2R25A

Complex of ypd1 and sln1-r1 with bound mg2+ and bef3-
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
STIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphorelay intermediate protein YPD1
publication title Crystal structure of a complex between the phosphorelay protein YPD1 and the response regulator domain of SLN1 bound to a phosphoryl analog
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein/transferase
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2r25A00
1WN0A 2Q4FA 3U3BA 1TQGA 1I5NA 2LP4A 2OOCA 1YVIA 1SR2A 2LD6A 3KYIA 4PACA 2A0BA 3IQTA 1OXBA 1QSPA 3US6A 1BDJB 2LCHA 1C02A 1C03A 2R25A 1A0BA 1Y6DA 3MYFA 4EUKB 4G78A 3KYJA 1OXKA 1FR0A
chains in the Genus database with same CATH superfamily
2YLIA 3UMIA 2QNLA 5COGA 4YT8A 2LFDA 3JRMO 1D0ZA 256BA 2ZPAA 3FMSA 3JZ0A 4KI2A 4QDLA 2LP4A 3ZWIA 3LEOA 4YL1A 3ZSUA 3ZVRA 5AC4A 1ZU5A 2NPUA 1YVIA 3HNLA 2GA0A 2AWCA 2HJMA 3EH1A 2CDQA 3IQTA 3KKBA 4IAQA 2XL6A 4O7GA 4JIOA 3T6BA 3VAYA 2ZXOA 3ZTZA 4BJ5C 2KJGA 5L0GA 3J06A 4PJNA 3ZIBA 3EZIA 3WODF 1A7EA 1T6QA 2RD9A 3ZG1A 2YEVA 3RIPA 2DGJA 2R7TA 2GFHA 2Y3BA 5L0JA 3G4ZA 4EKWA 1BR4A 4AE4B 1RJ9A 2G3KA 3MYFA 5JRAA 4JKVA 2WVQA 4XPWA 1NZEA 5B1AC 2Q4FA 4NTFA 5DS6A 4CX9A 2LQGA 1B68A 2R7SA 4MVMA 3SP1A 5JVEA 2DYSC 3NYMA 4JTDB 3ZQYA 4PACA 3SYNA 1HW2A 2EIMC 4E7SA 2OJQA 4JEAA 5GPGB 1OW8A 1E86A 4U9EA 2I15A 2KQ9A 3T4RA 4A4AA 2R7VA 1N1CA 3BEHA 1H9GA 3CQZA 2XS1A 3GEEA 4JCZA 3QVZA 1G8XA 4PFOA 2R7XA 2Y69C 1OKKA 4Q4ZF 2DI3A 2ZD9A 3K1HA 2TMVP 1NU7D 1VLTA 2CW0F 3GEHA 4BJTA 1RCPA 1ORJA 2P7VA 4E17A 1NFOA 3KYJA 4I44A 1MMNA 3ZDLA 2M4EA 1LVKA 3AGTA 3EHNA 3RH3A 1HMDA 1KU2A 3LEVA 5JSLA 3V5XA 1VOMA 3DZAA 3RQFA 2KSFA 4KC9A 5TJ5E 4FAPB 2V3CC 1FMVA 4JRZA 2R03A 3DWWA 3UMKA 3C7JA 5F28E 5DLJA 2H7VC 3DD7A 3NMJA 4KNVA 3AG1C 4XLPF 4AX2A 1NFNA 2JD3A 2WZFA 4G7HF 3UMHA 5FZTA 4X0RA 3FVYA 1QVXA 4GEHA 4PJJA 2H8AA 3LNRA 2AU5A 4P9FA 4O6MA 2NUPA 2WZGA 1OR3A 2J7PA 2FGYA 2Q3TA 4MW3A 4F4BA 2J0WA 1M2VA 1ZHYA 2HSBA 2AWYA 4KBLA 2A69F 1TWGA 1OR2A 2VCBA 2J9BA 4O6NA 5CI9A 4CDVA 3B0VC 3VYWA 2ICWG 3C18A 3EJNA 2H7BA 3GODA 2R02A 4IAOA 3GWNA 4MVUA 3U2LA 5E2QA 3E9VA 3NDBB 1M6TA 2EPLX 1AUEA 3BRJA 5A6KA 2EPNA 1S05A 2M64A 3DE8A 1OXBA 2OCCC 3ASNC 3AGUA 4U5EE 1L7CA 4XQ1A 5KYXA 2HSQA 3GM2A 3QMKA 3TJ6A 2YLDA 3NMIA 3SXZA 4JTCB 1SZIA 1Q0DA 2P61A 1C02A 3DAGA 3KH2A 1K04A 1OW7A 4BJ5A 2PX0A 2D4UA 2WB7A 2WL8A 4JZAA 1F1MA 5D92A 3RF3A 5AGFA 1NSGB 1CGNA 3W8HA 3VF0A 2PFDA 1E85A 3U0CA 5A6BD 2OU6A 3UR3C 2RSEB 1PD0A 4DBRA 3TOMA 2B0HA 1D1CA 1H7IA 5JS5A 5JUAA 4JJGA 4OINF 5BQGA 2GAQA 3AQBA 1FMWA 5L3QA 3HLZA 1T9KA 3ABLC 4AE4A 4R32A 2L6HA 2YL3A 2CYDA 3UNGC 3AG3C 2BE5F 2IM8A 2R05A 3ZTMA 5L0CA 4YL3A 2YWAA 2EPOA 2Y39A 3DM5A 3V7OA 1VK5A 3FAPB 2LFFA 4IWBA 4DBQA 5BQIA 1JMWA 1BZ4A 1EA8A 4GQHA 4CJOA 4RDAA 1YZCA 2OJED 4EBJA 3SNHA 1PD1A 1FR0A 1EQ1A 3B29A 1CGOA 1EKYA 3TULA 3S0XA 4MNDA 2QTVA 1EI7A 2R7OA 3FXHA 1FFHA 3KMIA 3M4BA 1WASA 1HW1A 3DKAA 4LLCA 4B6IA 1OCCC 2A0BA 4BJ1A 4U5CE 4DRHB 4NQFA 4ANJA 4JEBA 4N06A 3EGDA 3EGXB 2YL1A 2ZXRA 4MVSA 1OCOC 3ASOC 3S9OA 4E0IA 4YN0B 2PNOA 2YLGA 2QLAA 3W2WA 2LCHA 5DQTA 3EZHA 3F46A 1T01A 4YK5A 2LIGA 4PFPA 2R25A 4OIOF 3NKDA 1XZPA 4MQ9F 4YT5A 3AJMA 4C3BA 5A6AA 2A0UA 1ST6A 4UDVA 2R7WA 3DM9B 4PJLA 3PDMP 4RBNA 4YJWA 1Z23A 2YRFA 3N24A 1BR2A 2NSGA 2OQMA 2YKZA 3C63A 3K6BA 4LDRA 2Y3HA 3AQCA 1YYJA 5FCLA 3GANA 2XLEA 2OOCA 2IXOA 2XS8A 1SR2A 3HKKA 3L8IA 1WOLA 5K0IA 2EIJC 2EPMX 3I5PA 2O9XA 3S84A 3B71A 1LS1A 2AP3A 3O10A 4J30B 3AOUA 3LUTB 4XEVA 2H7OA 3X2QC 3GORA 2R9RB 5AC5A 5HV9A 3IPMO 5L0IA 3S90A 3US6A 4NTBA 3EFOA 3LS0A 1HE1A 1Q0GA 2P6VA 3W2VA 5KYUB 1NBBA 4PK4A 1D1AA 2QE9A 3OEOA 4BG0A 1A41A 1Y6DA 3DJNB 1K05A 3GWLA 3DXJF 3TJ5A 1OW6A 1IW7F 2HUJA 2PBEA 3EGDB 1LM3B 1TQGA 3HTKC 3H65A 2B0JA 5L3VA 2W9YA 5T1DB 1I5NA 1YDIA 3K7DA 4NC3A 4CSAA 3LESA 5B3SC 4XLNF 1Y4CA 1J8MF 1HE9A 1LPEA 4DOZA 3C8ZA 5KYYA 3PHF2 4C7OA 1RMVA 4QI2A 1VB5A 3T9OA 1ZVZA 2Q9BA 3U9MA 1V4AA 2CCYA 1CPQA 4YT4A 1FTSA 3GEIA 1ZHWA 4CJGA 2IXPA 2WZLA 1JR8A 2P1AA 3N0TA 4I3MA 4EHPA 2MHRA 4DRJB 1GGQA 2YQYA 2CGEA 2DB4A 1ZHZA 3C8GD 3JYHA 4CSAC 4BEMJ 4IB4A 4O6YA 1E83A 2NSFA 4MVRA 2XL8A 1O87A 2HMZA 3RQEA 3RQGA 1HY5A 1QZXA 5E3CA 3DE9A 4EBKA 3AG4C 4LERA 3LLKA 3GM3A 4XEKA 3AG2C 3SXMA 5B3IA 1RXQA 2X51A 2QUPA 3U3BA 4D4NA 4NCQA 4CBEA 5CI8A 1R5ID 5COMA 3K33A 3EFOB 3K1IA 3HNKA 1Q0KA 4MVZA 1J8YF 2WVNA 4G0HA 1Z6AA 4DRIB 4DVYP 1TFKB 3WAQA 3SXYA 4LLEA 1LS4A 2J45A 5BUOA 1WWPA 2L6FA 3NYJA 4G7OF 2XM0A 1YARO 3MBGA 2R7UA 5L0DA 3EQLF 1Z63A 1OCZC 2HJ3A 2JPUA 2VH3A 3PMRA 3DJUB 3K1IC 2W4BA 3CAXA 1MQVA 2FFHA 3Q7GA 3ZC4A 4DVZA 5DS4A 2UUIA 3NKEA 3RVYA 3LJBA 2KW3C 4U5HA 3SEOA 3ZQVA 1O3UA 5KYYB 1C03A 2OEXA 1FNTc 1M57C 4MTFA 1Z5ZA 4ZLDA 3LLIA 4ULWA 2AVKA 2J7PD 2XM4A 5T3TA 1CGME 1TKNA 4J7TA 1YA9A 1QKRA 3GM1A 2A1DD 2P0NA 3O55A 4Z9IA 5A6BA 4OIPF 4LACB 3SXKA 5T3WA 3CSKA 1Q0MA 3KPHA 4ZLCA 3MFNA 2HKVA 1LKXA 1FFTC 3EGXA 3ECSA 4I1MA 4DJ9A 2CNWD 4E18A 4J32B 1S7ZA 4CDYA 5L0HA 4U5FE 4IRUA 3B0UX 1H6GA 1M2OA 1TWHA 4MTOA 3U8VA 2BL2A 3R2PA 1KNYA 2XLVA 1YYXA 3QTHA 3EG9B 4EIYA 3L34A 2NUTA 2HS5A 2J0XA 1W2WA 4AL1A 1K40A 2QY9A 5A6JA 3HNJA 3LAYA 1PV3A 4WGYA 2GWWA 5COFA 1NLXA 4JURI 5A69A 1ZU4A 3W8IA 3ABMC 1APCA 4J7YA 4H54A 4L6RA 3TOLA 1D0YA 3O39A 3OWTA 3TQOA 1G4US 1T5OA 3Q7LA 4MW8A 4NTAA 3SZRA 4C3EA 1TR2A 2XLDA 4OIQF 3EHMA 2J9UA 4E7ZA 1LE2A 2WVOA 5JLIA 4CDAA 3JSEO 5KYUA 4BPMA 4MVQA 1LIHA 3HJCA 4FESA 2YL0A 2XLMA 4JVSA 3H2VA 4QI0A 4FX5A 5DQZA 2XXAB 1TWCA 4CS8A 4P9TA 3CEXA 4OD4A 3EPVA 4N4WA 2L81A 1GQAA 4YL0A 1QSPA 1AVOB 4CIPA 1UFBA 1UG7A 5L0FA 4JJFA 1LE4A 3IQ6A 3M15A 1ZHTA 4N6HA 4YT2A 3IEEA 2ZXPA 3NG1A 2Q7RA 2G3VA 4JTAB 4LDQA 1VLSA 2IXMA 4U5DE 3RFYA 1A0BA 3K66A 4MVOA 1VTMP 4C7OB 4EUKB 3JTLO 3V5ZA 3VRCA 4ER9A 1JRAA 1VMAA 4CS8C 3V5YA 1V55C 1A7DA 2BC5A 1JPJA 2NUTB 3LS1A 4WGZA 5D91A 3RVZA 1RKEB 2HZ8A 1U0BB 2HFIA 2KGOA 1I4ZA 3E70C 4Z9HA 3U2MA 1YAUO 3X1OA 3DAFA 4AK9A 4CS9A 1YA7O 2A68F 4I1OB 1V54C 2J46A 3IQCA 3KYIA 4U5BE 5B1BC 4BEJA 1E84A 2ASRA 4JC7A 1BR1A 3DMDA 5DVWA 3JSZA 4JW1A 4YWQA 2VB6A 3FAJA 1JAFA 1QPUA 3S27A 1MNDA 1ZHXA 2IYLD 2HV7A 4ULVA 4M63A 2OKUA 3Q6NA 4CS9C 1VYIA 3VM6A 1NU9C 2KC3A 3MLGA 2KYHA 4Z9JA 2W4MA 3L0IA 3RKOF 1VYKA 1LI5A 2XLOA 3I4UA 3M79A 4H4KC 4HFKB 1OXKA 1C17M 2ETSA 4D4XA 2VASA 1SF8A 4U5GA 3QVYA 2GDCA 2DYRC 1QLEC 1QQ3A 2MWQA 3MX3A 3O6XA 4N6CA 4EBBA 4OD5A 1PCXA 1WGWA 1JOGA 1A7VA 4HE8D 4LDKA 1YZAA 2J9WA 2LD6A 1MNEA 1YJGA 2OEVA 3L8JA 2Y3GA 2R7QA 4PJMA 1YLMA 2KK1A 2KNHA 2VCAA 3JRTA 5JT4A 2I8BA 2L6GA 2L9JA 3S29A 2A6HF 4IARA 3QZCA 3FHDA 4K0DA 4IGGA 1RKCA 3C8GA 2EPKX 1OKKD 3TK0A 3C62A 2YZSA 4CS7A 1ORYA 3N2ZB 4XTKA 2J9VA 3LNMB 4G78A 4GYTA 2UUHA 5BQHA 1MMGA 2L7AA 3PCVA 5F5FA 3Q6MA 1L3PA 2LSEA 3EG9A 4JE9A 2D5RB 4WABA 5KYWA 1DOWA 1LI7A 4ONSA 3A9CA 3R7CA 3U9JA 5EHHA 2R7RA 4Q5SF 1RJ9B 2EILC 2J8WA 1DOVA 4MS2A 4Q7CA 1FAPB 1JPNA 4AL0A 4CIHA 1ZW3A 1TFOB 2V26A 2HMQA 1Q0FA 3TD7A 2LK4A 5KYNA 1E2XA 4FWVA 1MMDA 3U5SA 1BDJB 4HFFB 1WATA 2OG2A 3UGPA 2X0CA 3UGOA 3POVA 2VC9A 1M56C 4OIRF 3T6GB 2W45A 3WG7C 1BBHA 2F22A 1T6IA 2YVKA 1Z7Qc 2A6EF 4EWCA 5CIVA 2XXAA 2PX3A 4XEFA 2Z15A 3C8GB 1D1BA 1IZMA 1I4YA 3FOOA 3JT1A 4K7BA 3QW0A 3HNIA 2JX0A 4XWJA 3S28A 1O5HA 1V74B 2CNWA 3ATPA 3M1CB 3M4CA 4XPXA 2EINC 4RD9A 3NMKA 3G4XA 2YHSA 4HEAJ 3T6JA 1ZZPA 4IJJA 5DS5A 2E87A 2IOQA 2NG1A 4G7ZF 5E3AA 2Q9AA 3IQ5A 4PR9A 1OCRC 3RW0A 1GS9A 1T6UA 4KNWA 3RYLA 4JCHA 3W4YA 3WHNA 3FDQA 4E0HA 1OQCA 4W8PA 5EGYA 5KYWB 3B9QA 3CZ6A 2YL7A 1WTYA 1XZQA 3I5QA 3NYLA 3FOPA 3JCUQ 4W8KA 1RKEA 3JYYA 3B0PA 5JP7A 1TWAA 1HMOA 1H9TA 1XWJA 3OA1A 1KTMA 4MTGA 1G4WR 1CPRA 1SYQA 3ABKC 5HSWA 4U9DA 1AEPA 5E33A 3KL4A 2G62A 3NRHA 1WN0A 2Q9CA 2ZXWC 1R4TA 2XRHA 3MYIA 3U3FA 3DI5A 4BJ6A 4A2NB 2PF4E 3F47A 2Y3DA 3IHUA 3U8PA 3ITFA 2NUPB 4DXWA 3G50A 1Z3IX 4WJ0A 1ZYRF 2FAPB 3L1MA 5F5HA 1MMAA 3EH2A 1M2VB 3QW1A 3A11A 4O79A 4XPYA 1U6HA 1U89A 2XLWA 2PP4A 4C3DA 1NG1A 1SMYF 2MYSA 4BJ6C 2XL4A 4K1OA 4P6IC 5EK0A 2EIKC 2IBFA 1G5ZA 1ORSC 2C03A 5IY5C 2XSEA 1ZW2A 2Q00A 2HV6A 3H2UA 4NY3A 2VCCA 2XLHA 5KYXB 1D0XA 1GM5A 2IXNA 2C04A
chains in the Genus database with same CATH topology
1WN0A 2Q4FA 3U3BA 1TQGA 1I5NA 2LP4A 2OOCA 1YVIA 1SR2A 2LD6A 3KYIA 4PACA 2A0BA 3IQTA 1OXBA 1QSPA 3US6A 1BDJB 2LCHA 1C02A 1C03A 2R25A 1A0BA 1Y6DA 3MYFA 4EUKB 4G78A 3KYJA 1OXKA 1FR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WN0 A;  2Q4F A;  3U3B A;  1TQG A;  1I5N A;  2LP4 A;  2OOC A;  1YVI A;  1SR2 A;  2LD6 A;  3KYI A;  4PAC A;  2A0B A;  3IQT A;  1OXB A;  1QSP A;  3US6 A;  1BDJ B;  2LCH A;  1C02 A;  1C03 A;  2R25 A;  1A0B A;  1Y6D A;  3MYF A;  4EUK B;  4G78 A;  3KYJ A;  1OXK A;  1FR0 A; 
#chains in the Genus database with same CATH topology
 2YLI A;  3UMI A;  2QNL A;  5COG A;  4YT8 A;  2LFD A;  3JRM O;  1D0Z A;  256B A;  2ZPA A;  3FMS A;  3JZ0 A;  4KI2 A;  4QDL A;  2LP4 A;  3ZWI A;  3LEO A;  4YL1 A;  3ZSU A;  3ZVR A;  5AC4 A;  1ZU5 A;  2NPU A;  1YVI A;  3HNL A;  2GA0 A;  2AWC A;  2HJM A;  3EH1 A;  2CDQ A;  3IQT A;  3KKB A;  4IAQ A;  2XL6 A;  4O7G A;  4JIO A;  3T6B A;  3VAY A;  2ZXO A;  3ZTZ A;  4BJ5 C;  2KJG A;  5L0G A;  3J06 A;  4PJN A;  3ZIB A;  3EZI A;  3WOD F;  1A7E A;  1T6Q A;  2RD9 A;  3ZG1 A;  2YEV A;  3RIP A;  2DGJ A;  2R7T A;  2GFH A;  2Y3B A;  5L0J A;  3G4Z A;  4EKW A;  1BR4 A;  4AE4 B;  1RJ9 A;  2G3K A;  3MYF A;  5JRA A;  4JKV A;  2WVQ A;  4XPW A;  1NZE A;  5B1A C;  2Q4F A;  4NTF A;  5DS6 A;  4CX9 A;  2LQG A;  1B68 A;  2R7S A;  4MVM A;  3SP1 A;  5JVE A;  2DYS C;  3NYM A;  4JTD B;  3ZQY A;  4PAC A;  3SYN A;  1HW2 A;  2EIM C;  4E7S A;  2OJQ A;  4JEA A;  5GPG B;  1OW8 A;  1E86 A;  4U9E A;  2I15 A;  2KQ9 A;  3T4R A;  4A4A A;  2R7V A;  1N1C A;  3BEH A;  1H9G A;  3CQZ A;  2XS1 A;  3GEE A;  4JCZ A;  3QVZ A;  1G8X A;  4PFO A;  2R7X A;  2Y69 C;  1OKK A;  4Q4Z F;  2DI3 A;  2ZD9 A;  3K1H A;  2TMV P;  1NU7 D;  1VLT A;  2CW0 F;  3GEH A;  4BJT A;  1RCP A;  1ORJ A;  2P7V A;  4E17 A;  1NFO A;  3KYJ A;  4I44 A;  1MMN A;  3ZDL A;  2M4E A;  1LVK A;  3AGT A;  3EHN A;  3RH3 A;  1HMD A;  1KU2 A;  3LEV A;  5JSL A;  3V5X A;  1VOM A;  3DZA A;  3RQF A;  2KSF A;  4KC9 A;  5TJ5 E;  4FAP B;  2V3C C;  1FMV A;  4JRZ A;  2R03 A;  3DWW A;  3UMK A;  3C7J A;  5F28 E;  5DLJ A;  2H7V C;  3DD7 A;  3NMJ A;  4KNV A;  3AG1 C;  4XLP F;  4AX2 A;  1NFN A;  2JD3 A;  2WZF A;  4G7H F;  3UMH A;  5FZT A;  4X0R A;  3FVY A;  1QVX A;  4GEH A;  4PJJ A;  2H8A A;  3LNR A;  2AU5 A;  4P9F A;  4O6M A;  2NUP A;  2WZG A;  1OR3 A;  2J7P A;  2FGY A;  2Q3T A;  4MW3 A;  4F4B A;  2J0W A;  1M2V A;  1ZHY A;  2HSB A;  2AWY A;  4KBL A;  2A69 F;  1TWG A;  1OR2 A;  2VCB A;  2J9B A;  4O6N A;  5CI9 A;  4CDV A;  3B0V C;  3VYW A;  2ICW G;  3C18 A;  3EJN A;  2H7B A;  3GOD A;  2R02 A;  4IAO A;  3GWN A;  4MVU A;  3U2L A;  5E2Q A;  3E9V A;  3NDB B;  1M6T A;  2EPL X;  1AUE A;  3BRJ A;  5A6K A;  2EPN A;  1S05 A;  2M64 A;  3DE8 A;  1OXB A;  2OCC C;  3ASN C;  3AGU A;  4U5E E;  1L7C A;  4XQ1 A;  5KYX A;  2HSQ A;  3GM2 A;  3QMK A;  3TJ6 A;  2YLD A;  3NMI A;  3SXZ A;  4JTC B;  1SZI A;  1Q0D A;  2P61 A;  1C02 A;  3DAG A;  3KH2 A;  1K04 A;  1OW7 A;  4BJ5 A;  2PX0 A;  2D4U A;  2WB7 A;  2WL8 A;  4JZA A;  1F1M A;  5D92 A;  3RF3 A;  5AGF A;  1NSG B;  1CGN A;  3W8H A;  3VF0 A;  2PFD A;  1E85 A;  3U0C A;  5A6B D;  2OU6 A;  3UR3 C;  2RSE B;  1PD0 A;  4DBR A;  3TOM A;  2B0H A;  1D1C A;  1H7I A;  5JS5 A;  5JUA A;  4JJG A;  4OIN F;  5BQG A;  2GAQ A;  3AQB A;  1FMW A;  5L3Q A;  3HLZ A;  1T9K A;  3ABL C;  4AE4 A;  4R32 A;  2L6H A;  2YL3 A;  2CYD A;  3UNG C;  3AG3 C;  2BE5 F;  2IM8 A;  2R05 A;  3ZTM A;  5L0C A;  4YL3 A;  2YWA A;  2EPO A;  2Y39 A;  3DM5 A;  3V7O A;  1VK5 A;  3FAP B;  2LFF A;  4IWB A;  4DBQ A;  5BQI A;  1JMW A;  1BZ4 A;  1EA8 A;  4GQH A;  4CJO A;  4RDA A;  1YZC A;  2OJE D;  4EBJ A;  3SNH A;  1PD1 A;  1FR0 A;  1EQ1 A;  3B29 A;  1CGO A;  1EKY A;  3TUL A;  3S0X A;  4MND A;  2QTV A;  1EI7 A;  2R7O A;  3FXH A;  1FFH A;  3KMI A;  3M4B A;  1WAS A;  1HW1 A;  3DKA A;  4LLC A;  4B6I A;  1OCC C;  2A0B A;  4BJ1 A;  4U5C E;  4DRH B;  4NQF A;  4ANJ A;  4JEB A;  4N06 A;  3EGD A;  3EGX B;  2YL1 A;  2ZXR A;  4MVS A;  1OCO C;  3ASO C;  3S9O A;  4E0I A;  4YN0 B;  2PNO A;  2YLG A;  2QLA A;  3W2W A;  2LCH A;  5DQT A;  3EZH A;  3F46 A;  1T01 A;  4YK5 A;  2LIG A;  4PFP A;  2R25 A;  4OIO F;  3NKD A;  1XZP A;  4MQ9 F;  4YT5 A;  3AJM A;  4C3B A;  5A6A A;  2A0U A;  1ST6 A;  4UDV A;  2R7W A;  3DM9 B;  4PJL A;  3PDM P;  4RBN A;  4YJW A;  1Z23 A;  2YRF A;  3N24 A;  1BR2 A;  2NSG A;  2OQM A;  2YKZ A;  3C63 A;  3K6B A;  4LDR A;  2Y3H A;  3AQC A;  1YYJ A;  5FCL A;  3GAN A;  2XLE A;  2OOC A;  2IXO A;  2XS8 A;  1SR2 A;  3HKK A;  3L8I A;  1WOL A;  5K0I A;  2EIJ C;  2EPM X;  3I5P A;  2O9X A;  3S84 A;  3B71 A;  1LS1 A;  2AP3 A;  3O10 A;  4J30 B;  3AOU A;  3LUT B;  4XEV A;  2H7O A;  3X2Q C;  3GOR A;  2R9R B;  5AC5 A;  5HV9 A;  3IPM O;  5L0I A;  3S90 A;  3US6 A;  4NTB A;  3EFO A;  3LS0 A;  1HE1 A;  1Q0G A;  2P6V A;  3W2V A;  5KYU B;  1NBB A;  4PK4 A;  1D1A A;  2QE9 A;  3OEO A;  4BG0 A;  1A41 A;  1Y6D A;  3DJN B;  1K05 A;  3GWL A;  3DXJ F;  3TJ5 A;  1OW6 A;  1IW7 F;  2HUJ A;  2PBE A;  3EGD B;  1LM3 B;  1TQG A;  3HTK C;  3H65 A;  2B0J A;  5L3V A;  2W9Y A;  5T1D B;  1I5N A;  1YDI A;  3K7D A;  4NC3 A;  4CSA A;  3LES A;  5B3S C;  4XLN F;  1Y4C A;  1J8M F;  1HE9 A;  1LPE A;  4DOZ A;  3C8Z A;  5KYY A;  3PHF 2;  4C7O A;  1RMV A;  4QI2 A;  1VB5 A;  3T9O A;  1ZVZ A;  2Q9B A;  3U9M A;  1V4A A;  2CCY A;  1CPQ A;  4YT4 A;  1FTS A;  3GEI A;  1ZHW A;  4CJG A;  2IXP A;  2WZL A;  1JR8 A;  2P1A A;  3N0T A;  4I3M A;  4EHP A;  2MHR A;  4DRJ B;  1GGQ A;  2YQY A;  2CGE A;  2DB4 A;  1ZHZ A;  3C8G D;  3JYH A;  4CSA C;  4BEM J;  4IB4 A;  4O6Y A;  1E83 A;  2NSF A;  4MVR A;  2XL8 A;  1O87 A;  2HMZ A;  3RQE A;  3RQG A;  1HY5 A;  1QZX A;  5E3C A;  3DE9 A;  4EBK A;  3AG4 C;  4LER A;  3LLK A;  3GM3 A;  4XEK A;  3AG2 C;  3SXM A;  5B3I A;  1RXQ A;  2X51 A;  2QUP A;  3U3B A;  4D4N A;  4NCQ A;  4CBE A;  5CI8 A;  1R5I D;  5COM A;  3K33 A;  3EFO B;  3K1I A;  3HNK A;  1Q0K A;  4MVZ A;  1J8Y F;  2WVN A;  4G0H A;  1Z6A A;  4DRI B;  4DVY P;  1TFK B;  3WAQ A;  3SXY A;  4LLE A;  1LS4 A;  2J45 A;  5BUO A;  1WWP A;  2L6F A;  3NYJ A;  4G7O F;  2XM0 A;  1YAR O;  3MBG A;  2R7U A;  5L0D A;  3EQL F;  1Z63 A;  1OCZ C;  2HJ3 A;  2JPU A;  2VH3 A;  3PMR A;  3DJU B;  3K1I C;  2W4B A;  3CAX A;  1MQV A;  2FFH A;  3Q7G A;  3ZC4 A;  4DVZ A;  5DS4 A;  2UUI A;  3NKE A;  3RVY A;  3LJB A;  2KW3 C;  4U5H A;  3SEO A;  3ZQV A;  1O3U A;  5KYY B;  1C03 A;  2OEX A;  1FNT c;  1M57 C;  4MTF A;  1Z5Z A;  4ZLD A;  3LLI A;  4ULW A;  2AVK A;  2J7P D;  2XM4 A;  5T3T A;  1CGM E;  1TKN A;  4J7T A;  1YA9 A;  1QKR A;  3GM1 A;  2A1D D;  2P0N A;  3O55 A;  4Z9I A;  5A6B A;  4OIP F;  4LAC B;  3SXK A;  5T3W A;  3CSK A;  1Q0M A;  3KPH A;  4ZLC A;  3MFN A;  2HKV A;  1LKX A;  1FFT C;  3EGX A;  3ECS A;  4I1M A;  4DJ9 A;  2CNW D;  4E18 A;  4J32 B;  1S7Z A;  4CDY A;  5L0H A;  4U5F E;  4IRU A;  3B0U X;  1H6G A;  1M2O A;  1TWH A;  4MTO A;  3U8V A;  2BL2 A;  3R2P A;  1KNY A;  2XLV A;  1YYX A;  3QTH A;  3EG9 B;  4EIY A;  3L34 A;  2NUT A;  2HS5 A;  2J0X A;  1W2W A;  4AL1 A;  1K40 A;  2QY9 A;  5A6J A;  3HNJ A;  3LAY A;  1PV3 A;  4WGY A;  2GWW A;  5COF A;  1NLX A;  4JUR I;  5A69 A;  1ZU4 A;  3W8I A;  3ABM C;  1APC A;  4J7Y A;  4H54 A;  4L6R A;  3TOL A;  1D0Y A;  3O39 A;  3OWT A;  3TQO A;  1G4U S;  1T5O A;  3Q7L A;  4MW8 A;  4NTA A;  3SZR A;  4C3E A;  1TR2 A;  2XLD A;  4OIQ F;  3EHM A;  2J9U A;  4E7Z A;  1LE2 A;  2WVO A;  5JLI A;  4CDA A;  3JSE O;  5KYU A;  4BPM A;  4MVQ A;  1LIH A;  3HJC A;  4FES A;  2YL0 A;  2XLM A;  4JVS A;  3H2V A;  4QI0 A;  4FX5 A;  5DQZ A;  2XXA B;  1TWC A;  4CS8 A;  4P9T A;  3CEX A;  4OD4 A;  3EPV A;  4N4W A;  2L81 A;  1GQA A;  4YL0 A;  1QSP A;  1AVO B;  4CIP A;  1UFB A;  1UG7 A;  5L0F A;  4JJF A;  1LE4 A;  3IQ6 A;  3M15 A;  1ZHT A;  4N6H A;  4YT2 A;  3IEE A;  2ZXP A;  3NG1 A;  2Q7R A;  2G3V A;  4JTA B;  4LDQ A;  1VLS A;  2IXM A;  4U5D E;  3RFY A;  1A0B A;  3K66 A;  4MVO A;  1VTM P;  4C7O B;  4EUK B;  3JTL O;  3V5Z A;  3VRC A;  4ER9 A;  1JRA A;  1VMA A;  4CS8 C;  3V5Y A;  1V55 C;  1A7D A;  2BC5 A;  1JPJ A;  2NUT B;  3LS1 A;  4WGZ A;  5D91 A;  3RVZ A;  1RKE B;  2HZ8 A;  1U0B B;  2HFI A;  2KGO A;  1I4Z A;  3E70 C;  4Z9H A;  3U2M A;  1YAU O;  3X1O A;  3DAF A;  4AK9 A;  4CS9 A;  1YA7 O;  2A68 F;  4I1O B;  1V54 C;  2J46 A;  3IQC A;  3KYI A;  4U5B E;  5B1B C;  4BEJ A;  1E84 A;  2ASR A;  4JC7 A;  1BR1 A;  3DMD A;  5DVW A;  3JSZ A;  4JW1 A;  4YWQ A;  2VB6 A;  3FAJ A;  1JAF A;  1QPU A;  3S27 A;  1MND A;  1ZHX A;  2IYL D;  2HV7 A;  4ULV A;  4M63 A;  2OKU A;  3Q6N A;  4CS9 C;  1VYI A;  3VM6 A;  1NU9 C;  2KC3 A;  3MLG A;  2KYH A;  4Z9J A;  2W4M A;  3L0I A;  3RKO F;  1VYK A;  1LI5 A;  2XLO A;  3I4U A;  3M79 A;  4H4K C;  4HFK B;  1OXK A;  1C17 M;  2ETS A;  4D4X A;  2VAS A;  1SF8 A;  4U5G A;  3QVY A;  2GDC A;  2DYR C;  1QLE C;  1QQ3 A;  2MWQ A;  3MX3 A;  3O6X A;  4N6C A;  4EBB A;  4OD5 A;  1PCX A;  1WGW A;  1JOG A;  1A7V A;  4HE8 D;  4LDK A;  1YZA A;  2J9W A;  2LD6 A;  1MNE A;  1YJG A;  2OEV A;  3L8J A;  2Y3G A;  2R7Q A;  4PJM A;  1YLM A;  2KK1 A;  2KNH A;  2VCA A;  3JRT A;  5JT4 A;  2I8B A;  2L6G A;  2L9J A;  3S29 A;  2A6H F;  4IAR A;  3QZC A;  3FHD A;  4K0D A;  4IGG A;  1RKC A;  3C8G A;  2EPK X;  1OKK D;  3TK0 A;  3C62 A;  2YZS A;  4CS7 A;  1ORY A;  3N2Z B;  4XTK A;  2J9V A;  3LNM B;  4G78 A;  4GYT A;  2UUH A;  5BQH A;  1MMG A;  2L7A A;  3PCV A;  5F5F A;  3Q6M A;  1L3P A;  2LSE A;  3EG9 A;  4JE9 A;  2D5R B;  4WAB A;  5KYW A;  1DOW A;  1LI7 A;  4ONS A;  3A9C A;  3R7C A;  3U9J A;  5EHH A;  2R7R A;  4Q5S F;  1RJ9 B;  2EIL C;  2J8W A;  1DOV A;  4MS2 A;  4Q7C A;  1FAP B;  1JPN A;  4AL0 A;  4CIH A;  1ZW3 A;  1TFO B;  2V26 A;  2HMQ A;  1Q0F A;  3TD7 A;  2LK4 A;  5KYN A;  1E2X A;  4FWV A;  1MMD A;  3U5S A;  1BDJ B;  4HFF B;  1WAT A;  2OG2 A;  3UGP A;  2X0C A;  3UGO A;  3POV A;  2VC9 A;  1M56 C;  4OIR F;  3T6G B;  2W45 A;  3WG7 C;  1BBH A;  2F22 A;  1T6I A;  2YVK A;  1Z7Q c;  2A6E F;  4EWC A;  5CIV A;  2XXA A;  2PX3 A;  4XEF A;  2Z15 A;  3C8G B;  1D1B A;  1IZM A;  1I4Y A;  3FOO A;  3JT1 A;  4K7B A;  3QW0 A;  3HNI A;  2JX0 A;  4XWJ A;  3S28 A;  1O5H A;  1V74 B;  2CNW A;  3ATP A;  3M1C B;  3M4C A;  4XPX A;  2EIN C;  4RD9 A;  3NMK A;  3G4X A;  2YHS A;  4HEA J;  3T6J A;  1ZZP A;  4IJJ A;  5DS5 A;  2E87 A;  2IOQ A;  2NG1 A;  4G7Z F;  5E3A A;  2Q9A A;  3IQ5 A;  4PR9 A;  1OCR C;  3RW0 A;  1GS9 A;  1T6U A;  4KNW A;  3RYL A;  4JCH A;  3W4Y A;  3WHN A;  3FDQ A;  4E0H A;  1OQC A;  4W8P A;  5EGY A;  5KYW B;  3B9Q A;  3CZ6 A;  2YL7 A;  1WTY A;  1XZQ A;  3I5Q A;  3NYL A;  3FOP A;  3JCU Q;  4W8K A;  1RKE A;  3JYY A;  3B0P A;  5JP7 A;  1TWA A;  1HMO A;  1H9T A;  1XWJ A;  3OA1 A;  1KTM A;  4MTG A;  1G4W R;  1CPR A;  1SYQ A;  3ABK C;  5HSW A;  4U9D A;  1AEP A;  5E33 A;  3KL4 A;  2G62 A;  3NRH A;  1WN0 A;  2Q9C A;  2ZXW C;  1R4T A;  2XRH A;  3MYI A;  3U3F A;  3DI5 A;  4BJ6 A;  4A2N B;  2PF4 E;  3F47 A;  2Y3D A;  3IHU A;  3U8P A;  3ITF A;  2NUP B;  4DXW A;  3G50 A;  1Z3I X;  4WJ0 A;  1ZYR F;  2FAP B;  3L1M A;  5F5H A;  1MMA A;  3EH2 A;  1M2V B;  3QW1 A;  3A11 A;  4O79 A;  4XPY A;  1U6H A;  1U89 A;  2XLW A;  2PP4 A;  4C3D A;  1NG1 A;  1SMY F;  2MYS A;  4BJ6 C;  2XL4 A;  4K1O A;  4P6I C;  5EK0 A;  2EIK C;  2IBF A;  1G5Z A;  1ORS C;  2C03 A;  5IY5 C;  2XSE A;  1ZW2 A;  2Q00 A;  2HV6 A;  3H2U A;  4NY3 A;  2VCC A;  2XLH A;  5KYX B;  1D0X A;  1GM5 A;  2IXN A;  2C04 A; 
#chains in the Genus database with same CATH homology
 1WN0 A;  2Q4F A;  3U3B A;  1TQG A;  1I5N A;  2LP4 A;  2OOC A;  1YVI A;  1SR2 A;  2LD6 A;  3KYI A;  4PAC A;  2A0B A;  3IQT A;  1OXB A;  1QSP A;  3US6 A;  1BDJ B;  2LCH A;  1C02 A;  1C03 A;  2R25 A;  1A0B A;  1Y6D A;  3MYF A;  4EUK B;  4G78 A;  3KYJ A;  1OXK A;  1FR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...