB 3M70A 1UOGA 1XC6A 1FAYA 2QVSB 3HBZA 4PIXA 4QPYA 4LOSA 4Q5OA 3WZ1A 4COYA 1XYOA 1GUIA 4OVEA 2R061 2Y34A 4PLMA 5A3WA 2BQPA 4IE6A 3LDKA 1GMMA 4NVPA 4PBPA 4XBQA 1QXPA 4Z2AA 4RN5A 4HT1T 4PI0A 1UZWA 5G04L 1OKQA 1REEA 3WINE 3S7EA 3AKPA 4UFJA 4B1LA 3LPFA 2Y6HA 4DXSA 1W8FA 1GQGA 3ES1A 5ACA3 2KXLA 1OQDA 1ZZ8A 2WSVA 2XH6A 1RUC3 3H3LA 1F35A 1N3QA 3AKSA 4MHUA 2WFF1 5BNPA 5APAA 4O9EA 3ZYRA 5FYVA 3B93A 2WA4A 3IDAA 4XBNA 2BGPA 2VD7A 2ZKLA 3HN3A 3N36A 1UD1A 4I01A 2R073 1LHNA 3WNOA 1SCRA 1RVF2 3GHNA 4F83A 2YY1A 3N3HA 1RMU1 3L2HA 3NV4A 4X8NA 5E89A 4LOTA 5JXIA 4JDNA 1ENSA 5SV8A 1WCQA 2HYXA 1NKGA 3H1WA 3I2IA 4UFMA 4ZPIA 3FZ3A 5FUPA 2PAKA 2Y8KA 5HCBA 3USUA 1LB2A 4CA9A 2RR11 4IV3C 2VZRA 1UNBA 2JDKA 4I02A 5EXOA 1QNYA 3QACA 2B5HA 1F2NA 3SH3A 1ULDA 1UU6A 1NYWA 4ITCA 1PK6C 4Q0UA 4YG6A 1NLRA 1JS9A 4AFAA 3PMSA 2HWB3 2PFWA 4D8MA 3A21A 1BVP1 4AFDA 2JE8A 4Q2FA 3VD3A 1D0GA 2RE9A 4QB1A 3MYXA 1ZX5A 3LPGA 2QCSB 1MPXA 1W0PA 3IIIA 5CFCB 5JOWA 2UWBA 3RZKA 2V09A 5FY9A 4FTEA 2ZPXA 4K21A 3WSOA 1LEMA 1SHWB 1YHFA 5A3MA 3JD72 2MEV1 4QKDA 4CYDA 5FZ6A 1SBEA 2B7YA 2AACA 2XBO2 4GXLA 1NQJA 4LBKA 2W39A 3ZXAC 2R1DA 4YGEA 3HOBA 2ZMNA 4BWOA 1AYM3 1N3PA 1SFNA 2WQ4A 1J58A 4HXCA 4YPJA 3KQRA 4I3PA 4CZSA 3RZGA 1LOEA 1JZ6A 3H1MA 4BQ2A 4LK6A 1W8WA 1QOTA 1C5IA 3NQHA 4OZOA 5FO7B 2A70A 4AR2A 2WA3A 2VULA 4KI5M 3ZN6B 4UI9L 1YFYA 3SH5A 4XVHA 4Q4X3 4QD2A 2R30A 2JECA 1X50A 3RZHA 3PUQA 5LEJA 4AAXA 1HN0A 1QJY2 4K9SA 3MV11 3ITQA 3PUSA 3T1MA 5JSPA 1QGLA 3SITA 4BIOA 4Z92B 4MGTA 4XW3A 2CTVA 3MIDA 1GOGA 3ZFFA 3T3YA 3GZUC 4QGNA 1YXWA 1BEV1 1ST8A 2YV8A 5FZ0A 2VGDA 5KHIA 4RGKA 4YW4A 2WT2A 4Q26A 1MS8A 1H8TB 4AW7A 5IVYA 1Q5OA 2Z79A 3HBKA 5FMOL 5J36A 1YLLA 5JMCA 1PZ7A 1IPKA 1VBC2 5CFDB 3NKTA 2WS93 3TN92 5LA1A 1F8VA 2Q0AA 3PUHA 3DEMA 4ISRA 3VZJA 4XQWA 4EZHA 1YQ6A 1OOPC 2XXZA 1EV13 2VNOA 3ZXLA 3AX4A 4A6SA 1PX4A 2VMFA 1XXNA 1RUE2 2RJ2A 4O9GA 4Y1YA 5B4NA 2HWD2 4E4ZA 1XRUA 1W9WA 2JDYA 4ZXEA 1CESA 3CIHA 5IK4A 4XDOA 4UBGA 4D7YA 1GZTA 5F32A 2OKXA 4Z1VA 2AR6A 2PQQA 4UOJA 2D6KA 2AH2A 1HRV2 1ZZ7A 5FZEA 4JKLA 4DNYA 4NHXA 3SMHA 4XJ9A 2WC2A 1F5JA 5FLJA 3VBRB 1O91A 1URXA 2GSYA 4YW2A 5CISA 1VBE1 2GN7A 2JDZA 1O3RA 1VMHA 1X9PA 3ON7A 4YZ1A 2GP5A 3UL2A 3WW3A 1UKRA 1ZRFA 1AXYA 4LPLA 4NR1A 4GULA 3F2ZA 4ZS2A 1JYCA 5A33B 3RJRA 3BI3A 1JODA 3NAPC 2Q5TA 2KR2A 4P08A 3RYKA 3RI8A 5FOJB 3AXEA 4KQ7A 4EN6B 2K9ZA 4CDXA 4ONUA 5A7QA 2D43A 3H7JA 3OPWA 5C3SA 3POWA 2P4EA 1GU3A 1AL0G 1CZVA 1SLCA 3MUY1 1R1A1 4DUVA 2VQ0A 2ZGQA 4M00A 5C8CA 4AFCA 3MZHA 1YIFA 4K7JA 3DUIA 4CCDA 5KWRA 1JZ7A 3ZKUA 3HVDA 2W1WA 3N9LA 5FZBA 5ACA1 2P3YA 4OHYA 4ARXA 1QH7A 3B9IA 3VBFB 3O7OA 1QOOA 3BPSA 3HNYM 4UW5A 5JSOA 2W1QA 1K45A 3MICA 2RS33 4KWJA 2FDFA 3AMQA 4EROA 4A6OA 1HKDA 1LOFC 4MZUA 3VDBA 2WLQA 2WNOA 1ZZ6A 1DZRA 4N7UA 2DBNA 4CDWC 2CWMA 3ILNA 5E6HA 1JZ8A 5LWBA 2Y60A 2ZGNA 1M06G 5ISLA 2CGNA 3MIBA 5AFEA 3J8F2 4LBQD 5CKNA 4LBNA 3UNPA 1QJU3 4IEXA 3LZZA 1TME2
chains in the Genus database with same CATH topology
1LOBA 1RUG3 1UX6A 2EA7A 1SFYA 2QZ3A 3RYRA 2VOWA 1DGRN 3VHPA 5JWPA 3KCXA 3HT1A 1LHUA 1CAXB 1ND2A 1XNDA 4AFBA 4KU8A 3VBSA 2D3PA 1NXMA 3R4DB 4Q4W1 4IEQA 5JPMB 2E6VA 4D69A 2RS11 4L8QA 1H1IA 4EWEA 3VKOA 3WW1A 3WP5A 5JCTA 3AYDA 4MVTA 2GH8A 4MGZE 1AYM1 1R081 2SBAA 2WZR3 2R043 5DG1A 3PHMA 4W65A 4C1XA 4XJWA 3QBQA 2W08A 4GB32 4RQPC 2XL7A 4AI1A 2WNVB 1SDWA 2AYHA 2XGXA 1A3KA 4HK9A 1SEFA 1NE6A 4MGYE 4P9JA 3DL3A 4XHBA 1DGWA 1O7FA 3DF0A 3FLRA 1UPIA 4JV4A 5D8AB 1VBB2 2IFWA 4IEYA 3WG4A 1SLBA 2XVKA 4AVTA 2D40A 1D4M1 1VP6A 1BXHA 5AC93 1DDLA 4RHV3 1HXS2 4PF5A 1KJLA 3QCWA 1GV9A 2WS91 2CL2A 4GQ7A 4DZGA 4CEWC 2OVUA 4BZ4A 3HD8B 4FT8A 3NV2A 4IEZA 4YG3A 2AGSA 2RMU2 4FVVA 2IC1A 3N35A 4PLNA 4YZ3A 5CFCA 5J37A 3EQEA 3SLIA 4XFIA 1FXZA 4K3UA 4IERA 5E8AA 3AZWA 1Z7S2 5CBLA 1Q8SA 5H9QA 3ZFGC 1DZTA 1WW7A 4DFSA 1KFXL 3VUOA 1COV2 4OI1A 2JG9C 3B00A 4KG0A 1ZBA3 3ZN6A 2Z42A 2ZOEB 2LALA 5L7OC 3D4KA 5C9AC 3HMYA 3I54A 3S0MA 1QH6A 4HPKB 3VBUC 4QPGA 5SV5A 2YDEA 2HWE1 4EN7B 2GMMA 3QH7A 4FOVA 2NZ9A 2XB6C 4IL7A 3N4MA 3N7KA 3E5QA 3WQ7A 1MS4A 1WW5A 4XFBA 4KU7A 1FV2A 1I5ZA 1QY4A 3OD4A 3IN9A 2G9FA 4FP2A 5K8SA 1H8TA 5AFBA 5CFDA 2VU9A 3V64A 2MPFA 4FSJA 3SXWA 2DCTA 4LA3A 2WFPA 2R16A 2Z5WA 5JI9A 2OW4A 2R072 3B9CA 4PLOA 2WNEA 3AKTA 1SLAA 1AX1A 2ZGRA 3BODA 1IS3A 4RS5A 1RGSA 5L19A 3I8TA 2X53S 1KXGA 4LBQB 5J98B 4JGZB 3VZNA 5HCAA 1Q43A 3PVNA 2WT1A 4LUMA 4A2UA 1UPSA 1V9U1 3M4FA 4GALA 4RGAA 2Q30A 4AQTA 3VBRA 2K2SA 2HWB2 1C8M1 3JB4C 1VAKA 1YRZA 4JGYC 3LAGA 1OI6A 1ZNPA 1SACA 1Q8PA 2ZGLA 3WCSA 2VNRA 1CGPA 2SLIA 2BTVC 4JCKA 5A33A 1C5HA 1NCRB 4LHLA 1AR71 5FLIA 5JZGB 1HRI3 2P3JA 5JSRA 3CO2A 1Y9QA 3OCPA 5FAXA 1RJ8A 1YCIA 3WUDA 1RHI3 2WKKA 3KSCA 4P5HA 4ZKTB 4OUSA 3LKJA 2ENRA 1SQ4A 3MLLA 4P9WA 3IIAA 1J3RA 2R6QA 4KH9A 3IDCB 3H8UA 3VBFA 4UBHA 4XXAA 3AZVA 2V5YA 3J4UH 3JBG1 1W39A 4Q4X2 5K0UB 1UL9A 3HT2A 1AR92 2PTMA 4HKOA 1NY71 3ROUA 4K1ZA 4E2GA 2C1FA 1ASJ2 1NCQC 3KM5A 5HXVA 3NV1A 3FJSA 4AHWA 5FMOS 2XJVA 1FNYA 1BYHA 1FPN3 3CNAA 5AC91 4RHV1 3IM0A 1DGWX 1ZA4A 1PGL1 4OULA 3MF6A 2WJSA 2WSUA 3DGTA 2XL9A 4RFT0 3ASIA 1JHNA 2D98A 5LK5A 2QZ2A 3KGZA 4YVWB 4FPLA 4QPIC 1DYPA 1REDA 5JOZA 3R4UA 1CAXA 2VECA 3U0ZA 3ZXGA 3CJIC 4RD7A 1EV12 4OFGA 1RUF3 4CEYB 2DFBA 3HWJA 2XJTA 4XF1A 1S0GA 1DU3D 1W6MB 3M3CA 2JG8B 3MGUA 5F6LB 2EALA 1QF3A 3THPA 2A3WA 4GKYA 3LA2A 2AENA 3ZSLA 4QT6A 1B35C 1PZ9A 3QH6A 4FO9A 4M01A 1ENXA 2ILMA 1O4ZA 4R9BA 3SH4A 4D7TA 4R9CA 2WNVA 1ULEA 3A0NA 3ZSEA 1LR5A 2WFF3 4XE9A 4ASLA 3FC0A 5JIUA 3UJQA 4IESA 4JC1A 1FMD2 4AHYA 1RUOA 3PVBB 1LHOA 1CX4A 1RMU3 5D8AA 4XOGA 1VBA2 1X82A 1HLCA 1OLQA 3O0VA 3VZOA 3ZFEB 3FUOA 4DPNA 5JLVA 5KHKA 3KCYA 4Y4YA 3OGGA 2HEYF 4YW3A 2VNGA 4E4SA 3RQ0A 3WVJA 2GH2A 4C90A 1AR81 4XIOA 1RVF1 4Y1VA 1DQ2A 5CIRA 4LE4A 1GSLA 4E4DX 4X8PA 4AEJA 4AVAA 1DQ6A 4OZXA 4WVWA 1MVEA 2HWC1 2D6LX 3KT1A 5AVPA 3ZPYA 4NWVA 1V6NA 5I0TA 4ES9A 4AG4A 1LHVA 1POV3 1SMVA 3D0SA 1J1TA 2MEV3 5KHHA 4LO5B 3KCCA 3RG0A 2ATFA 2DVFA 1OMIA 3EJKA 3FFZA 3O5SA 3ZSJA 4PDWC 4I3GA 2VOKA 5ABJB 4GKXA 2JENA 1YFWA 5L73A 1ZZBA 4LBMA 2CGPA 1KDMA 3MPBA 1UKGA 2TNFA 1VLNA 3W9AA 4HPKA 2BNNA 2PLV2 1F31A 1AYN1 3AZZA 5JOXA 3AZXA 1T6GC 1U5YA 4HANA 4YVSB 2VVEA 4I0WB 1HV0A 1JYIA 3LOBA 2WZR2 1PZ8A 4NWWA 4JDMA 4R4ZA 1YFXA 1BMV2 3VBOC 4BM8A 3AFKA 2VUAA 1EPWA 1FV3A 2X5IB 4DB5A 5J7MA 1N1YA 2OZJA 2OA2A 3ZMOA 1XYNA 2K0GA 1QDOA 2WNUB 3WCRA 1BBT3 4RA0A 1GNHA 4FPHA 1AXKA 4LBQA 3ZSMA 3VHNA 3W59A 1FPN1 3WG1A 4XMIA 4JGZA 1MEC1 3NKGA 3ECQA 4YSFA 4WVVA 1ND3A 1VBC1 3Q9OA 4OI0A 1OSGA 4P9IA 2BGCA 1UMZA 4XFHA 1H2MA 1VBE3 2E63A 4KWKA 2A6WA 1REFA 1H0BA 5DZEA 1RUF1 1SLTA 2ZBJA 3NWKA 1AR63 3ZIXA 1IGOA 1JOJA 2VQAA 1KD7A 4DXZA 2Y0IA 1NCRA 3ATGA 1H2LA 4Q4V2 3KZ4C 5JZGA 1SBFA 1R1A3 4CDUC 1FOD3 2JD4A 3INAA 4JQRA 3NJZA 3OTFA 5GLVA 3D82A 2LM3A 4R4XA 4C91A 1ZBE3 5FOBB 1X7NA 1ZZCA 3RDIA 5LEKA 2BNOA 1WBFA 2CY6A 2RM21 5K7PA 4XF9A 1CJDA 2Q1ZB 1JUHA 1LENA 3AP7A 1V6MA 4IV3B 4YW5A 5K0UA 3S7IA 4QHBA 1BJQA 1TMF1 4HKWA 4CP1A 5BY5A 1B09A 4AQSA 3KB5A 1PK6B 1YI9A 1V6LA 2EF6A 1NA1C 1Y3TA 3WDUA 3RS6A 1LECA 2R0HA 1PIV3 3IDBB 4IQPA 2IXJA 3SISA 3HN1A 4H14A 1AL23 3TWIA 4Y26A 4GH4C 5DDJ2 3I2DA 3W58A 4YVWA 4KGGA 2O1QA 1GFF2 1V6OA 1H9WA 2ZGMA 2F6BA 2CAVA 4CEYA 4QQ2A 3RMYA 3WLUA 4Q4W3 2IXIA 4QQPA 4CDQC 3AP5A 3FHIB 3VGIA 2RS13 1W6MA 2JG8A 1POV1 2YGLA 3U4XA 1VBD2 4ZU4A 1ALYA 1CVNA 4N90A 3VKNA 4DRRA 1TME1 3TNPB 4FAGA 2ZX2A 3K51A 4N53C 4YGCA 4K20A 1S2BA 4W6XA 4YGBA 1R083 3TRSB 1X36A 1YYNA 2GZWA 2IFRA 5GZEA 5J09A 3MIGA 5LRRA 4FPKA 3VHRA 4L2NA 1N1SA 5BNOC 4G3YC 2NM1A 4X6QB 4GMP3 4F7ZA 5C33A 3PTYA 1BK1A 3J9SA 2C0ZA 2HWF2 1O3TA 4P14A 5A32B 1RUI2 4H3WA 4LR4A 3GHMA 4XJAA 2AUYA 1MQTC 4S2DA 1OA3A 3M3OA 2E7QA 4LA2A 3WP3A 1UIKA 3N7LA 5GZDA 1OD5A 2A73B 1O3QA 3ZFEA 1CD3G 1D4M3 1OOPB 2UURA 5BXXA 4GB31 1PMIA 3SHRA 3LA3A 2D6MA 3BPZA 1W6PB 3G6JB 3WR0A 2JEMA 3WUCA 3WP6A 1QOSA 2BFUS 3HQXA 2NN8A 5T5PA 1EAH2 1DQ1A 1VIWB 1VBB1 5GALA 4AGRA 3IMNA 4IXLA 5T55A 4OHVA 4FP3A 4OHZA 3QD6A 1BBT1 5FREA 2VH9A 1N1TA 2I07B 4WM8C 4QPGC 3R05A 4IEWA 5F9TA 1HQLA 1R092 3ST7A 2X29A 1QKQA 1RUD3 1VR3A 2UU8A 1DQ5A 1PHMA 2A3XA 3ZX7A 1RUJ1 2UY8A 1DGLA 2XLFA 3NAPB 4H7MA 1YWKA 3C3VA 1CAVB 1KQRA 5ABJA 2DCYA 1JBCA 1NOVA 4YGDA 4BLJA 2GNTA 3MLKA 5LK7B 1WUVA 2A5ZA 3ZXEA 5KC6A 3RRDA 1Q8OA 1AR61 2MNGA 1SLLA 3QLQA 1QQP3 4HL0A 2EAAA 2R062 2HWE3 2I45A 4LUKA 4F3JA 3D6EA 4JVAA 2XJUA 4YVSA 3VZKA 5CAZA 3L2YA 3LSDA 5T52A 1RIRA 1OA2A 4RS5C 1FOD1 3AXDA 1OA4A 5JR7B 4K8FA 1GNZA 1O4YA 4CDWB 4DY5A 2JICA 4D7SA 1RUNA 1ZBE1 4WZCA 1JH5A 4AVBA 2DU0A 2X5IA 3AYCA 5LRSA 1Z78A 4ATFA 4B7EA 2XG3A 1MZ6A 1WLWA 2WNUA 3JQXA 1RMU2 4Q4Y2 1XQNA 1EYBA 3LCPA 4AEDC 1X33A 1C1FA 4TWTA 4LHKA 2WIIB 2YC0A 1G9AA 2RR12 4C1WA 3UJOA 1HIXA 1S1AA 2WLPA 1PIV1 3U10A 1AJOA 3DKWA 4BH9A 1AZDA 1GQHA 3V56A 4FTSA 1V9U3 1AL21 4IEVA 4LT5A 1DQ4A 1OLRA 1RUH3 1C8M3 4XQ4A 3URFA 2ZHLA 4YNIA 5F6KA 2XKOA 3GZTB 2EAKA 2JX9A 3OYWB 3ZYPA 1SBDA 2YUEA 4RQPB 3P3NA 3TYJA 2ZX1A 4AEKA 2MEV2 4BMEA 1AR73 3MFAA 1ULCA 1XU2A 1KITA 1N1VA 4AVSA 4FPOB 3MIFA 2NPIA 4U2AA 4YZ5A 1D2QA 2IZWA 4AE2A 4R52A 4BCUA 3BTAA 4EN8B 1IKPA 4GMP1 3UK9A 1ZRDA 3JBG3 2Q1MA 4KWLA 4IV3A 1JN2P 4NHLA 2UYBA 4RR3C 1GKBA 1PVC2 4KG8A 1V6JA 2NMNA 1HW5A 3KD4A 1F5FA 1PK6A 3OGJA 2ZMKA 4K1YA 4L97A 3RI9A 1IZ3A 5CVRA 2QFEA 4LBJA 3VBHC 4CEWB 3M2MA 2BVBA 3EBRA 4AF9A 4QQLA 1BEV2 5D1IA 1HV1A 5F5QA 3EO6A 2Q8OA 2QDRA 1PO11 1V70A 4QX5A 2XWBB 3MPPG 1AR91 3WQ1A 2QUOA 4L11A 4Q8LA 2GC0A 4LEJA 3OBRA 3ZFGB 4BQ1A 3AZYA 1DLLA 5DUUA 1ULFA 3TAYA 4B8EA 1VRH1 2FZ2A 1MS9A 3D5OA 3G7DA 4EN0A 3B01A 1A78A 4P9LA 4WM7C 1AF9A 1XNBA 2JG9B 1TNFA 5J48A 3ZDSA 5L7OB 4XBLA 5BYNA 5C9AB 4LO8A 1RUD1 5D8AC 3VBUB 2HKXA 3WOGA 1GLHA 1LOAA 2D3RA 4QM8A 1MR5A 4XFFA 1WLTA 1NLSA 3WDWA 4QXKA 2WINB 2DVBA 4Y1ZA 1S0BA 1QJX2 2ZX3A 2R32A 2ZMLA 1S0FA 3LSEA 5BNNC 5JIAA 4XILA 1AVBA 1BZWA 2HEVF 4Z82A 5CA6A 1CN1A 5A32A 1LKNA 1QQP1 4AVCA 4COZA 1JW6A 1CAWB 3H3ZA 3TB0A 4XF3A 2E7TA 1J3QA 4KGQA 1CPMA 3FLTA 3NW4A 4XDQA 4KNCA 1R1A2 5HBAA 3FFQA 1R1ZA 2P17A 3DPRC 3K48A 2YYOA 1LOCA 1V6IA 3SCFA 5I0RA 4KBBA 4M0NA 4D3WA 4M3CB 5ACA2 4JTOA 1W6PA 4J1XA 2ARXA 3MIHA 1RUC2 5KXDA 1UIJA 4Q0PA 5EJ3A 1M4WA 1XNKA 3E97A 1AR83 4DRVA 1FMD1 2QJVA 3GBWA 1EY2A 2RHPA 4DOUA 1RVF3 4A7KA 2NQYA 2HWC3 1G9DA 2VY0A 5BNQA 1D2SA 2TBVA 3WHUA 1ULGA 2I2SA 3WHTA 2DVAA 3VHOA 4JGYB 1YO8A 4BPZA 1H2NA 2H6CA 1DGRA 2DCKA 1J3PA 3LOIA 4R8HA 4N9HA 3B3QE 2PHRA 1QDCA 2H6BA 3NAPA 4FAHA 2QE3A 2AREA 1CAVA 1RUH1 4MH0E 5JPNB 2A6ZA 3PNAA 2DVDA 5C4WB 4LO4B 3SNMA 1W6QB 2H0VA 4N43C 4Q4W2 1RITA 3T1LA 4XFCA 4MGIE 1RJ7A 2Q4SA 3T2TA 5FTTC 1DYKA 3JD73 4HN0A 3B7MA 2ZAHA 1IS4A 2GNBA 2RS12 1AYN3 1YJKA 3ZXDA 2Z2SB 2D6NA 4DMIA 1AYM2 1LOFA 5GJ6A 2GC2A 4Q29A 3E6CC 1H30A 4XTPA 4CDWA 3B94A 2DV9A 1S0EA 2XUMA 1K5MC 1WLCA 3VDDC 4ZXKA 3BOPA 4IV1C