2R1DA

Crystal structure of rat neurexin 1beta in the ca2+ containing form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
b'GHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurexin-1-beta
molecule tags Cell adhesion, splicing
source organism Rattus norvegicus
publication title Regulation of Neurexin 1beta Tertiary Structure and Ligand Binding through Alternative Splicing
pubmed doi rcsb
total genus 42
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, W
ec nomenclature
pdb deposition date 2007-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r1dA00
3VKFC 1YYNA 1LOFA 2HYKA 1WW5A 3M3OA 4TZDA 3VKNA 2OUHA 2R16A 1DLLA 1F5FA 1ENQA 5JOZA 4K21A 5T54A 1S0EA 3LSDA 3RMXA 2ERFA 2W52A 4FOYA 3AYEA 1EPWA 4XBQA 3SITA 4AGGA 3KQRA 4ITCA 3VKLA 1LHVA 1V6NA 3MPPG 4L8QA 1AVBA 2VW0A 4ATFA 4FOQA 4AWDA 1ENSA 3WDTA 2ZHLA 2NP0A 1JXNA 3OYWB 2AUYA 2C9AA 2GMEA 4FPEA 2PHTA 2C5DA 3OYWA 3WOGA 4IQPA 5H9SA 1QOTA 1SBDA 4U2AA 2P37A 1O4YA 3WUCA 1SBEA 3WDXA 2AENA 1WLWA 1DQ1A 4FOVA 1C1FA 1RINA 1MVQA 2D6NA 3RSJA 5IUQA 3OBRA 4XJZA 3V0AB 4CTEA 1QOSA 1W6QB 2NN8A 4XMIA 4YZ1A 1DIWA 4FP3A 1CJPA 2ZGMA 2ZBJA 4LBNA 4AVTA 1D2SA 2VY0A 1QKQA 1Y7BA 2ZGNA 4FPHA 4HL0A 1A78A 2A6WA 1VALA 1V6JA 5CB7A 2FHRA 3WDWA 1SBFA 5CBLA 1JN2P 3PVEA 4YGBA 1W6NB 1JHNA 2E6VA 1RIRA 1F31A 2DV9A 2NZ9A 3A0KA 1WD3A 2D3RA 1JBCA 4Q1PA 3VUOA 3ILFA 4C1WA 1BQPA 2P3IA 5JLVA 5GZEA 1FV2A 1V00A 2PELA 3B9CA 3ZXFA 3AZVA 2A3YA 2ZGTA 3I4IA 1MR5A 2Q5TA 2DU1A 2D44A 2GMMA 4JCKA 1GNHA 2UWAA 2R0FA 1WW4A 2FMDA 2ZGUA 5T55A 4YM3A 3V0AA 5FREA 5GJ6A 3USUA 4FVVA 1S1AA 4WVWA 1LOFC 3B3QE 3OBTA 2ZHKA 1S0DA 2D6MA 2V73A 4LBQA 3O0WA 1QF3A 1LTEA 1DQ2A 4CZSA 3RS6A 1VAVA 4M3CA 4Y1YA 4YZ4A 2DU0A 1KITA 4UW3A 5DXDA 5HCBA 5IT6A 1ULCA 3O0XA 2ZA9A 1QNWA 1SLBA 3B01A 3NV1A 4UW4A 4BLIA 1ULEA 3SLIA 3R4SA 5H9PA 5EWSA 1V6OA 1QNYA 2OUJA 2GALA 4DS0A 2WKKA 1C57A 2GNBA 1DHKB 1BKZA 3IPVA 1ZA4A 4AGVA 5GZCA 4FPKA 3FLPA 1LESA 2JKBA 1HQWA 2G4IA 2DUOA 3JUUA 5T50A 1SFYA 3W58A 4Y20B 1WBLA 1S0FA 2A6XA 1HQLA 2CWMA 3OGGA 4LBLA 5AVAA 1GLHA 1LHUA 1QOOA 4BPZA 5JDBA 4WZFA 3USUB 3V0BA 2E51A 1MS5A 2YROA 1G9AA 2ZGLA 1I3HA 4R9BA 1GANA 1GSLA 4XJWA 3RMYA 2CTVA 4XILA 1AXZA 1AJKA 4GKYA 3IMNA 2SLIA 2DVDA 4YZ3A 4YZ5A 4BMEA 5JMCA 1CR7A 1BJQA 3ILNA 5CA6A 1YXWA 4SLIA 4XYXA 4XOGA 4BM8A 5FRAA 3M3CA 1S0IA 3JU9A 4DRVA 3O5SA 1C1LA 1KJRA 1LHNA 3UL2A 3WG3A 5T52A 3FLRA 2E7QA 3O12A 2YV8A 4FQZA 4P9YA 3ILRA 1MACA 5GALA 4BOWA 3MW4A 3AYCA 3UJOA 1CN1A 1UL9A 4YFZA 1HKDA 1Q8OA 2WLQA 2DVFA 1WD4A 1LULA 1CVNA 2P2KA 3ZPYA 4ZKTB 4Y20A 1GZ9A 1QMJA 1OQ1A 3IM0A 1AF9A 2EF6A 3FLTA 4YG0A 1CPNA 2JJ6A 1IS3A 3FFZA 1MS3A 5H9QA 1WCSA 3WLUA 3WV6A 2YZ4A 5H9RA 5F9TA 2ZMNA 4YM0A 1JYIA 5E89A 1W6MB 5JOWA 1LCLA 1Q8PA 3VV1A 5GLWA 1IS5A 1LENA 3MW3A 1WBFA 2VH9A 2E7TA 2LTNA 5T5LA 1AZDA 3WNXA 1AX0A 3D6EA 1LECA 4P14A 1LOBA 1JW6A 2ZMLA 2ARXA 3FBYA 4TYSA 4Y1UA 1AX2A 1Q8SA 2EAKA 1R1ZA 1FNYA 3AZWA 1JUIA 2ARBA 2ZGRA 1MS4A 5IK7A 5L73A 1WLDA 3O0VA 1MVEA 1AXYA 1LGBA 1I1EA 3TB0A 1NLSA 2A6YA 2EXJA 4KBBA 1BXHA 4PCRA 1DQ0A 4Y22A 4FPOB 3PMEA 1AX1A 1U0AA 1S0GA 2WSUA 2XG3A 2AYHA 3AXEA 3A4UA 1QDCA 1UZZA 2DWRA 4XZPA 1ULFA 1ENRA 2ZZJA 3D5OA 1W6OB 1FX5A 1OKQA 3BIWE 5JOYA 1YO8A 5DUXA 4NO4A 1PZ8A 1W6OA 3T2TA 4Y26A 4XXAA 1UAIA 1GZWB 4UW6A 1GKBA 1H9PA 2D6OX 3B00A 4AVSA 4U36A 1LODA 1Q56A 3OY8B 5LK5A 1LOCA 1W6QA 1S0JA 4BMBA 2AGSA 4ASMB 1HLCA 2NYYA 4PBPA 1H30A 3SH3A 1ONAA 1VIWB 1W6PA 1WW6A 2AREA 2JECA 1LEDA 1DBNA 3OPZA 4RL7A 2D3PA 3VKMA 4FPLA 4YG6A 1UX6A 3WG2A 4YGEA 1SLCA 2WSVA 1LOAA 1SLIA 2ZHMA 5KXCA 2CNAA 4XTPA 4XXPA 2A3XA 1Q8VA 2Z42A 4Y1ZA 3WDVA 2VW1A 3KM5A 4CRQA 1W0PA 3TAYA 1IKPA 4XBLA 4C1XA 4Y1XA 4PF5A 2TEPA 2CL2A 1G9BA 4LBMA 2VUAA 2NM1A 2A5ZA 1IS4A 2OW4A 3V64A 1CONA 1APNA 3SNMA 4BQ1A 4DRRA 5DZFA 2YXSA 1FV3A 3MW2A 5CNAA 2A70A 2BQPA 3N7LA 4I30A 2D3SA 3PVOA 1Q8QA 2GN7A 3INAA 5SV8A 1O4ZA 5GZFA 4YW5A 4FOWA 1CPMA 2A71A 4YW4A 3IKWA 4WV8A 1QDOA 2DVAA 3APBA 1LHOA 2B7YA 1SLTA 4YGDA 4GWNA 1W6PB 1URXA 3BTAA 5IK4A 1IKQA 2DVGA 1DYKA 1IOAA 5T5JA 2GNMA 4XJ8A 2AH2A 3B69A 3ZXKA 1KQRA 1JOJA 2ENRA 2D6KA 2ZGPA 3R4UA 4XJAA 3AFKA 3BODA 3H0OA 2EALA 4M01A 2WQZC 2EXKA 1LEMA 4LBKA 1KDMA 3RG0A 4YW1A 4P9WA 1VLNA 2PHFA 4FQ4A 1UPSA 4Q27A 5T5PA 3N36A 3POYA 4XHXA 3NV2A 3AZXA 3ZYPA 4K20A 1AJOA 1DGLA 3ASIA 1GYKA 3ZXEA 3HR9A 4ZXKA 5KXBA 2VU9A 3AJZA 5E8AA 5DZEA 4P9XA 2EIGA 2CYFA 5GLVA 5BYNA 1WLCA 4H55A 1IS6A 4XIOA 5DG1A 4LBJA 2D7FA 2DUPA 2DTWA 3V0BB 3AP6A 2ZGSA 4R9CA 4XHBA 1WW7A 3WUDA 5KXDA 2D6LX 2GNDA 1DQ6A 3POWA 3RQ0A 1JYCA 3WVJA 1PZ9A 2UWBA 1GZCA 3AXDA 4LBQB 3AYDA 3VKOA 2V5YA 5F5QA 5JOXA 1G8WA 5GM0A 2ZMKA 3FUOA 2D43A 2ZABA 3HMYA 1SLLA 3WHUA 2A6ZA 1DZQA 2KM2A 3RRDA 1A8DA 3I8TA 1MS9A 5IK8A 3GNEA 1LJ7A 1BYHA 1Z0HA 1ULDA 1XQNA 3QCWA 3W59A 1YIFA 2WT1A 3ENRA 1CQ9A 3WG4A 2ZAAA 4AYUA 4BLJA 3ZSLA 2DURA 1RITA 1MS0A 4D69A 4DFSA 2UURA 2A75A 1YRZA 2ZGOA 4OZXA 5CAZA 3POSA 2ZGKA 1G7YA 3OJBA 4AVVA 4K1ZA 2ES3A 1CIWA 2RHPA 2WT2A 1BZWA 5DUWA 2A6VA 3UJQA 4UW5A 4Q1RA 2H0BA 2WNEA 2R1BA 3V65A 5EYXA 2PHRA 3AYAA 4M3CB 1LGNA 3WCRA 2PHXA 3N7MA 2DVBA 1UMZA 2R49A 2UU8A 4FPGA 4WVVA 1NXD1 4XJ9A 4YW3A 4GA9A 4ISQA 4M3CE 5GZGA 3BOPA 2VW2A 3PVNA 4XTMA 1W6NA 3NV3A 4YFWA 1PZ7A 1C4RA 1WUVA 1LOGA 3NV4A 3ZXLA 2ZGQA 3L2YA 4R9DA 1AXKA 2DYCA 3N35A 2WT0A 4GALA 4R9AA 1G86A 3CNAA 2R1DA 3U4XA 3FUQA 2D6PA 2GNTA 3C2UA 4Z8BA 2JDZA 1S0CA 3ATGA 3AZYA 4XJUA 5T5OA 3ZSJA 2YY1A 1ZM1A 4NOTA 2W39A 5IK5A 2JE7A 3AK0A 1N1TA 1MS8A 2EXIA 3M1HA 1MZ5A 3SH4A 4FPJA 3D4KA 2A7AA 3M2MA 2XB6C 2NMNA 1ULGA 3AP9A 5DUUA 1N1VA 1V6KA 2EXHA 3R05A 5GZDA 1LGCA 4LBOA 4XE9A 3PJQA 2NMOA 4K1YA 2VXRA 4Y24A 5DG2A 1N3OA 1UKGA 4M00A 4YLZA 4YM2A 4F83A 2GN3A 4GWMA 4XMAA 5GLZA 1LU1A 5EXOA 2GMPA 3QLQA 2P3KA 4Q2FA 1YI7A 3IN9A 4XIKA 4JRAA 1LOEA 1QU0A 3DUIA 4YG3A 1N1SA 2P34A 3IPVB 1SLAA 4RA0A 1N3PA 4W65A 3ZYRA 1D0HA 3LCPA 1V6IA 4PQ9A 5KXEA 4XBNA 1QGLA 1G9FA 1DYPA 4Y22B 4PBOA 2R0HA 2WJSA 5GLUA 3M3QA 4GXLA 1MS1A 4ATEA 4LBQD 3WZ1A 1KRIA 1GNZA 1W6MA 1GV9A 1SACA 1DFQA 5DUVA 1SCRA 3AJYA 1LHWA 2W68A 2P3JA 1TEIA 2E53A 4FP2A 2SBAA 3M3EA 1OFSA 1UZYA 2OVUA 4FPCA 5EYYA 4AGRA 2JE9A 1V6MA 2ZKNA 3AP4A 1LU2A 1N1YA 4Q8LA 1G9DA 1FNZA 2YMZA 4XDQA 3HN1A 1HDKA 3MEPA 3Q9OA 3WDYA 1FATA 3WDUA 4JC1A 3N3HA 4Q26A 2I2SA 2UWCA 3GALA 1CESA 1GBGA 4YW2A 5HCFA 5GLTA 2DUQA 1X50A 3SISA 3WG1A 3AP7A 1W0OA 4Y1VA 1KJLA 5DZGA 1VAMA 1SCSA 4ISRA 2JD4A 1MZ6A 3T1LA 4GKXA 1UN1A 4HANA 3ZSMA 4DPNA 2AR6A 3UK9A 3DGTA 1DQ4A 4YGCA 4YM1A 1GICA 1B09A 5JVVA 3SH5A 3ZXJA 2ZACA 4M3CF 5HCAA 1N47A 3AZZA 4YZ2A 3AP5A 4FPFA 1FYUA 2DTYA 3ZSKA 4Q8KA 2PHUA 3LSEA 2CY6A 3WHTA 1KDKA 1N3QA 4MYEA 1GZWA 3NWKA 3N7KA 3ZVXA 4DQAA 1V6LA 3A0NA 1A3KA 3OY8A 1S0BA 1Z78A 1DQ5A 2W08A 3WCSA 2A3WA 1H9WA 5E88A 1F9KA 2CWSA 1J1TA 2GDFA 2LALA 2PHWA 3AX4A 3T1MA 1G9CA 2ZHNA 4FPYA 1FAYA 3N7JA
chains in the Genus database with same CATH superfamily
3ZIWA 3VZLA 1AYN2 4RN5A 3VKNA 2R16A 3OSDA 3ZFGC 4B3NA 5JOZA 4YVSB 4K21A 3ZXGA 4CDXA 2BYVE 1UYXA 4Q0SA 5T54A 5JI9A 3LSDA 4HSJA 3NAPA 3T09A 4AGGA 4BDVB 4ITCA 4I02A 1OF3A 4D8MA 4LT5A 3HVDA 3WEZA 3VZOA 1OLQA 3F95A 1AR81 4FOQA 3THDA 4AI1A 3PVBB 2RDQA 3ZM8A 2NP0A 4CPBA 3LE0A 2VZPA 2Z69A 5BV6A 4FPEA 5JSOA 5FY7A 4C8DA 2C5DA 3OYWA 4IE7A 2JDUA 4IQPA 4WVZA 2R073 1ZREA 1O4YA 1EY2A 1SHWB 1WLWA 2RS13 1RHI2 4CDUC 1PHMA 2BVVA 1RUE2 2D6NA 4Z82A 4SBVA 2VJXA 2BGCA 1IQDC 3J7MA 4TLFA 4Y4YA 1Q3EA 1W6QB 4NRQA 1RJ8A 2HWE2 1YFXA 4FP3A 4LBNA 5FYSA 2ZBJA 1AR92 2ZPXA 2FDKA 4DXTA 2VY0A 4KG0A 3GJBA 4QX0A 3S7EA 1Y7BA 1VALA 2IXCA 4NN0A 3WDWA 5FZ1A 2TBVA 3LFMA 5C5UA 4DEVA 3WX5A 1PVC2 4AHZA 3I3MA 3MYXA 2VMHA 2NZ9A 2WRAA 3A0KA 5EV7A 1ZBE3 4J1WA 3U75A 1OMIA 1S2KA 3WT3A 2LM3A 3EJKA 5GZEA 1IPKA 1V00A 1XXNA 3B9CA 3ZXFA 3AZVA 3FJSA 5A7QA 5LBFA 3BTXA 5A1FA 3QH6A 3UNPA 3ON7A 1RUJ3 3KCXA 4JCKA 1CAVA 2UWAA 1WW4A 3MIFA 5FYIA 1WMFA 4BA6A 1AHSA 1OUXA 3S5QA 1VRBA 3ZFEB 2JB8A 4RQPA 5FREA 1POV1 1UU5A 1UMIA 3VHOA 3AMMA 1BMV2 4LMFA 2ZHKA 1S0DA 5F3CA 1YQ2A 1BK1A 2HWD2 2MEV1 5FK7A 3FHAA 4MXVA 4IV1A 3OUHA 4LBQA 4NPLA 3O0WA 1QF3A 4O9EA 4QPGA 3ZDSA 3FL7A 4CDXC 4CZSA 1VB4A 2XJRA 1NLQA 1JODA 4EN8B 1AYN3 3PIJA 4Z07A 3KHCA 2WAOA 1KITA 4MVTA 4UW3A 5HCBA 2FZ2A 1R081 5FCCA 4BXFA 5JXIA 1F8VA 5AC92 4GH4C 4COVA 1ULEA 2ZTNA 3PU8A 3R4SA 1NQDA 1HXS1 1T6BX 1C28A 1X9PA 4NHYA 1QNYA 5LWBA 3AM2A 4LJHA 3O1UA 1C57A 1DHKB 1BKZA 5GZCA 1K5MC 3Q8EA 4PT6A 1JZ6A 1HRV3 1H1IA 1VBA2 1W8HA 4XC9A 2G4IA 4E27A 3JUUA 2IXKA 4JQTA 2ID4A 1SFYA 3W58A 1H6YA 2XBO1 4LBLA 4ZU7A 1HQLA 4TLGA 3U07A 1DGWX 3RZJA 1B35B 5I91A 1ZRCA 4CP9A 2HWF3 1QOOA 4BJ0A 1ND3C 1JU4A 4I2OA 3CEWA 1UY2A 3KV6A 4MO3M 4N7IA 1BMV1 4LO7A 1RUH1 1S2EA 2ZGLA 4XJWA 5A7PA 2CTVA 2WN2A 5FZMA 4LA3A 4XABA 2YC4A 4IL7A 4N53A 2FDJA 2DVDA 4H3WA 3W9AA 1BJQA 4IEOA 2OYZA 4XYXA 5EPAA 1DU3D 4QXHA 2QQKA 2PN5A 2XHNA 2BOIA 1PX4A 1MPXA 3K48A 3K4AA 2E7AA 4DRVA 2J1VA 1C1LA 2C24A 2FQPA 4KNCA 1LHNA 2J1RA 5I0TA 4X8PA 3SQOA 5D8AA 1QJY1 4CCEA 5IWFA 2VMIA 4N53C 5FUNA 1MACA 4HETA 3VL9A 3UJOA 1XNDA 1PGW2 1CAWB 1CN1A 1LR5A 1UL9A 2E63A 4JGYA 4DZGA 1VBD3 5FJKA 4JGYB 1P8JA 1GZ9A 3FLTA 4NIGA 1ZBE1 3OUJA 1MS3A 3HPNA 2F17A 3UETA 1H2MA 1KS4A 4FBFA 1QJX1 1ACCA 5EIYB 5KC6A 3VD3A 2JENA 1FMD3 1J59A 1W6MB 2RDNA 2FD8A 4IV3A 4J6GA 5EJ1B 1JZ3A 1EPZA 4XUNA 4QGNA 1LENA 5FPZA 2BGOA 2YBPA 5FYZA 4AHYA 2E7TA 1VBB2 2GSYA 1LRHA 3BU0A 1AR61 4GH4A 1AX0A 1HRI1 2CV6A 3ZFEC 4CCJA 1CZSA 3D6EA 3ZYJB 1CAXB 1ODNA 1AL21 1LOBA 2Q1FA 3ELNA 4IGOA 2ZMLA 4AEKA 1OFNA 4UFKA 5FMBA 3WP5A 4CA9A 3L9JT 4Y1UA 3WNLA 1YQ6A 4AF9A 1R1ZA 1FNYA 2VMEA 3AZWA 1JUIA 4CUBA 4EWAA 1DYOA 3HBZA 1C8M3 2W1SA 2JIGA 4PI0A 5IK7A 4H2AA 4ES9A 4CVUA 2VCCA 2VQUA 2JG8A 3PUIA 3TB0A 1VMHA 3H3UA 3LWCA 4KBBA 2VZUA 2BBAA 2PQSA 1ND2C 1U0AA 1S0GA 1CZVA 2XG3A 3PMEA 4LPLA 2AYHA 4UYBA 5LA1A 2CHHA 2QZ3A 3ZXDA 1QDCA 1TVGA 1JYVA 2E33A 5FKBA 3RJ2X 2YBSA 2BJSA 3D5OA 4I0WB 3I2OA 3BIWE 1OKQA 3LGRA 5JOYA 1YO8A 4NO4A 2WNUC 5IVEA 1VB2A 1HB2A 4XF0A 4XXAA 1GZWB 4NPRA 3M70A 1GKBA 4O65A 4Q5OA 4QDRA 3VZJA 4AEDB 1LOCA 1AR83 1XE7A 3KVAA 1RB8G 1OA3A 2W3JA 4ASMB 1W9TA 4CDQB 4MGZE 1QIQA 2NYYA 4AVAA 4PBPA 3RZMA 5CZKA 2JECA 2AREA 4RL7A 2JDHA 4AI9A 2D3PA 2PAMA 4XF1A 3NMBA 4FPLA 2JDKA 3JBG2 1I9RA 4JZRA 2RDSA 1O4TA 1SLCA 4Q0QA 5C9AC 1EV11 1LOAA 5KXCA 2VNOA 1UZVA 2XJQA 3C7HA 1HB1A 3N9MA 3NNJA 4XTPA 4XXPA 3ZR6A 5FPUA 2Z42A 1BHGA 1HN0A 3GXUA 3WDVA 4MLOA 3EO6A 3PURA 3KM5A 5D2AA 1W0PA 2H6CA 1MQTB 4C1XA 4PIZA 4Y1XA 2G9FA 2CL2A 2WNUB 4GQ7A 3ZPYA 3M8LA 3SEEA 3ZOIA 1E5HA 1AYM3 1IS4A 3ETPA 5FY4A 4CDUB 1D4VB 1CONA 2DCKA 3LF7A 1UX7A 2P6HA 2YXSA 4QU2A 4BK4A 2VZQA 2BQPA 3T08A 2GN7A 4V1PA 5BNPC 5GZFA 5LK7B 2VM9A 3EYPA 1CPMA 1QWRA 3NRUA 3OGSA 3IKWA 4CDQA 3DN7A 2JG9C 4CPBD 5IFTA 2DVAA 1W28A 2Q1MA 2P3YA 1GOFA 3ZKUA 2VAUA 4YGDA 2LS6A 1JS9A 2RS31 3BTAA 1RUF3 1OURA 2DVGA 4IEWA 4W6YA 4UFMA 5FQ0A 3POGA 1JYWA 3HIFA 4XJ8A 3WW1A 2AH2A 5LA2A 3GHMA 3ZXKA 4NJ4A 3O1MA 4CCKA 3BKZA 1XU1A 4NVPA 3O1PA 2ZX1A 4CEYB 2WO3A 1AYM1 5AC91 1VBE3 2CAUA 1UO9A 1J1LA 3RG0A 1QJZA 1TZOA 3HNYM 2PHFA 2V72A 3O14A 4P9WA 5ANQA 4E2GA 5FZ7A 4Q0UA 1M06G 3POYA 1ZVFA 4QHZA 1EYBA 2JKXA 3CJIB 1OLRA 1W8WA 3ZYPA 4Q4W1 2WLPA 4BB3A 1COV2 2DFCA 2BWCA 2GZWA 2WC2A 1S55A 3HR9A 2JICA 1UZWA 2EIGA 4J1XA 5GLVA 3NO8A 1ASJ2 5B2GB 4XIOA 5DG1A 2R061 1XU2A 5CISA 5K0UC 4M0NA 4ARXA 4XHBA 2HWC3 3WUDA 2GNDA 3POWA 3WVJA 3M3IA 1QH7A 1X8MA 5FMOS 3CBNA 4AVCA 2WNOA 3M4FA 4XAEA 3SKVA 5JOXA 5GM0A 2ADEA 2QQMA 3GZUC 1QXJA 3LA3A 2XJSA 2A6ZA 3TOJA 1DZQA 1NY71 1RUH3 5F5CA 1US3A 2KM2A 4GULA 3LD8A 4JQRA 4K7JA 5LW9A 2UYBA 5LEKA 4D7TA 5DDJ3 1WCUA 3O1SA 1ND3A 3MIGA 1YIFA 2WT1A 3BGAA 1BEV3 2ZAAA 4LO8A 4BLJA 1RITA 1PIV1 2XHKA 4L0PA 4AEDC 4KBZA 2IXIA 4BK5A 2UURA 4OCTA 2HWB3 2ZGOA 5CKNA 1TME3 4I0AA 3POIA 4OI0A 5F6LB 3W20A 4WM8C 4AVVA 3OJBA 4K1ZA 1ZNPA 5FZ6A 4YVWA 1LKNA 4PLNA 2WT2A 1ZZCA 4DB5A 3TEWA 4CXYA 4NMIA 4QKFA 2A6VA 2XJVA 1VRH1 2H0BA 2R1BA 3V65A 3WP4A 2VCBA 5EYXA 2PHRA 3PLQA 5CFDA 1LGNA 1CAUA 2PHXA 2XUEA 2R49A 4PDWC 4QX8A 2ZEYA 5HV4A 1NXD1 5FAXA 4M3CE 1QJX3 2D98A 2R071 5GZGA 4GB32 5LASA 3RPQA 3IAQA 5FO9B 1RUI2 4HLTA 1VE0A 1J83A 3HT1A 5FYHA 1AXKA 2E26A 4OQ9A 3U1XA 5FYCA 3ZN5A 3KCCA 1PIV3 4ES8A 3VD4A 1G86A 4PIXA 3JCIA 4LKSA 3U14A 5FPVA 1Y4WA 2D6PA 2RS32 2HBUA 2ET7A 3IWZA 4LKFA 4V2WA 3PNAA 4WM8B 1QJU1 2JDZA 3MV01 1CAVB 3ATGA 1PGL1 4XJUA 4FFIA 4MXWA 1NKGA 4GMP0 4LUKA 2JIJA 3OF1A 3J8F1 1Z7S1 1OVPA 3FZ3A 1MS8A 3RI9A 4J25A 1H8VA 1DF0A 1HV1A 1MZ5A 2QKDA 1GQHA 2W1QA 3FMGA 1GWMA 5FY9A 1ULGA 2YB7A 1UY3A 4AQ2A 4XFCA 3CDZB 3MZHA 1PNFA 1R1A1 1RXGA 3CKHA 2X10A 1ZZ9A 2NMOA 2VXRA 1SZBA 4Y24A 1N3OA 1PVXA 2R043 1DZTA 5DPNA 1OQDA 1MEC1 2V5DA 4XMAA 5EXOA 2GMPA 5FYVA 5FZBA 4URAA 5KC5A 1QJX2 2P3KA 4O9GA 4QDSA 4Q2FA 1NCRB 1QJY3 1O3SA 5CFCA 2XWBB 2OPWA 1A8MA 4OYUA 1SLAA 2KD7A 4EWEA 4RA0A 1N3PA 4W65A 5FPBA 3LOIA 1COV3 4PQ9A 3ZYRA 4BIOA 2JG8B 3BTZA 2AC1A 1Y43B 4Y22B 1X7NA 2E31A 2BBVA 2R0HA 2Q8DA 2HEVF 2BDRA 2VOWA 2OQ7A 3E97A 3VBOC 4IE4A 3OUIA 1TME2 4LE4A 4CSWA 3P1IA 1VBB1 4EN0A 2BWAA 2VECA 2VZ1A 4QHBA 4BIFA 1R1A3 3I7DA 1TEIA 2E53A 1JHJA 3KHBA 4FP2A 4RHV1 1UZYA 4YYOA 5EYYA 4AGRA 2P17A 1OOPA 3J4UH 3LAGA 3VBOB 5BNOA 2ZKNA 3AP4A 1LB2A 3WQBA 1W90A 5CADA 2EIBA 3C7FA 3VBHC 4JRLA 4CXXA 3HN1A 2R32A 5C8CB 1XPWA 1FATA 3BTYA 1IPSA 1UIJA 1CESA 1GBGA 2XKOA 4BZ4A 3U0ZA 2R042 1DGRA 1UKRA 2ETEA 3OGRA 3EHKA 5DZGA 4CEYA 4LKDA 4A44A 5FMDA 3ZFFC 3T2QA 4G3YC 4GKXA 1UN1A 4BU2A 3VDBA 1HRV1 2WFF3 1GP4A 2XOMA 3AL6A 4MH0E 4UF0B 3UK9A 3AZZA 2C26A 1YIPA 1RUJ1 2PTMA 3W5NA 1ULOA 2DTYA 4Q8KA 2PHUA 3NJVA 5J09A 4HT1T 5HCHA 1RUI1 3LEGA 1KDKA 3GCWA 4GIQA 4JVAA 3MPBA 2ZS6B 4JKMA 2FZ1A 4ZXEA 4M4RA 4DQAA 1V6LA 4E2QA 2W08A 1H9WA 5E88A 2LALA 1XSQA 3CO2A 3AX4A 3T1MA 4BQYA 2ARCA 2ZHNA 1ZZ8A 3Q8FA 4OHWA 4C91A 3OD4A 5C8CA 2CGOA 3ZMNA 5J1XA 1YYNA 1LOFA 1YFUA 4E4ZA 2OPKA 2HYKA 1WW5A 2X09A 3M3OA 4QX1A 3TBDA 4TZDA 2BPA2 1DLLA 2VPVA 1GP5A 1RUNA 3ZFFB 3LZZA 2PMWB 1WA4A 2IVIB 3RMXA 4B4PA 4FOYA 1QY4A 2E9QA 3POJA 3EB7A 3I54A 4Q4V3 4XBQA 3UGFA 3WY6A 1CIYA 2WQ8A 3KQRA 3VKLA 1LHVA 1V6NA 3MPPG 4L8QA 4QM8A 2VW0A 1OT5A 2QQOA 2WZ8A 3K46A 3THCA 4HPKA 2QQUA 1VBD1 3WDTA 4QT6A 3OYWB 5JSPA 2GMEA 2VOXA 4A3XA 1AL23 4B7KA 2PHTA 4A3ZA 5K4LA 5H9SA 1SBDA 2PLV1 1OOPC 4BQXA 3HBKA 3WUCA 5LY1A 4LK6A 2AENA 4D3WA 1HIXA 2GP3A 5I8TA 5FOJB 2FDFA 3LDKA 4Q4Y1 5GKAC 2XJUA 5IUQA 4JAAA 3V0AB 1O8PA 4HK8A 1PMJX 3CJXA 5FO7B 3BIEA 1REFA 1T2XA 3KSCA 1FXZA 4YZ1A 4FCAA 4LR4A 4FAHA 1DIWA 3RWKX 2C0ZA 3S7IA 1D2SA 1GZTA 1QKQA 2Y8KA 4HL0A 4RR3A 5KHJA 1A78A 2A6WA 2EIDA 1L7RA 3SHRA 1YNAA 4MHRA 2FHRA 3BN6A 1SBFA 4NIIA 2PA7A 1JN2P 5KBFA 5FMCA 4YGBA 5FZIA 1W6NB 1JHNA 4FFHA 3CZUA 5FZ8A 2ZCWA 4YVSC 5ABJA 1WD3A 2D3RA 4Q4W2 4PQQA 5C7GA 5IVCA 4UFJA 4IEXA 2PELA 4AI3A 2A3YA 1HQNA 4WM8A 4FSJA 2GMMA 2XONA 1Q5OA 3AVRA 3IMMA 4MGKE 5FTTC 3LB9A 2FCVA 3OPTA 4IW3A 3HQRA 3C8XA 2FMDA 5M0TA 2ZGUA 1UYYA 4CP9B 1W2AX 3GZEA 2Y6HA 3ZKYA 3I2DA 2WBKA 5FZOB 3RZKA 2HWD1 5LA9A 3THPA 1A6CA 1BBT1 4BCUA 1WCDJ 5FZ3A 2ZEXA 4UT5A 4ASLA 2FDGA 4K3UA 1DQ2A 4B7EA 3ZMOA 1VAVA 4R8HA 3S6PA 1CAUB 2DU0A 4XURA 1ULCA 1GQGA 4ZPIA 5A3WA 3B5LB 3KV9A 1XJAA 3J8F3 4BLIA 2P4EA 4PDWA 2H6BA 4EV0A 3J7NA 2JDPA 1V6OA 4YW7A 5F3GA 2GC3A 4DS0A 3RJRA 1O7FA 2GNBA 3JZVA 4W8JA 3IPVA 1LNSA 4AGVA 5EP9A 3NKGA 5CKQA 4QX7A 4FPKA 1TMF1 2B45X 2DCJA 2Z4FA 2I45A 1LESA 2JKBA 4HKWA 1HQWA 2DUOA 5T50A 5AVAA 1NG0A 3OGGA 3ZLIA 3RZHA 1GLHA 3H3ZA 2K46A 4QKNA 1RVF2 3NNMA 2Y64A 3I2HA 2VUDA 2WYFA 4IEZA 2AEYA 2E51A 4KI5M 1BLZA 1W9YA 2YROA 3HWJA 5BNQA 1SQ4A 4R9BA 3VZKA 3BVCA 4NHLA 5CFDB 5LRRA 1VR3A 2SLIA 1PVC3 4BMEA 1CR7A 2ARAA 3ILNA 4CDQC 4UOJA 1YXWA 3DCQA 4SLIA 4BM8A 3I3EA 4XFBA 5D8AB 3WQ1A 1VBB3 4TTGA 4Q0VA 3WG3A 1AR71 5FZGA 3O12A 2X05A 3G7DA 2D40A 4FQZA 1Q43A 5FP9A 3B93A 1RUOA 3MW4A 3AYCA 3OGVA 2WLQA 3AKQA 5A7WB 4OHXA 3RDIA 4JKKA 4Y20A 1VBC1 1POV3 2YFZA 2WFPA 3E6BA 1E57A 1OQ1A 2EAAA 4KL1A 3P6BA 1O5UA 1CPNA 2G9GA 1XYPA 4OLLA 1QHDA 4PJYA 5JAXA 5H9QA 5JIUA 4IEYA 3WLUA 3WV6A 2XKPA 2ZMNA 4YM0A 1JYIA 4AK3A 4OHYA 3EQEA 2C6SA 2C4XA 4PIYA 1WMXA 1LCLA 3T30A 3VV1A 1H2NA 4AFCA 2RDRA 1IS5A 1RC6A 3W5MA 3MV11 2X5IA 2Q4SA 1HN1A 5F2SA 3KGZA 5T5LA 3RWNA 4BHPA 4BXSV 5C5TA 2GU9A 4HK9A 3U4SA 4AQ6A 1XBFA 3SCFA 3BI3A 2W87A 4URTA 3VBUB 5JZGA 5K8SA 1H4GA 5JXJA 1JW6A 1KXGA 3WF0A 2JD9A 4ZS2A 4CDWB 4LOSA 4NIHA 1MZEA 1Q8SA 3RYPA 2EAKA 1D4M1 1HB4A 2ARBA 3ZN6A 2RS12 3E5UA 5IVFA 4O7XA 3I97A 3A23A 2WABA 4AE2A 1BBT2 5LB6A 2Y33A 2EXJA 2VXJA 5FYMA 1DQ0A 4FPOB 4IV3C 1VMFA 1AX1A 5FYUA 4ASKA 3WNOA 1U12A 1Y9MA 3AXEA 1UZZA 3C7EA 1QJY2 2WR9A 1OBNA 1NZIA 5DUXA 1W6OA 4L99A 3EXUA 5IHRA 2NLRA 2VTXJ 1RUJ2 4OZOA 1NY72 1G6NA 1OHFA 1UAIA 1H9PA 2YC0A 4UW6A 3IIIA 1W6QA 3MIDA 3UESA 1IG0A 1UYZA 1VRH3 1JH5A 3TN91 4ZS3A 5F6KA 2FCUA 3AMHA 5A70A 1H30A 3SH3A 4N8MA 1VIWB 2R6QA 3KT1A 2W1UA 1LEDA 4H7MA 4CEWC 1V9U3 3TNQA 5A32A 3HAGA 2AEZA 5C8CC 3H1WA 1UX6A 3TRSB 4YGEA 3ITQA 1NCRA 4RGGA 1SLIA 1GWKA 2ZHMA 1JMUB 2WNVA 5A3PA 1IGOA 2OQ6A 3PU3A 2EVXA 4CRQA 1JYXA 3TAYA 3O1RA 3HNBM 1G9BA 1W39A 2QQVA 3I49A 1HXS3 4Q4Y2 1H8TA 4DUVA 2NM1A 5FZ4A 3P3PA 5LA0A 2TUNA 4XCAA 5DZFA 1FV3A 3N7LA 1RUF2 5F5IA 2D3SA 5JLVA 1O3QA 1Q8QA 4KG8A 3VDDC 1O4ZA 4MHUA 2RR13 5E6HA 4YW5A 5FFOC 4B1MA 2A71A 2O8OA 4YW4A 1HV0A 1B35C 1DGWA 1QDOA 4WV8A 4FFFA 4KWKA 4B4RA 5FV3A 3CZJA 3NNFA 1VBC2 1NA1A 1URXA 4ZU4A 2LUWA 2CSGA 2ILMA 4IE6A 1OH4A 2GNMA 2VD7A 5CYYA 1NX9A 3NAPB 3V56A 2ENRA 4XEZA 5ACA1 4C0HA 1RUC3 2Y6FA 3OEAA 1FT9A 3H0OA 3ME2A 4RHV2 5BXXA 3RVHA 3SXWA 3WNKA 1SDDB 3DF0A 1H2LA 3B94A 4HPKB 5FYTA 5IJRA 1KDMA 4YW1A 1RHI3 4Q27A 3MF9A 3BPSA 3N36A 3C7GA 3NV2A 1SG3A 3AZXA 5F39A 4QDQA 3USSA 5IAXA 1DGLA 2RS53 1GYKA 1K3IA 1PK6A 2W0XA 5IW0A 3AJZA 5KXBA 3LEKA 2CYFA 5FY5A 2HKXA 5LATA 4H55A 1KEXA 4JGZB 4LBJA 5FYBA 3T2PA 3ZFEA 5F3EA 2AACA 5AVPA 1W0NA 1F35A 2J1AA 5A6YA 2KR2A 1DQ6A 3WP6A 4OUEA 5I0UA 3MUY1 4A2UA 2UWBA 1ZZ6A 4OVEA 4QPIB 3UGGA 1RUD1 3AYDA 2XGXA 3AC0A 3UKVA 4QPIA 5I93A 3K4DA 1RHI1 4QPYA 1AR63 3GYDA 3KMHA 3PUQA 1UU6A 3TN93 2W1WA 3JB8A 4K6BA 4N7UA 4DY3A 3WHUA 3X29B 4D6SA 1V70A 3TEYA 1XNTA 3RRDA 1MS9A 3DYPA 2QQJA 1LJ7A 5DQ0A 1Z0HA 4OMDA 3RNSA 1ULDA 1RVF1 1XQNA 2HWE3 3QCWA 4OMCA 3RZZA 5K9YA 1ZZ7A 2JWPA 1YFYA 3KLSA 5FIXA 4P9GA 3AFGA 1HW5A 4AYUA 3BPZA 4XUPA 4QB6A 1NYWA 3MLKA 4WBBA 4YPJA 2PYTA 4NPMA 4AHXA 1BEV1 2ZGKA 3MF6A 1T6GC 2ES3A 2RJLA 1CIWA 1RUD3 2OKXA 3P3NA 4DXRA 4C90A 4QQOA 5F5AA 1XE0A 3PUAA 2WNEA 5ISLA 1O59A 1JI6A 4RS5A 3T2OA 3VBSB 5AFBA 3AYAA 1OF4A 4M3CB 4D0QA 1VBC3 3UKTA 2FDIA 5C9AA 2UU8A 4QQHA 4XJ9A 4ISQA 1HRI2 3PVNA 2VW2A 4RSUA 4QPGC 3CLPA 2TNFA 4XTMA 1PZ7A 2VZSA 2OIIA 4KWJA 4RGAA 5FZFA 4LO5B 5I8YA 3NQHA 2YDEA 4GALA 4OQ8A 4KU8A 4R9AA 5FUPA 1TNFA 3LDBA 1MZFA 1OD5A 2R1DA 1QJU2 2RMU3 3FUQA 1CAWA 4Y3OA 4NUBA 3ZDVA 2YFUA 2VUJA 1YUDA 4Z8BA 1DGRN 3AZYA 5IVYA 3S30A 2V4VA 4XUQA 5BNNC 1ZBA1 4NOTA 3I3QA 1YC61 5J96B 5IK5A 2JE7A 2JG9A 3DYMA 2BFUL 4LHSA 4PHZA 5FP3A 5F37A 2NPIA 1X82A 3JB4C 2ZEZA 2GH8A 4E9KA 2A7AA 1O91A 2XB6C 2NMNA 4BQ2A 5KWRA 2G19A 4IV1B 2RMU2 4BE3A 4DMIA 5BNNA 1OKOA 1V6KA 2EXHA 4AQSA 1EV13 4GJYA 4GH4B 4RQPC 3VN4A 2R072 1UKGA 4YLZA 1IQAA 1CAXA 3JD71 2GN3A 1OUSA 2Y60A 4CDWA 1HRI3 4UI9L 3IN9A 4TWTA 4JRAA 3FHQA 4GWJA 2VMDA 2F4LA 4YG3A 5HXVA 3IPVB 3L2HA 1W04A 2VBDA 3WF1A 1D0HA 1D2QA 2RS52 5EFUA 1SMVA 4XBNA 3B7MA 1G9FA 4QGLA 5A80A 4L92A 2UY9A 1FOD2 3E6DA 3PJYA 2WJSA 1C8M1 1SFPA 1B35A 2IWGB 5AC93 2BERA 2LRPA 5FLIA 5K0UA 1GNZA 3ALQA 4XFHA 4ARYA 3WF2A 1DFQA 4YRDA 1HXS2 2VVDA 4Q4Y3 4NAMA 2W68A 2ZX2A 3AKSA 5LBBA 4AW7A 4BQ5A 5HPOA 4FO9A 1FOD3 4LNVA 5FBZA 3RGBA 1UPIA 1V6MA 2UY8A 2VQTA 2W94A 4BQWA 1N1YA 3MIHA 3K51A 2YPDA 2G1MA 3K2OA 3CF6E 3NL1A 2VNVA 1PM4A 3MFAA 2YMZA 5A1LA 5C3QA 2JE8A 3Q9OA 2ADDA 3WDUA 4JC1A 1FPN2 3N3HA 5IVJA 4Q26A 1MQTC 2I2SA 2UWCA 1W06A 2ZZQA 3KF3A 1FMD2 1IG3A 4HVRA 4XQDA 5CU1A 4ZU5A 4YW2A 3I59B 4CCNA 2BP6A 3SISA 1X50A 4CEWA 3WG1A 5HI0A 1ND2A 1QJEA 4Y1VA 2BTVC 4ISRA 2JD4A 4NHMA 1MZ6A 2VBBA 2ORZA 4UBHA 5A7WA 4W50A 1TMF2 4DPNA 3ACIA 4XW3A 4IDZA 1EUTA 4YM1A 3N4MA 1Y9QA 3FHIB 2WNUA 4NE9A 2RM23 2JG8C 2Q1ZB 3B02A 4FPFA 1JOBA 2VZTA 5CG8A 2Q30A 4C0BA 2BNMA 4DO0A 2CY6A 3D8CA 3IZOA 3WHTA 1OXCA 5JWPA 1W9FA 5ACA3 2JDAA 3NWKA 2J1EA 3ZVXA 1NA1C 3POBA 1S0BA 1Z78A 3MFCA 1DQ5A 4QU1A 3U37A 3LPGA 3WCSA 4F3JA 2CWSA 1J1TA 2PHWA 2Z5WA 4BQ3A 5BY5A 1XC6A 2QDRA 5FZEA 2XL7A 3N7JA 1YQ5A 5BNPB 1WCKA 4CCLA 3VKFC 2QVSB 4COYA 4R4XA 1F5FA 2IVJA 3WD5A 4JHZA 3JQXA 4CEWB 1WGPA 4ZONA 3AYEA 4FI9A 3O1VA 3SITA 1RUF1 1C5HA 1NUKA 1RMU3 2KXLA 4LLFA 5CIRA 1AVBA 4JHTA 2XL9A 3MUZ1 3IDAA 4AWDA 1AR62 4MZUA 2QCSB 4JTNA 3MGUA 4BQ4A 2AUYA 2C9AA 3ACGA 1PO21 1VJ2A 4IETA 3POFA 1QOTA 4QGMA 2P37A 2BW8A 2QQPA 1QH6A 1DQ1A 4FOVA 3J26N 1RINA 1MVQA 1WA6X 5A3UA 5A33A 5LEJA 1L7LA 3KVBA 3PMSA 1UY0A 3VGIA 2GC2A 4AR2A 3DEMA 1QOSA 4XMIA 1YCIA 4HSLA 4AFBA 2XR4A 4QQPA 4QPIC 5BNPA 4P5HA 2ZGMA 4M4PA 4FT8A 1W9WA 2W5FA 4FPHA 1AL22 2W47A 5C9AB 3D0SA 3O1OA 4A7KA 1FPN1 4COWA 5KHHA 5CBLA 3PVEA 5A3NA 1I6XA 2E6VA 2MNGA 2VVEA 3LDRA 1WZXA 1CX4A 1RIRA 1F31A 2DV9A 1POV0 1QJU3 2B42B 4WVMB 4Q1PA 3VUOA 1U5XA 4IESA 4Q4V2 3ZSEA 4C1WA 1JTZX 1FV2A 3FFQA 4Q29A 1VRH2 4HVOA 1H8TB 2ZGTA 5L7OB 4LIUA 3ZO0B 1MR5A 4E4HA 2Q5TA 2DU1A 2D44A 2CAVA 1SFNA 2XQXA 1GNHA 1HB3A 3OBZA 2HWF1 2QTWB 4ET7A 1UIKA 1O3RA 5T55A 4LO4B 1UOBA 3V0AA 1D4M2 3FWEA 5GJ6A 5JPNB 1K5MB 4OUSA 5DAPA 4WVWA 4E2SA 1YWKA 3B3QE 3VBRA 2VG9A 2GC0A 4ZZ8A 1W2OA 3E5XA 3PTYA 4XETA 1LTEA 4KWUA 1RUG1 3KB5A 3RS6A 2BEOA 3I2GA 5FP8A 2YGLA 4Y1YA 3VLBB 4RHV3 2XBO3 2WZEA 2ZA9A 5FKCA 4EN7B 2QJVA 1SLBA 3NV1A 4CEYC 1VBA1 4N43B 4UW4A 5FLJA 3VBFB 5JCTA 1J84A 3A22A 2DBNA 4XCBA 3SLIA 3WF3A 5FDBA 2BOJA 3MICA 1PO11 4IV1C 4AAXA 3WW4A 1NQJA 2OUJA 3ZYBA 4MGQA 4NWVA 4Y4RA 1W03A 5FXZA 4F7ZA 1ZA4A 1YI9A 3FLPA 4ONUA 4Q4X2 3JQWA 4MV2A 4Z92B 2EICA 2BVBA 4P00B 1WBLA 1EP0A 2UYAA 2A6XA 4KQ7A 2CWMA 1DDLA 5IATA 5C8WA 1LHUA 2YYOA 1W8TA 1GP6A 3KCYA 1V0AA 4BPZA 3NJXA 2QFEA 1W3VA 2ZXQA 4LHKA 1K5MA 3V0BA 5FPAA 2BUKA 3DL3A 1K42A 1G9AA 1I3HA 4UFLA 4IGPA 1YHFA 2B9VA 4AI2A 3O7OA 1OOPB 4XILA 2W92A 4YNIA 1AXZA 5FZ0A 1AJKA 2QE3A 4GKYA 3IMNA 5EQUA 5FZHA 2Y6GA 4YZ3A 2B9UA 2Z79A 5CA6A 3IDEA 3SKJE 4UAPA 4XOGA 5FRAA 2O0OA 3M3CA 4Y5TA 3R0RA 1OPOA 1ZRIA 3UL2A 4K40A 4QB2A 3VBUC 2YV8A 3GF6A 4JTOA 1OQEA 1ND2B 4P9YA 5GALA 1E5IA 1NCQB 1UYPA 2R041 5EZWA 2WS93 1HKDA 2VTFA 3PUHA 4S2FA 1WD4A 1LULA 2P2KA 1NCQA 2VBPA 1FI2A 3OD0A 3ROUA 1QMJA 4YG0A 1AF9A 2EF6A 2HBTA 2IC1A 4CCOA 1PM7A 1SEFA 1IS3A 1GWLA 2HWF2 3FFZA 4JDOA 4AQTA 5F9TA 4MGSA 1R093 2YZ4A 5H9RA 2QQNA 5E89A 4DXZA 3A21A 1W8ZA 5L7OC 1CZTA 1M4WA 4GMP3 4QD2A 3N9NA 5GLWA 1UY4A 1QQP3 3MW3A 5LBCA 2VH9A 2VR4A 2LTNA 1AZDA 4CP2A 4UBGA 1RUG2 2VCMA 2ZX3A 4CUAA 5C70A 3ZN4A 1QJFA 4NRPA 2RM21 1LECA 3N9OA 3OB8A 4IEUA 5SV5A 2WZR2 5KR7A 4L2NA 3LA7A 2VCAA 5CFCC 2ARXA 4XF3A 3DKQA 1Z7S2 4TYSA 2YC2A 4EJRA 4L11A 2HWB2 2OX0A 1WCQA 1SDWA 3RI8A 3W21A 5FWJA 2WWJA 1H1MA 2ZGRA 1MS4A 1CGPA 5L73A 1AXYA 2J7MA 3QOPA 1I1EA 1NLSA 2A6YA 4PCRA 4Y22A 5DDJ2 2HWE1 1OH3A 1RVF3 5FLHA 2WSUA 1RUE1 4CXWA 1U5ZA 2O14A 3ACLA 2CDOA 3VDAA 4QXBA 4MUVA 2DWRA 5A3OA 2X8KA 4I3GA 1ULFA 2ZZJA 1DLCA 2PFWA 1FX5A 4S2GA 5LCWL 1GU3A 3WQ0A 1W2TA 3N9QA 1UOGA 4PF1A 5A7NA 1PVC1 4Y26A 4HKOA 3T2TA 2WFF2 3I2IA 3CIHA 5A33B 4KH9A 4W4ZA 2D6OX 3B00A 3QD6A 4U36A 5LK5A 1Q56A 1S0JA 1ZBE2 4EWDA 4XF9A 3S5AA 3J8F2 1HLCA 1W05A 3ZYIB 2D5FA 1JZ7A 2ZJCA 4INDA 3UT0A 1ONAA 1W6PA 3OPZA 1WW6A 5LY2A 1PGL2 1GQPA 2J1SA 3ES1A 2HWB1 3VD9A 2WSVA 4QKDA 3ZFFA 4NWWA 4RS5C 2OXBA 5A6XA 1REDA 3WQ7A 5KHKA 4NHKA 1ULPA 2A3XA 3WF4A 4EZ4A 1V9U1 4YWAA 2VW1A 4WM7C 2OZJA 5C6CA 3NKTA 4PF5A 1EAH3 5A6ZA 1R1A2 1RUC2 2RS33 3WW2A 2YGMA 4LBMA 2VUAA 5L36A 2VNGA 4FTEA 2A5ZA 2OW4A 2WUHA 3K75B 3V64A 3VHRA 1XYNA 4A4AA 1DG6A 2DFBA 1APNA 2RVAA 4N9HA 1GUIA 4BQ1A 4D7YA 1IZ3A 4DRRA 5FPXA 1QEXA 3MW2A 5CNAA 2A70A 4AAPA 1TQ5A 3INAA 2BU9A 4FOWA 2XQRA 5K7PA 3HQUA 2Y0OA 4M0HA 2ZOEB 3ZX7A 1NA1B 4AOCA 3APBA 1OC1A 1SLTA 5C33A 4GWNA 1HX6A 2JB4A 5IK4A 3MI8A 4DINB 3B9IA 1DYKA 3R4DB 3LPFA 4FXGB 1X33A 2K0GA 2XJPA 3KQ4B 5A6QA 2RJ2A 3B69A 1O5LA 1W8OA 1KQRA 5E1RA 1JOJA 4N43A 2D6KA 3UGHA 2PLV2 3VBFA 3R4UA 3NW4A 1RGSA 5DAVA 4YSFA 3F2ZA 3AFKA 3HOBA 5D21A 1LEMA 4FAGA 3DKWA 2JDNA 1D0GA 3H50A 4LHNA 4CDWC 4FQ4A 4LORA 5T5PA 5FXVA 1YQCA 2RMU1 2R30A 2I74A 3FN9A 4I01A 3VDDA 3IDCB 1U5IA 1VPHA 1ST8A 1AJOA 2GH2A 2HWD3 3ZXEA 2WN3A 4OFGA 1ZBA3 2R7EB 2WAAA 3GBFA 4ZXKA 2VU9A 4LTAA 4K9SA 5DZEA 1JYTA 1RXFA 2BNNA 2FCTA 3AKTA 1WLCA 3A7QA 4LA2A 5JIAA 2RJKA 5BYNA 2ZAHA 1OVSA 1US2A 5C3PA 1Y3TA 1VBE1 4JGZA 3T4HB 4A6SA 3NJZA 1COV1 3IB3A 1WW7A 4ZZ5A 4HBNA 5KXDA 1E5RA 1UF2C 2D6LX 1JYCA 2XLFA 3GM8A 1PZ9A 3VHNA 4EE2A 1BCXA 3AXDA 4Q4W3 3VBRC 1TG7A 4XPVA 3Q8AA 1G8WA 4YVSA 5ABJC 3JD73 4CCCA 5JPMB 3QBQA 1UMHA 3FUOA 4WM7A 2D43A 4XDOA 3FX3A 5BPXA 4HFSA 2ZABA 2OS2A 4X6QB 1VMJA 1A8DA 1H2KA 5FXWA 1Y9GA 4AFMA 4H7LA 4P9JA 2Z2SB 3H42B 4B29A 1W3XA 4YVWC 3WG4A 4EZHA 2YHJA 2BZDA 2DURA 4CUCA 1MS0A 3I3DA 4MOAA 5CFDC 1O3TA 3QH7A 2A75A 4OZXA 3ZIXA 4RQPB 2FMYA 3K3NA 5CAZA 1UCXA 3NVCA 3POSA 1G7YA 4A45A 1AR91 1U5YA 4B4QA 2WDBA 1W8FA 1BZWA 2ZKLA 5DUWA 3UJQA 3H9AA 1KD7A 3KV4A 4LLOA 1O6UA 3E1F1 4X6RB 1OD3A 5EHDA 2W9XA 2YU2A 3P5BA 1RUC1 5J37A 3WCRA 3LKJA 2DVBA 4WVVA 3BYWA 4FPGA 4QM9A 3VBUA 4OHZA 2WL1A 3H1YA 1WKYA 1EUUA 1JZ5A 1W2NA 3NV3A 1JU3A 2VVFA 2WO7A 1PGSA 4XFIA 3T0AA 3BOWA 1LOGA 1WUVA 3NV4A 3ZXLA 1EV12 1NOVA 4JX0A 4R9DA 1ZZBA 2ET1A 3ETQA 2WT0A 4QB1A 1R083 2D5HA 1NT0A 1UXXX 1YJKA 4QQ2A 3K4ZA 3CNAA 4N90A 4UFIA 4QX2A 2WS92 1BEV2 2GNTA 1ASJ3 4PLMA 1AR73 2XVKA 3H8RA 4MADA 1S0CA 5T5OA 1C5IA 1ZM1A 2JG9B 3T3YA 3SEPA 2W39A 3AK0A 1N1TA 2EXIA 3M1HA 5JMOA 4HXCA 4RD7A 4Y5Z0 4IEQA 3R6SA 4AEMA 3EMRA 4IV3B 5LBEA 1AR72 1RL3A 1RTVA 5F1RA 3IIAA 3VD5A 4MGTA 2GAUA 3R05A 5JXGA 5GZDA 4MGIE 4FTBA 4LBOA 5FOBB 5DG2A 2EIEA 2C9KA 2C1FA 4M00A 3C7OA 5IVBA 4YM2A 4Z2WA 4GWMA 5FZCA 2VO5A 4LK7A 5GLZA 3KV5A 4COZA 4PDWB 2OA2A 2BV4A 1CX1A 3H8UA 1R64A 4QQLA 3RYRA 4XIKA 2B5HA 1X36A 4P5YA 2P34A 3ZYGA 4OHVA 4K8RB 2HWC1 2WS91 5HXMA 3G6JB 5JR2A 5KXEA 4Y5SA 1MEC2 1MQTA 2QQIA 3GDBA 5FWEA 2B39A 4WZCA 2B8MA 2Y26A 4PBOA 1DZRA 3I3BA 4UF0A 2ZX4A 2VL4A 5GLUA 3M3QA 1AUYA 1E5SA 2VGDA 4D6QA 3LEIA 4QXCA 4KGGA 1GNYA 4LBQD 1W6MA 3WZ1A 2WZR1 5IAVA 1KRIA 1SACA 3U10A 3ACFA 5C4WC 1REEA 4NR1A 4EQVA 3OTFA 2VZRA 5APAA 2P3JA 4LQRA 4LE3A 2SBAA 3M3EA 1OFSA 2OVUA 3RFRA 3VL8A 3AVSA 2VMGA 3MDPA 5ERLA 3VBOA 2WYSA 2WFF1 4Q8LA 4BH9A 5IFPA 1SPPA 1FNZA 2XDVA 3ZFGB 4DOUA 1HDKA 3MEPA 5F7UA 1RUH2 2MPFA 4TSVA 3MIEA 2RG4A 3GALA 2PAEA 3N9PA 4XACA 3VZNA 2DUQA 4CDXB 3AP7A 3WP3A 4O61A 5FUIA 1XOYA 4NHXA 3PL0A 5L9VA 2VE1A 4EN9B 3LEMA 1XE8A 1SCSA 2RS51 3KF5A 1UD1A 5A3LA 4X8NA 5CVRA 4HANA 1OPMA 1GOHA 2B46X 3VDDB 3DGTA 1DQ4A 4YGCA 5JVVA 2RR11 5FYYA 1BK0A 3NAPC 4ORFA 4YZ2A 3ZYFA 3AP5A 3ZXAC 1S2BA 1FYUA 4XFGA 3ZSKA 3LSEA 1I5ZA 2VTXA 4ZY9A 3K3OA 3S0MA 1N3QA 4HN0A 1ZRDA 4MYEA 4JDMA 5BNOB 1ZYBA 2G9ZA 2VULA 3A0NA 3ACHA 3THTA 2JX9A 1XNAA 3OGJA 4IE5A 3UKNA 3Q8BA 2A3WA 1F9KA 2GDFA 3GCXA 4I3PA 2XXZA 2IFWA 1FMD1 4FPYA 1FAYA 3EBRA 4Q4X1 5JZGB 5FZAA 1VBE2 3C3VA 5DAWA 2XWJB 4RGKA 5FPLA 2OUHA 3SCGA 4AI8A 1ENQA 4CU6A 2PLV3 1RUI3 2WO2A 2CGPA 2RE9A 2X5IC 4G4FA 1S0EA 4LULA 2ERFA 2W52A 3CJIC 1EPWA 2D93A 2ZX0A 4QPWA 5J3UA 3D3AA 1NE4A 4A41A 3IDBB 3GGLA 3PHMA 1D7PM 4ATFA 1QQP2 4L97A 4EROA 1ENSA 2RR12 2ZHLA 5FK8A 2XJTA 4LOTA 1JXNA 4PI2A 1H0BA 4OUMA 4XUOA 3CQOA 4QKBA 4CUGA 3WOGA 4GWIA 4F8AA 4U2AA 4BYYA 2WWSA 1GMMA 1SBEA 2J1UA 3H7YA 3LFIA 2DCZA 4MSVA 4RR3C 3WDXA 2WINB 4JGYC 1C1FA 2DCYA 1WWYA 2A73B 1NAEA 3J7LA 3OBRA 3OOXA 2WA4A 4IEVA 4XJZA 4GMP1 3RSJA 4CTEA 2NN8A 5ANNA 4AG4A 4K8FA 2YU1A 4EYUA 1F4HA 4IEPA 1KGYA 3VBRB 4AVTA 2CGNA 1CJPA 2ZGNA 4JGZC 4OULA 1UNBA 2VZ3A 1V6JA 3UYJA 5CB7A 1AL0G 5I0RA 2HJIA 1UU4A 2VQ0A 3WR0A 4Q4V1 3FC0A 4LKEA 4E8DA 5DABA 1PO22 3HJRA 4IUGA 1JBCA 1OSGA 1XNKA 5F3IA 3GZTB 3ILFA 1R082 1BQPA 1OA4A 2DDUA 4XFAA 4E4SA 2P3IA 5JUVA 1TMF3 3DPRC 2DBIA 1W99A 2A1XA 5A3TA 4UWDA 3URFA 2X29A 3I4IA 4HZFA 4RFT0 1ND3B 1OLMA 1AYM2 2QZ2A 4H14A 4P08A 2LW8A 2R0FA 4E8CA 1R091 5CKMA 2MEV3 5FJHA 4NROA 4YM3A 1WMDA 4BWOA 2JXAA 4I09A 3USUA 4FVVA 1S1AA 2VUCA 4MGYE 1AYN1 1LOFC 3OBTA 1O8SA 5FZDA 2D6MA 3VDCA 2JDMA 2V73A 3JBG3 2OZ6A 1J3PA 4PLOA 2IXHA 4M3CA 4YZ4A 3D82A 1K12A 2XLGA 3OPWA 5DXDA 3RYKA 5IT6A 3O0XA 3WW3A 1QNWA 3B01A 4XQWA 4RYDA 2JDYA 3CU7A 4GJZA 4JKLA 2IFRA 5H9PA 5JZGC 5EWSA 4P02B 4DIQA 2Y6JA 2GALA 2P5BA 2WKKA 3RZGA 2VC9A 2X53S 1TME1 2XVGA 3ZPOA 1HJFA 3ES4A 2XLAA 1F4AA 4Y20B 5D8AC 1S0FA 4HONA 5J48A 3S57A 5JDBA 5K0UB 5DDJ1 2YG0A 4WZFA 3VBHA 4Q0PA 3USUB 3AKRA 4S2HA 1MS5A 1TE1B 4UFHA 1GANA 1GSLA 3RMYA 2V4AA 3NNLA 3GJAA 2X5IB 5L9BA 4YZ5A 5JMCA 2R063 2QDNA 4QWNA 2GP5A 4XZUG 1I5PA 2BRTA 1S0IA 1OA2A 3JU9A 2P1BA 4HN1A 3O5SA 4A42A 1KJRA 3DYOA 4L9BA 5T52A 3BU7A 3FLRA 3WINE 2E7QA 3KZ4C 1YLLA 1C8M2 3ILRA 4R4ZA 4BOWA 1V9U2 3GZAA 1PIV2 2XH6A 3T4VA 4YFZA 3CL1A 1Q8OA 2Y6LA 1Z7S3 2DVFA 5FXXA 1CVNA 1PGW1 4ZKTB 4MXWB 3IM0A 3KT4A 1RMU1 2JJ6A 3CHXA 5D1IA 1WCSA 2CU5A 3SCHA 2GC1A 2IUWA 1XYOA 5JOWA 3TWIA 3N9LA 1Q8PA 3M7AA 1XRUA 2HLEA 4CU9A 5JR7B 4OI2A 5C4WA 5BNNB 1WMEA 1WBFA 1C3HA 1H4HA 1UQXA 2FBEA 4OI4A 4I0BA 3T0DA 4YW6A 4GZ9A 2LROA 3WNXA 5L19A 5C3OA 4QHOA 5KHGA 3WSOA 1ODMA 4P14A 4LXLA 1FOD1 2J1TA 2BFUS 2VOVA 3H1MA 4QXKA 4R52A 4DUWA 1ALYA 4D94A 3FBYA 1VBD2 4XUTA 5C71A 1AX2A 2RS11 1BVVA 2RV9A 2YUEA 4AHWA 3AMNA 3VBSC 1K5JA 1WLDA 3O0VA 4CU8A 1MVEA 1LGBA 4FXKB 3ST7A 4YARA 1BXHA 1MEC3 5FO8B 3H8XA 2BGPA 5J7MA 4QX3A 1QXRA 4XDPA 3WNNA 1KS5A 1CD3G 3A4UA 5E16A 4AFAA 4NAOA 3JD72 3WXPA 4XZPA 1ENRA 1W6OB 5IVVA 3TN92 1F15A 3Q8CA 2PHDA 5FBJA 1PZ8A 4B8EA 3TEXA 2DF7A 3J9SA 4NRMA 2WQ4A 1UW8A 3BCWA 4AVSA 3OBAA 4MX3A 2XPJA 1LODA 1W8NA 3OY8B 3VB9A 4BMBA 1NCRC 2AGSA 3E5QA 1J58A 3HT2A 4AEDA 4GB33 2WNVC 1JOPA 2EA7A 2VOTA 1JZ4A 4DUXA 3KGLA 5A32B 2XBO2 4RR3B 1ZA7A 5FQ0B 1DBNA 1ZBA2 3VKMA 4YG6A 2ORXA 3GHNA 3H3LA 4COUA 5I0DA 3WG2A 2WNVB 1H6XA 4HKLA 4A7ZA 2CNAA 3LQCA 4LUMA 4FFGA 1UY1A 4QMAA 1Q8VA 4B1LA 5AFEA 4Y1ZA 1VAKA 1IKPA 4XBLA 1W9SA 2TEPA 1X9TA 2R062 4P9IA 4CE8A 2O8QA 5F32A 5DAXA 4FTSA 3QACA 5CG9A 1QQP1 1AR82 2CDPA 3SNMA 3VD7A 1LAJA 5FZKA 2HEYF 4I30A 1GFF2 3PDQA 3PVOA 5SV8A 4CU7A 1RUG3 4CCMA 2BNOA 2QBXA 3IAPA 3VHPA 1YFWA 3H7JA 3PUSA 1H8TC 1FPN3 3DECA 5FMOL 1HRV2 4LIVA 2JEMA 4Z2AA 1LHOA 2B7YA 2IXLA 3HD8B 4IERA 2E32A 3ZFGA 5FZLA 1W6PB 2HEWF 1IKQA 1QXPA 5I0SA 1ZX5A 1IOAA 1RMU2 3ORJA 2H0VA 1UXZA 2P6CA 4N9IA 5FY1A 5T5JA 4DXSA 5JXHA 2Y6KA 3HQXA 1KFXL 5B4NA 2Y38A 1NZCA 3MIBA 2ZGPA 4KWLA 1L7QA 2VZOA 1PK6C 3O1TA 4XJAA 1PMIA 3BODA 2EALA 1PX3A 4M01A 2WQZC 2EXKA 4LBKA 4W6WA 5ABJB 2WO1A 1VLNA 4CP1A 5DMYA 1UPSA 5F2WA 1PO12 3D0JA 4XHXA 5J98B 2NQYA 2D97A 4LEJA 4MG2A 4CDUA 3POEA 4K20A 5L7OA 2W95A 2K9ZA 3ASIA 3DPRA 1GR3A 5T3NA 4D7SA 3IBMA 1X8EA 5E8AA 4P9XA 4LO6B 3U11A 5FP7A 3VBHB 1S4CA 2B4KA 1IS6A 5A1AA 2D7FA 2DUPA 2DTWA 4HOOA 3V0BB 2W46A 3AP6A 2ZGSA 3GBGA 5L9RA 1DCSA 1R092 4R9CA 4IXLA 4XFFA 5FZOA 5EJ3A 3U78A 1WLTA 3KT7A 4GD4A 4G9SB 3AMQA 3RQ0A 2J22A 4CCDA 3GBWA 5A7SA 4DNYA 1GZCA 3HNMA 3HN3A 4LBQB 4QPGB 3H8OA 1A34A 1H1AA 3SMHA 3VKOA 2V5YA 5F5QA 2Y34A 5BNOC 2VMFA 2ZMKA 4GB31 3LIGA 3HMYA 1SLLA 2VNRA 2XMLA 3WNPA 5BUVA 3OG2A 4RFRB 5G05L 3KD4A 1J3QA 1OI6A 4XQ4A 3I8TA 2KA3A 5G04L 5IK8A 3GNEA 4AEJA 1BYHA 2QQWA 1RYYA 3W59A 3J7HA 2J42A 3ENRA 1CQ9A 1PO13 1YEWA 3ABZA 3DPRB 3ZSLA 4D69A 5FY0A 4Z1VA 3K77A 4DFSA 1XB9A 2WZR3 1NE6A 1YRZA 4BISA 1F2NA 4YVWB 4A6OA 4QX5A 1DP0A 5LRSA 3DXTA 2RHPA 5JSRA 4JDNA 5B4XA 3TEZA 3LOBA 3FE5A 2I07B 3I2FA 4Q1RA 4UW5A 5DN2A 1JZ2A 5CEHA 2YPJA 1UOFA 4Q4X3 4RS5B 5FY8A 3VBSA 3N7MA 4A7YA 2VQAA 1UMZA 4YW3A 1NXMA 5A7OA 4GA9A 4IGQA 4META 4WM7B 3FBMA 3BOPA 3OEBA 4S2DA 4YFWA 1JUHA 1W6NA 3JXSA 1POQA 5FP4A 2IXJA 5J36A 2FDHA 2Q8EA 1C4RA 1ZRRA 5IYYA 2ZGQA 3L2YA 4WVMA 5LZ6A 3AMPA 2DYCA 2OT7A 3IT8A 3N35A 1EAH2 2O1QA 3U4XA 3KS7A 3BB6A 3C2UA 4KMQA 3TYJA 4AXOA 5A3MA 3DV8A 2MHFA 1W2UA 2PHLA 4DEQA 4EN6B 3DXUA 5I8SA 1J3RA 3ZSJA 2YY1A 3ECQA 1XSRA 2Y0IA 2V09A 1UZ0A 5EJZB 3WNMA 3ZR5A 2RM22 2PQQA 3SH4A 2K2SA 3RZLA 1PNGA 4FPJA 3D4KA 3M2MA 2HYXA 5HBAA 4AVBA 1KFUL 1BVP1 3AP9A 5DUUA 1CWPA 1N1VA 3AL5A 2ATFA 2WA3A 1LGCA 1YJLA 4N43C 3VBFC 1UOJA 4IE0A 4XE9A 3PJQA 4CP0A 4K1YA 5HV0A 4HVQA 3E6CC 4F83A 2W91A 3NJYA 2QUOA 1LU1A 1UWWA 1W8UA 2XUMA 3QLQA 1HJGA 3AB0A 1YI7A 1OLME 4D6RA 1ENXA 1LOEA 1QU0A 3DUIA 1N1SA 3CMGA 4P9LA 3ZN6B 3MHZA 5CFCB 3LCPA 1V6IA 4TXWA 1XNBA 1C8NA 5FR3A 1QGLA 1DYPA 2Q8CA 5C3RA 3TNPB 4LITA 1AR93 4HG6B 4TN7A 2YBKA 3NNGA 2DCTA 4GXLA 1MS1A 5FZ9A 1BBT3 4ATEA 4AFDA 1JZ8A 1GV9A 3ZYHA 1NLRA 2VOKA 3LIHA 5DUVA 1RUE3 1SCRA 1VP6A 1LHWA 3AJYA 1STMA 5F8PA 5JI7A 3I2KA 1L3JA 4LHLA 4FPCA 1IHMA 4V2VA 4ZHNA 2JE9A 1YQ8A 1LU2A 3VZMA 4NIAA 1SPPB 3BALA 2F4PA 2WWUA 4N53B 3LA2A 5KHIA 3T0BA 1D4M3 2AZ5A 2IZWA 4XDQA 1G9DA 4E4DX 4CYDA 5C3SA 3KWVA 3WDYA 1GOGA 2N7GA 2Q0AA 4KGQA 3I59A 4QAWA 1TNRA 2L9LA 4Y33A 2WZPP 3HEIA 1EAH1 5HCFA 1ZRFA 1RJ7A 5GLTA 1ASJ1 1W0OA 4JV4A 4W6XA 1KJLA 1PMHX 2QNKA 1K45A 1VAMA 2HWC2 2XVLA 3AKPA 2QQLA 5DAQA 4UXAA 3T1LA 2VMCA 3SC7X 3BUCA 4AZZA 2W2IA 3ZSMA 2AR6A 4XAAA 2PAKA 2F6BA 3ZXJA 1GICA 1B09A 4XVHA 1CJDA 3SH5A 2ZACA 4DY5A 4M3CF 3CJIA 1N47A 1PO23 5TSWA 5HCAA 2ZEWA 1JYNA 3NSTA 3PTRB 2WIIB 4AI0A 1PK6B 1VBA3 3I2JA 1XNCA 1IPJA 2VZVA 4OI1A 1GZWA 2Q8OA 1NCQC 3N7KA 5ACA2 3UV9A 4NIDA 1RUD2 1F5JA 1A3KA 3MBWA 3OCPA 3OY8A 4GAZA 4HMZA 5C4WB 4XF4A 4AL9A 3MLJA 3PIGA 1G9CA 2PXJA 2HH9A 2MEV2 3JBG1 3MO4A 4KU7A 3MLLA
chains in the Genus database with same CATH topology
3ZIWA 3VZLA 1AYN2 3VKNA 2R16A 3ZFGC 4B3NA 5JOZA 4YVSB 4K21A 3ZXGA 4CDXA 2BYVE 4Q0SA 5T54A 5JI9A 3LSDA 4HSJA 3NAPA 4AGGA 4ITCA 4I02A 4LT5A 3VZOA 1OLQA 1AR81 4FOQA 4AI1A 3PVBB 2NP0A 2Z69A 5BV6A 4FPEA 5JSOA 2C5DA 3OYWA 4IQPA 4WVZA 2R073 1ZREA 1O4YA 1EY2A 1WLWA 2RS13 1RHI2 4CDUC 1PHMA 2BVVA 1RUE2 2D6NA 4Z82A 4SBVA 2BGCA 4TLFA 4Y4YA 1Q3EA 1W6QB 1RJ8A 2HWE2 1YFXA 4FP3A 4LBNA 2ZBJA 1AR92 2ZPXA 2VY0A 4KG0A 3S7EA 1Y7BA 1VALA 2IXCA 4NN0A 3WDWA 2TBVA 3WX5A 1PVC2 4AHZA 3MYXA 2VMHA 2NZ9A 3A0KA 5EV7A 1ZBE3 4J1WA 1OMIA 1S2KA 3WT3A 2LM3A 3EJKA 5GZEA 1IPKA 1V00A 1XXNA 3B9CA 3ZXFA 3AZVA 3FJSA 3QH6A 1RUJ3 3KCXA 4JCKA 1CAVA 2UWAA 1WW4A 3MIFA 1WMFA 4BA6A 1AHSA 3ZFEB 4RQPA 5FREA 1POV1 1UU5A 3VHOA 3AMMA 1BMV2 2ZHKA 1S0DA 1BK1A 2HWD2 2MEV1 4MXVA 4IV1A 4O9EA 4LBQA 4QPGA 3O0WA 1QF3A 3ZDSA 4CDXC 4CZSA 1VB4A 2XJRA 4EN8B 1AYN3 4Z07A 1KITA 4MVTA 4UW3A 5HCBA 2FZ2A 1R081 5FCCA 1F8VA 5AC92 4GH4C 4COVA 1ULEA 2ZTNA 3R4SA 1NQDA 1HXS1 1C28A 1QNYA 3AM2A 1C57A 1DHKB 1BKZA 5GZCA 1K5MC 1HRV3 1H1IA 1VBA2 2G4IA 4E27A 3JUUA 2IXKA 1SFYA 3W58A 2XBO1 4ZU7A 4LBLA 1ZRCA 1HQLA 3U07A 1DGWX 1B35B 5I91A 2HWF3 1QOOA 1ND3C 4I2OA 3CEWA 4N7IA 1BMV1 4LO7A 1RUH1 2ZGLA 4XJWA 2CTVA 4LA3A 4IL7A 4N53A 2DVDA 4H3WA 3W9AA 1BJQA 4IEOA 2OYZA 4XYXA 1DU3D 2PN5A 4DRVA 3K48A 2E7AA 1C1LA 2FQPA 4KNCA 1LHNA 5I0TA 4X8PA 5D8AA 1QJY1 2VMIA 4N53C 1MACA 4HETA 3VL9A 3UJOA 1XNDA 1PGW2 1CAWB 1CN1A 1LR5A 1UL9A 2E63A 4JGYA 4DZGA 1VBD3 4JGYB 1GZ9A 3FLTA 1ZBE1 1MS3A 4FBFA 1H2MA 1KS4A 5KC6A 1QJX1 2JENA 1FMD3 1J59A 1W6MB 4IV3A 4J6GA 1EPZA 4QGNA 1LENA 5FPZA 4AHYA 2E7TA 1VBB2 2GSYA 1LRHA 1AR61 4GH4A 1AX0A 1HRI1 2CV6A 3ZFEC 3D6EA 3ZYJB 1CAXB 1AL21 1LOBA 4AEKA 3ELNA 2ZMLA 1OFNA 3WP5A 3L9JT 4Y1UA 4AF9A 1R1ZA 1FNYA 3AZWA 1JUIA 4EWAA 3HBZA 5IK7A 1C8M3 4ES9A 2JG8A 3TB0A 3H3UA 3LWCA 4KBBA 1ND2C 1U0AA 1S0GA 2XG3A 3PMEA 2AYHA 2QZ3A 3ZXDA 1QDCA 3RJ2X 3D5OA 4I0WB 3BIWE 1OKQA 3LGRA 5JOYA 1YO8A 4NO4A 2WNUC 1VB2A 4XF0A 4XXAA 1GZWB 4NPRA 3M70A 1GKBA 3VZJA 4AEDB 1LOCA 1AR83 1XE7A 1RB8G 1OA3A 4CDQB 4ASMB 4MGZE 2NYYA 4AVAA 4PBPA 2JECA 2AREA 4RL7A 2D3PA 2PAMA 4XF1A 4FPLA 3JBG2 1I9RA 4Q0QA 1O4TA 1SLCA 5C9AC 1EV11 1LOAA 5KXCA 2VNOA 2XJQA 4XTPA 4XXPA 2Z42A 3WDVA 4MLOA 3EO6A 3KM5A 1W0PA 2H6CA 1MQTB 4C1XA 4PIZA 4Y1XA 2G9FA 2CL2A 2WNUB 4GQ7A 3M8LA 1AYM3 1IS4A 4CDUB 1D4VB 1CONA 2DCKA 2YXSA 4QU2A 2BQPA 2GN7A 4V1PA 5BNPC 5GZFA 5LK7B 1CPMA 1QWRA 4CDQA 3IKWA 3DN7A 2JG9C 2DVAA 2Q1MA 4YGDA 2RS31 3BTAA 1RUF3 5FQ0A 2DVGA 4IEWA 4W6YA 3HIFA 4XJ8A 3WW1A 2AH2A 3GHMA 3ZXKA 1XU1A 4NVPA 2ZX1A 4CEYB 1AYM1 5AC91 1VBE3 2CAUA 1J1LA 3RG0A 1QJZA 4E2GA 4P9WA 2PHFA 3O14A 1M06G 4Q0UA 3POYA 1ZVFA 1EYBA 3CJIB 1OLRA 3ZYPA 4Q4W1 2WLPA 1COV2 2DFCA 2BWCA 2GZWA 2WC2A 1S55A 3HR9A 2JICA 4J1XA 2EIGA 5GLVA 3NO8A 1ASJ2 5B2GB 4XIOA 5DG1A 2R061 1XU2A 5K0UC 4M0NA 4XHBA 2HWC3 3WUDA 2GNDA 3POWA 3WVJA 3M3IA 1QH7A 1X8MA 5FMOS 4AVCA 3M4FA 5JOXA 5GM0A 3GZUC 1QXJA 3LA3A 2XJSA 2A6ZA 3TOJA 1DZQA 1NY71 1RUH3 2KM2A 4GULA 4K7JA 4JQRA 2UYBA 5LEKA 4D7TA 5DDJ3 1ND3A 3MIGA 1YIFA 2WT1A 1BEV3 2ZAAA 4LO8A 4BLJA 1RITA 1PIV1 2XHKA 4AEDC 2IXIA 2UURA 2HWB3 2ZGOA 1TME3 4I0AA 4OI0A 5F6LB 4WM8C 4AVVA 3OJBA 4K1ZA 1ZNPA 4YVWA 1LKNA 4PLNA 2WT2A 1ZZCA 4DB5A 2A6VA 2XJVA 1VRH1 2H0BA 2R1BA 3V65A 3WP4A 5EYXA 2PHRA 3PLQA 5CFDA 1LGNA 1CAUA 2PHXA 2R49A 4PDWC 1NXD1 5FAXA 4M3CE 1QJX3 2D98A 2R071 5GZGA 4GB32 3RPQA 5FO9B 1RUI2 4HLTA 3HT1A 1AXKA 3ZN5A 3KCCA 1PIV3 4ES8A 1G86A 4PIXA 3JCIA 2D6PA 2RS32 2ET7A 3IWZA 4WM8B 3PNAA 1QJU1 2JDZA 1CAVB 3ATGA 1PGL1 4XJUA 4MXWA 4GMP0 4LUKA 3OF1A 3J8F1 1Z7S1 3FZ3A 1MS8A 3RI9A 1H8VA 2QKDA 1DF0A 1HV1A 1MZ5A 1GQHA 3FMGA 1ULGA 4AQ2A 4XFCA 3MZHA 1PNFA 1R1A1 1ZZ9A 2NMOA 2VXRA 4Y24A 1N3OA 1PVXA 2R043 1DZTA 1OQDA 1MEC1 4XMAA 5EXOA 2GMPA 5KC5A 1QJX2 2P3KA 4O9GA 4Q2FA 1NCRB 1QJY3 1O3SA 5CFCA 2XWBB 1A8MA 4EWEA 1SLAA 1O3RA 4RA0A 1N3PA 4W65A 3ZYRA 3LOIA 1COV3 4PQ9A 4BIOA 2JG8B 1Y43B 4Y22B 1X7NA 2BBVA 2R0HA 2HEVF 2VOWA 3E97A 3VBOC 1TME2 4LE4A 1VBB1 4EN0A 2BWAA 2VECA 4BIFA 4QHBA 1R1A3 3I7DA 1TEIA 2E53A 4FP2A 4RHV1 1UZYA 4YYOA 5EYYA 4AGRA 2P17A 1OOPA 3J4UH 3LAGA 3VBOB 5BNOA 2ZKNA 3AP4A 1LB2A 5CADA 3VBHC 4JRLA 3HN1A 2R32A 5C8CB 1FATA 3U0ZA 1UIJA 1CESA 1GBGA 2XKOA 4BZ4A 2R042 1DGRA 1UKRA 2ETEA 3EHKA 5DZGA 4CEYA 3ZFFC 4G3YC 4GKXA 1UN1A 1HRV1 2WFF3 3UK9A 4MH0E 3AZZA 1YIPA 1RUJ1 2PTMA 2DTYA 4Q8KA 2PHUA 5J09A 4HT1T 1RUI1 1KDKA 4GIQA 4JVAA 3MPBA 2ZS6B 2FZ1A 4DQAA 4E2QA 1V6LA 2W08A 1H9WA 5E88A 2LALA 3CO2A 3T1MA 3AX4A 2ZHNA 1ZZ8A 4OHWA 4C91A 3OD4A 5C8CA 2CGOA 3ZMNA 1YYNA 1LOFA 1YFUA 4E4ZA 2OPKA 2HYKA 1WW5A 3M3OA 3TBDA 4TZDA 2BPA2 1DLLA 2VPVA 1RUNA 3ZFFB 3LZZA 1WA4A 3RMXA 4B4PA 4FOYA 1QY4A 2E9QA 3WY6A 4XBQA 3I54A 4Q4V3 3KQRA 3VKLA 1LHVA 1V6NA 3MPPG 4L8QA 4QM8A 2VW0A 4HPKA 1VBD1 3WDTA 4QT6A 3OYWB 5JSPA 2GMEA 2VOXA 4A3XA 1AL23 4B7KA 2PHTA 5H9SA 1SBDA 2PLV1 1OOPC 3WUCA 4D3WA 2AENA 1HIXA 5I8TA 5FOJB 4Q4Y1 5GKAC 2XJUA 5IUQA 4JAAA 3V0AB 4HK8A 5FO7B 3CJXA 1REFA 3KSCA 1FXZA 4YZ1A 4FCAA 4LR4A 4FAHA 1DIWA 2C0ZA 3S7IA 1D2SA 1QKQA 4HL0A 4RR3A 5KHJA 1A78A 2A6WA 3SHRA 1YNAA 2FHRA 1SBFA 2PA7A 1JN2P 5KBFA 4YGBA 1W6NB 1JHNA 2ZCWA 4YVSC 5ABJA 1WD3A 2D3RA 4Q4W2 4IEXA 2PELA 4AI3A 2A3YA 1HQNA 4WM8A 4FSJA 2GMMA 4MGKE 1Q5OA 5FTTC 3LB9A 2FMDA 2ZGUA 3I2DA 2HWD1 3THPA 1A6CA 1BBT1 4BCUA 1WCDJ 4ASLA 4K3UA 1DQ2A 4B7EA 3ZMOA 1VAVA 4R8HA 3S6PA 1CAUB 2DU0A 1ULCA 1GQGA 3B5LB 3J8F3 4BLIA 4PDWA 2H6BA 4EV0A 1V6OA 2GC3A 4DS0A 3RJRA 1O7FA 2GNBA 3JZVA 3IPVA 4AGVA 3NKGA 4FPKA 1TMF1 2B45X 2DCJA 2I45A 1LESA 2JKBA 4HKWA 1HQWA 2DUOA 5T50A 5AVAA 1NG0A 3OGGA 1GLHA 3H3ZA 1RVF2 4IEZA 2E51A 5BNQA 2YROA 3HWJA 1SQ4A 4R9BA 3VZKA 4NHLA 5CFDB 5LRRA 1VR3A 2SLIA 1PVC3 4BMEA 1CR7A 3ILNA 4CDQC 1YXWA 4SLIA 4BM8A 4XFBA 5D8AB 3WQ1A 1VBB3 4Q0VA 3WG3A 1AR71 3O12A 3G7DA 2D40A 4FQZA 1Q43A 3B93A 1RUOA 3MW4A 3AYCA 2WLQA 3AKQA 4OHXA 3RDIA 3ZPYA 4Y20A 1VBC1 1POV3 2WFPA 3E6BA 1E57A 1OQ1A 2EAAA 4KL1A 3SMHA 1O5UA 1CPNA 2G9GA 1XYPA 4OLLA 1QHDA 4PJYA 5JIUA 5H9QA 4IEYA 3WLUA 3WV6A 2XKPA 2ZMNA 4YM0A 1JYIA 4AK3A 4OHYA 3EQEA 4PIYA 1LCLA 3VV1A 1H2NA 4AFCA 1IS5A 1RC6A 2X5IA 2Q4SA 3KGZA 5T5LA 3RWNA 4BHPA 2GU9A 4HK9A 4AQ6A 3SCFA 4URTA 3VBUB 5JZGA 5K8SA 1H4GA 1JW6A 1KXGA 4CDWB 1MZEA 1Q8SA 3RYPA 2EAKA 1D4M1 2ARBA 3ZN6A 2RS12 3E5UA 4AE2A 1BBT2 2EXJA 1DQ0A 4FPOB 4IV3C 1AX1A 1U12A 3AXEA 1UZZA 1QJY2 5DUXA 1W6OA 4L99A 3EXUA 2NLRA 1RUJ2 1NY72 1G6NA 1OHFA 1UAIA 1H9PA 2YC0A 4UW6A 1W6QA 3MIDA 1VRH3 1JH5A 3TN91 5F6KA 3AMHA 1H30A 3SH3A 1VIWB 2R6QA 3KT1A 4H7MA 1LEDA 4CEWC 1V9U3 3TNQA 5A32A 3HAGA 5C8CC 3H1WA 1UX6A 3TRSB 4YGEA 1NCRA 4RGGA 1SLIA 2ZHMA 2WNVA 1IGOA 2EVXA 4CRQA 3TAYA 1G9BA 1W39A 1HXS3 4Q4Y2 1H8TA 2NM1A 3P3PA 2TUNA 5DZFA 1FV3A 3N7LA 1RUF2 5JLVA 2D3SA 1O3QA 1Q8QA 4KG8A 3VDDC 1O4ZA 2RR13 4YW5A 5FFOC 2A71A 2O8OA 4YW4A 1HV0A 1B35C 1DGWA 1QDOA 4WV8A 4KWKA 4B4RA 1VBC2 1NA1A 1URXA 4ZU4A 2LUWA 2ILMA 2GNMA 3NAPB 3V56A 2ENRA 4XEZA 5ACA1 4C0HA 1RUC3 1FT9A 3H0OA 3ME2A 4RHV2 5BXXA 3SXWA 3DF0A 1H2LA 3B94A 4HPKB 1KDMA 4YW1A 1RHI3 4Q27A 3MF9A 3N36A 3NV2A 3AZXA 3USSA 1DGLA 2RS53 1GYKA 1PK6A 2W0XA 5KXBA 3AJZA 2CYFA 2HKXA 4H55A 4JGZB 4LBJA 3ZFEA 5AVPA 3WP6A 1DQ6A 4A2UA 5I0UA 2UWBA 1ZZ6A 4OVEA 4QPIB 1RUD1 3AYDA 2XGXA 3UKVA 4QPIA 5I93A 1RHI1 4QPYA 1AR63 3GYDA 3KMHA 3TN93 1UU6A 5JAXA 3JB8A 4DY3A 4K6BA 4N7UA 3WHUA 3X29B 1V70A 3RRDA 1MS9A 1LJ7A 1Z0HA 3RNSA 1ULDA 1RVF1 1XQNA 2HWE3 3QCWA 3RZZA 5K9YA 1ZZ7A 3KLSA 1YFYA 4P9GA 3AFGA 1HW5A 4AYUA 3BPZA 1NYWA 3MLKA 4WBBA 2PYTA 4AHXA 1BEV1 2ZGKA 3MF6A 1T6GC 2ES3A 2RJLA 1CIWA 1RUD3 3P3NA 4C90A 4QQOA 2WNEA 4RS5A 3VBSB 5AFBA 3AYAA 4M3CB 1VBC3 3UKTA 5C9AA 2UU8A 4QQHA 4XJ9A 4ISQA 1HRI2 3PVNA 2VW2A 4RSUA 4QPGC 3CLPA 2TNFA 4XTMA 1PZ7A 2OIIA 4KWJA 4RGAA 4LO5B 5I8YA 2YDEA 4GALA 4KU8A 4R9AA 1TNFA 1MZFA 1OD5A 2R1DA 1QJU2 2RMU3