2R2CA

Crystal structure of a domain of the outer membrane lipoprotein omp28 from porphyromonas gingivalis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
121
Chain Sequence
KSYKTWDVPIAKINIFAVAEYTDTQKIKVTVKGKILEGNTLPKSMVQVYLLEDKNHVLRGAVNGIWGEEFVNLKDYLYTYAVEPLSGMSFVAENYSIVAFVYDVQTFEVYDVVHVKINPQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 28 kDa outer membrane protein Omp28
publication title The crystal structure of a domain of the outer membrane lipoprotein Omp28 from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Membrane protein
total genus 23
structure length 121
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11551 Omp28 Outer membrane protein Omp28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2cA00
4LLQA 2FJGA 3QUYD 5SX5H 1RUAH 1C12B 3MA9L 1G9NH 4V1DA 3OV6A 1CVRA 1ZHKB 3MLTA 5BRZA 4O02L 3UTSE 1S7QB 4OQTL 1T0MA 1XGRB 2UY7A 3ALPA 4MJID 1HKLL 3C6SA 3UTQA 1ULVA 3WNMA 3MJ8B 3BE1H 5EU6B 1R5VB 5CINH 5FO8B 4ONFH 1U8MA 4UNVA 2NYYC 1G7LA 2GY7B 3ARRA 1T1ZA 3ZYIA 1K4DB 2MQ3A 4AT6B 5FM8A 3P4NB 4M3KB 3EBAA 4ELKA 1YQ2A 1RJZA 2X4PB 4KJYA 2ATKB 3TYGL 3Q3GA 2G5BA 1ACYL 1JP5A 1KG0A 5FUCC 3MBED 1MFAL 2EXYD 3CMOL 3RWCA 5T1LB 4NJAH 3LMJL 3NIFE 4X6DA 4KI5C 4LLDA 2ITCA 5K9OB 1KJ2A 3NCJH 1IGFL 1FP5A 3B3IA 1A3LH 4ONGH 4FQJH 1G7IA 3TBYA 2W07A 1CLZL 1UVQA 1ROWA 4L9DA 1YUHB 4QRUA 4UDUA 1ZLVK 3KXFA 1KLUB 5I1HL 1T4KA 4HV8B 5GSVB 4APQA 3QJHA 3K2MC 2Z92B 4LEXL 2HG5A 3B9VA 1G7JA 4TRPH 1FO0L 5C7XL 4LIQL 4Z7OF 3W2DH 3BEWA 3C6LD 2IBZX 5J6GB 3QWOA 3R1GL 2VDMH 1AO7B 2IADB 3EJZD 5JHDD 3V4UH 5HPMA 1BQUA 4WI8A 5DJ2A 3IJHB 1RZIA 4ZO7A 5HGGS 4NUJB 4YIQA 2DF3A 4RBPH 3TO4B 4JDZA 4NIKB 4PV9A 2CMRL 2KKQA 5EPMB 1RZFH 1FN4B 4FQCL 4TPRH 4HC1A 1BIHA 3V8OA 2R29H 8FABB 4PTUB 2NXYD 5BMFL 3L7EB 3L1OH 4Y0GA 4OB5H 4F15C 4KKBD 2X70B 4D2NA 4OV5B 1MQKH 4OD1H 3HNSH 2BVPB 2VLKE 4Q6IC 4WRLA 1OQOA 1VEOA 2CDEB 1WTGT 4JFYA 5IV2A 4JE4B 1IMHC 4FG6D 1U91B 5C0FB 1SBSH 4TUJA 3T4YB 1FAKT 1NCDL 1S9YB 1QVOA 3VFSB 3VRJA 3QDJA 3TZVA 2F53A 4FZ8L 5ESQA 2A0LC 4CNIA 2HVKA 3O3EB 3TA3B 4PLJD 2DL9A 4DWHA 4PRIE 5D93C 1B2WL 3QUXC 3LB6D 4Z7VF 2RFXA 2Z31B 1X5ZA 3H7BA 1NGXA 3WIHA 3R06A 3HZMA 5I8EA 1QRNE 4LCWB 2NXZD 3BP6B 4ZFFA 1KTLA 5FECB 4M5ZH 5DVNA 4W4OC 3HUJE 5T5FH 2H32A 4GSDH 4WO4C 3VD9A 4DFIA 3GMQA 5C07A 2WINB 3EYUL 5E2VL 4EJ1C 3KYAA 4KDVA 3K7UA 4N5ED 4H8WL 1X5YA 2B5IB 3L3DB 4HKJA 3BGFB 5GGUA 5F7DB 3ARBA 4NRZA 4P23C 4R90L 3D3VD 4Y19E 3PG2A 3S36H 1TDQA 3UMTA 5EA0L 1MCSA 1BQHG 1OF2A 3VFPA 3W5NA 1D5XB 4Z5RA 4IHOA 1P1ZA 3MLZH 5BQ7B 2XN9A 4DAGH 5D2LE 4MSWA 1C5BL 2D2OA 3SE3A 1NEZA 3VGFA 1TITA 15C8L 2Y72A 3CDGB 3G5VA 1ZEAL 5GGQL 2IAMD 4KK8C 4Z18A 2WV3A 4NHCL 5EOTB 1M7IA 1A6PA 1MAML 5I19L 4LLMB 4UIMA 1I1YB 1EFXB 3JV0A 4OI8A 1D5ZB 2ESVE 2XWJA 2HAZA 1I7RA 4OLUH 3BN3B 2XQBL 2Z8SA 3PP3H 5T3XH 3U9UB 3WJJC 3QG6A 4NQXA 4U6VH 5ANMA 1FC2D 2VH5H 3VJ6B 1BLNB 3OJVC 1VHPA 2EYRB 4Y5VC 4DK3A 1NC2B 3G5YB 2LFGA 1NCWH 1BVZA 2VDQH 5J06A 2DOCA 2Y6SD 4PRHB 5DRNB 2YA1A 1XF1A 4NFBA 4UU9B 3LQMA 1Q0YL 1IGCH 4YBQC 3WL9B 2OCFD 1BVLB 3SJVB 3TEUA 3SE8L 1DVFC 3BXNB 4H20L 4QRPD 5DC0A 5ENWB 2IQ9L 4GH7B 3GUTB 1PSKH 1UZ6E 1OB1A 4NRXA 1NBQA 3FT2B 4RQQA 5LXGH 2VR5A 4N1HB 4HLJA 5HYJE 4LCUB 2CO7B 1MCOL 3ARGB 4N0FB 3W0WB 1OAYH 1ZE3C 5IVXF 4P2RA 2X89D 3CD4A 4P9ML 5I30L 3VMNA 4TYUA 1KEML 2XY1A 2BHYA 4Q9BA 1FAIH 3MRKB 2VQ1B 1HHIB 1T5XB 5DD6B 2NY6D 1Q38A 4AEHH 5JQ6H 3PHSA 5F6IB 2R8SL 3QPXH 3C2SA 3TBVA 4JVUA 1WIUA 3VRIA 3UP1A 1XH3A 2BP3A 5I1DA 1IEAA 4M5YL 1FGNL 3KPMB 3D9AL 4ZOBA 5I75C 4M61B 2OR8A 1FFQA 3GSWA 4FTVE 5GGQH 3RBSA 5IFJB 4ZQKA 3PGDA 2Q7NA 2YUVA 4HXAH 3S6CA 3MNWB 3QRGH 4MWFA 5DFVD 5F3BA 3EDDA 4Y16C 3VD3A 4NUGL 4OGXH 1UWXH 4NKDB 5HBBA 1NAKH 2DBLH 4LPCA 3GMLB 3AAZB 2OL3B 1NMAL 1OSPL 2AJ3A 2L4OA 2IGFL 4TVPH 3B2UC 4X0KB 3OKNB 1E28B 1PYWB 3FTGB 5GHWL 4WU7B 1VENA 3QUMA 4H5SB 4NZTH 2P5WA 4OD2A 3SCMB 1H0DB 4EN3C 5DMYA 4HMDA 1IM9D 5FOJA 1MCEA 2J12B 1OCWL 4PJHA 3T65B 1KCRL 1ETZB 3FQNB 3U6RA 1XGYL 4WEBH 4XI5C 4Q6IA 5CP7A 2YBRA 3G6JE 4X4ZA 4XCEA 2CKNA 3MXWL 3EOAB 1MVUA 1W72A 1JHTA 5SX5K 1X5FA 2XG4A 1S7RB 4JGMA 2AGJH 3JWOH 4Y4HB 3WFEL 5BJTA 1RUMH 5ID0B 1A9EA 1D5MA 2A77H 3VRLE 4YHKH 1A9BA 1HHKA 3OR7B 5CWSA 3OG6B 2Q7YA 2NMSA 1V7MH 5MI0B 1JIBA 3QUXA 4G42B 5KSBA 3LS5L 4TOYL 2P24A 4UOJA 2R0WH 3U4BL 2JJTC 5D2NC 3BPLB 4JQVC 4PJEB 4Z0XB 4ISVA 3EUUA 5I1KL 4AG4L 2ZP0T 4TNVF 2D9QB 1LO4H 4NFCA 4HKXB 3S5LA 3HNTL 4W4OA 3ILPB 1HYSC 4WO4A 4LARH 2MNUA 3E2HC 1GSMA 2R1XA 3RQ3A 1EEZB 4QT5B 1TTFA 4RGNB 4JFPA 1JBJA 5ADPH 3P0VH 4GLRI 3UDWC 2BY2A 1Q1JH 4OCXL 4ODTL 5F9JA 1IC7L 1J8HD 3DUSA 2OP4H 4P23A 3OQ3B 2BNUB 2A74A 4RNRA 5EUOF 2C7UB 4P9HC 3WD5L 2DTMH 4TSBH 4OKVB 1R5IA 1YDPA 4WY7H 1K85A 3S35H 1X5IA 2MKWA 1YEIL 3NPSB 1FZKB 3W9EA 1MJJA 3LKPA 4UNTA 4MJIE 3RUGE 3FCTA 3IFNH 2UVFA 3QUKB 4D9RD 4MDIA 5TFSL 2DM2A 2N7AA 1OP9A 4P46B 1T1WA 1XGTA 5JOEA 4I0KA 1G6RH 2ARJA 3DROA 1C1EL 5DJ8B 3F5WA 5HDQH 4WUKL 5AZEH 4CN4A 1T1XB 4OLYH 3UJJL 1KTRL 1BAFH 3TFKD 2Z91B 1CICD 2P1YA 3WJJA 4MNHB 1B88A 4E0RA 3BDYL 2HN7B 4NQVB 1MI5A 4OTXH 2EDHA 5CMAB 3BUYA 1AHWB 1IBGH 5IG7B 4JB9H 3HC4H 2OSLB 4KJWD 1ZGLB 4Y5VA 2MTPA 3QHTC 3ARFD 1FIGH 5IQ7L 1R3IH 2HT4D 1W0VB 4S1QL 3KPTA 3WLWC 5ICYA 1DVFA 4HPOL 3QDMA 1RK1A 5IHLB 4S0TD 1H3PL 4YDVA 4U7SA 3GI8L 2A1WL 5E8DL 5J56B 4MCZB 3MRNA 3V5DA 2UWEE 4XVJL 2JTDA 3RTQB 4M7KL 1DLFL 1EO7A 32C2A 4WFGD 1MHPL 3J8F7 1I4FA 1NBYB 3SKNA 1J10A 4EBQL 2CUMA 2BY1A 3WN5C 1RZ7H 1UEYA 1CLOH 3G04B 3CIQA 5FA4A 3D6GA 4YBLC 2CRYA 3KJ6H 2A73A 1U95A 5CJOH 4CVXB 1FNEB 1LILA 4MJ2A 2AJYL 4P2OC 1NGWB 1AD9B 3RWIB 3GSNA 3ULUF 1UWGH 4MJ5B 4WW2B 3OAZH 4LFHG 3WE6A 4F57L 4F58L 3T0BA 3N9GH 1G0YR 1L0QA 1RHHB 1P4LA 1ONQA 1AKJB 3MSPA 4OF6A 2RGSA 2JCCB 1IKFH 2Y1VA 1PKQA 5D1XC 3RAJH 1JUFB 4HC1H 5ICZA 3Q5TA 4FQ1H 5BVJA 4L4VD 1TZHA 1OAZL 3AU1B 1GZPA 2ICEA 4G80B 2P5ED 4Y16A 2YK1H 3LSOA 5K9JL 1CXLA 4RX4D 2L0DA 4NRYB 1ED3A 4ODUA 1X5AA 2CSPA 1UQSB 5T3XD 3REWB 3UTTA 3WFCH 3QI9D 2YRPA 1LDPL 2IALB 2OJZL 4OZGA 3BPNC 1J1OH 4QHUB 1XCQA 4KV5F 3VFRB 4EN3A 2HTKC 4ZXBB 2QQKH 1FLRL 4JRXB 1RIVH 3O6FB 1PVHA 2XZQH 4LKXA 4JR9L 3UJTH 5DQ9A 4M48H 3FQRA 5L88L 1URLA 5DJYA 5JW4N 3KPSB 3WIHH 5CSBA 1U9KA 1WK0A 2DIBA 2WK2A 3DGGB 1IGJA 2ZKHL 5C8JA 4E41B 3CSYA 3IS1X 2H32H 4HAFA 3TV3L 3AREB 4HIIB 1R0AH 2NPLX 3PP3K 5FM5O 3DLQR 3CFCH 2NR6D 3OF6D 3GHEH 3KJ4C 1U8HA 1AGDB 1MFNA 1P4BH 1B4JL 1KB5L 5DK2A 5IBTL 5INDB 4HDIA 2JJTA 1GC1H 4K3DH 5D2NA 1YPZB 4JQVA 3UCRA 3QJFB 3D3VE 5IFHL 4L9LC 4DGYH 3QEHA 4RAUB 1HI6A 2IPTH 1RHFA 4R8WL 3FL7A 3MRLA 5D1ZB 4UB0L 4TULL 1EAJA 5FYKD 3TJEH 1BD2D 2JELH 3ROOA 3HLAB 4JREB 5HJ3A 4QXTA 4JHAH 1NFIA 1OTSD 3UDWA 4PJ5B 2X2YA 5ADOL 4O2FB 4LGSB 4PBXA 3PL6B 5I9QB 5HY9B 2XKNA 4JM4L 4ZFZA 1IGTA 4BQCA 1WVZA 2CLRB 1OAUL 4N0UA 1CDIA 2K9UA 4IEFB 1QSEA 3SDDD 1IGYB 4TVPD 2SEBA 2AJSH 1C08B 2EIEA 4HKZA 4PP2B 1X5HA 2PW1A 4HKBB 2QHRL 4DZBB 4NZDA 2MFNA 1WFNA 2VTFA 5EFIA 1MCHA 3I3DA 4P4RB 4QO1A 4YPGA 5ERWB 4M7ZC 1N3NB 1DBBL 3RBGA 4QRPE 5FM4A 4KWUA 2VDKL 4AL8H 5I1LB 2FZ3B 3CMGA 1UZ8A 3MV9A 2OZ4H 2P48B 1HCVA 3UO1H 3NFPB 4I4WB 2AS5M 1SM3H 25C8H 1IC5L 2F5AL 4EXKA 4QCIA 4YO0B 1FYTA 2AXFA 3WBDA 1ZGLP 3N50A 4JQIL 5CEYA 4X4XB 4HF5L 3QIWC 3IFLL 2NY4C 2PUQT 3AB0B 3UZVB 2FEEI 2AJUL 1RMFH 4ALAL 4XVTL 1DN0A 4I3SL 5D72H 4F7PA 1FIEA 2ICWJ 2FBOJ 5J89A 3RIAF 4MXVE 5EBWA 3MNVB 1JPST 5DLMH 5A2JH 3H9SB 5C0CD 1J5OL 3VH8B 4EDWL 2JJUA 1KIPA 3TCLA 4WW2F 4ZDHA 2VDPH 1TJIL 4XB7A 1MWAA 2EC9U 1A6WH 5C08A 4QRSA 3KG5A 2X7LA 4JKMA 4G7VL 5C6PB 4P2OA 3MRQA 1XGUB 1MRFL 1N26A 1CGTA 2FNBA 3DHMA 1F4XH 1F58L 5HI5D 4EIZC 2JCCF 2D7TL 2NY0C 3LH2L 1N5YL 4V1DD 4RMSA 1FO0B 3V7AG 5E2JA 1FNHA 2LAAA 4YZFE 3C5JA 1JNLH 3HAEB 5BRZD 3KHQA 4KDTC 4OAWA 3CFBB 4Y5XC 3HFML 1OSZA 1TZGH 4UV7L 4GKZB 5D1XA 2GI7A 1L7IL 4HK0A 1DSFL 1DEEB 1SY6L 4I48B 1J12A 4ZS6D 4X4ME 2Q76B 2YRZA 4DKEH 3S8WA 4MXQC 4KZEH 3OKEA 2BVQA 1H5BC 4XNYL 1P4IL 1A5FH 3NZHL 1HEZA 4I18B 1FE8L 1KTKE 5MHSD 2E6QA 4NO2B 5EU7C 4ZFGH 3AMLA 3PWNB 2NZIA 4FQXB 3VFTA 5IFAH 5MERB 3LIZH 3SDXE 1LE9A 3KLAB 4P5KB 2XA3A 4PJAB 4QOKA 3NAAL 1I7UA 1V7NH 3H9HA 1UM4L 5D6DC 3UYOD 2CXKA 1KFAL 4PY8I 2ADFL 1RZJL 3L5WA 4LSPL 4KVCH 1A3QA 3JWDC 4KVNH 5DJCA 2EDJA 3V0VB 3KXFD 3QCUH 3ZDXF 1EA9C 5CD3A 2D9CA 3BO8A 1MPAH 5HHMB 4APQD 1E4JA 1WBYA 4PJ8D 1I9JH 2ED8A 1M71B 1OGAA 4QEGA 2BERA 5C0ND 3PJSB 2RJMA 2Y9RT 4XC3H 3VFWA 4DCQB 1RULH 2XNAA 1J8HE 4PGDA 1YJDC 1T22A 1NL0L 1SJEA 4XXDB 2B1HL 5D6CB 5L0QB 1BQLL 2R39A 4FS0A 2CD0A 3CC5B 4L9LA 2XRAH 4MNGB 5BS0A 5H2BB 3HMXH 4U2ZA 1NDGA 2I60L 3MLUH 3LEYL 4WWKC 2VUYA 4XCNB 3SKOB 2ICWA 4Q0XL 1LEIA 5E00A 3MCLL 3QA3A 2DLEA 5EBGA 1OWRM 3AS2A 2YUXA 4D9RE 1EUUA 4UINH 3ZLQC 3BP7B 4YXKL 3K81A 2H8PB 1E6JH 5D7SH 1AI1H 2GJ6A 4RDQF 5DEZA 1QG3A 4JAMB 4KRMB 5B4MD 2W38A 2MSPA 5B8CC 4CU6A 2D4DA 4WW1B 3HMWH 3K80A 4LCYA 4CRPA 3E8UL 1ZTXH 3O6MH 4UI2A 3S88L 1JNNL 4NO0B 4R97C 4R2GB 4ZSOB 4X9GA 4AMKH 1ZA3B 1JF6A 3IDMA 4Y1AB 3UBXB 1MCQA 4PRAB 5F96H 2IH3A 2IMMA 2NNAB 5KZCD 3TCXA 1CL7L 2MWCA 1FL6A 1CFSB 3UTOA 4JM2C 4F9PC 3O4LB 3QDJD 4G9DB 3TZVD 4N8CH 2F53D 4UDTA 5FYJU 5DR5L 2A9NL 5DJDA 4HPYL 3FFDB 2HJLB 2FBJH 2UZIH 2X4TA 4S1RH 4XGZA 4GKNA 1YEDB 3SDCB 4BELD 4BZ2L 5ALBH 1IT9H 2EYTA 4R3SA 3W9DB 1TQBB 1MJ8L 2MQCA 3HE6C 5J8OA 1LGVA 5IT2H 5ESVB 2AXJA 3U36A 4WFGE 4N0YH 3RX5A 5JORB 2H41A 1NCBH 4JPIB 2AJVH 5C07D 5CEZL 4U1IA 5SWSB 3QIWA 5F9AC 3ZHLA 3PGFH 3BVNA 1B6UA 1OWWA 4ODXA 1MCBA 5I1EH 4LLYA 3UX9B 3GSNH 4X99A 3VXRA 2BNQA 4PPTA 4I3RH 4XBPB 3BFOA 3ARBD 1V3MA 5D7IE 4AM0B 5K9KA 2E3VA 4OUUA 3QEUB 3CPLB 1QPXA 1G7HB 3LKRB 3NABH 2C9AA 3GKWL 2XN9D 5DRXB 2UV3A 1JRHL 4Q0XH 4LLUB 5DUPL 3FB6B 4J3UA 5IP4A 2QADB 3GSUB 5GRUH 2VRAA 2G60H 1X44A 1Z9SA 2JB5H 1U58B 2AJZA 3CU1A 3U4EB 1RZ8A 5J6HB 4L4VE 4WEUD 5FGCE 3BIAX 1OT1A 1GHFL 1NGQH 2P5EE 3X12B 1AQKL 4J3VA 2BRRL 3SY0B 1EJ6A 4ERSL 5IBUG 3EYVA 4LGRB 1FZOB 1CK0L 4Z0BH 5TQ2L 1N2RA 3RL1A 4K7FB 5T3XE 4M43L 4P99A 4ZO6A 2HRPH 2QJDA 4KDTA 2A83A 3O6KL 4JZJC 1TJHL 4E42B 4Y5XA 4GT7A 1AC6A 1B4RA 2GK2A 1Q94A 1RZKL 4PJIA 4XHJC 1F3JB 4DKFL 4YK4B 3LD8C 5EU4B 1KCVL 5B38B 2APVA 3P11H 3NCBB 2PR4H 1EEUA 3NH7H 3RVXC 1H5BA 3QHFH 5FHAL 2IWGA 4F7EA 4HQQH 1RJLA 2HFTA 1W2KT 1IZKA 2EDOA 5DSCB 4HJGA 1QFUL 3GJFB 4P2RD 1X9QA 1NEZG 3VXMA 4LF3A 5CCKL 4F8QA 1I1RA 2E9BA 5C0AA 1BX2B 4LHUB 1A7QL 1ZVHA 5EZIH 4LVOC 1QYGH 4KI5D 1SEQL 5D5ME 3IAPA 2EYSB 4GRMB 5D6DA 4XVUC 2BX5A 1CE6B 5E99L 1GGBL 3HE7B 3OBAA 5FO7A 3VGAC 4DVBB 5FDWA 3T0AA 3IKCB 4RWHA 2CGRH 3U7YH 3EJYC 5HTSA 4XMPH 4D0BA 3S98A 4QRRB 4Q9RL 2CH8A 1BD2E 4CVWA 3TLRA 5IK3A 3PWPE 4HIJB 4HK3J 5IOPA 1QRNB 3MMEA 2HFGH 5IVNA 3IB4A 4P9HH 2DWEA 1MREL 4F37F 4EUPG 4U2YA 1EEQA 1T2QL 3L5XH 5HVGB 4PJBA 5DQDL 3P40A 5E2WH 1DP0A 4EZMA 1DUYA 2PYEA 3UROR 1GPOL 2X9XA 4WWKA 4TVPE 2E7LC 5I17B 5BCAA 4WUUA 3MCKB 1Q9KB 2VLLB 4JZOB 4PJCB 2P5WD 3PP4H 2NX5E 3GBNH 5IMLA 4BQ8A 4R0LC 4NKOB 2DB8A 4FABL 2ZSWA 3UBXI 4ZUSB 5B8CA 5EIQA 1CG9B 4G6FD 4C55A 4UILL 1ZS8A 5D2LB 1G84A 4HCRL 5T33L 4ODVH 3MV11 1WEJL 4MAYB 4M9OA 4F3FB 1GRWA 3V7AE 2KZ1B 5T1KB 3TBWB 1KTDB 1MEXL 4H1LH 4M6NL 4ZNEA 5C3TA 1NMCB 4X9BA 4HWBL 1YECH 5CHNB 3OGCB 5C09A 3J7HA 3L95B 1TVHA 1X4XA 3N85L 4JM2A 4NQCA 4F9PA 2ZG3A 2DQGL 3BWUC 4MS8C 5FYJD 5GS0L 2A0LD 3CXDH 1QRKA 3RPIB 4HX1A 4JKWA 1Q0XL 1QLRB 1X5LA 2DN7A 5GISH 4A2MA 3LZFH 1AE6H 4QLRA 1N0XH 1G9MC 4U1NA 2GAZA 5CSZA 1MRDH 3G5XA 1RI8A 3IJSA 1NFDA 3ZYOA 4FRWA 1JE6A 1BGXL 3GSOB 1YY8A 3HE6A 4W4NA 2WUBH 3BIBX 1UH2A 4FFZL 5C0CE 3QO1A 3GMNA 5TPWL 5IUSA 1TETL 3T0EC 3NZ8A 4WO4D 3SDYH 5KSUA 4PP1C 4M1DH 1MWAH 2BVUA 1A2YA 3DHJA 2EZ0C 2HKHL 2OXGA 4FQLL 4OLZH 5IW1B 1QD0A 2LU3A 1A7RH 3DUUA 3GMPB 3NIFF 1PX4A 2XFXB 3O11B 4ZFOL 3I50H 4LK4A 3HZKA 4JHBA 4X6EB 1Z0MA 1P7QA 2IPKB 4X6CA 4P23D 1AIFB 2AEWA 2V2WA 3BESR 4GXUN 4X7SL 5E1AA 3V4PL 4M6OL 4B50A 2AW2A 4V1DE 1R5WB 4FMFA 3BSZH 4ZO9A 1M7XA 2VDOL 3GRWL 1HH6B 3G9VA 1I1AC 1NLDL 2NTFB 1U36A 4BSJA 2R2EB 4KK8D 2IEPA 5JXAL 3ZKXB 3RKPA 1MRCL 3BHBB 4IDLA 4X8XA 3UC0L 3LDBC 3T8XA 3LS4H 1I8LC 2IPUK 5A3IC 3KWWB 3ARUA 4MNQA 4XPFH 4PUBL 1XMWA 5BXFA 1YNKH 1CS6A 2W60B 3D69A 3Q0HA 1ITBB 4XPHH 5IB5B 5CJ8A 2FHBA 1G7PB 1SJXA 3D87B 3EOYG 3VXQA 3LKOB 3WNKA 1MI5D 4K3JH 3T2NL 3JWNC 3LQAL 4JZJA 3G6DL 5DFWH 3T09A 2R69L 4ENEC 2Y06L 3S5LG 2IPUG 3ET9F 4HH9B 5MHSE 1YN6B 5T3ZH 4UT9H 1LO0H 2R0LL 3CZFB 4Z78A 4YBQD 4X6DE 2V7NA 2XTLA 1JN6A 1BZ7A 3BI9X 1DVFD 3QDMD 1BPVA 4JHWH 3FO2A 1P6FA 3C5ZC 2H3NA 4QHKJ 2OR9H 4NN5C 5H8DA 1U8JA 3MRGB 5BV7H 1RU9L 4D3CL 2W59A 3QXAB 4DW2L 3VFVA 2I9TA 2FWOB 4KK6C 3X3FH 3KXFE 1A7NH 1VERA 1M6OA 3DPBA 2FJHB 5EC1B 1OM3H 2HFEA 3P30L 2HRLA 3B4NA 4PB0H 4PJGB 2KBGA 4XNQA 2EDTA 3OKKA 5DWUH 1KN4H 3BP5A 4I9WD 1I3RA 5M7QA 2YUWA 5KJRH 5K33A 4HS3A 1BFVL 1FL3B 2V5SA 4YHIA 1KB5B 3E6FA 1VEMA 1I3VA 5JOPD 4X7TA 4WI6A 4U3XA 3HUJF 4YE4H 5IROC 5CBAA 3ECBB 1SJHA 4H26A 3P4MB 5FYKL 1J0YA 5F7NC 3UPCA 1WAAA 5HYEA 4Y16D 2FLRT 5ILTL 4WI7A 3BH9B 4NBZB 5DJ0A 5HHOB 4JDVB 5CJQL 3TPUB 1BOGA 2PTTA 2VDRL 3B2UD 4FA8A 4XWGH 2W91A 3UTTD 5HHPA 3GI9H 2F19H 1RUPH 4JPWH 1UM5H 1YEGL 2YXMA 3MV8B 5D2LF 2FYYA 3DRQB 4OCYH 3BZEA 3QUYB 4EN3D 3WUWG 2F54A 4PBVC 4JFZL 2YEZA 4UQ3B 5KTEL 2H6PB 4R0LA 2FX8H 2NW3B 3OJ2C 3H6JA 3QDJE 2F53E 4HUWB 1YEKL 4XP9H 3I9GH 4P3DB 5DQJA 1REIA 1S7SA 1UGNA 4URTB 4GRWB 4XI5D 3CGTA 5FUZL 5EUKB 2P8LA 4HWZA 1LP9A 3FO9B 4JG1L 4NNPH 5IHUL 4K8RL 5FHBL 3VXOA 4KKAC 5JQHC 4R4NC 5SWQA 1TQCC 5K93A 5IMKB 1OW0C 3MACL 1S9VA 3ULVC 1TTUA 4NN7C 4RMUA 5F9WC 3P30H 5C07E 2G5RA 4K3GA 2XWBA 2Q1EA 1UG9A 2XZCL 2JLLA 1MSPA 2RAMA 3V95A 4FNLL 3S96B 3O3BA 1GAFH 3S34L 3DXAA 1UZ6F 3HCVA 4GAJL 1CIDA 1JGEA 1I85C 2L7UA 4WCYL 1XAUA 1B3JA 1G7MA 1A6VL 1HYSD 3T0EA 2XN9E 2VLRB 3RWJB 5EU3B 4ZUUB 1B90A 3C2AL 1ZLUH 2GFBB 2PO6B 1FH5L 3L3HA 1AGFB 2DKMA 3V0WH 2YZ1A 3L3JA 1K3IA 5HHQB 4JN2B 5JW4R 3QNYB 3LRSB 2VZVA 4KHTL 4XNZC 3QZWG 4G8GA 4XT1C 1HSBA 3FFCE 4FFYL 5DYOB 1OT2A 3RL2B 2XTJB 3HHRB 1I1AA 1INEL 1QSED 3RDTC 4PGBA 4JY6A 2P8PA 3DRTB 5ANME 4YAQA 1A1NB 1WZLA 4MQ7A 3WXWH 4N68A 1XCTA 5LWYH 3UPRB 5B3NA 3PHQA 1GL4B 1F00I 5JTWA 1A6AA 2R1WA 3MJ6A 5HGHA 1GGCH 5JHDB 4LRNL 3DVFA 1DBJH 1I8LA 4WGWB 3MRMB 1DBML 4JO3H 3IXAB 4O9HL 4MCYA 5DK0B 1BFTA 1FNSH 4P2QE 4HULB 2DI9A 3HPJA 3C08H 3FHAA 3MV9D 4K07A 4MXWH 4HJJL 4GG6B 4R4FH 2IH1B 1Q9LB 1WQVT 1UENA 4AEFA 1T3FA 4P2RE 4NFDA 4IDJL 4R26H 1FYTD 2GTZB 5TE4L 5DMKB 4WEMB 1BQHB 4KI5E 2ED7A 4QTIL 3WLWD 2H1PH 3MA7B 3HC3H 4S1SH 3D18A 1EHLH 4O51B 5MENE 3C5ZA 2CQVA 3KPPA 2W65B 1JZ5A 1BJ1J 4LLWB 1MJ7H 1NMBL 4NT6A 2BVEA 3JWDH 5GZOC 3BQUB 1KJ2L 4LBEA 3RJDA 3G6JF 4X5WB 4NQEA 5JNYA 4ODWA 3LKQB 5AZ2H 5JR1H 1G7QB 1PDKA 2BMKA 1ZVSA 3GGWB 3OHXB 4YR6B 3MRFB 5CJ5A 1NGYA 2VWEC 3V52H 5L2JB 4FQQB 5C08D 4XNUH 3BAEH 1YJDH 2VSDA 3FQXB 3I6KB 4P2OD 3A67H 2NXZB 4HZLB 4LHJB 4U1JA 2LVCA 2HVJA 5HVHC 4GAFB 1OTTC 5CP3H 2YRLA 4XCCH 3IJYB 1NLBL 4HH8A 3U9PH 3QFJD 4JFEB 5HSFA 1A7BA 1TCMA 2VSCA 5F1IB 1NCAL 2FLBT 3WDHA 3EO1B 2VAAA 1QUNA 2P8MB 4L3AA 2XWTA 5D1XD 5IROA 2P5WE 4AQOA 2P47B 1DBKL 1QHPA 3D3VB 3TH4T 5C0BB 2BFVL 1YN7A 1QA9B 1ZHLA 4EDXB 3BPCA 2ATPA 4PJHE 1QBML 5GJSL 1SYVA 3I6GA 2CDFA 5MEQB 4NP4L 4PB9H 2MPAL 1ZLSL 4L1HA 2IAMB 2GJZB 1Q9OA 5E8NA 5DGQA 3RI5K 4GS7B 3C5SB 3UPAA 1MNUL 2X4RA 4RFEB 3IDJA 1JPGB 4NM8L 5ID1A 3RA7H 2NY3B 4GRWF 3ROLB 1VADA 2J4WH 3ARDC 1EEYB 4DUWA 3EFDH 3CVHH 3P0YL 1AP2B 4QHMB 2VLJB 3KPLB 2Z93A 1WZMA 4P4KB 1K2DA 4QOKD 4ZD3H 2D0HA 3LPFA 3RWGA 2HYMA 4M7JL 1T5WA 1PZ5B 3DV6B 2YD3A 1A0QH 5KSBE 1B0GA 1JF1B 1W0WA 3NIDE 1EVTC 2Q8AL 2QL1A 1FORL 3GBML 1FZMB 1K6QH 3MGTA 5LAXB 1XIWB 4ONHA 1VFAA 1OW0A 3V0AC 4DGIL 1OGAD 5KVDL 4LU5H 4JPKL 5F71A 3E3QC 1GIGL 1JPTH 4FQ2H 4JY5H 1MFDL 4GW4B 1F4WH 1JHKL 5TDOB 1YA5A 3CDYA 4XX1G 3KYNA 3I85A 5BS0D 1I85A 3WUZA 2D03H 2AEQH 3QCVL 1QO3B 5L2KB 2ZWLT 1LO5B 1QQDA 4OZ4A 3HI1B 1S7TB 3AM8C 4YX2L 3TIDB 1KCSL 1WCBB 5CJXC 1FVEA 1H3VA 3FRUA 2ZCHL 4N8VA 3K4AA 1I3GL 1ZWIA 2GJ6D 3CH1A 4YHML 2AQ2A 4NPYB 3AS1A 5IB4B 1UB6A 5C0RL 4BKLA 5EBMB 5LCVL 1C16A 1BF2A 1K4CA 2EDDA 4J6RH 2MOVA 3P73A 3V4VL 3RDTA 4TSAH 2GTWB 4CJ0A 1MI5E 2V2XB 2VKXA 5DGRA 1U8LB 2BOCB 4G6MH 4HT1H 3TT3L 1KIUA 3O2DL 4Z7WB 2VN4A 3O41A 1YC8A 4X8JB 5EC2B 1IJ9A 1MIEH 3DWTA 1KGCD 2QKIB 4IRJB 3QDME 4GW1A 5C0EA 3NGBB 3A6CL 3L3OA 35C8H 3TP4A 4JRWA 3PUCA 4PJFB 4JO1L 4PJ7B 3K4DA 2QV2A 2FL5B 5JPNA 1IM9B 1N6QL 3GIZL 4CDHA 1KN2H 4PRBA 5DT1H 3DX7B 1UYWL 2MCPL 4DN3L 2V7HB 1INQB 3MLRH 1K8DB 3QIWD 2NY4D 5F72S 4UOW1 4NNXA 5HHNA 2AV1B 1TCRB 1UXWA 3OKMA 3Q1SH 3MNZA 4KUZH 2HT2C 3W11C 5IESL 3GIVA 3VXRD 2BNQD 4I9WE 4UTBH 1M05B 1I8IA 2VXVH 5I74B 3TA3C 2W0KA 2FO4B 3QNZB 5AD0A 3WFBL 2V2TB 3E6HA 1MH5B 2ADGA 3O3DB 1KPUB 1BBDL 5AYUH 2Z31C 3U30B 1GXEA 4OIIH 4FXLA 1ZT1B 3I75A 2AJXL 3L3IA 1UXSB 1G0DA 5GRXG 3MYJB 1I8MB 5JOPE 1KLGB 1L0XA 1BEYH 1YNTA 1PKQE 1KENH 3D85B 1IGIH 5DD0H 3BT2L 2IBBA 3MLXH 3DX8B 4J1UA 1Z9MA 4Y89A 2YUZA 2NY0D 3ZT6A 4G5ZL 5IEHA 2B5IC 4NM4L 1ZSDB 4U1MA 4YEFA 3BGFC 4L4TA 1RURL 1F8TH 5LJYH 2P7TB 1KYOJ 3UTTE 3CJJA 4PTTB 3NCEB 3MRPB 1HOCB 2QBWA 2V5TA 4OZGE 2APTA 4ZAKA 1PQZB 1P7HL 1S5IH 5ITBH 3V8CA 4XP4H 5CIPB 5F9OH 4W81A 3C60B 3QUML 3U0WL 3KLHC 4HMEA 1JGUH 3A0OA 4XPAL 5EO1B 4M62H 3DIFB 1F90H 1KBGH 1K9TA 2HLAB 4MXQD 4IMLB 2ZUTA 4PGCA 1MJUH 1UA6H 5DO2C 3FB5A 4ZS7L 5C2BH 1I7ZA 3OXSA 3I2CL 1YQVH 1X5GA 1VSCA 2J8UA 1CL7I 3IAQA 2WBKA 1ZHKA 1JL8A 1PW3A 3ARDA 3U79A 3VXMD 1WFUA 1W72L 5IB2B 5C0AD 1CICB 5F44A 4YHLL 4X6BB 2VDNH 2AXHA 4HZAA 1FGVH 1G9MH 4BSWB 5EU6A 5FYJL 4CL7A 4ODSL 1R5VA 2F74A 3JUYA 4I0CC 4KPHH 2JE8A 5D2NE 3VWJB 4XAWH 4CVZA 1ZLWH 1K4DA 2MQ0A 4AT6A 4I77L 2EDXA 5TQ0L 3NACL 4BUGA 3P4NA 4LDOB 4LPWA 4EI6A 4HLZG 2ESVA 5E5MB 2E7MA 2NY5C 1IAII 1GOFA 2ATKA 4NWUL 3ARGC 3BGMB 2E27H 1U3HC 2Z8WC 3GM0A 5J13B 1FCCA 4O4YL 1U3JA 4MB4A 2FJFB 2Q6WB 1F5WA 4WIQA 5TF0A 3R4DA 4BYHA 3MXVL 5EULV 4J3TA 3O6LL 5F6IC 4N0UE 2PYED 4ZFOB 1IFHL 1QSEE 1JRHI 3L7FB 4WWKD 2HP4A 5EO9B 1WZ1H 1LD9A 4HXBL 4L3CB 4WUUD 1UM6H 3AM8A 3ALXA 2UUDH 4OFVA 4HIXL 4CAGA 1A14L 5CJXA 1D9KD 5I8KH 1KLUA 5GSVA 1ZGLM 2Z35B 2Z92A 4HAGA 2EDRA 2O5YL 1FHGA 4CUCA 5ESAB 3EOTL 3ULSB 2EE9A 4OZIB 1F11B 1JNHB 3HI6L 3JTSB 3KS0J 3QP3A 5J6GA 5FKAB 1AO7A 2IADA 1J0JA 3MV9E 4KTEH 4RMWA 4YZFF 7CGTA 4L4VB 4FZEH 3IJHA 3TBSB 4ETYA 1QOKA 4NUJA 3WHXB 3HA0A 5C09D 4JM2D 4NQCD 4AIZB 1FYTE 1G0XA 2EE2A 4PRDB 2CO6B 2VDLH 3ZTJG 3SCMC 4MHHI 4MB3A 2DI7A 1FRGH 8FABA 1LK3L 3QI9B 1VKXB 1T0NB 4FTVA 5HDOA 1WBXB 4I0PB 1U8PA 3L7EA 3L3GB 1G1YA 1LK2B 2PTVA 4X6FB 3HE6D 1ADQA 4IS6A 4TSCL 3RP1A 4KQ4L 2X70A 1DQJB 4NGHH 4OV5A 3P9LA 3WKML 8CGTA 4XP5H 4NNYB 3KPQB 2CDEA 1DQLH 1KJ3L 2IBGA 3IDXL 4MYWB 5EWIL 4OGYL 1U91A 5C0FA 2DIAA 3O3AB 3DBXB 3T4YA 5C08E 4ETQA 3ZHDA 4Y4HC 2JB6B 3T0XA 2G9HB 3IGAB 1JJUA 3VFSA 1U2CA 5BW7C 3K8LA 1P7QD 1QSZA 1XGPA 5IEKA 3NIGE 4JLRB 3O3EA 5GGTL 3TA3A 5ALCH 4NKIL 5MI0C 3LHPH 3QFJE 1JCKA 4TQEL 2Z31A 1KNOA 1MOEA 3BPLC 1MHHB 4JRYB 2OI9C 4HWEH 4LCWA 4WWID 5J1TC 4OM0L 2EH7L 5H37H 3LB6C 5FECA 2FR4A 4XPTL 1CD1B 3B9AA 2QQLH 2WINA 4DJMA 3PQYE 3UAJD 5DMIH 4RMTA 5T1DH 4Y4FB 1N59A 1DQMH 3L3DA 4XX1E 1S9KC 2GYSA 4OD3H 2HA1A 3B9KB 1LO2H 1AXIB 4MA1B 2E7CA 1AD0B 4QGTA 1QP1A 1D5XA 4A6YA 1TPXB 4XHJD 5EU5B 1S5HB 1SHMA 1XZ0B 5ELIA 2I27N 3NBNA 1X6NA 3DX9B 3CDGA 1NSNH 3WNNA 1G1CA 1H15B 4QOKE 4M93B 43CAA 2RCSL 1NKOA 1C5CH 1DUZB 1FSKB 4QHLB 1BECA 2X1QA 4PR5B 3QEQE 3MRIB 4LLMA 5LG1A 3RVXD 2PW2A 1I1YA 4O5LH 1IM3B 4LLVA 1D5ZA 4BZ1H 2DWDB 4TUOA 3TBTB 4HFWB 4KTDH 4KK9C 3U9UA 3T77B 3HS0B 2R56L 5IMMB 5DHYA 3ZL4L 1ND0B 3KR3L 3MOQA 3OKOA 3ULVH 2H9GB 1AHWC 1ZVYA 3TVMB 4WFFD 3V6FA 3VJ6A 4FP8H 3KYKH 1OGAE 4EI5C 2EYRA 2EC9T 1CE1H 1PGRB 5F7EL 4CVUA 2OYPA 4PRHA 1WTLA 1CDGA 3NTCH 4K23L 3RWEB 4KKNA 3GSRB 4MJIA 4XVUD 3RUGA 2FB4H 1IC4H 1BVLA 5BS0E 2AEPH 3BXNA 4ZUWB 5ENWA 4LPUA 3GUTA 4M00A 5D9SB 1WBZA 4NCC1 3ZE2E 4GRLB 3VFGL 1BJ1H 3EJYD 5D1QC 5E7BA 2EIZA 1IGML 2AK1L 3NA9H 1FV1B 3ARGA 3INUH 1U3HA 3W0WA 3Q6FB 2ERJB 2FO1A 2VZUA 3UEZA 5JW3L 2ZSVB 2GJ6E 3B2VH 1PJ9A 4P2CG 4YXHH 5AWNL 5CBEB 2DQFB 4PJ9C 3GMOB 4LVHC 3GO1L 2VQ1A 2Q87A 1HHIA 4O2CB 5E70A 3IF1B 5D7IF 3ZE1F 2OJEA 5I0ZA 3OAYK 3DSFH 3WIIH 2A6JB 5I18H 2DQEH 4CKVX 3C9NA 3BPOB 4OZIF 1I1CA 4XMLH 2FATH 4M61A 5LGHH 2FJGB 5I2IB 4X7DC 4KQ3H 4V1DB 4Y2OA 3VGBA 2UWEA 3SOBL 2CJUL 3MTRA 1KGCE 3MLTB 5BRZB 1CFVH 2AVGA 1A7OH 4YQXH 5K9QG 1ES0B 3FMGL 1HXYA 5ITFB 3ZTNL 1CU4L 2Z0BA 1D3CA 3C6SB 3UTQB 3I6LD 1CT8B 4JN1L 3GSVB 2UZXB 2X1WL 2XG5A 1O7SA 3GMLA 3HB3C 1EK3A 1NAML 5F6HI 3P4OA 3HZYB 2R0ZH 1MF2L 3OKNA 3ZE0E 5ABDE 1PYWA 1TXKA 2B7DT 4MD5B 1RFDL 4MS8D 3RU8H 4FQIL 4H5SA 1PBYA 5IR1A 3SCMA 1G9NC 3FN0L 2DQJH 1GJIA 3ZSSA 4MA7H 4ZXBC 4F2MB 4ZTPH 4UT6L 5HVWA 1RJZB 1HNFA 3QNXA 2EDNA 3VXRE 4YDKH 2BNQE 3EFFB 3Q3GB 1E6OH 3O6FC 3T65A 1U2HA 1ETZA 1VFMA 3DXAD 3FQNA 5E7FA 2YA0A 2VXTH 3UYRL 5FXCH 3WXVL 1H3UA 5A16A 5KOMC 3FO0H 4UUJB 4ESKA 2YWZA 4GKOA 3RVUC 1CD9B 5ETUB 1KCKA 3T0ED 4S2SB 4XPGL 2ITCB 4PP1D 4J2XA 3EOAA 2AAVA 2EZ0D 1KJ2B 1S7RA 3B3IB 4GAGL 4Y2DB 4Y4HA 1G7IB 3AREC 5ID0A 3TBYB 3HZVA 5D5MF 1UVQB 1EHXA 3OR7A 5CFHA 4ACPA 1L9NA 1H8NA 4G8GD 2LTQB 1S8DA 3KXFB 3T1WA 1IAMA 4APQB 1DQDH 2WP3O 1I1AD 1DR9A 4RDQG 5FEBA 4PJEA 4Z0XA 4YXLH 2VISB 5JZ7C 3GNMH 3BEWB 5IIEB 2K7QA 4XNXL 4HKXA 3FB7A 3QWOB 1VGEH 3ILPA 3O4OC 5D1ZC 3TO2B 1ZLWK 4G6JH 1RY7B 1PG7L 1EEZA 1JK8A 2ITDA 1L6ZA 4QT5A 4ZO8A 5DJ2B 1YEFL 1YEHH 1RZIB 2ZPKH 4JREC 2WBJC 2F8VA 1Y6KR 1KC5L 4Z7UE 3PL6C 4QF1A 5E2UL 3U46B 5I9QC 2BOBB 2LABA 2RB8A 4JPVH 1FFPB 2BNUA 4JDZB 4QXGH 4Y5YB 2CUIA 2C7UA 5E08H 4PV9B 5DVMA 4XMKH 4ENED 3OPZL 4IRSB 2RIKA 3VXME 5FA3A 4AY0A 1FZKA 1K3ZA 5C0AE 4M7LL 2AERT 1INDL 2O5XL 5BZDB 4GXVL 3QUKA 2O5ZL 4Q74A 5ACZB 1MCDA 2W9EH 3C5ZD 1P84K 5F21B 4G6KL 5DJ8A 3CSGA 1T1XA 4HS6B 3WFDH 2Z91A 4LSVL 4MNHA 4WHDA 2Y5TA 3SKJL 1UACL 2E9IA 3LEVH 5J0BA 4KK6D 2Q8BL 4NQED 2HN7A 2I07A 4NQVA 1PG7X 4LQFH 5CMAA 4PY8J 3ILQD 1AHWA 1LQSR 3CFKA 3F58H 4LHQB 4P5TC 4JKPL 5IG7A 1R3LB 3DGCR 4EI5A 3CFIC 1ZGLA 5BO1H 3U0PA 1TFHA 5IBUB 3P2TA 1A64A 3FN9A 5MP6H 2I9LA 3HZMB 4AH2A 1W0VA 4PS4L 2C3VB 2CK0H 4MD0A 4LSQH 1DL7H 3K0WA 1JHLH 4NOBA 4PJBE 3FKUS 3KAAA 2PYEE 1HHHB 2DQHH 3GB7A 5EO0A 5D1QA 4K3EL 1A6ZB 2NY2B 1NUGA 4HJ0C 5GGUB 1G6VK 3SQOH 4NRZB 1L6XA 2QSCH 1NBYA 4YC2B 2NTSP 4P48A 3FOLA 3G04A 1AFVL 3PDGA 1QBLL 2AXGB 3VFPB 1M4KA 4PJ9A 4IHOB 4Z95L 2Q86B 5HHVH 1T7WA 4PJDA 4XBEH 4MSWB 4OT1H 1NGWA 3T3PF 4MMXC 5LBSH 2AI0L 6CGTA 2EH8L 4ZNEE 4YWGH 5E4IA 4WV1C 4N0CC 5FV1L 1Z5LA 5I16B 5FUOH 4DOHB 5IGXH 4HGWB 1Z3GL 2DYPA 5EH1A 1RHHA 5C09E 4NQCE 3CLEL 3O2VL 5IVZB 3MJ9H 1L7TL 2OTWB 5ACLA 2JCCA 2EDBA 4G9FB 3STLB 4UT7L 1RIHH 1JUFA 3CNKA 4G7YL 1DE4B 5ANMB 2A9ML 1CGSH 1JYXA 5B3JF 4UMGA 3MBXH 3U1SH 2A6KB 1ADQH 1NFDE 3QAZB 3ZKNC 1EGJL 4JY4A 1RUKL 4NRYA 1BWWA 4DEPB 4BH7A 4TNWK 4QXUL 4KKAD 3REWA 4R4ND 1WITA 1AY1L 3ULVD 5FF6A 2IALA 4EUPB 2VXUH 2D0FA 1I1FB 4OJFH 1IILE 4QHUA 1DJSA 5FOBB 4L5FH 3VFRA 3MRHB 2NW2B 4XCYB 1HQRB 4ZXBA 2HJKB 3RVTD 1J87A 3OXRB 4X6CE 5TF1H 1MCPH 1NUNB 4HS8L 3MR9A 1CGYA 1P2CB 5EBLA 4H0IA 3TWCL 5C71A 3DGGA 4X9HA 1ZT4B 4NBXB 1IEHA 1DANT 1DDHB 2EKJA 2KZWA 1H3XA 2X9WA 5BVPL 5EORL 3TBVB 3MGAA 3VFOB 3VRIB 4JKKA 3AREA 1JZ3A 1JGVL 4EIGB 3VD4A 4HIEA 4ZUVB 3MOAH 4XZUA 2VC2H 4YPJA 1SEBB 2BNRE 3ARQA 3D39B 2RR3A 1E4XL 3GSWB 2ORBH 2ZOKB 5DHVB 3RVVC 1MFCL 1YPZA 2WWKO 2NR6C 3IDIA 3RDTD 5L0QC 3QJFA 1JGDB 1HCFX 5LQBH 5DS8B 4GLRH 2PYFB 5D71L 4MWFB 1MFEH 1CLCA 5D70L 4RAUA 3WKNA 5F3BB 1NCCL 1TLKA 2P4AB 1ZANH 2DQUL 3ULUL 1FVDA 3T0WA 2LAGB 4ZUTA 1GYAA 3HLAA 1UWEH 1F4YL 4EKXA 2AJ3B 2WBJA 4PJ5A 2V6HA 4DGVL 5I1IH 4O2FA 1JVKA 1S3KL 3PL6A 2KPNA 4KMQA 1CTNA 5HY9A 1JFQH 4PJXB 4B7LA 1MAKA 3QUMB 1S9XB 2P5WB 2HFFB 3MOBL 2EDFA 2CLRA 2FX7H 3LY6A 3KS0H 4P57B 5E6IB 4R2GC 2VXQH 1MFBL 4KZDH 1IGYA 4PJHB 4M6MH 1JTTA 1C08A 3NCMA 2B2XH 4PP2A 4WFFE 4F15B 1QPPA 3U6RB 4HKBA 5JUEL 2R4SH 4DZBA 4N8VG 4Q6IB 5DA0B 3QDHA 5CP7B 3SEPA 3B5TA 3SDDC 3BEVB 2VE6A 2VLMD 1KEGL 1T1YA 1W72B 5DTFB 5ERWA 5FAAA 5IMOB 5GZOD 1XF2A 1N3NA 2ZUUA 3CX5K 4AYFA 4CADB 1D5MB 4OCWH 4PRPB 4MJ6A 5I1LA 2FZ3A 3ESUF 4XVSH 3GK8H 3SDCC 3HNVH 1MHCB 4PIRF 2WW8A 5GGSA 2ID5A 2D7NA 4P5TA 4NQDB 1TQBC 3QUXB 2P24B 3NFPA 3CSPA 4MQSB 4O58H 4RISL 4OZFG 2GUOB 4YO0A 1KACB 1WAAE 1OQXA 4IRZL 4KKCC 5DUML 4BFIB 5LKNA 1OTTD 5FV2A 3S5LB 3VMPA 1FNGB 4WO4B 1BM3H 4L4TD 3PHOA 2R1XB 3EYSL 3EZ8A 4JFPB 2YXFA 2UYLB 1A6UH 2J7LA 2M1KA 3MV7B 3MNVA 4C58B 2GK0A 3H9SA 1EJOL 1YEJH 4LCCB 5IWLC 4OF8A 3VH8A 3KPRB 1DFBH 2EICA 4WI5A 4QRTB 1KXTB 2D3VA 3CVIL 3NFNA 5I8OH 5AYQA 4PGEB 1QR1B 1KT2B 2J6EH 3OGOE 4HW6A 1IQWH 5FKPA 2HH0H 1J1XH 5GGRB 1E4WL 3VFNB 5HYFA 1MJJB 2D7MA 3LKPB 5DD5L 2VL5A 3I6LE 4AQ1B 4MDIB 1LP9E 2G75B 3B5HA 2OL3H 4WV1A 1FO0A 1T1WB 4OLXH 4XP1H 3L9RA 2ARJB 1OAKL 3K74B 1S7VA 4U1GB 3HAEA 1XT5A 3ARDD 1FZJA 1EPFA 2YKLL 1C7SA 2PXYC 2YS4A 4OCSH 3CFBA 3VG0H 3T1FA 3PDDA 1MELA 5MEOB 4E0RB 4QXWA 1OPGL 3A6BH 1UCBH 4R9HA 1DEEA 3ME0A 3AY4C 4WHYG 5EU6D 5JHLH 2Q76A 3CLFL 5L9DH 3EIFA 5SX4I 3OJDB 2MJWA 3U7WL 3U0TB 4G8IA 1JWSA 5L6YH 5EDXA 2FX9H 1T21A 4IOFC 2ESVD 2HT3C 3EO0B 3OKLA 3T0EE 3V7MA 1CXEA 5KVGH 3K1DA 1DVFB 4M1GH 2IQAA 5GGVY 1RK1B 4WJ5B 2WIIB 4NO2A 4YDVB 3PWNA 4KI5F 5T1LD 2V17L 4P5KA 4QYOB 4PJAA 3OSKA 4NYLB 2R0KH 1QR4A 1J1PL 4G8GE 4E5XA 2X4QA 3I02A 4L3EE 3BGAA 3WUWB 1GH7A 1W8OA 4XAKE 5FA4B 5FCUL 4K2UL 5SWZB 4CBPA 1IZJA 5AEAA 4OCRL 1U92A 3MLWL 2A73B 2DQDH 1U95B 2NY7L 2GT9B 12E8H 4U1KA 3PF2A 1HINH 1WV7T 4M7LT 4LAJH 3VFMA 3MLSL 1PZUB 1IAOB 5E2TH 3K2UH 4EOWH 1FC1A 3OWEA 3QCTH 4XPBL 5D7JB 4Y8DC 2FD6H 2OQJA 4AK1A 5D4QA 4POYA 3PJSA 2IANB 5HGBB 1EFQA 5T5NG 2Z8RA 4XXDA 5D6CA 1AO7D 5I66B 1DN2A 1YMHA 3CC5A 5ICZB 1LO3H 4MNGA 1PLGH 3NCFB 5H2BA 5BVJB 2WMPA 1OAQH 2W0PA 1TZHB 1GZPB 6FABL 4Y16B 4PJXF 3LSOB 1MLCA 4HBCH 1A47A 5F1SA 4LDLB 1CR9H 4XCNA 3SKOA 3O0RH 4ODUB 5I1CL 2E9WA 3ARZA 5F7KC 3QEGH 3BP7A 2APBA 4PJHF 3OZ9H 4JAMA 1KF9B 2VZ1A 4XP6H 5EZJA 3DVNB 2PTUA 1RSFA 3ALWA 4KAQH 4WW1A 5I1GL 1J18A 3QG7L 3PWPA 4MAYC 4NSKB 5IM7A 4ZSOA 1ZA3A 3FQRB 1UFUA 3UBXA 3ZYZA 1NBVL 5IB3A 3QZWB 3VW3H 5CILH 3HR5B 2DQIH 4RGOL 2J88H 4K9EL 1VFBB 1VGKB 1CFSA 3W11D 2HT2D 5EOCL 3SDDA 1JTPA 4PG9A 4G9DA 4OBRA 3WS3A 3HTLX 3TA3D 4OI9A 4MVBC 1KYOK 9CGTA 2VITA 2NX5A 3BKYH 3NIDF 1N4XL 3BKMH 2HJLA 1FDLL 2Z31D 2ZUYA 3X3GL 4Z8FL 1YEDA 3SDCA 4R6UA 3TN0B 2XI9A 4LCWD 1DTUA 4OI7A 4DVRL 1CD8A 2I24N 4P59H 1IC1A 5DK2B 2D31A 2WWMC 2C1OA 3ES6B 5ESVA 5KG9A 5D2NB 5B22A 4NO5B 5JORA 1J0HA 4JPIA 3TT1H 1RJYA 5SWSA 3QEHB 4YUEH 2ZJSH 3WS6C 5TE6L 4Z7VB 4LOUC 3B8SA 3PDOA 3QH3B 2GJJA 1KXVC 4XBPA 2AK4B 3N1MC 3OAUL 4Q2ZB 5JLZB 4MLSA 4UTAH 4AM0A 3OB0H 1AXTH 1NFIB 3QEUA 4D8PA 2HJFA 1G7HA 3LKRA 5IWLA 2D7PA 4FOMA 1HXMA 2XKNB 5DRXA 4ZFZB 1TMCB 1GC1C 3KLHD 3FB6A 1MUJB 3GSUA 3MZGB 5J11B 5C0CA 4Z7NE 4YHNB 3SGDI 3U4EA 3ZKXC 4JDTL 5T1MA 5JDSB 2K1MA 5DO2D 1JZ7A 1EFXD 1M7DA 2PW1B 3PNWA 4F9LC 3X12A 2CRIA 3PXHA 3SY0A 4LMQI 1MHEB 2FHFA 3EO9L 5FB8B 2QQNH 5I1JH 1Z6JT 5KN5B 4K7FA 2R2HB 5IF0B 1HZHL 2IFFL 2PXYA 4E42A 3ULVE 3N1PC 4UV4H 1QEWB 5KANG 5E56A 5GZNC 3IVKB 1F3JA 1NAMB 1UZ8B 4PRHD 2EE6A 3AY4A 5B38A 1JMXA 2XKUA 2OK0H 1P7KA 5GS3A 1CGVA 3SJVD 1T03L 3S37X 4QCIB 4X80L 3DTXB 3JZ7A 5FYLL 3QWRA 2WSKA 3NVQA 4CW1B 1G6RA 5DD1L 3EZJB 5HHXH 5JA9A 4XCFL 1CZ8H 5DSCA 2HKFL 3ARGD 3W0WD 1U3HD 1WF5A 4JO2L 3GJFA 4X5LA 3WMSA 4R7NB 4JFDA 1CFQB 1FBIH 2NY1B 5EBWB 1BX2A 4LHUA 4LSRL 4JFFB 5KVEH 2B4CL 4DQOL 3DUHA 2EYSA 1AGEB 4GRMA 2WLYA 3SE9H 4YHOH 1RAMA 2GEEA 2Y07H 5EZLA 1X4ZA 5E0QA 1A3RL 4YBLB 5I73B 1CE6A 2BY0A 4DVBA 1ODAA 5C08B 4QRSB 1N7ML 2X7LB 1CBVL 3MRQB 5TE7H 3S37H 5IVXB 4Z7OE 1F02I 4WNQB 2BSSB 3FHQA 3JTTB 2AV7B 1QNZH 4NJ9L 3C5JB 3WSQL 3S3PA 2EO9A 5GPRA 1MCRA 3EHBC 4OAWB 4ZTOL 1EO8L 5GGVH 4PJ8A 4XC1L 1KJMB 1D6VL 4HK0B 4R7DB 4NZRH 3DECA 1RJCA 5DVLA 4H25B 2ENYA 4JO4L 1LEGA 2EE3A 1R3KA 1A02N 4D9LL 4KY1L 1CWVA 4OZGF 2AABL 3GMMB 3MA9H 2VLLA 4PJCA 3OKEB 1CD0A 3SCMD 4O02H 3MRJB 4OQTH 4NKOA 3QIUC 3VD7A 3QDGB 2VLME 3TM6A 1HKLH 2YD4A 1CG9A 1QLEL 2X42A 1XFPA 3TNMA 4MAUL 2W1NA 3VFTB 1IL1B 4RWYL 4MAYA 1LE9B 4WHTA 5T1KA 1KV3A 3TBWA 4JHZA 4KDWA 4QNPE 3OL2A 5DD3L 1CFTA 3OJMB 2VWEE 3F7VB 2E8YA 3MQIA 4Y4HD 5CHNA 3OGCA 3STBA 2R23A 4BZYA 2R4RL 3TYGH 4C56E 3RPIA 1ACYH 1A4KB 4W68A 3CUPB 4GMSL 3GKZA 3RNQB 1MFAH 3BO8B 3CMOH 4L4TE 5IW6B 1LEKB 2BCKB 3LMJH 5C0IA 3L3KB 1NGZA 3MODL 1YNLL 4NCC2 2CLVB 3GSOA 4U7MA 2W9DL 2X1OA 2XNAB 4PGDB 1IGFH 5L7XL 2CUHA 1XR9A 1OP3H 3QISA 1NUFA 4WFHE 3JVGC 4QWWC 4MA3B 1CLZH 4NQTA 4S0SD 1NDGB 2PO6C 4NZUL 5I1HH 5CS7A 3WS6A 3DO7B 1U6AL 1JWMA 4X6EA 2X4SB 1LEIB 1XR8B 2IPKA 4Y7MA 4LEXH 1LVEA 1AIFA 4BQ9A 3AROA 3QULA 1FO0H 3BWAB 3MRBA 4HHAB 4LIQH 5ACMA 5C7XH 5F7MC 2L7JA 4LVEA 2J8UE 3HAEH 1HH6A 3N0PB 2XTJC 3R1GH 5M94B 2DMBA 2X5PA 3SGEH 2BDNL 3ARVA 3WCYA 5HGDB 2O61B 1PKOA 1QLFB 5F70A 5EU6E 3IDMB 2P45B 1QFWL 3D48R 5EUOB 5GS1B 2CMRH 5JMRA 4FQCH 4KK9D 5IB5A 1G7PA 5AUMA 1IAIM 4PV8B 4UDTB 5BMFH 4M7ZB 5DXWA 3VE0A 2BVTA 1FNFA 4J8RB 2F58L 5DJDB 4WTXA 4S11A 2CIKA 3FFCA 4EI5D 5J57B 4XWOC 4LASL 4HH9A 3E3QE 1BP3B 3CZFA 4GW5B 4B53A 1YMMB 2B0SL 1MVFA 2YC1A 5LVEA 4G3YL 2DQTL 3GMRA 1HKFA 1NCDH 3VGDA 2HMIC 4XBGB 1T0PB 4FZ8H 3IYLW 3QIWB 2GSGB 2NY4B 2YZ8A 1HHGB 2W92A 2FSEA 5D1QD 2CIIA 3BQUC 4ODXB 1B2WH 2QTEA 4LLYB 5GS2H 5FGRA 2FWOA 4P2QA 1YC7A 2WBWB 5INCB 5K9KB 4DTGL 2FJHA 5EC1A 2HTLC 2OZ4A 4PJ9D 1RZJC 2DLFL 4HBQA 3H3PL 4JFOB 4YDIL 1TZIB 2IG2L 1GZQB 4PJGA 1IQDB 3RI5F 1OARL 3LEXB 4HSQA 2ZCKL 4P3CL 3EYUH 2E7HA 5E2VH 2Y23A 1AO7E 2HWZL 2YPVL 3NFSL 1KIQB 2AJZB 4H8WH 4F33B 1S7XA 2CR3A 4MDJB 3CDFA 1FL3A 5MENA 3ZDYE 2XPGB 2EDYA 4R90H 3F7YB 2DYPD 3ESVF 3TIEA 1AKJD 5EA0H 3QXTA 2YMXL 2XACC 3EYVB 3ECBA 3RL1B 4BA8A 1R3JA 4LPVA 1MIML 3P4MA 1C5BH 4Y5XB 3O45A 2F5BL 15C8H 1ZEAH 1K5NB 1MAJA 3R0MA 4PJIB 4NHCH 5D8JL 3EYFA 4HUXA 1JYVA 5HHOA 1MAMH 3TPUA 5I19H 3HB3D 3V5KB 4P3WA 1FVCB 1C5DA 1AJ7L 3ZKSD 3KYOB 2EKSB 2N56A 4GS7C 4OM1L 2XQBH 1V5JA 3MV8A 4U1HA 1H5BB 2OS7A 3LKNB 3NOIA 3OB0K 2NY3C 4UQ3A 4ZXBD 2H6PA 1JPSL 3QIUA 3O6FD 3MLVL 3B43A 4P4KC 5I71B 1WWCA 3GHBL 4YGAB 4LF3B 4ODHL 3KPSD 5F7FA 2ADJB 3RVUD 1Q0YH 2X4OB 2CKBL 5EUKA 4BJLA 4LCWE 3FO9A 1X7QB 1V3JA 3SE8H 4H20H 5ISZB 2IQ9H 3IXTA 2XZAL 3AVEA 2FECL 5JIIA 1XIWC 3ARED 2YWYA 2C4FT 1QZ1A 1CI5A 1MCOH 3IDGA 4AEIL 3RVWC 5J4MA 4P9MH 2PKDA 5I30H 4YHYB 3ZZ1A 1KEMH 3MUHL 4KHXL 3JUZA 3T4AB 4OF3A 5JZ7D 5IK3B 3ZE2F 3T2QA 4YJZL 2OTUA 3H42L 2R8SH 3VXNB 4DN4L 4Z7QE 3QSKB 2ICWI 4IIQB 3JVGA 5D1ZD 2VLRA 2DM3A 1X5XA 2JF1A 2NZ9C 3O2WL 3RWJA 3PABB 4M5YH 1FGNH 4ONOA 5EU3A 3D9AH 5KW9L 2GFBA 2PO6A 3S97C 3K8MA 1YY9C 5DC4B 4CU8A 2BSRB 2WBJD 4PJ5D 3WDJA 4G6AC 4LSUL 1AGFA 3PL6D 2BSTB 1DBAL 3O8XB 2MMXA 3QNYA 3LRSA 1LDSA 4WUUB 2Y5EA 5J3HC 3L6FB 2A6DB 4LAQL 5DYOA 4MHHG 3RL2A 4YDLB 3B8YA 3ELAT 4NUGH 4OGAC 3BRGC 3DRTA 1XGQB 3SHSA 4KMLB 1A1NA 1ZS8B 3QUZB 3EGSB 1WC7B 1NMAH 1OSPH 3UPRA 2IGFH 3HMXA 4PRHE 5EZOL 5TDPB 3VWKC 5GHWH 4D0CB 2ZCLL 5KVFL 1JWUA 3MRMA 3Q6GL 1NEUA 3IXAA 1RD6A 4I13B 5DK0A 4IRJC 1RZKC 3SJVE 4BK4A 5C0JB 1CLYL 1TVHB 5B39G 1B9ZA 1SY6A 3NGBC 4CMHC 2ZG1A 3LV3A 3VMOA 1OCWH 2X4NB 5CZVL 1KCRH 5DFTA 4GG6A 4P5TD 1X5KA 4OFPA 1OGTB 3F62A 1Q9LA 3ZE0F 1OL0A 4U6XB 1EAPB 1I9RL 3GJFH 3BKCL 3F12B 3W0WE 1XGYH 1VA9A 2VXSL 4U1NB 5CSZB 1J11A 3PXJA 2Y7QA 3RZCC 2GTZA 3MXWH 3HE6B 2XA8L 2DD8L 5DMKA 3BKJL 1HH9A 3NPZB 3GMNB 5F3HA 3MA7A 3RKDC 3WFEH 5CGMA 4O51A 3NZ8B 5E24E 5A43C 5KSUB 2W65A 4HG4K 3WJLC 2X1XR 5I74C 1Q72L 1U8KB 3BQUA 2I5YL 4GUPB 4HJ0D 1KCUL 1V05A 3MRCA 3LS5H 3H9SD 3RX7A 4TOYH 4RBPK 3HZKB 4I5BB 4X5WA 3U4BH 4AZ8A 3U30C 3LKQA 1U93A 1G7QA 2V2WB 4WTZG 3V9FA 1OAXL 3CFJB 3GGWA 3OHXA 5I1KH 3P9WB 4YGVB 4YR6A 3MRFA 4AG4H 3X11B 4DK6A 2D7QA 1E4XI 4KFZC 3HNTH 3UJIL 1FNLA 3FQXA 2VR9A 1RV6X 4HZLA 2UVEA 1SVZA 3BMWA 1BBJB 4OCXH 3IJYA 4ODTH 4OQ1A 1NPUA 1U8IB 4N0CD 3QR2A 4JFEA 1IC7H 3D5OF 1IEBB 1RIUL 4MNQB 5DRWB 3WD5H 2QSQA 4PJIF 3EO1A 3MRDB 1CGUA 3B6SA 1QSFB 2P8MA 4R96B 4NC2B 5C92A 5C6TL 4JZNA 4RA0C 1YEIH 1U8QB 3MFFB 5C0BA 5DJZB 4JZJB 3C60C 1QA9A 1GGYA 1GGIL 5D96C 2NCMA 4EDXA 1AXSA 2WP3T 3HRZB 3ZT5A 2DDQL 3ZKND 1NGPL 2WUCL 5TFSH 3IFPB 3MRRA 1EMTL 2GIYA 5E8EB 5MEQA 3KVQA 3V5HB 1C1EH 4WUKH 2WZPD 3UJJH 2V7NB 1KCLA 3C5SA 1H8OA 3CSBA 1ORSA 3V2AR 3L5HA 3VH8G 2GKIA 3BDYH 1AR1C 3W39B 2H3NB 3SPVB 3ROLA 4YFEA 1EEYA 3FQUA 4NC1C 3DOSA 3FQWB 4QHMA 2VLJA 5DI8B 3QHZL 3U83A 2XYCA 3KPLA 3MX0A 4P4KA 4K94L 2WAHA 5IQ7H 5E8OA 4LSSL 4Y4KB 1M6OB 3DV6A 2RHEA 3LKSB 1JF1A 3G5ZA 4PREB 4S1QH 3VWJC 4LVOB 4ORGB 5HYSA 4PJEE 3RFZC 5GS0C 4HPOH 1ZOXA 3Q5YA 2ZNXA 1CGXA 1FZMA 2VUOA 4LEOA 1T80A 1H3PH 2OBGA 1CN4A 5LAXA 4JVPA 3GI8H 1XIWA 2A1WH 5E8DH 5HHMD 4F7MA 1LNUA 4U1LB 5I15L 4U31A 4XVJH 3RWFA 2FGWL 5BV7C 5IHZA 4YHIB 4X7FC 5J13C 4M7KH 1DLFH 1MHPH 3JSSA 4EBQH 4N90D 2DQCL 2FH8A 3OTTA 3MJ7B 1J88A 3RVVD 5TDOA 2UZYB 5J1AB 5CBAB 4PJBF 5BOPA 5H35B 3BJ91 4H26B 2AJYH 4MQTB 1FPTL 2B1AL 1QO3A 5CZXC 5L2KA 2CRMA 1LO5A 3FRPG 3HI1A 4F57H 1S7TA 1CF8L 1ZT7A 5EIIB 4A6YL 5DJ0B 4F58H 3TIDA 1HIML 1WCBA 2Q20A 2PTTB 3BP4B 1S7WB 1N8ZB 1KB9J 4NPYA 2FYYB 3NN8B 4JFXB 3VXUB 1I7TB 2F54B 3G6AB 1OAZH 2YEZB 3PWPD 4H88L 5FM5M 4R0LB 5GJTL 2A6IB 3WO4B 1GCFA 1QSVA 2VIRB 4KRPB 4NO0D 4R2GD 1HWHB 2GTWA 4MA8L 2V2XA 5K9JH 2DJUA 3PIQB 1CIUA 1U8LA 3BZFB 4JM2F 2BOCA 1LE5B 3D25A 3VWKA 5GRJL 2P8LB 3O4LD 4Z7WA 1LDPH 2OJZH 3IU4L 4X8JA 5EC2A 3CDCA 1OP5H 3ZKQD 3HI5L 1VFUA 4IRJA 3HC0B 2NX5D 1R3HB 4NCDA 3VXOB 3DVGA 5H94B 1KPRB 1NFDF 1FLRH 3SDCD 4JR9H 4PJFA 4I0PC 3GZKA 4PJ7A 5L88H 2FL5A 1YYLL 1H3TA 3VD5A 3CU7A 1XF5A 4B0MM 2NY5L 3AC0A 3SGJC 3DX7A 3DXAB 2ZKHH 3RZCA 2V7HA 3HCVB 1INQA 3H3KA 3KPNB 5SWSD 4KKCD 2VZSA 4PGZA 4H1LA 1CFBA 4XB8A 2AV1A 1G7MB 1TCRA 4PJDE 4X6CF 5IB1A 3TV3H 3SKMA 1UWXK 4YDJB 4GQ9L 4RFNB 5DEFB 1M05A 2PN5A 3EDKA 4LCIL 3WJLA 3HG1B 4KI1A 3K46A 3VXSB 4OLWL 43C9A 4GKSB 5GRWA 3CFDB 3IRPX 3TNNB 1SJVA 1B4JH 1KB5H 2BC4A 1KPUA 5IBTH 1E27B 3L3JB 3VGGA 1FQ9C 4QRQB 2IC2A 5DVKA 1PG7W 5IFHH 1ZT1A 4L29A 1HSBB 1I8MA 4C4KO 2QADD 2V5RA 2JCCE 7FABL 3AS0A 1ORQB 1Q9WB 4R8WH 2ZUQB 3D85A 2P8PB 3WIFB 4UB0H 4YAQB 3WN5A 4TULH 3MREB 1H3WM 4HWUA 5I1AA 1C8PA 4Y4FC 3FT4B 2GITA 1ZSDA 5ADOH 1A6AB 2R1WB 3BD5A 2DTSA 3H9YA 4OCLC 3B9KC 2P7TA 4NO3B 4JM4H 2PXYD 4MA1C 4PTTA 1HOCA 2YD5A 1OAUH 3HRPA 4HUUA 4C83B 3QFJA 1T83C 1TPXC 1PQZA 3BX7C 3HPJB 4KRLB 4TUKL 5CIPA 5KSAC 3C60A 2GY5A 2C5DC 2ILLA 5F97E 4JRXE 2QHRH 5EO1A 4M93C 2LU4A 3DIFA 2WWKT 3P9MA 3AUVA 3N06B 1HK6A 1FSKC 4GRWH 1NDMB 1WSST 4IMLA 1EUTA 3KPSE 1CXKA 4P5MB 5DZNA 3QWRD 3PQYA 4IOFD 2HT3D 3VCLA 1DBBH 5F7UA 2W0FA 4H0HB 3LN9A 3C5ZB 3KPPB 2VDKH 1A7PL 2GQHA 3S7GA 4K7PL 1Z0NA 2LV4A 1ZLVH 4JFDD 4NN5B 4NT6B 3IT8D 3TVMC 5IB2A 4JG0L 4LHUD 1QKZL 3O9WB 4W6YB 4X6BA 2MHAA 4X7EC 2YPLB 4NQEB 5JNYB 2F5AH 1IC5H 4NWTL 5K9QI 3UZQA 3QQ4A 3EOBB 1RUQL 4JQIH 4NHUB 3ZHKA 4HF5H 4RFOL 1YPZE 3IFLH 3VWJA 4ELMA 1NGYB 2KL6A 3FAXA 2AJUH 5TGBB 4ALAH 1TJGL 4XVTH 3KPOB 4I3SH 4WENB 1AQDB 3DURB 4AIXA 2A38A 3QEQA 3MUJA 3TF7C 3MCG1 4GRLC 2JJWA 5E5MA 2QR0A 3MV01 2OTPA 4Q9QL 2ERJC 5EOQL 2X10A 1J5OH 3DI3B 4EDWH 4PJ5E 5HDBE 5E5RB 2FJFA 1TJIH 3DX6A 2Q6WA 4OLVL 2APWA 2XWTB 4W6XB 5FCSH 4YNYA 3PWUA 5E9DA 4K7PX 2CDGB 1VCAA 4G7VH 1MRFH 1YN7B 2VZ3A 1F58H 4DZ8A 3L7FA 5EO9A 5CUSL 2D7TH 1HSAA 3LH2H 1N5YH 4L3CA 4FXKA 4I2XB 1SYVB 4BUHA 3BPOC 2CDFB 3T2PA 3GRWA 3THML 2AEIT 3GJEB 4OBSA 5C0DB 4U6YA 1AH1A 2R1YB 2WQ8A 2Z35A 3HFMH 4JJHA 4UV7H 4WU5A 4F7CA 5DURB 4UQ2B 4HFUL 4IJ3B 4WI2A 1L7IH 5ID1B 3ULSA 1DSFH 1D9KC 5KS9A 1SY6H 2H26B 4OZIA 2LQRA 2PF6A 1F11A 4OSUL 1YYML 3JTSA 4YHZL 4MAYD 1LP9F 4KGLA 4LNRA 4E9LA 1NJ9B 5T1KD 4Z76A 2ZUSA 1Y6MR 3BOVA 3CFEA 3M8OL 1KJVB 1FFOA 4POZC 2BVOA 3TBSA 3QIBB 4XNYH 1BJMA 1P4IH 4YFDB 3NZHH 3WHXA 3F6IA 5DZLA 5IJVB 1I8KB 1U3ZA 1JZ6A 1FE8H 4UIKL 4OIAA 1CYGA 4MVBD 3OAZK 4KMTL 3K8KA 3VFUB 1WBXA 1GOGA 3VI4E 1D6EA 4KJPC 4I0PA 3NAAH 2HLFC 1LK2A 2Y36L 1B0RB 3CK0L 4GMTL 4HGKC 3MJGX 3UTSB 2Y4SA 1UM4H 1DQJA 3H9SE 2WWMD 2DLIA 2BJML 3G08B 4JANB 5TH2B 1YEEL 1KFAH 3H0TB 3SGJA 3D2UB 2ADFH 3KYNB 1RZJH 2E6PA 4GBXB 4LSPH 4BSVB 3BMVA 1VPOL 2X40A 4R4BB 5KOVC 3GDBA 4KROB 3O3AA 3DBXA 4Y2DC 4X4YA 1SBBA 2JB6A 1IARB 2G9HA 2I25N 2OLDA 4LOUD 3ARXA 5LGKA 1IAIL 3TYFA 2LTQC 5HPOA 1N64L 3MLYL 4N8VB 1T7YA 4G8EB 1I9IL 3LN4B 2JK5B 1NL0H 2B1HH 1BQLH 4JRYA 4LSTL 4XNZB 1UB6B 2E5EA 2K7PA 3JV4B 2YD1A 4PY7B 1X5JA 2I60H 3M07A 4BH8B 3RDTB 3LEYH 1D5IL 4N1EA 1CD1A 1ZHBB 3MFGB 1S7UA 3MCLH 1OLLA 4RRPA 4YXKH 3BZ4B 1KELL 3RWHA 4J12A 3B9KA 5J12C 4OZFB 4Y5YC 1JGLL 3UAJC 5JIHA 1AD0A 2KQMA 3FFCD 3E8UH 4GW1B 3S88H 4IRSC 1JNNH 1T83A 5GZND 5I6XB 4HUMB 1KLFA 1XZ0A 5KSAA 1RUAL 4N9GB 4IOIB 1J0KA 4LPXA 2N4IA 1G9NL 4PJAE 1H15A 3F7QA 1CL7H 1BFSA 2G2RA 4PRBB 4QHLA 3MRIA 4AIOA 1JYWA 4POUB 1IM3A 1DQQB 5DR5H 2A9NH 3CCHA 3TBTA 4NNXB 3QQNA 4HPYH 1SMOA 3HS0A 3GIVB 1Y18B 1F6FB 1ND0A 3BE1L 4P2QD 4Z7UA 3ARPA 1KULA 4MQXC 5CINL 4BZ2H 3WFHA 2GW5A 2H9GA 4ONFL 3WDIA 5HHME 3TVMA 5AD0B 2CKBB 1U8OA 5DDHB 1MJ8H 3GSXB 3S4SA 1T04B 3R8QA 3LQZB 4N90E 3RWEA 3L3IB 5CEZH 1KPVA 3SGKC 1Q8MA 3V6ZB 2E8ZA 3GSRA 3X13A 3VA6A 1F6LL 3SKUD 2VLKB 4MNGE 1AC0A 5MEND 1BFOB 4X5XA 3KYMB 4PGJA 2PNDA 4J1UB 4NJAL 3KDMB 4GRLA 5IEHB 4M3JA 2NY2C 4U1MB 1N6VA 5HYQB 5JW4M 4L4TB 1OHQA 3NCJL 3SO3B 3QQ3A 3GKWH 3P77B 1A3LL 5L8LB 3EHBD 4ONGL 1JRHH 4FQJL 5DUPH 4L8DB 4PRIB 1WFOA 3VG9B 1ZA6B 4TNWF 5CBEA 2DQFA 1A4JA 3GMOA 4O2CA 4ZAKB 4Q97A 5HHOD 4FN0A 3IF1A 1EIBA 4FXGB 3OKDB 1GHFH 3BDBA 4ZSOE 5L8KB 1AQKH 2BRRH 3OR6A 4RCAA 4TRPL 4ERSH 1I75A 3MV8D 3BDXA 1CK0H 1EDQA 3HUJB 4NC0B 3W2DL 5CP3A 4PGCB 5TQ2H 1RZGA 3FJTA 5I2IA 4M43H 3FB5B 4QKXB 2WANA 1I7ZB 3OXSB 4N5UA 3O6KH 2VDML 3W82A 1TJHH 3QIUD 3O4LE 4Z7NF 1QFWI 4XTRC 3V4UL 2J8UB 3AFLA 3OX8B 1RZKH 3DMMC 1ZKAA 1D9KA 3ARDB 4DKFH 3M1BA 1ES0A 4Y19B 5DRZB 5ITFA 4M4PA 1KCVH 1KUMA 5F93C 1CQYA 3QAZC 1CT8A 4WTWA 3GSVA 3RWDB 5IQ9A 1RZFL 4TPRL 2R29L 4GAYB 4OCNC 4DEPC 2F74B 3VGHA 3ULVF 5FHAH 3HZYA 2VB5A 4MD5A 3L1OL 3QO0B 4CVZB 4TN9A 5SWSE 4OB5L 4RGMB 3NA4A 1QFUH 1MQKL 4OD1L 3HNSL 4U3HA 3DI2B 4EI6B 2ESVB 5CCKH 4F2MA 1NC4B 4L8SB 2X05A 3EFFA 1A7QH 5J7CC 3PWLB 3CVHA 4NBYB 3QT2A 4YBHA 1SEQH 1SBSL 4JCLA 4UUJA 3WV0A 5ETUA 5E99H 4S2SA 1GGBH 2VLRD 4QWWD 5J9PB 2PO6D 2XY2A 4Y2DA 1LD9B 4Q9RH 4KUCD 5FO9A 5DJAB 4M5ZL 4QHNA 5HYJB 2XTJD 5T5FL 4GSDL 4MD4B 1K8IB 1MREH 1T20A 2VISA 1T2QH 5DQDH 5IIEA 3L5IA 1GPOH 5CIPH 3TO2A 3IDNA 3S36L 2ZOLB 5CKGA 4Q58C 1FG2B 4OFIA 3MLZL 3P3YA 4DAGL 3U46A 4FABH 2BOBA 1FFPA 3KHOA 4Y5YA 1MCWW 2BNRA 4UILH 4OFDA 4HCRH 5T33H 4XWOD 4IRSA 4FFVC 1UB5A 1WEJH 2FGZA 4FTVB 5E6IC 1JTOA 4JFDE 1U8PB 1MEXH 4M6NH 4OLUL 4HWBH 4IS6B 1SVCP 5T3XL 5BZDA 3STZA 3JBG7 3P9LB 3DETC 5ACZA 2HMID 4U6VL 3N85H 2DQGH 2VH5L 5GS0H 3H9ZA 1J05B 4G43B 4HS6A 3RGVB 1VACA 1Q0XH 4M9PA 3BIKA 3BQUD 1NCWL 3FT3B 2VDQL 2VZTA 4ETQB 2FECI 4U0RC 2XKSA 4QNPF 3S36X 1XGPB 5IEKB 4NDMB 2ZUWA 1IGCL 1BGXH 2YPKB 2HTLD 2X44D 4QRRE 1S78C 1R3LA 4FFZH 1O7VA 4K3HA 3WNLA 5C0GA 1KNOB 1PSKL 3ARSA 5TPWH 5LXGL 1TETH 3PE9A 3ILQC 5HVFB 3SGKA 2C3VA 2HKHH 4FQLH 1OAYL 4OZHA 2FR4B 2Q3AA 5KAQF 4JFED 3G6JB 3TPKA 1HHHA 5A2FA 3B5GA 1CDHA 5DJXB 1FAIL 1A6ZA 1N59B 4X7SH 3WHE1 3V4PH 4M6OH 4AEHL 1GVIA 1P5VA 5JQ6L 2VDOH 1F97A 4PJCE 3GRWH 3TGXA 4LCCC 3QPXL 1QFPA 4HEPG 1NLDH 5C0BD 1JPFA 3FO1A 4MX7B 2DMCA 2AXGA 2Q86A 4A6YB 5C6WH 5JXAH 4KTYA 1MRCH 4QY8B 1CFNA 4YEEA 3E0GA 3UC0H 4W6WB 3I3BA 2YN5A 1DLHB 1NBZA 2J8UF 4PUBH 43CAB 4HXAL 3QRGL 4YHPB 5DMGC 4DFHA 3AXLB 1WWAX 2PW2B 5I16A 4LLVB 2NY3D 4U1GC 3LCYA 4BFBD 4HGWA 3T2NH 1PFCA 3LQAH 4TUOB 4C54A 3G6DH 5IVZA 5F89B 2E7LA 2VLJD 4ZYKB 2R69H 2OTWA 4OGXL 2Y06H 4G9FA 4P4KD 1NAKL 2DBLL 5DHYB 3STLA 3DMMA 2B20A 3WFZA 3OKOB 4TVPL 1DE4A 2R0LH 5T5NF 5CJBA 3V6FB 3T04D 3LN5B 3O2DA 4KKLC 5D7LA 2ZG2A 2A6KA 2QSTA 4NZTL 5GRZA 2CLZB 1HILA 3MUZ1 3REVB 5CGYC 1D5BB 4WI9A 1QACA 1XIWD 2ED9A 4MJIB 3RUGB 1BF8A 1RU9H 4D3CH 2LE9A 4EUPA 4DW2H 3PGCA 1I1FA 1EZVY 2VYRE 5FOBA 3RVWD 1WBZB 3MRHA 2NW2A 4WEBL 4XCYA 1N0LA 1HQRA 2EIZB 2HJKA 5SV4A 3OXRA 1TENA 1U3HB 5CEZD 1CCZA 4PLOB 1FFNB 2AGJL 3JWOL 5F1NA 1P2CA 1RUML 2A77L 3RVTC 4YHKL 5L2KD 1ZT4A 2NZ9D 2BHUA 1DDHA 1BFVH 3PV6A 1V7ML 3MBEB 1RK0A 3VFOA 1R6VA 1YY9D 2OJEB 3IDYB 2R0WL 4L4JA 4G6AD 4ZPVA 5GSRB 4ZUVA 3C9NB 5D7JC 3FOMB 3I3EA 5FFLA 1SEBA 5J3HD 3D39A 1LO4L 1JZ2A 1CDJA 2VL4A 1KIRB 5FYKH 2EEAA 2ZOKA 3RRQA 5DHVA 5D7KD 5HYSG 4LARL 5FGBC 2UWEB 4OGAD 4JCMA 1JGDA 5ILTH 1IKNC 3HPLB 3ZDYF 1U41A 5ADPL 5DS8A 3P0VL 2WNGA 5CJQH 2FIRT 2PYFA 3BH8B 1Q1JL 4L3EA 1HXYB 2VDRH 1OVZA 2GSIB 5DUBA 2OP4L 3VWKD 4O2EB 2DTML 4TSBL 5GRYA 1YEGH 4GG8B 5HXMA 3V6OC 1FJ1A 3P4OB 4WY7L 3C6LB 4IRJD 3S35L 5A2IH 5FGSA 4JFZH 5KTEH 5DJ6B 1JZ4A 3DV4A 3FB8A 1NANI 4PJXA 1YEKH 1S9XA 5IR1B 2J3SA 2W0LA 2HFFA 4PLNC 3IFNL 1HYRC 1WGOA 5FK9B 3QNXB 4G8FB 4P57A 5E6IA 1G6RL 2JJSC 4PLKC 5FUZH 5HDQL 5AZEL 2DM7A 3RZCD 3MO1A 4OLYL 1BAFL 4JG1H 3IETB 3K1KC 4U6HB 5IHUH 4D0DA 4K8RH 5A16B 5FHBH 4HK3N 4RA3A 2N1KA 4PJGE 2DLGA 4F7TA 2NXYB 3RKDD 3MACH 5JIPA 4OTXL 3BEVA 1OY3B 4HD9A 1IBGL 3PWVA 1MCFA 1EX0A 4EVNA 5DTFA 4JB9L 3HC4L 3BISA 5IMOA 2XZCH 3U2SB 5JPMB 1FIGL 4CADA 2Z4QB 4PRPA 3HZVB 1R3IL 4WI4A 4FNLH 3TN0C 1MHCA 3S34H 1S8DB 4GAJH 4NQDA 3I84A 5KANI 3S35X 4WCYH 2AKRA 1TNNA 3D85D 1A6VH 2OI9B 2GUOA 4CU7A 4Z77B 5F7YC 3C2AH 4BFIA 1FH5H 1N5AB 3FB7B 3VRLF 4OFYD 5HHOE 1FNGA 4RMQA 5F7LB 4LPYA 1RZ7L 1CLOL 1JK8B 2ITDB 4KHTH 5FYKU 3X14A 2UYLA 5HI3C 4Z7QF 3KJ6L 2JIXA 3MV7A 5CJOL 4FFYH 5E8PA 3D0VA 3MV8E 2R2BA 4QF1B 1BZ9A 2R2CA 1DZBA 1ERNA 1F6AB 1INEH 2DM4A 2YSSB 3KPRA 4LCCA 1BIIA 4QRTA 1UWGL 3BYTA 4JJ5A 3C60D 5LGJB 1WZKA