2R1DA

Crystal structure of rat neurexin 1beta in the ca2+ containing form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
GHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of Neurexin 1beta Tertiary Structure and Ligand Binding through Alternative Splicing
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion, splicing
molecule keywords Neurexin-1-beta
total genus 42
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, W
ec nomenclature
pdb deposition date 2007-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r1dA00
3T1LA 2EXJA 2GMEA 2V73A 1GZCA 4H55A 3U4XA 1LGCA 3VKMA 4U2AA 4ATFA 2ZA9A 5E88A 3AZYA 3WV6A 1F5FA 2WT2A 2I2SA 2GNBA 3D5OA 2D7FA 3WDYA 1CPNA 1W6MA 4K1YA 1QGLA 4AVSA 5EYYA 1PZ7A 3N7LA 1GBGA 2WLQA 3FFZA 1VALA 2NMOA 3PVNA 5GLWA 2KM2A 3BODA 3V0AA 4FPKA 1S0BA 2P3KA 2ZHNA 4BMEA 1QOSA 1KJRA 3IN9A 2ZACA 4YM2A 5IT6A 1JYIA 1Q8SA 2A3WA 3AK0A 3ZXJA 4TZDA 1C1FA 4XBQA 1DZQA 4FVVA 2ZAAA 4NO4A 3DUIA 3RMYA 4ASMB 2EXKA 3DGTA 3SH3A 2EAKA 1VAVA 1W6OB 1KRIA 2CYFA 2UU8A 1AVBA 5T5JA 3MW3A 1LHNA 2NYYA 2W68A 3RG0A 3RS6A 3OPZA 3N7MA 3D6EA 1JOJA 4GWMA 2GALA 4MYEA 5GZCA 2ZHKA 1WW4A 3VUOA 4BM8A 1V6OA 2E7QA 1UL9A 2JE9A 3N3HA 4XBLA 5IK8A 1DQ4A 4AGRA 4BQ1A 1W6NA 1CQ9A 3PVOA 3ZSLA 2WKKA 1W6PA 1HKDA 1FAYA 1DBNA 2D3PA 1DYPA 3FUQA 4YLZA 4DRRA 1DQ5A 3AZXA 4NOTA 1U0AA 3LCPA 4YM0A 1A3KA 2GNMA 1G9FA 1V6MA 1LOAA 1W6MB 4I30A 1Q8OA 4YZ3A 2R49A 4YZ4A 5DXDA 1S0DA 3UL2A 2ZKNA 3AZVA 4PF5A 5T5LA 1GNZA 2NMNA 2ZGUA 5H9PA 3SH5A 1LENA 4K20A 1NLSA 1WCSA 4Q8LA 3WG4A 4YM3A 3OBRA 1YXWA 1JYCA 2GMPA 3B01A 1ULEA 4M3CB 4YW5A 4JC1A 3WG3A 2DVBA 2TEPA 1SFYA 2Q5TA 5T55A 4Y20A 1G7YA 3I8TA 3IM0A 1DIWA 1QMJA 5DUVA 3AX4A 3GALA 3A0KA 2DU1A 1UX6A 3RQ0A 4FOYA 1G9AA 1GICA 2PHTA 4Y1UA 1GZWB 1FX5A 3AZWA 1G9CA 2ZGTA 3UK9A 2JE7A 3PVEA 1IKPA 2OUJA 2CNAA 3NV4A 4WV8A 2ZHLA 5GLVA 2GNDA 2XG3A 1I1EA 1W6NB 1YYNA 1W6OA 2ZGPA 5JDBA 4P9WA 3FLTA 3B00A 3ENRA 3PJQA 2ZGNA 2W52A 1S1AA 2RHPA 1DQ0A 3V64A 1MVQA 1S0FA 3WCRA 2D3RA 1UPSA 2DYCA 1YI7A 2P34A 2YMZA 5GZEA 4Q1PA 2WJSA 3ZYPA 2R1DA 4W65A 5FREA 1SLIA 1S0CA 4Q8KA 3ZSMA 1MS8A 1JHNA 3OY8A 1BQPA 3NV1A 4YG3A 1F9KA 1ULGA 2GMMA 2PHFA 4UW4A 3ZPYA 2ZMLA 4XIKA 3IPVB 4RL7A 3AXEA 3USUA 1LOFC 1LTEA 1UAIA 2DU0A 3C2UA 2FHRA 4Y1VA 4FPLA 2D6NA 2PHXA 4ISRA 1N3OA 2C9AA 5GJ6A 2AH2A 2AYHA 3KM5A 4C1XA 4YFZA 2A6YA 4XILA 4XJUA 3AP7A 5KXDA 3T1MA 3QLQA 1X50A 2R0HA 3ASIA 3ZSJA 2ZGRA 2XB6C 1QKQA 2VW0A 1V00A 2ZZJA 5EYXA 4LBNA 1Z0HA 1SCSA 3B3QE 4YG0A 2ZGOA 1SLCA 1DQ1A 2A70A 1AJOA 4TYSA 2P3JA 3AYAA 4FPFA 3AYDA 3OGGA 1WLCA 2ZMKA 2A7AA 1VAMA 2YZ4A 4YW2A 3BOPA 1LECA 1AXKA 2VY0A 1CESA 1CN1A 5HCFA 1RINA 5L73A 2ZBJA 5T54A 1NXD1 3H0OA 4PQ9A 2OVUA 4YZ5A 4DQAA 1SBFA 1TEIA 1W0OA 1O4ZA 3OBTA 5EXOA 3WDWA 1UZYA 4XDQA 2VH9A 2LTNA 3VKOA 1ZA4A 3R4UA 4IQPA 4XYXA 2D3SA 1SBDA 2AGSA 1APNA 3WCSA 4FP3A 2R16A 1G9BA 1QNWA 3ZVXA 1W6QA 4AGGA 2AREA 4FP2A 4DPNA 2CY6A 4LBLA 2ZGSA 1WUVA 2GN3A 1GSLA 2VW1A 4YGCA 1MR5A 1GNHA 2DV9A 1KITA 2JECA 2OW4A 3AYEA 1LEDA 4M00A 4PBOA 3TB0A 2SLIA 1D2SA 1Q8VA 5T52A 1BJQA 2ZGKA 4BLIA 1ONAA 1WW6A 4Y1YA 5F5QA 4M3CE 1SLLA 3APBA 4LBQA 4Z8BA 1C57A 2UWBA 4FQZA 2G4IA 2W39A 4LBQD 3ZXFA 4ZKTB 4FPEA 1V6JA 4PBPA 4FOVA 1AF9A 2E6VA 4Y20B 3I4IA 3O5SA 1RIRA 4WVVA 5CB7A 4BOWA 4R9AA 1EPWA 1LOBA 1OQ1A 4DFSA 2WNEA 1AX2A 5FRAA 2DVFA 1LHWA 1MS0A 2PHUA 3M3CA 2PELA 3WVJA 5DZFA 2A3YA 5E8AA 3O0WA 2R0FA 4YZ2A 1CR7A 5IUQA 1SBEA 1WW7A 3AP9A 4P9XA 4FPJA 3N36A 4M01A 4UW3A 3OYWB 1CIWA 4BPZA 2D6PA 1H9PA 1URXA 2DVAA 1WD3A 2EALA 1N47A 3V65A 3T2TA 1PZ9A 1LGNA 1LHUA 1W6QB 3A4UA 5IK5A 4GXLA 5GZDA 1KJLA 2DVDA 3WHUA 1ULDA 2ARBA 1UKGA 2E53A 3N7KA 1MACA 1FNZA 5DZEA 1IS6A 1ENQA 1CVNA 1RITA 1DFQA 4YZ1A 3IPVA 3VKFC 3USUB 1UN1A 2D6LX 5JLVA 4XJ8A 3BTAA 4LBJA 5GLUA 3ILFA 1N1SA 2W08A 3JUUA 1MVEA 1WW5A 3AYCA 4L8QA 5CA6A 2Z42A 3AP5A 3NWKA 3V0BB 4ITCA 3D4KA 3IMNA 3AJYA 2A6ZA 3HMYA 3O0VA 1N1VA 1BYHA 3AP4A 3NV2A 2CL2A 2NN8A 3PMEA 5AVAA 2E51A 3UJQA 4FPGA 3V0BA 4LBQB 1QDOA 5KXCA 4UW5A 1S0GA 4ZXKA 3BIWE 1BKZA 4CRQA 2HYKA 3B69A 1C4RA 1QF3A 1DQ2A 1KQRA 3M3EA 3AZZA 4GKYA 2YY1A 4WZFA 1GANA 2ARXA 1FATA 2EIGA 1DLLA 2WSVA 3OYWA 4Y1ZA 4KBBA 3WDVA 4AGVA 2DUPA 1LJ7A 3WZ1A 2YV8A 1A78A 5GZGA 2DWRA 1CPMA 2D43A 4XTPA 4XOGA 1N3PA 1QU0A 2GDFA 2LALA 1G9DA 3TAYA 1KDMA 1R1ZA 2P3IA 2NZ9A 1IOAA 4Q26A 4OZXA 1SLBA 4XIOA 1JN2P 2D44A 1H30A 3FUOA 2C5DA 2GNTA 1LOEA 4XBNA 5LK5A 2H0BA 3RRDA 2UWAA 3OY8B 5KXBA 1HQWA 4FOWA 5CBLA 4CZSA 4F83A 2DTWA 4K21A 4SLIA 3ILRA 4AYUA 4FPCA 5T5OA 2JKBA 1AXYA 2A5ZA 3FBYA 4HANA 4PCRA 1IKQA 2JD4A 3SLIA 1GLHA 1G8WA 2SBAA 3O0XA 1MS3A 3WDXA 5GLZA 2AENA 4Y24A 3SISA 1B09A 1KDKA 1QNYA 4LBOA 2AR6A 3MW4A 2A75A 2E7TA 2AUYA 2P2KA 1AXZA 1AJKA 1V6LA 4R9DA 1F31A 4FOQA 1VLNA 4FPYA 5DUXA 5E89A 4YGDA 3LSEA 3R05A 3VV1A 4XMIA 5F9TA 4LBKA 2P37A 1Z78A 4JRAA 5GM0A 1AX0A 1GKBA 3WHTA 1GZWA 4HL0A 4XMAA 1OKQA 1Y7BA 4XJZA 3VKLA 3B9CA 4XXAA 5IK4A 1IS3A 1LCLA 2FMDA 5T50A 3ILNA 2EXHA 4RA0A 4YM1A 1MS5A 1CONA 2D6MA 5CNAA 2ENRA 4Y22A 5JOWA 3IKWA 4GALA 2WQZC 2A3XA 1QDCA 1FNYA 2A6XA 3M2MA 1G86A 1S0JA 2ERFA 1D0HA 5JOZA 1C1LA 1GV9A 3AXDA 1LULA 1LOFA 4YW1A 4YGEA 1W6PB 1CJPA 3AJZA 4DRVA 3LSDA 5DG1A 2A6WA 2UURA 1Q8PA 4XHXA 3W58A 3WUCA 5JVVA 5H9SA 1HDKA 1O4YA 5DZGA 3POYA 2ZABA 4BLJA 3ZXLA 1HQLA 4Q1RA 2DVGA 4XJAA 1YRZA 5T5PA 1LESA 1I3HA 2JJ6A 2ES3A 5DUUA 3MPPG 3QCWA 3WNXA 3MEPA 3ZYRA 1LODA 2D6OX 3VKNA 5KXEA 1MS9A 4FPHA 4GKXA 3O12A 2ZGQA 3UJOA 2WT1A 4M3CA 1LOCA 3MW2A 1WBLA 2V5YA 5GLTA 1PZ8A 1H9WA 2GN7A 1W0PA 2VW2A 3WDTA 1V6KA 1XQNA 1SLAA 4Q2FA 1FV3A 4YW4A 1DHKB 3N35A 1QOTA 1SCRA 1WLDA 2VXRA 3M1HA 4ATEA 3ZXKA 1BXHA 2ZMNA 4U36A 3RMXA 1LHOA 2EF6A 3V0AB 1LHVA 4XE9A 4WVWA 2WT0A 1FV2A 3M3OA 3WG2A 2OUHA 3HR9A 4YFWA 3OJBA 4XTMA 2BQPA 1JW6A 1ENRA 1IS5A 3FLRA 1JBCA 2PHRA 3AFKA 4YGBA 2D6KA 1V6IA 2ZHMA 3N7JA 1A8DA 3WUDA 4XJWA 1QOOA 5GZFA 5EWSA 2R1BA 1GZ9A 3WG1A 1FYUA 3WOGA 1JUIA 3POWA 2NP0A 3GNEA 1N3QA 2WSUA 1ULCA 4P14A 1BZWA 1MS4A 1MS1A 5JMCA 5H9RA 2B7YA 1DQ6A 4R9BA 4K1ZA 3A0NA 3Q9OA 1YO8A 1ULFA 3L2YA 4ISQA 3ATGA 4XZPA 2YXSA 4XHBA 3POSA 3AP6A 3RSJA 1DYKA 4JCKA 5DUWA 5CAZA 3INAA 4UW6A 4GWNA 4Y1XA 4AVTA 3FLPA 4YG6A 1S0IA 1LEMA 4BMBA 3SH4A 5BYNA 2VU9A 4XXPA 3SNMA 2CWSA 2DURA 2ZGLA 1LGBA 2ZGMA 2CTVA 4Y26A 4YW3A 2DTYA 3NV3A 2CWMA 2DUQA 3WDUA 3KQRA 1WBFA 1UZZA 5HCAA 1LU1A 2A6VA 2UWCA 1IS4A 4XJ9A 3SITA 1WLWA 4M3CF 1HLCA 1ZM1A 2VUAA 1ENSA 1V6NA 3HN1A 4GA9A 4Y22B 1YIFA 5GALA 3M3QA 1UMZA 2NM1A 3ZSKA 5IK7A 1AX1A 2PHWA 5HCBA 4CTEA 5SV8A 1Q8QA 5DG2A 1N1YA 1VIWB 2A71A 5H9QA 3CNAA 1AZDA 1JXNA 1OFSA 1SACA 1Q56A 4C1WA 1MZ5A 2DUOA 5JOXA 4AVVA 4DS0A 1S0EA 3JU9A 4P9YA 2EXIA 1N1TA 3W59A 4R9CA 3WLUA 4FPOB 2JDZA 1LOGA 1WD4A 1MZ6A 1SLTA 2YROA 4LBMA 1LU2A 4Q27A 1J1TA 3ZXEA 5JOYA 4D69A 3R4SA 1DGLA 4AWDA 1GYKA 4FQ4A
chains in the Genus database with same CATH superfamily
3QH6A 3T1LA 4C91A 1NOVA 1SPPB 4KI5M 2WO2A 1S2KA 1Y9MA 1GZCA 3U1XA 3U4XA 4RHV2 1LGCA 2VTXJ 3FHAA 4YWAA 4CCMA 3IAQA 4U2AA 2HWE2 5FZCA 4WVMA 2BV4A 5BUVA 1HQNA 2I45A 1VBC2 4XUNA 1RUH2 1WLTA 1YQ8A 2C24A 3OD0A 3O1RA 3KF3A 4K1YA 4URAA 5FZMA 5FPXA 5EYYA 1KEXA 1UU6A 2HWC1 5EP9A 2Y6LA 1VALA 2XDVA 1DG6A 2RS11 5GLWA 2KM2A 2BJSA 4CCLA 2Q8EA 1W05A 4I0BA 2CV6A 5BNPA 5HXVA 4YM2A 3IN9A 1ODMA 1YNAA 4NJ4A 2IWGB 1VBE1 2Y38A 1HV1A 1W8TA 1JYIA 2WC2A 4Q4W1 1DZQA 2NQYA 4Q4Y2 3MF6A 2OA2A 2EXKA 4P02B 3WF1A 4BH9A 5FY8A 3SH3A 2EAKA 4IEUA 3RWNA 3THTA 4CXWA 1W6OB 4Q4W2 5T5JA 1I9RA 1DZTA 2NYYA 3GHMA 2BYVE 3H3UA 1R1A2 1RYYA 1RUC1 3RI8A 4QU1A 2GALA 5GZCA 4K8FA 3E97A 4CEWC 3N3HA 4CCJA 1NY71 3VLBB 4AGRA 5FY1A 1CQ9A 4A7YA 1MEC3 2B39A 4YARA 2B45X 3MIGA 1BBT2 2GP3A 1ZNPA 1IQDC 3AZXA 2ZAHA 4YM0A 5LASA 4PIXA 1OURA 2PQQA 4HVRA 4IE0A 4L92A 4TSVA 4NHYA 2D93A 2VO5A 2F4LA 4JKMA 2AACA 2BNMA 3H8XA 4PDWA 1NQDA 1EAH1 1S0DA 3AZVA 4I0WB 2MNGA 2VZSA 4C0HA 4HN1A 4XUTA 4Q0PA 1OLMA 4K20A 1NLSA 4RGGA 2WWJA 1W99A 3OBRA 1SDDB 4MHUA 4B8EA 1AR81 3SC7X 3AVRA 1ULEA 2EA7A 1GOGA 1KS4A 3WG3A 3MIEA 5GKAC 3DKQA 1MEC1 2Q5TA 1J1LA 4IV3A 2WNUB 1DCSA 3LDBA 1NLQA 3WQ0A 1ENXA 3DKWA 5BNQA 5JMOA 3GZAA 1XNCA 1GICA 2VUCA 3HT2A 1PHMA 2ZEXA 1MEC2 3JQXA 2WFF1 1FX5A 4HOOA 3T4VA 3AZWA 4NIIA 2ZGTA 3HOBA 4EN7B 4F3JA 1ND2B 5C33A 1G9CA 2PLV3 4JDOA 4QPGB 2JD9A 3LWCA 2DF7A 5DDJ2 4AI3A 1POQA 1TMF3 2OUJA 3NV4A 4WV8A 5C70A 2ZX2A 2MHFA 5GLVA 3N9NA 1W6NB 3PUIA 1YYNA 1VPHA 4QD2A 4P9WA 4GH4A 2P3YA 4NWVA 1VBE3 1K3IA 3PJQA 2XHNA 1A6CA 1S1AA 3GBGA 4P9LA 1MVQA 1S0FA 4Z2AA 2YMZA 4KWLA 1YI7A 2VUDA 5I91A 3SKJE 4M4PA 3ZYPA 2R1DA 1W0NA 5FREA 1VRH1 2QQOA 1S0CA 2YC2A 1PGL2 2B9UA 3ZSMA 5JXJA 2EAAA 3LA7A 3OY8A 1BQPA 5EJ1B 1F9KA 1ULGA 4Y4YA 3I49A 5C5TA 4XIKA 3IPVB 3I2DA 3VDCA 4MXWB 3AXEA 4RL7A 5FYTA 1LTEA 3MLLA 4LK7A 1PVC1 1D4M3 3ECQA 4JQRA 4FPLA 4NROA 3FMGA 4LE3A 1ZZ6A 2WFF2 2LRPA 4LPLA 4WZCA 2FDHA 1G6NA 4GB32 4OUEA 2C9AA 4KMQA 3VBFA 2BPA2 4PDWC 4YFZA 2A6YA 3PUHA 2CGNA 4XILA 3AP7A 3GBFA 2OX0A 4LR4A 1GP5A 2VBBA 4QDSA 3ZSJA 3ZYHA 1TNRA 1HJFA 1NCRA 2VW0A 2XB6C 4XDPA 5EYXA 4LBNA 3ZR6A 1W8ZA 2ZGOA 4NPLA 1RMU3 1RUI3 1Y3TA 1SLCA 4LQRA 4BDVB 2A70A 2ZTNA 4TYSA 3MZHA 1LB2A 3AM2A 2ZMKA 1DYOA 1LR5A 1RHI2 1W8UA 2A7AA 2BVBA 1YI9A 3TEYA 1OQEA 2P6HA 3BOPA 1EAH2 3VBHC 2YG0A 4O65A 2VY0A 4Q4X2 3TYJA 3WQ7A 1ZBE1 1DU3D 2BWAA 3JXSA 1NXD1 3H0OA 5T54A 4YZ5A 3AKPA 4E2SA 3AMMA 5SV5A 5D1IA 1W0OA 3E5UA 4H3WA 4M0HA 5BV6A 4K6BA 3HQRA 2QZ2A 4B7KA 3WEZA 2Z4FA 1AR93 2RDNA 3UV9A 4DIQA 4FSJA 1ZYBA 1ND3C 3WCSA 4E4DX 4E4ZA 3KF5A 3ZFGC 1E5RA 1Q43A 4COZA 2O1QA 2WYFA 1GNHA 3TB0A 4M00A 2OW4A 3AYEA 1LEDA 3NQHA 5TSWA 1NLRA 3LZZA 5T52A 1GWLA 4BLIA 1ONAA 2GH8A 2WWUA 5FY4A 1Q5OA 1SLLA 1W9YA 4LBQA 5F32A 2F17A 3I3QA 4XF9A 2UWBA 1AYM2 2W39A 3J7LA 4ARXA 3ZFEB 3HVDA 1HJGA 5FZ9A 2W1SA 4EN6B 4PIZA 4RS5C 3O5SA 5AC93 2TUNA 1EPWA 1LOBA 3RZJA 5LB6A 2Y6HA 2HWB3 3CIHA 4J1WA 3C7GA 4L99A 4XFFA 5FRAA 2WNUC 5DQ0A 3I3EA 2PELA 3T09A 1O3TA 3RZKA 2R0FA 1H0BA 1CAUB 1CR7A 1WW7A 3Q8EA 1M4WA 2PLV1 3DYPA 4BPZA 5B2GB 1XU2A 2EALA 4RHV1 1WD3A 1N47A 2YPJA 3HWJA 4IEYA 5JXIA 1PZ9A 1LGNA 1NA1B 2V4AA 5IK5A 4GXLA 2DVDA 3NSTA 5JR2A 2ARBA 1DP0A 3WW4A 1X9TA 3K2OA 5FFOC 5FUPA 3VUOA 2VECA 4E8CA 3IPVA 1OFNA 3CJIC 3S5AA 3MF9A 4H14A 3WQ1A 1UN1A 3OGRA 4OI4A 2RDSA 4GULA 1W9TA 3BTAA 3RYPA 1N1SA 1RVF3 1EV12 3LKJA 1PIV2 2WINB 4LOTA 1OOPC 1WW5A 3AYCA 4QB1A 4L8QA 5F3GA 4XFGA 1CJDA 4MUVA 5JR7B 1RUF1 4IW3A 3D4KA 1NKGA 4M0NA 3AJYA 4Y33A 3BALA 4E2QA 3TN93 3MYXA 3O0VA 3VD7A 5AVAA 2CL2A 5CADA 3OEBA 2ZKLA 3L2HA 4RR3A 3ZYJB 5L9BA 2KR2A 1BKZA 2HYKA 2CHHA 3WF0A 1RUC3 3D0JA 3NJYA 3HEIA 3KV4A 1R081 1JYTA 2YY1A 1EUTA 2X5IB 2WSVA 3ZN5A 1DGWX 4Y1ZA 1BEV3 1OOPA 4BK5A 4BISA 4E27A 4D94A 5A3UA 1LJ7A 2Y60A 1FPN1 2GC2A 4NUBA 5DAXA 4BHPA 4FO9A 1J3PA 1UX7A 3LEIA 1OF3A 2W92A 3ZKYA 2DWRA 4QWNA 4V2VA 1CPMA 1OI6A 2D43A 3SEEA 3BKZA 1N3PA 1FPN2 2LALA 2W1WA 4XFIA 4Z1VA 1G9DA 4SBVA 1DGWA 1KDMA 3ZFFC 4OZXA 2QQVA 5LBFA 2R6QA 1H30A 2HEWF 5I0SA 3K3NA 2H0BA 3E6CC 1IPKA 1MQTA 3R6SA 3U0ZA 1COV1 4F83A 5IFPA 1O4TA 2HLEA 3ILRA 4K21A 5LY2A 5T5OA 3VD3A 3SLIA 1Z7S3 2G19A 3WP5A 2W5FA 4LORA 4OUSA 5M0TA 2AENA 1B09A 1SPPA 4UFKA 4A42A 2ZZQA 1RUJ2 4MADA 5I0DA 4Z2WA 1AJKA 1V6LA 4CDQA 1F31A 2ZCWA 1OVPA 2BOIA 1NCQC 1YC61 5E89A 3DN7A 3LSEA 3I2HA 3T08A 4OHYA 5F9TA 1ULOA 5C3RA 2ORZA 3H9AA 3KVAA 1QJU3 3WHTA 3ZYIB 4LK6A 3J7MA 3C3VA 4HL0A 4ONUA 1ND3A 2YUEA 3VKLA 4E9KA 1EV13 4XXAA 5IK4A 1R093 4W8JA 4DXSA 5JZGA 1AR91 2FMDA 3MV01 1UMIA 5IYYA 5JPNB 5A3LA 1MS5A 1CONA 2Z2SB 3IKWA 1CAWB 2WQZC 5HV4A 1FNYA 2JG9C 1XYPA 1RGSA 3CMGA 2ERFA 1JS9A 3KS7A 4YGEA 3N9LA 4XEZA 5CFCC 4DRVA 1H6YA 2XONA 1O59A 2A6WA 4YPJA 4KG0A 1K12A 3C7FA 1Q8PA 4MXVA 3WUCA 3P6BA 3N9PA 2VOXA 1RUI1 2X5IC 2XLGA 1XNBA 3C7EA 1IZ3A 2A73B 3URFA 4ZU5A 3ZXLA 2DVGA 3MUY1 3PIGA 2HWB2 1REFA 4LKEA 3ZYRA 1LODA 1OXCA 2D6OX 1DZRA 1UW8A 5FIXA 3KT4A 5KXEA 1MS9A 4FPHA 1O3RA 1JH5A 2PYTA 3UJOA 5FMOS 4H7MA 4KQ7A 1TQ5A 1VBE2 1W90A 1XNAA 1XNDA 4M3CA 1UYPA 4FTBA 3CLPA 1PMIA 5GLTA 3UESA 5A3WA 4JQTA 2VVEA 1TMF2 1SLAA 1DHKB 5EJ3A 1CX4A 5LA2A 3ABZA 2VOWA 3K4DA 1WLDA 2QVSB 3M1HA 1SG3A 5FZ3A 2G9FA 3WF4A 5F5CA 3RMXA 2I74A 1LHVA 3CF6E 2WT0A 1FV2A 3M3OA 4O9GA 3SHRA 1X33A 2OPWA 1EY2A 3AMHA 5F3EA 2Q1FA 5FPZA 4YFWA 4AFCA 5IHRA 2ZEWA 1CAXB 3OD4A 1XXNA 1ST8A 2WN2A 3MIDA 2D98A 4XURA 1A8DA 5IVVA 3NAPB 2DBNA 1QOOA 1CAUA 2Y6KA 1S2EA 5GZFA 1PGW2 3WR0A 5IVEA 1VB4A 1GZ9A 2R1BA 2VMFA 3WOGA 1JUIA 4LO7A 1ZRCA 3POWA 3AB0A 2RR11 3K46A 5ABJA 1ULCA 1QH6A 3HAGA 2BZDA 4GMP0 4N9HA 1MS4A 1V9U3 4P14A 5ANQA 5IVBA 1HXS3 1DDLA 4UF0A 1DQ6A 2W0XA 2W1QA 4N8MA 3MICA 2QBXA 3A0NA 4R9BA 2BNNA 3H1YA 1CZTA 1X8EA 4XZPA 3VDBA 3POSA 2EIEA 1DYKA 4LUKA 4XF0A 4AR2A 4UF0B 4ES9A 3UGFA 3MLJA 4DINB 3B5LB 2W46A 4YG6A 2YYOA 5FZFA 1H1IA 2R071 3F2ZA 2HWC2 4XUQA 4I3GA 4UI9L 1XE0A 1DF0A 4XXPA 4IGOA 2ZGMA 1LGBA 3LF7A 3SNMA 3DXUA 2DUQA 3WDUA 3I3MA 4KWUA 1SZBA 2JE8A 1NZCA 5A3OA 3RPQA 1LU1A 1D4M2 2J1RA 1XU1A 1YFXA 5FBZA 2GZWA 4I09A 4Y22B 1YIFA 3M3QA 5FYVA 5C4WA 3S7EA 5EZWA 1ZZ9A 1Q8QA 5SV8A 1H4HA 2FCUA 5DG2A 4CSWA 3IDBB 4FXGB 1AZDA 1JXNA 3VZKA 1Q56A 1MZ5A 5JPMB 1W2OA 4AVVA 1S0EA 2WS92 2BUKA 3ZX7A 2VNGA 1N1TA 1OSGA 1VBB3 3W59A 4R9CA 4EN8B 3C7OA 4RQPC 4FPOB 5F6LB 3TN92 2N7GA 1UOBA 2RS13 4ET7A 4GD4A 1SLTA 3WW1A 3VBHB 3ZXDA 1RTVA 2YROA 2JDYA 4EJRA 1LU2A 2PXJA 1IPSA 4MO3M 1GQHA 4AAPA 3IAPA 2V73A 1QJEA 3Q8FA 2MEV3 4S2HA 1BHGA 1TE1B 3OF1A 4H55A 4COVA 2QFEA 2VG9A 1UZ0A 2RMU3 4H7LA 5A80A 3WV6A 1F5FA 4QX2A 3DYMA 2R043 1QJU2 4TXWA 4NHXA 2I2SA 4UFHA 1XE8A 3PL0A 4HKLA 3EXUA 2D7FA 3GXUA 4JGZA 3WDYA 1GUIA 3ES1A 1KD7A 4AVSA 2OQ7A 4XUPA 4QQPA 3IIIA 4L97A 3IZOA 1OA2A 2C9KA 3VBFB 1AL23 1DLCA 5FBJA 5KHGA 1RUJ3 3AKTA 4FPKA 4OI1A 1PMJX 2P3KA 1QOSA 1JYNA 1H2MA 1YUDA 2B9VA 1SMVA 2Y26A 3BVCA 2VZTA 3DPRB 1X7NA 2A3WA 1MQTC 2ZEYA 4COYA 5A6YA 5A7WA 2D5HA 4TZDA 1RUD1 2C26A 4IUGA 3W5NA 3DGTA 4PJYA 5FYMA 2PTMA 4A44A 1KRIA 3B93A 3RZHA 3MW3A 3OPZA 2XWJB 4FFIA 4B4RA 3O1OA 4O7XA 1JOJA 4GWMA 4YVWB 3VBUA 1WW4A 4AK3A 2YB7A 3IBMA 4MVTA 1P8JA 1UL9A 5IK8A 4XBLA 3D82A 1DQ4A 3POGA 1VBD2 4BQ1A 2GH2A 3PVOA 4JKKA 3ZSLA 2JB4A 4KWKA 5FY0A 5FPAA 2HH9A 4B7EA 5C3OA 1FAYA 4NE9A 2MEV2 2XQRA 4DRRA 4Z92B 5JSRA 1QXRA 4PT6A 3NNFA 4LHLA 1XPWA 4B3NA 2GNMA 4UXAA 1VRH2 5JI7A 2UYBA 2VCMA 1LOAA 3TEWA 1GU3A 1F8VA 1WGPA 3USSA 1RMU1 5DMYA 1QJU1 4YZ4A 2JB8A 3BTXA 4PF5A 5A7OA 1UOFA 1HIXA 1GNZA 1AR92 2VQ0A 4LULA 4C0BA 1XJAA 5D2AA 5F5AA 4YM3A 4ZZ5A 2XXZA 3IB3A 2QZ3A 3FN9A 1M06G 1LKNA 3BI3A 3R0RA 3HQUA 3B01A 5E16A 3WW3A 4CXXA 4JC1A 5FCCA 1VRH3 4ZU4A 1KFUL 2DVBA 4J6GA 2BGCA 4NHLA 1Z7S2 5T55A 4Y20A 1G7YA 2IXHA 1DIWA 1K5MB 1QMJA 5A3MA 1AR61 3AX4A 1GQGA 1LNSA 2EIDA 1UX6A 1RHI3 4FOYA 3MPBA 2IFWA 1GZWB 3LOIA 5FO9B 2YFZA 1OUSA 3J8F1 1OPMA 4AI9A 4YVWA 3A7QA 5CKNA 3PVEA 4KGGA 1IKPA 1AYM3 4S2FA 5ERLA 4NIHA 2PHDA 1I1EA 2C6SA 2ZGPA 5FMBA 3FLTA 1PNFA 5J96B 4GWIA 2ZGNA 2RS51 1UPSA 2B4KA 2P34A 4Q1PA 1KFXL 2H0VA 4LE4A 4PLMA 5FR3A 1QJY3 1SLIA 3NW4A 4I3PA 4Q8KA 3WNMA 1MS8A 4N90A 1MQTB 4YG3A 2GMMA 2PHFA 3M8LA 3VDDC 1FT9A 3CZUA 2C4XA 2QDRA 4QX3A 4AFDA 4QX0A 1W8WA 2CDPA 1UXXX 1YIPA 1UAIA 3SQOA 5FZ0A 5A7PA 5AFBA 3C2UA 5EJZB 2FHRA 3WNNA 1JZ7A 2D6NA 4CEYB 4XAEA 1H4GA 5LY1A 3KWVA 2AYHA 4QX5A 3JCIA 4C1XA 3BGAA 4N53C 3OG2A 3O1PA 1W8OA 5FY9A 3OB8A 4FAHA 2R042 4P9GA 2BEOA 2ZGRA 4JHZA 1V00A 1DGRN 2HEYF 1EAH3 1Z0HA 5FP9A 2RMU2 2AZ5A 2ZX1A 5J37A 2VTFA 2WNVB 1XC6A 3I59A 5A6ZA 4G3YC 2P3JA 4OHXA 2O8OA 4FPFA 4RR3B 2J1AA 3IT8A 4QPYA 4XAAA 5FZKA 1X8MA 1VMJA 2YZ4A 3ES4A 5L9VA 4LXLA 2IXCA 2UY8A 3D8CA 3ACIA 1CESA 1CN1A 3O7OA 4CDUB 5HI0A 5EV7A 4CDWB 5L73A 2RS12 2X05A 4E8DA 5A7WB 1QHDA 3AMPA 1JU3A 4PQ9A 1W04A 4HETA 1HRV2 1SBFA 3E5XA 3OBTA 4JV4A 2Q4SA 3WDWA 4XDQA 3WT3A 5JXGA 5LA9A 3DXTA 4UFJA 4IQPA 2J1VA 2VULA 3FC0A 4IEQA 1NCQB 4LJHA 4LHKA 4IEOA 3QOPA 2AGSA 1APNA 3ZMOA 3THPA 1UO9A 4C8DA 3T4HB 1MZFA 3KCCA 4LHSA 2VNRA 1W6QA 3S57A 2AREA 1RXFA 2RJKA 3OGVA 4FP2A 2CY6A 4NHMA 1WUVA 2GN3A 1GSLA 5FZ1A 5I0TA 2EVXA 4RR3C 5A6QA 4YGCA 1ZA7A 4MGSA 2JECA 2Q1MA 1KITA 4RFT0 4OLLA 4MGIE 4PBOA 4QHBA 5CFDA 5K0UB 5LK7B 3DCQA 2VC9A 4AEJA 2WN3A 3J7NA 4M3CE 4AEKA 5FZHA 2FCVA 2XJQA 3LDKA 4BQ5A 2VTXA 2FCTA 2HWC3 4XPVA 5IVJA 4FPEA 1V6JA 4PBPA 1OD5A 4FOVA 1AF9A 3I4IA 1X82A 4JZRA 1POV0 2Z69A 3I2KA 2E31A 3ACHA 1RIRA 1YWKA 3T30A 3WY6A 2FDKA 4R9AA 2OT7A 1JYVA 4N9IA 1HV0A 3ZN6A 4HVOA 5F39A 3VDDB 4BB3A 1ND2A 2PAKA 2ZOEB 2PHUA 1LHWA 3M3CA 3PUAA 3LIHA 4XF3A 1W2TA 2A3YA 2QQJA 1H1AA 1RUNA 1SBEA 1RL3A 3AP9A 4FPJA 3N36A 4UW3A 3VBSB 3ZFGA 1IG3A 5FPLA 2IXJA 2J42A 3OEAA 4FFFA 1PO13 1SQ4A 1W6QB 5G04L 2VJXA 5FMOL 3VBRC 2ORXA 3KZ4C 2WL1A 3MFAA 1L7LA 4Q4V2 5J7MA 2C0ZA 1HB3A 2KA3A 1QQP1 3WHUA 5IVFA 3LE0A 3N7KA 1MACA 4AVCA 1OLRA 2DBIA 1RITA 1ZBE3 2X10A 1YQ6A 3E1F1 4GH4B 3VHOA 5A70A 1VBA1 1REDA 2D6LX 2FDJA 1YFYA 5DPNA 5GLUA 1RUI2 3ILFA 4GH4C 2W08A 1O3QA 2XVLA 5FZGA 3AC0A 3JBG2 1ZBE2 5CA6A 4AHXA 4JGYC 4ZHNA 1RUJ1 1NG0A 2R30A 3WNOA 3V0BB 4I0AA 1UWWA 2JDHA 2BERA 4MXWA 5K0UA 4YVWC 1XYNA 3JB8A 1AYN3 5LEJA 2VNVA 3AP4A 3IDEA 3NV2A 2NN8A 2UY9A 3V0BA 4LKSA 2XBO1 4FPGA 1QDOA 5KXCA 2RM22 3NAPC 4Q4Y3 1X9PA 3BIWE 3LGRA 3OGSA 4FFHA 1ACCA 1E5IA 1AR63 1W2UA 5E6HA 3M3EA 3PTYA 2RDRA 4GKYA 2E32A 5BXXA 1FATA 4AXOA 3OYWA 3W20A 1VBA2 2DUPA 3WZ1A 2W2IA 2YV8A 4YNIA 3VDDA 1COV3 3U14A 2CAVA 4I2OA 3EO6A 3QH7A 4XTPA 5I8TA 2Q1ZB 1QU0A 3DL3A 3I3BA 3WNPA 4WM7A 2BP6A 1RUH3 2P3IA 5A32B 4XIOA 1VBC3 1VBB1 3VBSA 1US3A 3W9AA 1DGRA 2XUEA 1LOEA 1UYZA 1R1A3 3SXWA 4UFLA 5LK5A 5IJRA 3NJXA 3MIFA 3OY8B 2XPJA 4FOWA 1HB2A 4CZSA 4DY3A 2BGPA 5F3CA 2VE1A 1VBA3 4WVZA 3A23A 2JKBA 2A5ZA 4X8NA 4HANA 3ITQA 4WVMB 1GLHA 1G8WA 2SBAA 2RG4A 2KD7A 3Q8AA 2JG8A 5DAQA 4AE2A 1OLQA 2BNOA 2Y34A 5F1RA 2AR6A 3KQ4B 3ACLA 3H3ZA 3MW4A 4FBFA 3M3IA 2YU1A 5DABA 2AUYA 3UGHA 1B35C 1AXZA 1NCRC 1W8HA 3AMQA 1VMFA 2DDUA 4AI2A 2WYSA 4YGDA 4CEYC 4XFCA 4COUA 4KWJA 4HLTA 5KR7A 4IGQA 3WINE 5C71A 3J26N 3BPSA 4JGZC 5J36A 2P37A 5FYIA 1RUF3 1Z78A 4JRAA 3RZGA 3CZJA 4FTSA 1C3HA 1GKBA 4R52A 1AR82 5FZIA 2V72A 4HKWA 2K9ZA 4MGQA 4A7ZA 3WW2A 4DEQA 2XWBB 2IVJA 5T50A 2WNVC 2OKXA 3ZFFA 3PUQA 1K45A 4WM8A 3ON7A 2OPKA 2D6MA 1XNTA 2BRTA 1RXGA 3EBRA 3JQWA 1FOD2 1WMEA 3GYDA 3TEZA 3UYJA 1VP6A 1C1LA 1GV9A 1LULA 3VBRA 2BGOA 2TBVA 1L7QA 3NRUA 4PHZA 3AKQA 1CJPA 2Y6JA 5DG1A 2JDPA 1OPOA 1IQAA 2UURA 4JX0A 4ZS3A 4XHXA 5BNPC 2VMHA 5A32A 4GZ9A 5FUNA 1OKOA 1O4YA 3LD8A 4YYOA 4HN0A 3AMNA 2ADDA 4O9EA 4LKDA 4OQ9A 2ZABA 1RUC2 2DCKA 4WM8C 1AR72 5ACA1 5T5PA 1LESA 2Q8DA 3ZYBA 3OUJA 1RUG1 4XQWA 4BZ4A 3WNXA 4LO4B 3MPPG 3QCWA 1HRI3 3HNMA 4XF1A 2GAUA 5FZAA 4P9JA 4GKXA 4GAZA 4IEZA 4XFAA 2WWSA 5FZEA 2K0GA 3H7YA 5JAXA 3PHMA 2ET1A 1GWKA 2OS2A 2V5YA 3GZEA 1H9WA 4YW7A 4CEYA 1ZREA 3ZMNA 1RB8G 2VW2A 2PFWA 3KMHA 5C8CC 4GB31 1W8FA 4Q2FA 5A33A 1FV3A 4GQ7A 3N35A 1RVF2 2VXRA 2HWF2 1OOPB 1QXJA 2XQXA 3ZXKA 5FMCA 4NAMA 3FE5A 4N43B 4U36A 4XFHA 4EZHA 1LHOA 3KVBA 1YEWA 1RC6A 4K8RB 2R7EB 5C9AA 2XGXA 1PX4A 1E5SA 4Q0QA 3RVHA 3N9OA 1PO22 3RNSA 5I0RA 4S2GA 1JBCA 1ZRIA 4YRDA 4YGBA 1UKRA 3TNPB 4HBNA 3N7JA 5J48A 3LDRA 1W2NA 3MO4A 4XJWA 4J25A 3MLKA 3VBSC 5J3UA 3NMBA 3ZDSA 5FK8A 1HRI2 3ELNA 4CP9A 4A45A 3GNEA 1OBNA 2RS33 2WSUA 3U75A 5LBBA 3V56A 3EQEA 4AQTA 5JMCA 1MS1A 3CEWA 3ZLIA 2B7YA 3EJKA 4CCKA 5C3PA 3RYKA 3WP3A 5C6CA 2VZPA 1YO8A 3L2YA 2Y33A 2XOMA 3ATGA 5EPAA 2YXSA 4XHBA 3VL9A 3AP6A 3RSJA 4KGQA 1C8M3 1JU4A 2RS53 1ASJ3 1EPZA 1WCDJ 2JEMA 2PN5A 2VZUA 3INAA 4Y1XA 4AVTA 1PX3A 5CG9A 3CDZB 3WG4A 2VMEA 3GCXA 3NO8A 4DXTA 3DF0A 4E4SA 5FDBA 1RUE1 3NV3A 3CL1A 1I5PA 4NHKA 4AI8A 3NNGA 4GMP1 2AEYA 3O1TA 3SKVA 5IAXA 3SCHA 2RS52 1BMV1 1AUYA 2WAAA 4HK8A 3J8F3 4QPIB 3JD72 5FJKA 5HCAA 4QQ2A 2UWCA 3WNLA 3UKNA 1PVC3 2XJRA 3VBUC 1RHI1 3K75B 4M3CF 3RZMA 5FXVA 2XBO2 5LZ6A 2VUAA 4GA9A 1V6NA 4H2AA 4LIVA 4CCOA 2VUJA 1AR73 4IV3C 1UMZA 2WZEA 3UGGA 1S4CA 3DEMA 3WF2A 5D8AC 3ZFGB 1X36A 4QPWA 1N1YA 1BBT1 2J1UA 1GR3A 1QJY2 4MGZE 3B9IA 3VN4A 5C9AC 1OFSA 2HEVF 3POFA 4XCBA 4LA2A 4IL7A 3VZMA 2EXIA 2OYZA 3BU7A 3F95A 5LEKA 1STMA 4HZFA 3QACA 4QB6A 2DCTA 2X53S 3SCGA 4CA9A 1FOD3 4XZUG 4IV1B 3GHNA 3CJIA 3ZXEA 2J22A 3DECA 2F6BA 4AWDA 4FQ4A 2GMEA 2XUMA 1BEV1 3ZOIA 3W5MA 5FP7A 1UF2C 1RMU2 5JUVA 5FO8B 5CFCA 2FDIA 2ZA9A 3PUSA 4HSLA 4NIDA 3AZYA 2K2SA 2QQKA 1OF4A 1CD3G 2VMDA 1NX9A 5FP4A 2WT2A 4URTA 2P6CA 1UOGA 4BXSV 1WMFA 3D5OA 4CCEA 1GWMA 5C8WA 1NT0A 4Q4V3 1W6MA 1QGLA 3HJRA 2VZVA 4PDWB 5DDJ1 5JI9A 1PZ7A 1GBGA 2YDEA 3FFZA 3PVNA 4XF4A 4BIFA 2VZ3A 5K9YA 2W3JA 3LA3A 4WM7C 5FLHA 4XFBA 2LS6A 2ZHNA 4L0PA 3M7AA 5L9RA 2X8KA 2FBEA 4UBGA 5C9AB 1R091 4HVQA 1KJRA 4LUMA 5IT6A 3FJSA 4A7KA 4LLFA 3ZXJA 3AK0A 2JG9A 4CU7A 5IATA 1C1FA 4XBQA 5JSPA 3OTFA 2ZAAA 4FVVA 2VXJA 3DUIA 4IV3B 4NO4A 3NAPA 4COWA 4IXLA 4A41A 2CYFA 2UU8A 1O6UA 4LLOA 3RG0A 3RS6A 3EHKA 3N7MA 1ZBA3 2XHKA 3D6EA 3KT7A 1FI2A 4MYEA 1CZSA 1OH4A 2D5FA 2ZHKA 3ZO0B 4BM8A 3MFCA 4Y5SA 2VZQA 4D8MA 1O8SA 1J83A 2R32A 1W6NA 1UU4A 1GNYA 3NNMA 5DAWA 5HPOA 4HK9A 4LO6B 5IVYA 1T2XA 1DBNA 2MEV1 1DYPA 4K9SA 4YLZA 4CDQC 1ALYA 2QQUA 5HCHA 4NOTA 1U0AA 2VD7A 3LCPA 4CVUA 5KWRA 1QJX1 1RUG3 5FTTC 5I8YA 1HXS2 2P5BA 3PNAA 1NY72 3I2OA 2MPFA 4I30A 1REEA 4YZ3A 1XSQA 2R49A 4HKOA 3BYWA 1AL22 3UL2A 1RUOA 2VZOA 4G9SB 2C1FA 2ZGUA 4QDQA 3SH5A 1VRBA 2R061 3PTRB 5FK7A 1WCSA 1KGYA 3A21A 1UYXA 4OI2A 2YBPA 2IC1A 2LUWA 2W1UA 2VOKA 2WQ8A 1YXWA 4P5YA 4V2WA 2GMPA 2GU9A 1RUG2 4J1XA 2TEPA 3JBG3 1HB1A 1SFYA 2YGLA 4CU9A 2WA3A 3I8TA 3IM0A 4CDXC 1ULPA 3GALA 1W06A 2QDNA 3A0KA 1UY1A 2HWD1 3PVBB 3RQ0A 1G9AA 2PHTA 1W2AX 3N9QA 4NN0A 3N4MA 3A22A 3WX5A 3OUHA 1F2NA 1O91A 2WO7A 3S30A 2XJUA 3UK9A 3C8XA 4MZUA 1GP4A 1O7FA 3H3LA 2QQIA 3WP6A 5L7OB 3H8OA 3HQXA 5FOBB 4HXCA 4W6WA 2CNAA 3OCPA 2ZHLA 2XG3A 1QY4A 1W9SA 1W6OA 2DCJA 4CCDA 2J1TA 3ENRA 3AL5A 5FWJA 2RHPA 4CUCA 5LWBA 3WCRA 1T6GC 2D3RA 1JZ2A 5GZEA 1EYBA 2WJSA 3IIAA 5FLIA 1ZZ8A 1YQCA 3DPRC 2JX9A 5C8CA 2TNFA 1JHNA 1BCXA 3P5BA 1WA6X 4QGLA 4UW4A 5BY5A 4HG6B 2WBKA 2XVGA 4RQPA 2JDUA 1S55A 4CDQB 3USUA 1LOFC 2DU0A 4Y3OA 4TLGA 2XJSA 4Y1VA 1K5JA 2PHXA 3MBWA 4ISRA 1T6BX 4KBZA 4QU2A 4AEDB 1AYN2 2YPDA 4DMIA 3KM5A 3ETQA 3T0DA 2FDGA 4AQSA 2YC0A 2YBSA 3ASIA 3I59B 2IXIA 4NAOA 1SCSA 2BW8A 3B3QE 3NKTA 4LO8A 4YG0A 3LPFA 5HV0A 3UNPA 4XUOA 3HNYM 1AJOA 3CO2A 2HWB1 3AYAA 2R062 4KL1A 1WLCA 4ZU7A 4IERA 5FAXA 1VAMA 4YW2A 1R092 4CCCA 1LECA 1AXKA 4MX3A 5F5IA 4AHWA 4AG4A 2JIGA 5HCFA 1RINA 3ZFFB 2XLAA 2ZBJA 4IV1C 2OVUA 3E5QA 2RJLA 4XQDA 5A1FA 2B42B 4QQHA 1D7PM 5EXOA 4CDWA 4CPBA 4DXZA 5JWPA 2VH9A 4EV0A 4Q29A 1CZVA 1ZA4A 4QGMA 4XYXA 5IFTA 1TMF1 1PK6B 3MI8A 1G9BA 1QNWA 4TLFA 3BB6A 1RUE3 1ZZ7A 1WKYA 4EWEA 5LRSA 2DCZA 2ZGSA 4LBLA 3RGBA 4GMP3 4DY5A 3POJA 4CP0A 2D40A 5JIUA 5FZBA 1GP6A 3T0AA 4AZZA 1Q8VA 2KXLA 1BJQA 2ZGKA 3MUZ1 4LMFA 4QAWA 1WW6A 5F5QA 2E7AA 1J84A 3U10A 4QX8A 3APBA 4Z8BA 4CYDA 5FYBA 4A3ZA 4FQZA 3I7DA 2VCCA 2G4IA 4LKFA 4MSVA 4LBQD 5CYYA 2RS31 4A3XA 1CX1A 2CU5A 4AEDC 4Y20B 5FOJB 1W8NA 2XL7A 1W03A 2ATFA 2OZ6A 4WVVA 5CB7A 4I01A 2JKXA 1OQ1A 2CGOA 3T3YA 2CDOA 1FMD3 1AX2A 4BIOA 4Y4RA 3ZSEA 5IWFA 2DVFA 1MS0A 5DZFA 5E8AA 3GZUC 3EB7A 5FY7A 4UOJA 3HBZA 4YVSB 5HBAA 3VZNA 5IUQA 1NA1C 1QQP2 2VQUA 4QXKA 3VBUB 4M01A 2QQMA 4LIUA 1CIWA 1OA3A 1RJ7A 1H9PA 1URXA 3V65A 1WCKA 3RJRA 3T2TA 1LHUA 1W3XA 4YVSC 5ANNA 3FL7A 1PO23 4QGNA 1I6XA 1I5ZA 1UKGA 2E53A 5F37A 3TRSB 2JDMA 2OQ6A 1IS6A 1ENQA 1O8PA 2FMYA 3PIJA 3TBDA 5CFDB 4TN7A 3VKFC 3MIHA 3U37A 3CJIB 3LOBA 2WIIB 4D6QA 3DYOA 2VPVA 3CHXA 1YLLA 4LBJA 4N43C 3KLSA 3JUUA 3U07A 1JI6A 3AP5A 3T0BA 4AQ2A 3HN3A 1UY4A 3NWKA 2B5HA 2CSGA 1QJZA 4P08A 4CEWB 1HRI1 3IMNA 1SFPA 4BYYA 2A6ZA 3HMYA 4PQQA 1N1VA 5ACA3 4L2NA 3UJQA 4CU8A 1COV2 3PMEA 2E51A 2A1XA 3OOXA 3ZDVA 1OD3A 4LBQB 4LT5A 1SFNA 2JICA 3JD71 2RDQA 3H8UA 1S0GA 2ZX0A 4RN5A 2UYAA 4AFAA 1HX6A 4AAXA 2WZR3 2QCSB 3NJVA 1QF3A 1DQ2A 2Y0OA 2ARCA 2ID4A 2GC0A 3AZZA 4OHZA 1GANA 2OZJA 2EIGA 1DLLA 3H1MA 2QQNA 5HXMA 4L9BA 4EROA 1UQXA 4WM7B 5JSOA 1SHWB 4EQVA 1GZTA 1A78A 4DUXA 1NA1A 1FMD1 1VBD3 1JZ6A 2GDFA 5EFUA 4Z82A 3BN6A 2O14A 1K42A 2NZ9A 3CBNA 1IOAA 4Q26A 2WUHA 1SLBA 5EQUA 1JN2P 1PMHX 4NVPA 5F3IA 3FUOA 2C5DA 2GNTA 3FFQA 3S7IA 4XBNA 2RM21 4A2UA 5D21A 3ACGA 2UWAA 5KXBA 4JTNA 3K51A 3GCWA 3VHPA 3UETA 1YQ2A 4OQ8A 5AVPA 4FPCA 1AXYA 2BBAA 3FBYA 3HBKA 4PCRA 2J7MA 3O0XA 1V9U1 3ZYGA 1MS3A 3WDXA 1WZXA 1O5UA 3O1UA 1IPJA 4X6RB 2Q8CA 4LBOA 4D7YA 1OUXA 5ISLA 1F35A 3I97A 3PU3A 3OPWA 2E7TA 4OMDA 5FYZA 1PO12 2P2KA 4CP1A 4R9DA 3GJAA 4FOQA 4DZGA 1VLNA 4FPYA 5DUXA 5LBEA 1UMHA 1H2NA 1UY3A 1VR3A 2JDNA 2LW8A 3AKSA 3VBOA 3VV1A 4CPBD 3UKVA 1FOD1 4V1PA 5CKQA 3UT0A 4GIQA 4QX1A 1AX0A 2VOTA 3O1MA 5D8AB 3ZIXA 3J9SA 1GZWA 1JODA 4QKFA 1Y7BA 1PIV3 4N7IA 3B9CA 4MH0E 2XLFA 4QPIA 3E6BA 4CU6A 5IVCA 1CWPA 1WCQA 1YHFA 2QNKA 2EXHA 4OUMA 2HKXA 4YM1A 1JZ5A 2IZWA 3WNKA 4GALA 1BVP1 4IE4A 4HFSA 1QDCA 3M2MA 1G86A 1QJX2 5CEHA 1NCQA 1D0HA 4JTOA 5JOZA 2XJPA 3OUIA 1LOFA 2ADEA 4AFMA 3KHCA 4QPGC 1CIYA 3AJZA 4DEVA 3LSDA 1ZRFA 5FWEA 2ZXQA 1PIV1 5FYYA 2IUWA 1B35A 1QH7A 5FP8A 5DZGA 5H9SA 3THDA 2P17A 1D0GA 1XSRA 3SCFA 4ZY9A 1AR62 3ACFA 4QQOA 3I2IA 4IEXA 5EHDA 1UU5A 4N53A 4Q1RA 5A7NA 2FD8A 3I2FA 3ALQA 1YRZA 3POBA 2ZS6B 1IHMA 1I3HA 5A7SA 4DB5A 5DUUA 1XNKA 3AKRA 2VOVA 5AC92 3O12A 2YC4A 5F2WA 2E63A 1W3VA 2WT1A 1JMUB 1LOCA 4D7SA 3KV6A 4W50A 3MW2A 1WMDA 4UAPA 1PZ8A 1QIQA 2PA7A 2QQWA 4K7JA 3ORJA 1W0PA 3WDTA 1V6KA 1ND2C 3FBMA 2VAUA 3GGLA 4IEVA 4YW4A 5FQ0B 5FPVA 1CGPA 1QOTA 1SCRA 1UZVA 2VZ1A 3UKTA 2QE3A 3AL6A 4HT1T 5FLJA 1BXHA 2ZMNA 1POV1 4D6SA 4FAGA 4CDUA 3V0AB 1JOPA 2WZ8A 4WVWA 4XE9A 4OI0A 1VAKA 5L7OA 2VBDA 3PDQA 1PGL1 4N43A 4Q4X1 1RUD3 5LCWL 4P5HA 1IS5A 1UPIA 1VBD1 3BPZA 3FLRA 5FZLA 4CUBA 3AFKA 2HWD3 2D6KA 1V6IA 1YFWA 4YSFA 3U4SA 1WCUA 1PM4A 2IXKA 5EIYB 4IV1A 3KCXA 1CAXA 5EWSA 2VBPA 3VD5A 5F8PA 5FJHA 1FYUA 1H2LA 5LATA 2NP0A 3JBG1 5CIRA 3EYPA 5B4XA 4AEMA 1RUD2 2Q8OA 3ZM8A 1BK1A 5H9RA 2YGMA 1Y9GA 4K1ZA 4S2DA 3VZOA 1GOHA 1H6XA 4RYDA 2H6BA 4ISQA 5A3TA 2ZX3A 4A6OA 2R063 2CGPA 1H8TC 1NQJA 4GJZA 4JCKA 5DUWA 2XH6A 2WABA 5CAZA 2WZR1 4ZONA 4UW6A 3ZFEC 2WLPA 1S0IA 1LEMA 3DV8A 3M4FA 2WR9A 3VB9A 3EMRA 1QXPA 2VU9A 2CWSA 3KGLA 2CTVA 1UXZA 2YU2A 1QJX3 2DTYA 4Y26A 3TWIA 5DAVA 3T2OA 5APAA 4ASLA 1HN0A 1BVVA 1WBFA 1TNFA 4D7TA 5KHJA 2WFF3 1EP0A 4BA6A 2A6VA 4XJ9A 3SITA 2Y64A 3FX3A 4A4AA 5B4NA 1R083 2GC3A 5BNOB 3HN1A 5JZGC 1ZRRA 5GALA 1BEV2 1GMMA 4DO0A 2QQLA 3ZSKA 4QT6A 2PHWA 5IK7A 3HPNA 2VQAA 4OCTA 1ND3B 3I2GA 3ST7A 4RS5A 2WNUA 1UD1A 3K77A 2A71A 5CG8A 2JDKA 2WZR2 3CU7A 3I3DA 3JB4C 5FXWA 3TOJA 1SACA 2DUOA 4G4FA 3VHRA 3PURA 3TN91 3JU9A 3JZVA 1J58A 1IG0A 2E26A 4P9YA 4RSUA 3VBHA 1CAWA 1HRV3 3S5QA 1AL0G 1WWYA 4QXBA 2PAEA 5C7GA 1B35B 2HWD2 5FV3A 2JDZA 1MZ6A 1US2A 5FZ4A 4OZOA 3RJ2X 4AFBA 3IDAA 4Q27A 5DDJ3 5KC5A 4CDWC 1XB9A 5JOYA 1DGLA 3KD4A 2GSYA 4JKLA 4Q4V1 4X6QB 1NUKA 2EXJA 3ZXGA 5C5UA 4LOSA 5K0UC 1E5HA 4B4PA 4NRMA 3WXPA 3VKMA 3NNJA 4QPIC 2ZX4A 4ATFA 2FDFA 5E88A 1LRHA 1H1MA 2P1BA 1U5ZA 5FY5A 2GNBA 3VZJA 3HT1A 1HXS1 1CPNA 5A33B 2YBKA 5FQ0A 3LA2A 5FXZA 5D8AA 4A6SA 3N7LA 2WLQA 2RR13 2HWF1 2NMOA 1E57A 3KCYA 4QXCA 4EZ4A 4IE6A 5BNNB 1O3SA 3BODA 3V0AA 1VBC1 4NRQA 1NXMA 1S0BA 3GF6A 3PJYA 1QEXA 4BMEA 3WD5A 1UY2A 4CDUC 4M4RA 4MV2A 5FUIA 2HWE1 2ZACA 1R1A1 1AYM1 3NJZA 1Q8SA 4UBHA 1ZZCA 4ZS2A 3RMYA 4ASMB 5AC91 1BBT3 3ZN4A 1BK0A 1CAVA 1VAVA 2PQSA 1JUHA 2RR12 3SMHA 3VDAA 1AVBA 4JVAA 1LHNA 1AR71 2W68A 5ACA2 4E2GA 5FYHA 4CDXA 1SEFA 2V09A 1H8VA 1PGW1 1R64A 1XE7A 4KG8A 1GOFA 2RE9A 5FYCA 1Q3EA 3J4UH 2XL9A 3GDBA 1V6OA 2E7QA 2JE9A 4FCAA 2OXBA 1OQDA 2PHLA 5CISA 5F7UA 3OSDA 1J59A 5LBCA 2YHJA 3RZZA 3LEGA 2WKKA 4MGKE 3RYRA 4BXFA 1BLZA 1W6PA 5I8SA 1F4AA 1HKDA 2JG8B 4OHWA 2D3PA 3FUQA 3M70A 1O5LA 2W91A 3ZIWA 1DQ5A 1A3KA 1K5MC 1RJ8A 2VCAA 1NYWA 2WO3A 3K48A 2VMGA 1G9FA 5FXXA 3ZR5A 1UOJA 1V6MA 1UNBA 2D97A 1W6MB 2ZEZA 4BCUA 1Q8OA 1WMXA 5FPBA 4META 5DXDA 4CP2A 2WA4A 2ZKNA 4PLOA 5T5LA 1JHJA 5H9PA 2NMNA 2WS93 3HIFA 1LENA 2VMIA 3B94A 3K3OA 3BCWA 4Q8LA 2Q30A 1QQP3 3WF3A 3AFGA 1JYCA 4HMZA 4M3CB 4YW5A 2GP5A 3VBOC 4OFGA 4PI0A 4PIYA 3ZKUA 2W95A 1VJ2A 2WDBA 2Y8KA 5KC6A 5LRRA 2G9GA 3RWKX 5DUVA 5LA0A 2EICA 1UCXA 1IGOA 3RFRA 2DU1A 4NRPA 1ODNA 2K46A 3K4ZA 4Y1UA 4CUAA 1VMHA 1PO11 3GM8A 4IESA 3QBQA 3ZN6B 4XC9A 3BIEA 2JE7A 2W9XA 1HN1A 4JRLA 1XRUA 4Y5TA 4HPKA 2GNDA 2JDAA 3KT1A 1FXZA 2Q0AA 4KH9A 4QM8A 5JDBA 1D4M1 1HB4A 2F4PA 3B00A 3FWEA 1AL21 4B29A 5A3NA 2W52A 4GB33 1LAJA 1DQ0A 3N9MA 4HPKB 3V64A 2DYCA 2IVIB 4BE3A 4W65A 4ASKA 5KHIA 3VZLA 2DCYA 5LW9A 1BMV2 3BU0A 3I2JA 3NV1A 3ZPYA 1RUE2 2NPIA 2OIIA 1FMD2 2ZMLA 3KHBA 3VL8A 3POIA 4JGZB 5FZOB 5CU1A 5LA1A 4LITA 4ARYA 2JIJA 3LB9A 3JD73 1WA4A 3J8F2 3H7JA 4JGYA 4MOAA 3PMSA 1XOYA 2O8QA 3U11A 1N3OA 5CKMA 5GJ6A 1AHSA 2AH2A 4PLNA 4D3WA 5BNNA 3ZXAC 4XJUA 5KXDA 5KHHA 3QLQA 1X50A 2R0HA 4MG2A 4NR1A 5A3PA 3LIGA 4CE8A 5K4LA 1QKQA 4FXKB 2ZZJA 3Q8CA 3RDIA 5K8SA 2JG9B 1TVGA 4CXYA 1DQ1A 1YCIA 1U12A 3LFMA 1OH3A 4NPRA 3T2PA 4GJYA 4YVSA 2FQPA 4QHOA 5I0UA 2XJTA 1ZZBA 3AYDA 3OGGA 2BTVC 3KV5A 5BNOA 3K4AA 4RD7A 1AR83 3POEA 1TME2 4MLOA 2G9ZA 2ZPXA 4R4XA 4BQ2A 4JDNA 1VBB2 1PO21 4DQAA 1TEIA 5BNNC 5A7QA 1O4ZA 2RV9A 1UZYA 1Y4WA 2B8MA 2LTNA 3O1SA 3VKOA 4B1LA 3R4UA 4ZXEA 3R4DB 5DN2A 1ZBA1 3ETPA 3MHZA 3WSOA 2BFUL 3W21A 2D3SA 1SBDA 4FP3A 2P4EA 2R16A 3THCA 3ZVXA 1RVF1 2ET7A 4LA3A 1H2KA 1U5XA 4QKBA 4AGGA 2E9QA 4Q4X3 2LROA 2Y0IA 4D0QA 4DPNA 1A8MA 4MGTA 1VB2A 5KBFA 4B1MA 1R082 1OA4A 2VW1A 5C3SA 2VM9A 3H50A 2AEZA 2LM3A 1MR5A 1NAEA 2DV9A 4CEWA 3O1VA 5JXHA 3LFIA 4QB2A 4P00B 1EUUA 2SLIA 1D2SA 3OBZA 4IEWA 2HBUA 2XR4A 5FKBA 4NIGA 4Y1YA 1XYOA 1XBFA 4I02A 2Y6GA 2BOJA 1UIKA 2GC1A 3TEXA 4UFIA 2XMLA 2QKDA 1C57A 1F4HA 4B4QA 2PMWB 3ZXFA 4ZKTB 1S2BA 2YFUA 1UIJA 1OVSA 2WS91 5FO7B 3TNQA 4Q5OA 1JYWA 3MDPA 2E6VA 1MPXA 2IFRA 1QJY1 4HONA 4Q4W3 4BOWA 1NE4A 4BWOA 4DFSA 2WNEA 4XQ4A 4QX7A 2VNOA 3WVJA 1V9U2 2VVDA 1RUH1 3O0WA 2WNVA 3IMMA 5IW0A 2V5DA 4YZ2A 1K5MA 5C4WC 4JDMA 5BNOC 5JZGB 3VBRB 2FZ2A 5FPUA 2DFBA 2X5IA 4P9XA 3NNLA 1JZ3A 3OYWB 1HW5A 2RJ2A 3OBAA 4FI9A 2D6PA 2VQTA 2DVAA 3D3AA 4AQ6A 2Y6FA 2WAOA 3A4UA 2JWPA 1JZ8A 3QD6A 1KJLA 2ZJCA 4Y5Z0 1J3QA 3CQOA 5GZDA 1ULDA 2AC1A 4QXHA 3WQBA 4UYBA 1FNZA 5DZEA 2QJVA 3AVSA 1CVNA 1JTZX 3LQCA 1DFQA 5FKCA 4AF9A 4YZ1A 2XKOA 4RGKA 3BTYA 3NVCA 3USUB 4LTAA 4JHTA 4QDRA 4BQYA 5JLVA 1GQPA 2JG8C 4HSJA 4XJ8A 1C28A 3IWZA 4JAAA 4AEDA 1MVEA 5C8CB 1J3RA 3ZPOA 2Z42A 2EIBA 2WZPP 3VBOB 3I54A 4ITCA 4CUGA 1VE0A 3KV9A 3H1WA 3PU8A 4NMIA 1C8M1 2BWCA 4DNYA 3GBWA 3VD9A 4UFMA 4FFGA 1SDWA 1JOBA 1BYHA 1D2QA 3HD8B 1QWRA 3WP4A 2BU9A 4DOUA 2JENA 2V4VA 3DPRA 4UW5A 5C4WB 4ZXKA 2VVFA 4FT8A 4CRQA 1PNGA 3B69A 1ASJ1 2I07B 1UY0A 4WM8B 4AI0A 1C4RA 1A34A 1KQRA 3MIBA 4OULA 5J1XA 4WBBA 3BUCA 4WZFA 1D4VB 3FZ3A 3KGZA 2ARXA 2W87A 4KBBA 4QHZA 3WDVA 4AGVA 5BNPB 2QTWB 2VZRA 3G7DA 4KNCA 5FZ6A 4CCNA 2WO1A 3D0SA 4QM9A 5GZGA 3E6DA 4XOGA 4CP9B 1PVXA 3H8RA 5L19A 3TAYA 3S0MA 1R1ZA 2QQPA 4EYUA 1HRV1 2RVAA 2D44A 3U78A 3RRDA 3J7HA 1HQWA 5CBLA 1TG7A 2DTWA 1OLME 2JXAA 1C8M2 2ARAA 4SLIA 4IE5A 4UT5A 4AYUA 1OMIA 1TZOA 1F15A 4LNVA 1IKQA 2JD4A 3GZTB 4FTEA 5GLZA 2B46X 3FHQA 3SISA 4Y24A 1KDKA 1UYYA 1QNYA 2RMU1 2VR4A 5F6KA 4K40A 5FZ7A 4OYUA 2A75A 1KS5A 3C7HA 4N53B 4QKDA 3FHIB 2R041 4RQPB 1PK6C 4OMCA 5FYUA 5FZOA 1L3JA 4DUVA 1NCRB 4ZZ8A 5AFEA 1JZ4A 4TTGA 4R8HA 3KSCA 2XVKA 3R05A 2WNOA 4UWDA 1Z7S1 4AHZA 4XMIA 4LHNA 1U5IA 2VGDA 4LBKA 3ME2A 3RZLA 2X29A 5GM0A 2XKPA 5C3QA 5DAPA 1TME3 3MV11 4XMAA 3S6PA 1OKQA 4IETA 3O14A 4XJZA 2HWE3 1W9FA 3HNBM 5FP3A 4ZPIA 1IS3A 3T2QA 1LCLA 4AVBA 3ILNA 4RA0A 2HYXA 1F5JA 1YJKA 5CNAA 2ENRA 3Q8BA 4Y22A 5JOWA 1ZVFA 2HWF3 3IDCB 4DXRA 2A3XA 5A1LA 1OT5A 2A6XA 1V70A 1S0JA 4NIAA 3LPGA 1ZBA2 1YJLA 1CAVB 1FPN3 3AXDA 1Y9QA 1YQ5A 3PLQA 4TWTA 5CVRA 4YW1A 2Z79A 4QMAA 4ES8A 1W28A 1W6PB 2ETEA 3W58A 4XETA 5JVVA 4BQWA 5F2SA 1HDKA 3BOWA 3POYA 3SEPA 1PGSA 3CKHA 5A1AA 2R073 4BQ4A 2IXLA 4AHYA 2Z5WA 4BLJA 5CZKA 1HQLA 4XJAA 4X8PA 2JJ6A 2QUOA 4Q0VA 3X29B 2ES3A 4EN9B 5A6XA 3MEPA 4Z07A 3B7MA 3VKNA 1C5HA 4D6RA 2CAUA 3ZYFA 4C90A 2ZGQA 4Q0SA 2J1SA 4K3UA 4W6YA 1W39A 5E1RA 1WBLA 4IDZA 2GN7A 4JGYB 5G05L 1PM7A 2HJIA 1H8TA 1XQNA 3G6JB 4RFRB 5L7OC 4ATEA 3ZFEA 4BU2A 4LO5B 4OHVA 4DUWA 2VMCA 4RHV3 5FYSA 1L7RA 1H8TB 5JIAA 4AL9A 4AOCA 2HBTA 1JYXA 2EF6A 5IAVA 2L9LA 2PAMA 2FZ1A 2E33A 4QPGA 5FZ8A 1TME1 3WG2A 2OUHA 3GJBA 3HR9A 1NZIA 4KU8A 4KU7A 3OJBA 4XTMA 4CDXB 2BQPA 1JW6A 2WFPA 1ENRA 3VHNA 2PHRA 2RS32 3P1IA 2VCBA 2ZHMA 1ZRDA 5J09A 5KHKA 3WUDA 4OVEA 4XABA 4W4ZA 5T3NA 5ABJB 3RI9A 3WG1A 1MZEA 3NL1A 4BJ0A 4O61A 2XJVA 2WQ4A 5L36A 3BTZA 1N3QA 4XW3A 4EWDA 4IE7A 1W9WA 4L11A 1BZWA 4PF1A 4Q4Y1 1QJFA 4MHRA 1V0AA 3P3NA 4LEJA 4EWAA 2XBO3 3B02A 3Q9OA 4QQLA 1ULFA 2J1EA 3LEMA 5J98B 5I93A 1PVC2 1U5YA 3LAGA 1AYN1 2VL4A 5BPXA 4E4HA 4F8AA 5FZDA 1OC1A 3VGIA 5CFDC 4GWNA 4XDOA 3VD4A 3FLPA 3CJXA 4BMBA 2BFUS 4EN0A 1YFUA 3SH4A 2ILMA 5CFCB 5BYNA 2BVVA 3LEKA 3T1MA 4NPMA 2ZGLA 2DURA 4AW7A 4BK4A 4AVAA 4Q0UA 4YW3A 5K7PA 5ABJC 2CWMA 4IEPA 4P9IA 3KQRA 2PLV2 4AI1A 1ASJ2 3KB5A 1UZZA 2NLRA 2W47A 5FMDA 2WRAA 1IS4A 1C8NA 2BBVA 4N7UA 1WLWA 1HLCA 1ZX5A 1ZM1A 1ENSA 1POV3 4INDA 4R4ZA 4PI2A 1GFF2 2H6CA 2NM1A 1AX1A 4XCAA 4BQ3A 4F7ZA 5HCBA 3OGJA 4CTEA 2R072 1RUF2 4ORFA 4YW6A 1VIWB 1C5IA 1Y43B 3CNAA 3MGUA 4NWWA 2W94A 2BDRA 3L9JT 4IGPA 5H9QA 3VBFC 4EE2A 4C1WA 5JOXA 4W6XA 1KXGA 1EV11 2G1MA 2RM23 3NKGA 3ROUA 4RS5B 3H42B 2DFCA 4DS0A 1UZWA 1PK6A 4BQXA 3OPTA 4GWJA 3WLUA 1NE6A 3P3PA 2O0OA 1LOGA 1WD4A 5JCTA 4XVHA 4MGYE 4LBMA 1OHFA 1J1TA 4XACA 4QKNA 2X09A 4D69A 3R4SA 1GYKA 4RGAA
chains in the Genus database with same CATH topology
3QH6A 3T1LA 4C91A 1NOVA 1S2KA 1GZCA 3U4XA 4RHV2 1LGCA 4U2AA 2HWE2 4WVMA 5BUVA 1HQNA 2I45A 1VBC2 1RUH2 1WLTA 3OD0A 4K1YA 5FPXA 5EYYA 1UU6A 2HWC1 1VALA 1DG6A 2RS11 5GLWA 2KM2A 4I0BA 2CV6A 5BNPA 5HXVA 4YM2A 3IN9A 1YNAA 1JYIA 2IWGB 1VBE1 2Y38A 1HV1A 2WC2A 4Q4W1 1DZQA 2NQYA 4Q4Y2 3MF6A 2OA2A 2EXKA 4BH9A 3SH3A 3THTA 2EAKA 4IEUA 3RWNA 1W6OB 4Q4W2 5T5JA 1I9RA 1DZTA 2NYYA 3GHMA 2BYVE 3H3UA 1R1A2 1RUC1 3RI8A 2GALA 5GZCA 4K8FA 3E97A 4CEWC 3N3HA 1NY71 3VLBB 4AGRA 1CQ9A 4A7YA 1MEC3 2B39A 4YARA 2B45X 3MIGA 1BBT2 1ZNPA 3AZXA 2ZAHA 4YM0A 4PIXA 2PQQA 4HVRA 4L92A 4TSVA 2D93A 2BNMA 4PDWA 1NQDA 1EAH1 1S0DA 3AZVA 4I0WB 2MNGA 4C0HA 4HN1A 4Q0PA 4RGGA 4K20A 1NLSA 3OBRA 4B8EA 1AR81 1ULEA 2EA7A 1KS4A 3WG3A 3MIEA 5GKAC 1MEC1 2Q5TA 1J1LA 4IV3A 2WNUB 3WQ0A 1ENXA 3DKWA 5BNQA 3GZAA 1XNCA 1GICA 3HT2A 1PHMA 1MEC2 3JQXA 2WFF1 1FX5A 3AZWA 1G9CA 2ZGTA 4EN7B 4F3JA 1ND2B 5C33A 2PLV3 4JDOA 4QPGB 3LWCA 2DF7A 5DDJ2 4AI3A 2OUJA 1TMF3 3NV4A 4WV8A 2ZX2A 2MHFA 5GLVA 1W6NB 1YYNA 4QD2A 4P9WA 4GH4A 4NWVA 1VBE3 3PJQA 1A6CA 1S1AA 3GBGA 4P9LA 1MVQA 1S0FA 2YMZA 4KWLA 1YI7A 5I91A 3ZYPA 2R1DA 5FREA 1VRH1 1S0CA 1PGL2 2B9UA 3ZSMA 2EAAA 3LA7A 3OY8A 1BQPA 1F9KA 1ULGA 4Y4YA 4XIKA 3IPVB 3I2DA 4MXWB 3AXEA 4RL7A 1LTEA 3MLLA 1PVC1 1D4M3 3ECQA 4JQRA 4FPLA 3FMGA 4LE3A 1ZZ6A 2WFF2 4WZCA 1G6NA 4GB32 3VBFA 2C9AA 2BPA2 4PDWC 4YFZA 2A6YA 4XILA 2CGNA 3AP7A 3GBFA 4LR4A 3ZSJA 1TNRA 2XB6C 1NCRA 2VW0A 5EYXA 4LBNA 2ZGOA 1RMU3 1RUI3 1Y3TA 1SLCA 2A70A 2ZTNA 4TYSA 3MZHA 1LB2A 3AM2A 2ZMKA 1RHI2 1LR5A 2A7AA 2BVBA 1YI9A 1OQEA 3BOPA 1EAH2 3VBHC 4Q4X2 2VY0A 3TYJA 3WQ7A 1ZBE1 1DU3D 2BWAA 5T54A 1NXD1 3H0OA 4YZ5A 3AKPA 4E2SA 3AMMA 5SV5A 5D1IA 1W0OA 3E5UA 4H3WA 4M0HA 5BV6A 4K6BA 2QZ2A 4B7KA 1AR93 3UV9A 4FSJA 1ZYBA 1ND3C 3WCSA 4E4DX 4E4ZA 3ZFGC 1Q43A 4COZA 2O1QA 1GNHA 3TB0A 4M00A 2OW4A 3AYEA 1LEDA 5TSWA 1NLRA 3LZZA 5T52A 4BLIA 1ONAA 2GH8A 1Q5OA 1SLLA 4LBQA 4XF9A 2UWBA 1AYM2 2W39A 3ZFEB 4EN6B 4PIZA 4RS5C 3O5SA 5AC93 2TUNA 1EPWA 1LOBA 2HWB3 4J1WA 4L99A 4XFFA 5FRAA 2WNUC 2PELA 1O3TA 2R0FA 1H0BA 1CAUB 1CR7A 1WW7A 1M4WA 2PLV1 4BPZA 5B2GB 1XU2A 2EALA 4RHV1 1WD3A 1N47A 2YPJA 3HWJA 4IEYA 1PZ9A 1LGNA 1NA1B 5IK5A 4GXLA 2DVDA 3NSTA 2ARBA 3WW4A 5FFOC 2VECA 3IPVA 1OFNA 3CJIC 3MF9A 4H14A 3WQ1A 1UN1A 4OI4A 4GULA 3RYPA 3BTAA 1N1SA 1RVF3 1EV12 3LKJA 1PIV2 2WINB 1OOPC 1WW5A 3AYCA 4L8QA 4XFGA 1CJDA 4MUVA 5JR7B 1RUF1 3D4KA 4M0NA 3AJYA 3BALA 4E2QA 3TN93 3MYXA 3O0VA 5AVAA 2CL2A 5CADA 2ZKLA 3L2HA 4RR3A 3ZYJB 1BKZA 2HYKA 1RUC3 3D0JA 1R081 2YY1A 2X5IB 2WSVA 3ZN5A 1DGWX 4Y1ZA 1BEV3 1OOPA 4E27A 4D94A 5LK7B 1LJ7A 1FPN1 2GC2A 4BHPA 4FO9A 1J3PA 2DWRA 1CPMA 1OI6A 2D43A 1N3PA 1FPN2 2LALA 4XFIA 4Z1VA 1G9DA 4SBVA 1DGWA 1KDMA 3ZFFC 4OZXA 2R6QA 1H30A 2HEWF 5I0SA 2H0BA 3E6CC 1IPKA 1MQTA 3R6SA 3U0ZA 1COV1 4F83A 1O4TA 4K21A 3ILRA 5T5OA 3SLIA 1Z7S3 3WP5A 4OUSA 2AENA 1B09A 2ZZQA 1RUJ2 4Z2WA 1AJKA 1V6LA 4CDQA 1F31A 2ZCWA 1NCQC 5E89A 3DN7A 3LSEA 4OHYA 5F9TA 3H9AA 1QJU3 3WHTA 3ZYIB 3C3VA 4HL0A 4ONUA 1ND3A 2YUEA 3VKLA 4E9KA 1EV13 4XXAA 5IK4A 1R093 5JZGA 1AR91 2FMDA 5JPNB 5A3LA 1MS5A 1CONA 2Z2SB 3IKWA 1CAWB 2WQZC 1FNYA 2JG9C 1XYPA 1RGSA 2ERFA 3KS7A 4YGEA 5CFCC 4XEZA 4DRVA 2A6WA 4KG0A 1Q8PA 4MXVA 3WUCA 2VOXA 1RUI1 2X5IC 2XLGA 1XNBA 1IZ3A 2A73B 3URFA 4ZU5A 3ZXLA 2DVGA 2HWB2 1REFA 3ZYRA 1LODA 2D6OX 1DZRA 1UW8A 1O3RA 3KT4A 5KXEA 1MS9A 4FPHA 1JH5A 2PYTA 3UJOA 5FMOS 4H7MA 4KQ7A 1TQ5A 1VBE2 1XNDA 4M3CA 4FTBA 3CLPA 1PMIA 5GLTA 2VVEA 1TMF2 1SLAA 1DHKB 5EJ3A 1CX4A 2VOWA 3M1HA 1WLDA 2QVSB 2G9FA 3RMXA 2I74A 1LHVA 3CF6E 2WT0A 1FV2A 3M3OA 4O9GA 3SHRA 1X33A 1EY2A 3AMHA 4AFCA 5FPZA 4YFWA 1CAXB 3OD4A 1XXNA 3MIDA 2D98A 1A8DA 3NAPB 1QOOA 1CAUA 5GZFA 1PGW2 3WR0A 1VB4A 1GZ9A 2R1BA 3WOGA 1JUIA 4LO7A 1ZRCA 3POWA 3AB0A 2RR11 5ABJA 1ULCA 1QH6A 3HAGA 4GMP0 4N9HA 4P14A 1MS4A 1V9U3 1HXS3 1DDLA 1DQ6A 2W0XA 4R9BA 3MICA 3A0NA 2BNNA 3H1YA 1X8EA 4XZPA 3POSA 1DYKA 4LUKA 4XF0A 4ES9A 3MLJA 4DINB 3B5LB 4YG6A 2YYOA 1H1IA 2R071 2HWC2 4I3GA 4XXPA 1DF0A 3SNMA 2ZGMA 1LGBA 2DUQA 3WDUA 1NZCA 3RPQA 1LU1A 1D4M2 1XU1A 1YFXA 5FBZA 2GZWA 4I09A 4Y22B 1YIFA 3M3QA 5C4WA 3S7EA 5EZWA 1ZZ9A 1Q8QA 5SV8A 1H4HA 5DG2A 3IDBB 4FXGB 1AZDA 1JXNA 3VZKA 1Q56A 1MZ5A 5JPMB 4AVVA 1S0EA 2WS92 2BUKA 3ZX7A 2VNGA 1N1TA 1OSGA 1VBB3 3W59A 4R9CA 4EN8B 4RQPC 4FPOB 5F6LB 3TN92 2N7GA 2RS13 3ZXDA 1SLTA 3WW1A 3VBHB 1RTVA 2YROA 4EJRA 1LU2A 1GQHA 2V73A 2MEV3 4S2HA 1TE1B 3OF1A 4H55A 4COVA 2QFEA 2VG9A 2RMU3 4H7LA 3WV6A 1F5FA 2R043 1QJU2 2I2SA 1XE8A 4HKLA 3EXUA 2D7FA 4JGZA 3WDYA 3ES1A 1KD7A 4AVSA 4QQPA 4L97A 3VBFB 1OA2A 1AL23 5KHGA 1RUJ3 3AKTA 4FPKA 4OI1A 2P3KA 1QOSA 1H2MA 1YUDA 2Y26A 1SMVA 3DPRB 1X7NA 2A3WA 1MQTC 4COYA 4TZDA 2D5HA 1RUD1 3DGTA 4PJYA 2PTMA 1KRIA 3B93A 3MW3A 3OPZA 2XWJB 4B4RA 1JOJA 4GWMA 4YVWB 3VBUA 1WW4A 4AK3A 4MVTA 3IBMA 1UL9A 5IK8A 4XBLA 3D82A 1DQ4A 1VBD2 4BQ1A 2GH2A 3PVOA 3ZSLA 4KWKA 4B7EA 1FAYA 2MEV2 4DRRA 4Z92B 5JSRA 1QXRA 4LHLA 4B3NA 2GNMA 4UXAA 1VRH2 5JI7A 2UYBA 1LOAA 1F8VA 1WGPA 3USSA 1RMU1 1QJU1 4YZ4A 4PF5A 1HIXA 1GNZA 1AR92 2VQ0A 4LULA 4C0BA 4YM3A 1M06G 2QZ3A 1LKNA 3R0RA 3B01A 5E16A 3WW3A 4JC1A 5FCCA 1VRH3 4ZU4A 1KFUL 2DVBA 4J6GA 2BGCA 4NHLA 1Z7S2 5T55A 4Y20A 1G7YA 1K5MB 1DIWA 1QMJA 2IXHA 5A3MA 1AR61 3AX4A 1GQGA 1UX6A 1RHI3 4FOYA 3MPBA 2IFWA 1GZWB 3LOIA 5FO9B 3J8F1 1OPMA 4YVWA 3PVEA 4KGGA 1IKPA 1AYM3 4S2FA 2PHDA 1I1EA 2ZGPA 3FLTA 1PNFA 5J96B 2ZGNA 2RS51 1UPSA 2P34A 4Q1PA 1KFXL 2H0VA 4LE4A 4PLMA 1QJY3 1SLIA 3NW4A 4I3PA 4Q8KA 1MS8A 4N90A 1MQTB 4YG3A 2GMMA 2PHFA 3M8LA 3VDDC 1FT9A 2QDRA 4AFDA 1YIPA 1UAIA 5AFBA 3C2UA 2FHRA 2D6NA 4CEYB 1H4GA 2AYHA 4QX5A 3JCIA 4C1XA 4N53C 4FAHA 2R042 4P9GA 2BEOA 2ZGRA 1V00A 1DGRN 2HEYF 1EAH3 1Z0HA 2RMU2 2AZ5A 2ZX1A 5J37A 2WNVB 3I59A 4G3YC 2P3JA 4OHXA 2O8OA 4FPFA 4RR3B 3IT8A 4QPYA 1X8MA 2YZ4A 3ES4A 2IXCA 2UY8A 3D8CA 1CESA 1CN1A 3O7OA 4CDUB 5HI0A 5EV7A 4CDWB 5L73A 2RS12 1QHDA 3AMPA 4PQ9A 4HETA 1HRV2 1SBFA 3E5XA 3OBTA 4JV4A 2Q4SA 3WDWA 4XDQA 3WT3A 4IQPA 3FC0A 2VULA 4IEQA 4LHKA 1NCQB 4IEOA 3QOPA 2AGSA 1APNA 3ZMOA 3THPA 1MZFA 3KCCA 2VNRA 1W6QA 2AREA 2RJKA 4FP2A 2CY6A 4NHMA 1WUVA 2GN3A 1GSLA 5I0TA 2EVXA 4RR3C 4YGCA 2JECA 2Q1MA 1KITA 4RFT0 4OLLA 4MGIE 4PBOA 4QHBA 5CFDA 5K0UB 4AEJA 4M3CE 4AEKA 2XJQA 2HWC3 4XPVA 4FPEA 1V6JA 4PBPA 1OD5A 4FOVA 1AF9A 3I4IA 1X82A 1POV0 2Z69A 3WY6A 1RIRA 1YWKA 4R9AA 4N9IA 1HV0A 3ZN6A 4HVOA 3VDDB 1ND2A 2PAKA 2ZOEB 2PHUA 1LHWA 3M3CA 4XF3A 2A3YA 1H1AA 1RUNA 1SBEA 1RL3A 3AP9A 4FPJA 3N36A 4UW3A 3VBSB 3ZFGA 2IXJA 1PO13 1SQ4A 1W6QB 3VBRC 5FMOL 4Q4V2 3KZ4C 2WL1A 3MFAA 5J7MA 2C0ZA 1QQP1 2KA3A 3WHUA 3N7KA 1MACA 4AVCA 1OLRA 4GH4B 1RITA 1ZBE3 3VHOA 1VBA1 1REDA 2D6LX 1YFYA 5GLUA 1RUI2 3ILFA 4GH4C 2W08A 1O3QA 2XVLA 5CA6A 3JBG2 1ZBE2 4AHXA 4JGYC 1RUJ1 1NG0A 2R30A 3V0BB 4I0AA 4MXWA 5K0UA 4YVWC 1XYNA 3JB8A 1AYN3 5LEJA 3AP4A 3IDEA 3NV2A 2NN8A 2UY9A 3V0BA 2XBO1 4FPGA 1QDOA 5KXCA 2RM22 3NAPC 4Q4Y3 3BIWE 3LGRA 1AR63 1W2UA 3M3EA 3PTYA 4GKYA 5BXXA 1FATA 4AXOA 3OYWA 1VBA2 2DUPA 3WZ1A 3VDDA 2YV8A 4YNIA 1COV3 2CAVA 4I2OA 3EO6A 3QH7A 4XTPA 5I8TA 2Q1ZB 1QU0A 3DL3A 4WM7A 1RUH3 2P3IA 5A32B 4XIOA 1VBC3 1VBB1 3VBSA 3W9AA 1DGRA 1LOEA 1R1A3 3SXWA 5LK5A 3MIFA 3OY8B 2XPJA 4FOWA 4CZSA 4DY3A 4WVZA 1VBA3 2JKBA 2A5ZA 4X8NA 4HANA 4WVMB 1GLHA 1G8WA 2SBAA 2JG8A 4AE2A 1OLQA 2BNOA 5F1RA 2AR6A 3ACLA 3H3ZA 3MW4A 4FBFA 3M3IA 2AUYA 1B35C 1AXZA 1NCRC 3AMQA 4AI2A 4YGDA 4CEYC 4XFCA 4COUA 4KWJA 4HLTA 3WINE 3J26N 4JGZC 5J36A 2P37A 4FTSA 1RUF3 1Z78A 4JRAA 1C3HA 1GKBA 4R52A 1AR82 4HKWA 2K9ZA 4A7ZA 3WW2A 2XWBB 5T50A 3ZFFA 2WNVC 4WM8A 2OPKA 2D6MA 3EBRA 3JQWA 1FOD2 1WMEA 3GYDA 1VP6A 1C1LA 1GV9A 1LULA 3VBRA 2TBVA 3AKQA 1CJPA 5DG1A 1OPOA 1IQAA 2UURA 5BNPC 4XHXA 2VMHA 5A32A 1O4YA 4YYOA 4HN0A 3AMNA 4O9EA 2ZABA 1RUC2 2DCKA 4WM8C 1AR72 5ACA1 5T5PA 1LESA 1RUG1 4XQWA 4BZ4A