2R2CA

Crystal structure of a domain of the outer membrane lipoprotein omp28 from porphyromonas gingivalis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
121
Chain Sequence
b'KSYKTWDVPIAKINIFAVAEYTDTQKIKVTVKGKILEGNTLPKSMVQVYLLEDKNHVLRGAVNGIWGEEFVNLKDYLYTYAVEPLSGMSFVAENYSIVAFVYDVQTFEVYDVVHVKINPQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 28 kDa outer membrane protein Omp28
molecule tags Membrane protein
source organism Porphyromonas gingivalis
publication title The crystal structure of a domain of the outer membrane lipoprotein Omp28 from Porphyromonas gingivalis.
rcsb
total genus 23
structure length 121
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11551 Omp28 Outer membrane protein Omp28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2cA00
3K8MA 4M6NL 3RVXC 2H3NA 3EYQD 4XCFH 4WWKA 2XOTA 2CUMA 3QBTB 4XPAH 3QZWG 3BKCH 4PJIA 1IGCH 2VDQL 4RAUB 4YQXL 1RUML 3W9EB 4JREB 4PLKC 4HWBA 4MX7B 3D25B 4UDUB 5DHVA 1MY5A 4HEME 4ISVB 3PE9A 3HLAA 1PY9A 5E4IA 3ZKMC 2AXJA 4NM8H 4ODHH 1D5MB 1OAUH 3MLZH 4M7ZC 4M7JH 2H32H 4M1CD 2D7MA 4QGYA 5A3IC 1QFUH 5D5MA 3TIDA 5ANMA 1MCOL 1SJHB 4V1DA 2Q3AA 2DDQH 3O4LD 4NQCB 1B0WA 1RUKL 1G7PB 2UZYB 2OL3H 3NIGE 5GGVH 4MXQC 3FFDA 4KVCH 4WHTA 1DBBL 3WHXB 3VG9C 3HMXL 2AJ3B 3FHAA 2VAJA 5ISZB 1ONQB 4Y4FB 3D3VD 2QTEA 3SCMD 2AK4E 3ZE1F 5DEGA 5F7WC 1A4JA 3FONB 4IMLA 1C5BH 1HE7A 4GQ9H 4M00A 3AREC 3ZTNH 4O5LH 4YH6A 1CFQB 4PRNB 5GGQH 1TZGH 5DTFA 5FOBA 3WL9B 3OJDA 4LDOB 2ARJQ 3EBAA 3MLVL 4ONFH 4OZHA 4JFDA 3VCLB 5AAWA 1AO7A 2CMRL 1YY9D 5IESH 3O3DA 1FIEA 4Z7UA 3IF1B 1JFQL 1CG9A 3OGOE 1JZ7A 4PG2C 3GSWB 1C7TA 1IAIH 5DJ8B 4LSVL 1JGVH 1UC6A 4OF6A 1A7RL 4I2XA 4ZUTA 5C0EA 3CJJA 2J8UE 2QQNL 3FB5B 5HY9B 5FKAA 2JCCF 1JGLH 1QEWA 1OW0A 1S9YA 2FWOB 1BEYH 3FQRB 2CIKB 4P3CH 3VD4A 3MZTA 3NCEB 3RVWC 2G75B 5C7XH 5JOFA 3IDNA 4EIGB 3FB8A 4LPTA 3SKJL 4W4NA 3KG5A 2VDML 4PBWD 4AG4H 4AH2A 5IB3A 1A7NH 4Z95H 4QHKI 2ZUUA 2F5BH 3F7VB 4H5SB 1MHHB 5I1GH 1AI1L 3GSRA 2OBGA 4N0FB 5D7IB 2JTDA 5JW4Q 3FQTB 1W72A 3DO7A 4DEPC 5LGJB 1HCFX 1S8DB 3MRFA 2X4UA 2Y6SC 3BIKA 4ETQB 1XCQB 5FECB 4LGPB 4NKMB 4NPYB 1P53A 2NLJB 1UM4L 3S9DB 3TYGH 4LSPL 4LSVH 4UINL 2HP4A 1OF2B 3TNMA 3K2UL 2FR4B 1F11A 1BFVH 1DL7L 3HR6A 1H5BA 2DQTL 1MCFA 3QUXA 4ONFL 4NUJB 1JF1A 1I7RB 5FYJD 2M2DA 5MENB 1MCLA 2CK0L 3U79A 3MXWH 3TV3L 4QY8B 4W4OA 4X4YA 3C5ZC 4ZFOL 3ARBC 3KPSD 4PRBB 2NW3B 3RGVD 5IB2B 5T1LA 1DVFC 1R3LA 4PG9A 2C26A 5D6DC 3HHRB 4IMKA 3EJYC 3MBEC 1X4YA 2LU4A 1MJUL 3ETBF 4U7MA 3DX7B 4ODUB 2B5IB 4M6OH 3HNTL 3F65A 4EUPH 4L8BA 3U0PB 1M7DB 6FABH 2Y07H 3DBXB 3ZO0A 3U4AA 4BZ2L 3VFSA 3DXAD 5JPMA 4JFXA 4YHOL 1MHEB 5C07B 1WISA 1MCNA 4L29B 4WVRA 4HWNA 3SGJC 2P43B 5SV4A 2X40A 2J1KA 4LSTH 4M6NH 1HXMA 2XWBA 2HRLA 4K94L 1GRWA 5D2LA 2BCKB 4OQTA 1CLYH 1ZS8B 4IDLA 2BSTA 2BMKA 3JZ7A 3WFEH 3B3IB 1O7SA 2ZSWB 3KJ4B 3QWQB 1U91A 1T0MA 2A1WL 1L7IL 3ARGB 4Y19A 1WEJH 4OTXH 3PGDB 2YBRB 1FO0B 5E6IB 5L8JB 4L8SB 4OSUH 3VRJA 2FGWL 3MV7E 3QEGL 5ACLA 3V7AE 3CVHH 3ISWA 5C0BD 3WXVH 4WI8A 3X13B 5IHLB 4CJ0A 2BXYA 2VLKD 4YNYB 5CINL 2NY0D 4LIQH 5KSAB 2KPNA 1FRGL 4QHNB 3WN5A 2HG5B 3L5JA 1FE8L 5DJ8A 1UXSB 3SGEH 5C09E 3I6GB 3BN3B 3PWUB 4MAYB 5C86A 1A4KB 5DLMH 3VFNA 3BPOC 2GITA 1RK0B 2FEEI 1JHTB 1MVUA 4PGZA 4ZUUA 1OOAA 3FAWA 1FDLL 4FFYL 6FABL 2D0HA 4M48L 2VLJD 1ZT4B 4H20L 1QR4A 1MCWM 4U1JB 4E0RA 3S37H 2B0SH 2PR4L 4PGJA 3TYFB 4PJFB 2GSGB 1QBAA 3UJIH 1KULA 3RJQB 5GRJL 4JE4B 3D18A 3A6BL 1D7FA 1JZ3A 3BZ4B 1S9WA 3H7BA 5BZWB 2CUIA 2F74A 4TOYL 5CBEB 1AHWB 5BV7C 4XX1E 1XT5A 4D3CH 1GJIA 3LQAH 1T7XA 2FECL 4QCIB 3IU4L 5DJ2B 5EUOE 3B43A 1ORSA 3IFNH 3OJ2C 5FYKD 3VWJC 1NC2B 3OJMB 4NWUH 5D1ZC 1K4CB 3QDMB 3CAFA 8FABA 2JJSC 4PD4K 2AXFB 1UKTA 4Z8FL 4Q6IB 1F11B 4IRZH 1EHLH 4HAFA 1U93A 4F15C 3N06B 4UDUA 3T09A 4MJ5B 4EUPB 2V9RA 3VXTA 4MD0B 3N85L 1FP5A 3OAZH 1T0PB 5KTEH 1NCDH 4N90E 1YY9C 3BPOB 4JG0L 2NY6C 3ZE0E 3LH2H 2VZ1A 3LB6C 4O2CA 3O6FC 1OAQH 4CVXA 2NY0B 3L6FB 1BD2E 4GAFB 4O02H 3B9VA 2DMBA 3V5KB 3NIGF 2VXSH 3RTQA 5HYSG 5IOPB 5TE6L 4JKMA 3O6LH 3GGWB 2GJ6E 5HI3C 1QVOB 5DZOA 1CU4H 4M03A 2ICCA 4HFWA 2A2QT 2XN9E 4Q74A 2PW2B 1WUNT 1I1YB 4LGSB 3O8XB 5JW3L 2ZUTA 4NQCA 1G7PA 4WW1B 4NJAH 3D3VB 4OJFL 4LEXL 5KW9H 1YPZF 1RZJH 1UYWL 4L4VA 5SX5K 2H1PH 1IGTA 1A0QL 5C9KA 4MAYD 1S3KL 4I0PC 2FIRT 2CDGB 4GG8B 4NHUA 4E41B 2FYYA 1A4JB 1A7RH 1A21A 1MRCL 1VSCA 3CH1A 1N64L 4C4KO 1ZT1A 1KIPA 1UG9A 1FYTE 4KTDL 5IESL 5GISH 5DUML 4MMXC 5DEFB 3P4NB 1CI5A 4L9LA 4N5ED 4ZAKD 1IBGL 1HQRA 1U8NA 2UYLB 1TNMA 3AXLB 3HZVA 3CU7A 1P7QD 1RZKH 1J88A 4DQOH 5IMLB 2AQ2A 3QT2A 5CZXD 5FUZH 4OF7A 4PJ8D 5T5FH 4ETYA 5KG9A 2YRZA 2YZ8A 4KC3B 5H8DA 2B39A 3I3EA 2AVGA 5AAMA 3ESVF 1AQKL 2JJTA 3O41B 3KNBB 4WI7A 4EEEA 3OL2A 1UENA 2C7UB 3FFCA 2Z31D 1KLUA 1QO3A 4KROB 5BJTB 2F5AL 3C60A 2GSIB 3DURB 5GGSY 1DTUA 4KJYA 4ODHL 4AM0A 5CD5C 1OGAE 4I0PB 5FEBA 3FO1A 1XF5A 4PJAB 2Q3ZA 1MFCL 1JNLH 1U8HA 1MVUB 3EYVA 3VFRB 3CFKA 4G8EA 3FT3B 5DD3L 1SQ2N 2OL3A 4P2QE 4KK8D 1WZKA 5EZOH 4JHAH 2H3NB 3DWTA 1EH9A 3O0RL 4MD5B 4X0KA 2P8MB 2Q6WB 2FB4L 1FNEB 2YC1B 2BVOA 4PP2A 5IROC 2DQFA 4HUKB 4M8VA 4Z7VB 2RB8A 1ZVSA 1Q8MA 1D6EB 4ELMB 2BNQA 5F21B 3HE6B 4P4KA 2ZNWA 4ZS7L 5IEHA 4FRWA 2NY0C 1RZIA 1IT9L 4QY8A 1NMAL 2BERA 1GOFA 3QEHB 4HK0B 1SBBA 2FSEA 4MA3B 4IS6A 2BOCB 4ODUA 2NZ9C 3TIDB 3V6OA 4XP4H 1FQ9C 1XF1A 3VGDA 5F7LB 1P1ZA 5I8CB 4AL8L 3DTXA 3WJLA 1YEKH 5GSRA 3N9GH 3UTQB 1F4YL 5K9OB 4PJEA 2W1NA 1LE9B 2C4XA 2VKXA 4JJ5B 1FO0H 3P4OA 4QOKE 2JE8A 1XMWA 3B8YA 3PGFH 5E2UH 3U0PA 1BAFL 1UM6H 2RFXA 1E0OB 2X4SB 3O2DA 4XPBH 4OM0L 2BVTA 4GUPB 3W5NA 4HC1A 2NPLX 4RWHA 5HBBA 4M61A 3WO4B 1MHEA 5C07A 4ZAKC 1M6OA 1AO7B 5HYJB 5M7QA 3NA4A 1V7NL 3P4MA 5BVPL 5F1NB 2ORBL 2NY4D 4U3HA 1OD9A 1YPZB 3IDMA 2YA0A 4J23A 3WHE0 4HPYL 5DF0A 4PYGA 4PB9H 1U3HB 2IFFH 2OLDA 4G43A 5FKAB 2BNRA 1FPTH 2DI8A 5CGYD 3L3DB 4GBXC 1R24A 1A47A 3ES6B 3L7EA 2DJSA 3V2AR 3MXVL 4Y4FC 2B4CC 4MAYC 4JM4L 4UQ3A 2VLJE 1B6UA 1D3CA 2E8YA 4XB7A 1WSST 2VOTA 3MREA 2YUWA 4AZ8A 1ZGLP 1WIPA 2NY6B 3ARBA 5GS3A 1RUQH 5E2VH 3WO4C 5JQ6L 4TN9A 5E99L 3UYRL 2YWZA 1NCBL 4GXVH 2FBOJ 1TJIL 4N68A 1GPOH 2XTJD 2X4NB 2W60B 2IADA 1HEZB 1RJLB 1MFBH 4WHYG 4NZTH 3O3BA 4DKFH 3DSNA 3BDXA 2Q87A 3P4LA 1G9MC 3A6OA 5L9DL 2W91A 1T4KA 1F13A 4LSQH 1CXKA 1JHTA 4L5FL 1KJ3L 5DVLA 4G5ZL 3SPVB 3GSNL 3BKYH 4OB5L 3I6GA 4NQUA 2F15A 1NBYA 3GSVB 4ZUWB 1ORQB 4MS8D 2GSGA 4LCUA 4PJXA 1RURL 3KHOA 4YBQD 1OP3H 1U8LA 4ZG1A 4QHMB 4FZEL 3ULUC 1A6VH 2FL5A 1YA5A 3BPNC 5E1AB 3CK0H 1HNGA 3RWGB 5KVEL 1HOCB 2EDFA 3IDGA 3GMLB 2GSIA 3NAAL 2QADB 2ZCHH 3DXAB 3G5ZA 3P2TA 2BNUA 4OCYH 3VD3A 3RWCB 2FX9L 2VL5A 3DI3B 2PO6D 4NT6A 3IKCA 1U8HB 2AEPL 3RWHA 1OW0C 2X09A 4UOJA 4GW5A 4FQ2H 2Y36L 3CDGB 3FT3A 1N6QH 2Z91B 3V6OC 2UY6A 3RI5K 1ADQA 2CR3A 3SE8L 1B90A 2C3VA 3PHQB 5T33L 3E6FB 4NN6C 1URLA 1AP2A 4PP2B 3EYOB 3FN3A 2FNBA 3JV5A 4R4NC 2A9MH 1QSEB 1JZ8A 4AYFA 4RGOH 2KZ1B 4JO2H 3BW9B 1T1XB 2NY7L 2BY0A 2NXZC 5D1QC 3KPSB 1JBJA 1EJOH 1N7MH 1ZA6B 2E9JA 1JNHB 4JPKH 4HKBB 3V7AG 2ZOKB 1RUPL 2ZCHL 2X05A 1IJ9A 1F90H 3HFMH 5GGSA 5LAXB 4RGNC 5EPMA 4OZGE 2PYED 4HUWA 3JWOL 5A16A 1EMTH 2XTJC 3GGWA 1YEDA 5D2LB 4NO0A 4BKLB 4LSDA 4OF3A 1DQLH 4JG1L 3UPRA 2CO6B 1J11A 5AWNL 5JHDA 5I1CH 4XBPA 3ARDC 4O9HH 3D3VA 1UM5L 4MNQB 4FQPA 1TDQA 4N0UE 4B7IA 5CFHA 3GUTA 4XCNA 3GMQB 1KNOB 2J4WL 3IB4A 3PIQA 1PZUB 5DK3A 5E2WH 2C1OB 2DYPD 4R4FL 2Y9RT 3VWKA 3OWEA 4P5TA 3MROA 3WXWL 2GTZB 3MV8A 5L9DH 3I84A 3IFLL 2I07A 2EECA 5F9DC 5MP6H 5T1KA 3W82A 5B3NA 1CE1L 4RFOL 4OUUB 3KPRE 2X89A 4S1QH 3G5YB 3ZHLA 4L5FH 2XY1A 1XIWB 4LSQL 15C8H 1RUQL 2YS4A 2B2XL 1A4KA 1C16A 1WITA 4NZTL 1VADA 5KSBA 5J12C 5C0CE 3I50H 1XIWD 2F53A 4UQ3B 1M05B 2YEZA 4KPHL 4HIHB 5FOJA 5AD0A 3HR5B 3RWDB 2AJZB 5HHQB 5DRNA 4LVEA 4U1JA 5INCA 3L3OB 2P4AB 5KG9B 4JDVA 1ZHNA 4XVSL 4Y5XB 5J56B 5IVXE 1I8LC 2QHRL 5I17B 4E5XA 5JPNA 3W81A 4XWOD 2OJZH 3O6FB 2V5TA 4APQA 4YFEA 2XI9A 3QIWD 1EFXB 4PR5B 5BVPH 2B1HH 3V4PL 4YIQA 1N5AA 4X7TB 2OR7A 4Y19D 2GCYB 5DQJA 1X5HA 2F19H 3ARED 4ZXBB 4NQVA 2B2XH 2EIDA 2OZ4H 4M4PA 3HB3C 5EU6D 2A73B 1FG9C 4OLWL 2OZ4A 4CU6A 4JFYB 2YKLH 1T0NB 2NY3C 5IV2A 5E2UL 1ERNA 3RQ3A 1HN1A 2ZJSH 4XMLL 4Z77A 3AC0A 4CMHB 2W65A 1FSKB 4O51A 4MDJA 1V8HA 3QUXD 5CSGA 1A6AB 2PXYD 1NCTA 4AL8H 1EFQA 4P49A 3ULVL 4XP4L 3RY6A 4OIAA 2ZUQB 5I6XC 4O9HL 2NQCA 4C59B 4ELMA 2EO1A 2PYEE 3KYKL 2BVUA 5CD5D 2WBJA 5AWNH 3QEHA 4HK0A 3E8UH 3KJ6H 1DQLL 1A7BA 4KKNA 1LE9A 1EMTL 2BOCA 4RMUA 3VWJA 4YDLC 4PLOB 2NTSP 3LCYA 5DK0A 5EO9B 3DROA 4TUKH 2XPGA 1D9KD 4Q9BA 1XH3B 4OZFH 4GUPA 5IB5B 3VXQB 1QHOA 3N50A 1BZQK 1T1XA 2NY7H 5IVOA 3RVWD 3MCG1 4GG8A 1TVHB 1ZLWH 1KTLA 5FO7A 1NCCL 4E41A 1KJ2L 3L3GA 1ES0B 4NWTH 3JWDC 5J06A 3PGCA 3BKMH 1BFTA 5CAYB 2W0KA 1JHKL 4Q0XH 2DLTA 3MGTB 3MLSL 2GQHA 5FYJL 1AD0B 1JNLL 4M61B 1KN2L 2NZ9D 1I3GH 3OXSB 4GOSA 1QNZH 1E4JA 4D8PA 5C0GB 5I2IB 5IQ7H 3VXSE 2EH7L 1QSFA 2EDRA 3CXHK 5GZOC 5JZ7D 4ZPVB 5F88A 2ZUSA 2APBA 3BT2L 3RGVC 3T2PA 1D6VH 2XQBL 4G43B 5FUCE 4ODSH 5DMIH 4XVJL 5GJSL 1K8DA 5CBAA 1P5UA 2D31A 3FO9A 3ES6A 3L7EB 4XC1L 1N0XL 3S34H 5IT2H 2XFXA 3RTQD 1EA9C 4DZBB 1KCRH 1OAYH 5IM7B 4JZJC 4OZGF 3H0TA 1REIA 2VLRD 4KUZH 4P46B 4CAGA 3OZ9L 5IROA 5T3XL 4PJ7A 5BS0D 1T4KB 2Z93A 4PRAA 4Q0XL 1X5YA 1KGCE 4XPFL 2ADFH 1NCCH 4HG4K 3BWAB 3AY4A 3TO2A 4LCYA 4ZUWA 3T0EC 3QQNA 1FNLA 2Z4QA 2MOVA 1G6RA 3GNML 3D1MC 4J4PA 1Y18B 2YD1A 1SM3L 1M05A 1CWVA 1U58B 1YY8A 2PNDA 5EA0H 4XAKD 4HWUA 1TFHA 5IK3B 4WU5A 1OGAB 2XKNA 5I18L 3KLHD 1AO7D 1G7JA 4XP6H 4G8IA 2WWMC 3G5ZB 3E8UL 3KJ6L 3F7RA 3UX9B 4XNMA 5JR1L 4B7LA 3BIAX 4G6FD 1MWAA 3BO8B 2CDEB 2ERJC 4Q9RL 4GKOA 3RL1A 2J88L 3SJVE 3QNZB 4WWKB 3U36B 1HYSD 1X5KA 3IKCB 4XVUC 4XH2A 3OKEA 1G6RL 2ZJSL 3ZDYF 2VXVH 1GYAA 1WWBX 3FO0H 4L9LC 1JPFA 4N0RA 4EKXA 4DWHA 2R0KH 3PWPD 2X4OB 1VPOL 4WV1C 3LH2L 3PWPA 4ACPA 2HTKC 3MOBL 3BESR 3FTGA 2XKUA 2VKWA 5MERA 1U2CA 1WZ1H 5HI5D 1JGDB 5DRWA 4XPBL 3NPZB 3U83A 2MQ0A 5EORL 4KI5F 2D7NA 1PAMA 2O5XH 1NSNL 2RAMA 3LN4A 3C2AL 4BQ6A 2EEAA 4LLVA 1PDKA 1H5BC 1JWMA 2IQAB 4PJBF 5DC0A 4JFPA 3VXNB 2OM5A 4PJDE 4TUJA 5HYJA 4W6YB 2VERN 5F96H 3RKDD 1ZGLM 4KI5D 3OKMA 1NDGB 3GFUA 3REVB 3STZB 4JKWA 1FJ1A 4RFEA 3QWOB 2Z0BA 1AIFA 3IU4H 1MREL 4CVUA 4UBDD 1ITCA 5HHNB 4KKCD 3VXPA 1CT8A 4PRPB 2ADGB 4ODXB 2Q7YB 1KPRB 2XN9D 3FRUA 1NAKH 2DQEL 2V7HB 1KNOA 1TETL 3S96B 2BNQD 5BQ7A 5C0BE 1KB5B 5B39B 4Z7VF 4ZS7H 5GRJH 2YRPA 3UTTE 2A83B 3VWKD 15C8L 4OZHB 4JFDB 3VCLA 1T2QL 4NQDD 3UCRA 2SEBB 3QEQA 4LAQH 2DJ4A 4L29A 3ARBB 1B2WH 4P5KA 5EOCJ 2HJLB 3IT8D 4RZCB 1CE1H 4OUUA 3BGFC 2K1MA 1T1ZB 1JGUH 5D1ZD 2Z35B 4PTTB 4TTGA 1HNFA 2DTSA 3UZQA 5FHAL 3JTSB 5EU3B 1ZWIA 1LEKB 3ZDXF 1TVBB 3UDWA 1I9IL 5CHNB 1KIQA 4XCYA 2L7UA 3CVHL 5INDB 3GMRA 5DJAA 5KANG 1KXTB 5I1KL 2HVKB 1XIWA 2F53D 1VGKB 4PJIF 2IBZX 3QUZD 1Z9MA 2COQA 4QXWA 4L8CB 1RZ8A 4K7PX 5I1CL 4JRYD 3RZCC 1LNUB 4P46C 1E4XL 3BP7A 1Q1JL 3G08B 2DYPB 4FFWC 4OLZL 1V3JA 5DJDA 3BAEL 4CADA 3UO1L 2HFEA 3QFJD 4O4YH 2XZQH 5AZEL 3RWDA 5ICYA 3MNWA 4G8GB 1WQVT 1RHHB 1FCGA 3CMOL 1P2CA 3EYUH 3NMEA 4JY6A 3X14A 1CFVH 1BZ9A 1PEZA 1JE6A 1FVCB 1G7QA 2JCCA 3AAZA 5E9DA 3ARDA 2GTWA 3T65A 4KV5E 4APQB 4ZQKB 4DKDC 4I3SH 2NLJA 4PJFF 5DD5L 3O11B 1DBAL 1QFHA 2GITB 5CZVH 4K7PY 5KVMC 3RWIA 3QUYC 4K94H 5EN2B 1YMMA 4WO4D 3MLWL 2DM2A 5JHLL 4KZEL 3FOLB 4LSTL 4OAWA 5C6PB 1I1AB 1MH5A 5EZJB 4PJCA 3EJZC 1G7IA 1NGYA 1QRNB 4CW1A 2RBLA 4KKCC 1G7JB 3DVIA 5KBNC 4TVSa 5F3HB 2AJUH 2XXCB 3MX0A 1PW3A 5GZOD 2BVQA 4R2GD 2WSKA 3RWFA 5MEQB 2LU3A 3TBVA 4PG9B 2WBJD 3EFDH 2IPUK 2WAHA 3GSQB 3BO8A 4R7NB 3MNZA 5F9AC 3V0VA 5EUKB 3HI1B 3QZWB 1U42A 3RIFK 5E8DH 1DUZB 3B83A 2Y1VA 3ARQA 3QNZA 1JZ2A 4YHPB 2HN7B 5KSUA 2VISB 5HI5C 1E28A 3QAZB 3UC0H 4LKCA 4MQSB 4S1RH 4FXKA 2VXSL 4XAWL 3LKQA 2DQTH 4F57L 4F7EA 3K2UH 4YAQB 4OGAD 3I02B 3O3EA 3TV3H 3ZT5A 4X5XB 1VFAB 4D9LH 2FBJH 4Q6YA 1UM4H 2NTFA 3GIVA 5EC1A 2VZSA 5BW7C 2R0WH 3KR3H 1CFNA 3H9SA 1RZGB 1NLBH 3V5KA 3CC5A 4KQ4H 3GBNL 2WUCL 5FCUL 3GJFA 1ES0A 3V5HB 2I07B 1CDGA 4DGVH 5H37G 5F72S 4U6HB 1N26A 4KMTL 4L4VE 2A77L 5E2VL 3VFOA 3T08A 2QSQA 3U48A 4BFBD 1I1YA 1R3JB 3MJ8B 4H26A 1X9QA 3QCTL 5C08D 1E4XI 3CX5K 1FL6A 4KHXL 3ARGA 3VFMA 1LWRA 4WUUA 5ESAB 1S9YB 3MMEB 4OZ4A 4XHJC 2LVCA 3QWRA 4IMKC 5HHMD 2ADIA 4MCYA 1K3IA 5F7HA 1ZXQA 2EDWA 5JOFB 3PXHA 4HS3B 4NHUB 4CUCA 5HGBB 4PB9L 3H3BC 1NFDA 1BEYL 5FIEA 4WI9A 4BM7A 5FK9B 5INCB 1ZT1B 3VMNA 5HHOA 1Z9LA 5DJZA 4OKVA 5T3XE 4AEFA 4H20H 5BS0B 4NN5B 1X7QB 1FNSH 4XNQA 4LCWD 5IM7A 3N1GC 2VLRA 3AU1B 1A7QH 1CFTB 5FM4A 1ZWIB 2X4QA 3MFFB 4NUGL 3ARGC 3MLVH 3B6SA 3BP5A 3KJ4C 5IEKB 5IG7A 1VKXA 3P73B 3RWEA 1IQWH 1A6ZA 1XCTA 4PPTA 1ZT4A 3ZKMD 2HWZH 3BI9X 1ZMYA 1IM3B 3RZCD 2V5SA 3TCXA 5IFJA 2ENYA 3N9GL 5GGQL 4DKEL 3S35X 2D9QB 3KXFB 4BSVB 4XWGH 1ZK9A 4KVCL 4MDJB 4YHYC 5T1DH 3DPBA 3FN0L 1I1FB 5DWUH 2YD6A 5HJ3A 1MCOH 1VENA 3ARDB 1PG7L 4HUXB 3C2SA 1ORSB 4KKLC 1I7ZB 5MEOA 1DBBH 1UXWA 1CR9L 4U6VH 3W5MA 1TTUA 2HT2D 5T1LB 4PJIE 3FO1B 3LKRB 3RAJH 4PJ8B 5A2KH 5KOVC 1MWAB 1DE4B 2ADJB 1N59B 1NGZA 4YFLI 3TIEA 2UWEF 3O0RH 3U7YH 4QHUA 4PGCB 5HD8D 3P9LB 1QBBA 1EHNA 3SDAB 1BF8A 5EZOL 2KZWA 3DRQB 3BKCL 4RMRA 3ARDD 4DK3A 5C71A 4EDWL 4JHZA 5C8JB 5A43C 4V1DE 4X5WB 1QA9A 5LGKA 3BWUC 4BZ2H 1TVHA 4TSBH 4YQXH 5E70A 3RUGF 4C4KT 4R7NA 5KSVB 3T4AA 4IM8A 3HI1A 3QZWA 4R7DB 4MXQD 1NDGA 2IQ9H 2DTMH 4TQEL 2P47B 3JV4B 5ID0B 3FMGL 3HNTH 3BKJL 2QSCH 3FB6B 2IQAA 4HJ0C 4CVZA 1RUAL 1QP1A 4UTBL 4ONGL 4XP5L 5TDOB 4RMWA 5D2LF 2V2WA 1WBZA 5EUOB 3MRQA 4L3ED 4OLVL 1VFUA 1S7SA 3S96A 5T5FL 5D2NC 3KLAA 3QXVA 1KB9K 5KJRH 4LKXB 3VXPB 3DV6B 1XF4A 5T1LD 3FN0H 4B50A 4Z7UE 1VACB 3U0TB 4P5KB 5TDPB 3VFTA 5F6HJ 1F97A 4RFNB 3DGCR 3MV9D 4JAMA 1R3IL 2XFXB 1ADQL 3VA6A 2NR6C 2A83A 4Q9QH 3CSPA 4M02A 5GGTL 1A6UH 2CRZA 4CGTA 5GIRB 3L5WA 5ADOH 3NACH 4WFHD 3RA7H 2CUHA 2VXUL 4JN2B 1KIQB 4MJ6A 5HTSA 1LGVA 5F1KC 3B9KB 3LS5H 2M8XA 4HWZB 5LBSH 4ALAL 4KQ3L 2BNRB 4KXZI 4LCYB 2XN9B 5D5ME 4I77L 3G08A 1AHWC 5BV7B 2OCFD 3V4UL 4LEXH 5KW9L 2HFEB 1XGPA 4FHBD 4RFNC 5JORA 1J0HA 4UU9B 1IGIL 4ZS6C 4U1NB 5E1HB 3WIHL 1QFWH 1Q38A 2V17L 3BZFA 4Y16C 5ICYB 4J7RA 3SKJH 1NKOA 3HC4H 3R0NA 4AM0B 4BH7A 1H3GA 3BEVB 4YHML 2X4QB 3MFFA 3QUMH 1OAQL 1XF5B 4WHYH 2QR0A 1JGLL 4PJXE 4ZMAT 4IDJL 3QRGL 5D1XD 3MCKA 3PQYD 1YYMH 1IAIL 3DRTA 3GSVA 1IC7H 1P69B 4X4MA 3ARFB 3U9PL 4FABH 4O00A 2WUCH 5FCUH 5D7LB 1OARL 4PRIA 5BRZD 2CMRH 1T5WB 2DIAA 3LN5A 4IRZL 4NQCD 4W70A 5F97E 4M7KH 3CVHA 3SE3C 3U0WH 7FABH 4NNYB 5GRVK 4NQSA 4U0RC 1GCFA 3FRPA 4O5LL 4R96A 3BD5A 2Z8WC 3WNLA 1S78D 2IH1A 4P2OD 1FFPB 1KENH 3TO4D 1TPXB 2CO7B 1NUNB 1J1XL 4JO4L 3SCMA 2YD8A 5DFVC 3LKOB 4XC3L 3LN4B 2R8SH 4X6DA 2PTUA 3RBGA 5J13C 1UA6L 3GSQA 4WEMB 1A6TB 1CDHA 4L3EE 4BFIA 3UJIL 4P2CG 1RUKH 4WGWB 1FBIL 2ICWI 1DJSA 1CD8A 4JRXA 5C0JB 1BD2B 4RQQA 2ICES 2RFXB 4LKCB 1BVKA 1B9ZA 1FDLH 1T3FB 4FFYH 3VD7A 3BYYA 1CXIA 5FDYA 3BPLB 1T89C 4JFFB 5J1AB 2AXGB 1UB5B 3T3MF 1ZA6A 4DGIH 2IWGA 4QNPE 5ITFB 1HHIA 5LJYH 4H1LG 1KFAL 1QPXA 5EPMB 3E6HB 5L8LB 3MUY1 4PV9A 1ZHKB 3MRGA 2NY4B 2DQGH 3MRQB 3LSOB 5GGUB 1QBLH 1BBDL 4OZ4B 2DJUA 5ILTL 2EDBA 3BGMA 4U3XA 2CKBA 3GRWA 1FFOB 4JVPA 2YPLD 3WS3A 3VFMB 1YNKH 1Z6JT 1S7WA 2H32A 5B38A 4WO4B 1Q72L 4G3YL 4QRRB 4Y1AB 4E9LA 3KPNA 1AR1D 4U49A 4KMLB 4ONHA 4QF1B 3QXUA 5HI4C 1NGPH 3MC0A 3O4OB 1BOGA 4OLZH 1ZANH 3VRLF 1RJLA 1NFDB 1QBMH 4DGYL 4PY8J 2FGZA 1VERA 4KWUA 4KGLA 4GRWH 4FZ8H 4PUBH 1BM3H 5BJTA 1UJ3C 2CLZA 1R5IA 1PJ9A 3SE9H 5BVJB 4H8WL 3MLUL 1I9IH 3QDGB 3LIZH 1FL5B 1ORQA 3C6LD 3O2WH 5CWSA 1QYGL 1G7LA 4I0CC 4KUCF 2FL5B 1B2WL 4YUEL 25C8H 4Y8AA 2DM4A 3GHBL 1W2KT 4YHZH 1W8NA 1NLDL 4OIBA 4XTRD 1S9VA 3QH3A 3ECBB 1U8QB 1DLHB 2FJGA 1P7QA 2HJKA 1P9MA 3IAPA 4MB3A 2BVQB 1N2RA 1YYLL 2E9WA 4NKOB 1NGPL 3R1GH 1YMHA 1T1YA 3PL6A 1TITA 1LVEA 4MQ7A 4PJ8A 4RAHA 3TNNA 1JWSA 1XZ0B 3MLXL 4ZFFA 2NY1C 1UACH 1T66D 1CVRA 4KHTH 2R1WA 1QD0A 5GHWL 4PJGA 2G5BA 5ABDE 5F96L 4EDXA 3LKRA 2YA2A 1B0GB 5B39G 3NZ8B 1T5WA 4APQD 2DQGL 4ZODA 5ESVA 1IEAA 2HLAA 2R0ZH 1IAOB 2P1YA 4NGHH 2W92A 3MA7A 3JVGC 1F58L 3FFCD 4AT6B 2PTTA 4L8DA 2XRAH 3AREB 4ZXBD 1QFWI 4AIXA 3CZFA 5CJOL 4G8FA 1FFPA 1BLNB 3SE3A 5E4EB 1J8KA 2WBJB 2Z8SA 4F80A 4RGMB 4J3UA 3ZHDA 3U2SB 1EK3A 1A02N 5D1ZB 4KJQC 3WHXA 4LOUD 2J88H 3PWLA 4EBQL 3RU8L 3F7YA 1DZBA 4HWEH 4AG4L 4ZTOH 2P5WB 4P5MA 1Q9LB 4ZSOA 1T3FA 1DBJL 1HINH 1S7RB 1S7TA 3G04B 1LO5B 3P9MA 5DD0L 1CFQA 3UAJC 3K4DA 1LE5A 1MF2H 3MRBA 3KGRA 4LKXA 4HJGB 1TMCB 3WO3B 5A2IH 4A6YB 1YQ2A 5HGHB 3BD3A 1XF3A 3FB7B 5GGRB 3ZE0F 4JPIA 1IARB 1F6LL 3L1OL 1W0WA 5EU6E 3RIAK 2GK2A 4GS7C 3D2UA 4I8DA 4TNWK 1W72L 5I73B 3HS0A 5C2UB 2GJ6B 1FYHB 4GQ9L 3SPVA 1CK0H 1JHLH 4CN6A 3HR5A 4R90H 4G6AC 3K46A 5IJKA 3S3JA 2CLRA 5CGMA 2EEDA 4JDVB 4WTXA 5HHVH 1G1CA 1FFNB 4QNPF 2Q76B 1F6FB 1GIGH 4LSUL 5CZXC 1FZOA 3VXRD 5KZCD 2X9XA 1AXTL 4DN4L 4M7LH 1IE5A 2NR6D 4Z7QF 1Z0NA 4KKAC 2I27N 5EBGA 2AABH 2V17H 3C5ZB 4NZUL 2IGFH 1UVQB 2OYPA 4X8XA 4NFCA 3ZKXC 1WZLA 3WIHH 3AMLA 4JVWA 4BA8A 3UTSA 3F62A 3BWAA 1IGMH 4LARL 4PJ5D 1FH5H 3SDXE 2X4PB 3I6LD 2EDEA 2D4DA 3EDKA 2PETA 3HZKB 1OF2A 1RPQA 2VLLB 4PYHA 5I1HH 1I8KB 3CDGA 1G7LB 2ZNXA 4U31A 4HGMA 3OSKA 2O5ZL 2DI7A 4DN3H 4F7CA 5HDBF 3BUYA 4KI5C 1RFDH 3IKKA 3V6ZA 4NO0D 1XGYH 1I9RH 4AMKH 2IPTH 4DEPB 1DLFH 1MRFL 3EYOA 3ECBA 4CU8A 3O3AA 1K5NA 2J6EL 4KK8C 5DD1H 2AP2A 2DQDL 5IB2A 1AY1L 1DEEB 4NNYA 3PABA 4P2QA 1R3IH 5IW6A 1G7MA 3OXRA 4A6YL 3TNNB 4NJ9H 4X4XA 3H9YA 2G2RA 4M7LT 5EC2B 4YXKL 5SX4I 4N9OB 1UKSA 3DX7A 1CE6A 4MQXD 5LAXA 4K3HA 3HZYB 4NO5A 5B3JF 4IIQA 3I6KA 3ZKSD 1DVFB 3DLQR 5ESVB 2AI0H 4K71B 5EOQL 3NA9H 2BRRL 2DL2A 3LKSA 4OV5A 4N1HB 3FMGH 5TQ2H 1JWUB 1TJHL 1ZOXA 3RJDA 1VACA 3H3PL 3U0TA 2J2ZA 5I16A 1TCRB 1G0DA 2Y7QB 3BZDA 1M7IA 4OGAC 4MNGE 5L2KE 3ULVE 4UT9L 3KLHC 1T89A 5BZDB 1Q94A 4ZYKA 2DMCA 2ZPKL 4OFKA 1FN4B 5EIIB 3BE1H 1DANT 3T3PE 5BCAA 3OAYH 2BMKB 4QRTB 3GKZA 1AIFB 4N1EA 4G7VH 4JFDE 3U7YL 1QQDA 1HI6B 3MRGB 1JPTL 1U8KA 1J1OL 1R5WA 1NBVL 2YPKB 1G1YA 4YR6A 4L8SA 3VRJB 4FA8A 1AD9A 4F7PB 1YEJL 3F8UB 1LE5B 2Q8AL 3NGBC 1U92B 1CLCA 1NUGA 2YEZB 1FFOA 3X13A 1D5XA 5M94B 1PG7H 3KXFD 4G80B 2R69H 4UNTA 1S7XA 1DQDL 1RIVH 1ZVYA 2BNRE 32C2B 1LDPH 5F9WB 5D5MB 1BGXH 3T2QA 4OCLC 1HSAA 3BSZH 4XWGL 5DSCA 3TT1L 3LHPL 2WWKT 1FL5A 4FQXC 3WD5H 4FNLH 2MMXA 3QUYD 1U8MB 3VGFA 1SJEA 2CR6A 1GH7A 4MNHB 5C2BL 2GUOB 1RZ8B 4LF3A 1LNUA 3AM8C 3IFLH 4IRSB 3IETB 4PGDB 4PBVC 3VXRB 4NM4H 5HDQH 3WKMH 5AYQA 3WXWH 3NFSH 4NQDA 5CKGA 4U1KA 4PRNA 1FZOB 5AYUH 5J1SC 2AEQL 3UTZA 3SO5A 3BVNB 5FM5O 1WICA 2FJGB 4Y16A 1RU9L 3GI9H 4TPRH 2XACC 3KPPB 3MLRL 1T1YB 5I74B 5F9JA 5K9JH 1KPUA 5I1DB 1FNFA 3QR2A 4TUOA 1EO7A 1Y6KR 1JI1A 4XPTL 3NGBB 3LVEA 5CJBA 1QRNE 1FGVH 1V3MA 3U36A 5GS2D 3MBXH 5J9PB 1A1OA 2KH2B 3NCYS 2ATKA 4Q6IA 4GKZB 3U7AA 4P2RB 2KUTA 2L0DA 2E9IA 3IDNB 3FQXA 2QJDA 1MCQA 2XWJB 4KHXH 1JPGA 3LQZB 2ZUQC 3WIIL 1MH5B 4M7ZB 4UV4H 4LAJH 3ULUD 4JRXB 1IM9A 3NCMA 2PYEB 1C12A 3FTGB 1WAAF 5CP3A 4KMTH 1XEDA 2PTTB 4L8DB 4YXHL 3Q1SH 2XPGB 4O2EB 1Z5LA 3GSRB 4DGVL 4O2CB 1L0XA 4KKBC 4OZGA 5FUCC 2AJSH 4C58B 5DJ0B 5AG8A 5ELIA 1WAAE 5J1AA 1N3NA 4K7FA 1JWMB 2ZUXA 1CS6A 1HHJB 5BOZG 4TUJB 3AREA 1NC4D 3RUGB 2UUDK 2Z92B 1W0YT 3IDYC 2FBJL 3PNWB 4D9LL 3TF7C 2V9TA 2X4UB 4K2UH 4ETQA 1XCQA 4WCYL 2FO1A 2UUDH 3T8XB 1N6QL 1MIEL 1JPSL 2NCMA 4F57H 1JZ5A 3P0GB 4XI5C 4PGEA 1ETZB 2QQLL 5DYOB 4BSWB 2YPVL 1FYTD 4HXBH 4MNGB 1GZPB 2DQIL 5KVDL 1NCWH 3FT2A 4GXUN 3T0EE 3D69A 5I30H 4ZSOB 2H32B 4YGAB 4FQ1H 1K8DB 1TCRA 3NABL 2NTFB 4UIKH 3UJJH 4U7SA 1FV1B 1CFSB 1MLCB 5CSBA 4JFDD 3RL2B 2VXQL 4L4TB 1PSKL 1N4XH 1U3JA 3OF6D 4PTTA 5D96B 4P46A 1MIEH 1GOGA 1Z3GH 3KPSE 2EYRA 2DLFH 1HZHH 1XIWC 2FH8A 3CD4A 2DIJA 4GMSL 2D0FA 2DWEB 1EEZA 5GJTH 2R2BB 1T5XA 2HVKA 4ZNEE 4F37F 1H3PL 5GS0H 4L8CA 3FN9A 3BH8A 4YWGL 4X6EB 2B8OT 1AKJB 3QUKB 1FFNA 3SOBL 5M95B 3HNSL 1NC2D 4LNVA 1DBAH 4JY4A 1NGQH 3U7WH 4I3SL 3C8HA 5ERWB 3WBDA 1FFRA 1V3KA 4IOIA 3B9AA 5L88H 1DLHA 4P4RB 3RBSA 3SGEI 3MBXL 1N2RB 4U1GB 5DDHA 3IXTA 5GS1B 2IFFL 3CFCL 1SJEB 2OL3B 3TN0B 3JV6A 3MRNB 3GSXB 1EDQA 5D6CB 3WUWB 2AJXL 3PGDA 1QOKA 4S1DC 4TNVF 3WFZA 5J0BA 4B41A 2H9GA 4FXGB 5C0AB 4ZOAA 2AEQH 3DVFA 4N8CH 3QXDB 4TVPD 3GMMA 5C0CB 3WKML 2OXHA 5HHOD 3MA7B 4MDIA 3TBVB 2P24A 3IAQA 1FLRH 3OXRB 1UKQA 5F7DA 3C8KB 5E8EB 4LRNL 4QRQA 1NAML 4UB0L 5E95B 5KOMC 3L9RA 5C9JB 5HGAB 2Y06L 2FATL 3HG1B 4F8QA 3T0AA 1QLEL 3UROR 3UJTH 2WIMA 4Z78A 3B5GA 4I18A 1ZHBA 4UV7H 4GKSA 4H0IA 5HGGS 2BFVH 1KPRA 4R6UA 4LLWB 2AK4D 2OI9B 1NSNH 3JXAA 4F7MB 4MVBD 3SKMA 4XBEH 5KSVA 1DQMH 4K7PL 1WZ1L 4JHAL 4M6AA 4LLAA 1CGYA 5TH2A 4NRYB 1NCAH 4F2MA 2J7LA 3QXWA 4XT1C 4R97C 4Y4HB 5DJXB 4MXWL 3KYOA 1NGXA 4MLSA 3MYZA 1ETZA 4U7KA 4HX1A 1WBZB 3NTCH 5EUOA 3V52H 1FVDA 1LEKA 4DVRL 1R24B 4G9DB 4NKIH 1I3RA 1I7TA 3ELAT 1PVHA 1CVSC 4NBZB 2DAVA 3WSQL 2R56H 2P8LB 2HKHH 1HI6A 3LS4H 4FQXB 5J3HD 4RBPH 1QTYT 1RSFA 4PJHA 2XYCA 2VUYA 1DANU 2WMPA 5TPWH 4KXZH 4L1HA 1CXFA 1PBYA 4JZJA 5DK2A 4HCRL 4WEBH 2RGSA 3WUZA 3MJ7B 2GJZB 2PXYC 2VQ1B 1A1MA 2VDLH 3O4LB 4P4KC 1VEMA 3GB7B 4LSSL 1D5XB 1T04A 2NNAA 1EBAA 4D0BA 1I4FB 3K4AA 1S5IH 1E27A 1EUTA 1U3HC 2JCCB 5E9DB 2GTWB 1RZKL 3FKUS 1KN4H 2PW2A 4DQOL 4F7TB 3BX7C 3TFKD 1HSAB 2UZIL 1A6ZB 4G6ML 1X5FA 4OZIA 2XN9A 4Z7WE 5FYKU 1WFUA 4S1SH 5D7IF 3GNMH 5GS1C 3MCLH 3MR9B 1AY1H 5CUSL 1FNGB 1AR1C 1AGFB 1I1AA 3OG4B 5GJTL 1YNLH 4GAJH 3C9NB 1PKQA 4P46D 4DW2H 3VW3L 1QSFE 1Z3GL 5FKPB 3GMNB 5I8EA 2JF1A 3MNVB 1UADC 2O5ZH 3DX6B 5T3XH 3IJSB 5A2LH 1UZ6F 2BNUB 1UXWB 5J11B 3BEVA 3O4OC 4P2QB 1KN4L 4QTHB 3GBLA 2BC4B 2ATKB 5TPWL 4LHUA 4FFZH 3MNZB 3HMXA 3DIFB 4MJIB 1BZ7A 5IMLA 5EULV 3FQNB 4N0YL 1RIUL 2IGFL 2R4SL 5C0AD 3TVMA 2AGJL 4OZFB 1XF2B 2ZZUT 5HGDB 3VFWA 4HCRH 4GKZA 4WEBL 3TZVB 4KK9D 5C07D 2ARWA 2ARJA 5DURD 5LCVL 2AV7B 1I75A 43C9A 5IQ7L 3GSNA 2HKHL 3SCMC 3QQ3A 1ZKAA 2NX5D 1M4KA 5CJXA 4TSAH 1DQQA 1NCAL 5EO1B 1EAPB 5ESQB 3MRJB 5EU5B 4NKIL 4PJEE 4X5XA 4OCMC 2PYFA 5B22A 4MJ4A 4XBEL 3C6SB 4BJLA 4PRHA 1XGTA 1QR1B 3H9SB 4EVNA 1I8IB 2AKRB 5F7NC 3QJFB 3TT3H 2E6PA 4M4RA 4D9RE 4YXHH 3DYOA 4TVPH 1MWAL 5HDBE 1R5VA 5F3BA 1OHQA 3CFKB 1KLGA 5D9SB 1I1RA 4TUKL 3WIIH 2FZ3A 3UTTA 1S7SB 1J86A 3GJFK 1FGNH 1R3JA 3IDXH 1J5OH 5L2KB 3MA9L 4PGEB 3I3DA 1U8KB 3QO0B 3EOYG 1FNEA 2YC1A 3MMEA 5FYKL 2DLHA 5DD0H 5EIQA 2P44B 4XMKH 2C1OA 4AJ0A 3KYKH 2ZKHH 1XR9A 3SDDD 4LRNH 4LLQA 5FDWA 3DYMA 2KL6A 2X1PA 2FSEB 2FATH 1EGJA 1YDPA 4Y2DA 2GFBB 3DHJA 2VLJA 3PWPE 2VE6A 3TH4T 5BV7H 3VG0L 3K2MC 4NM4L 2UVEA 5HDQL 3K4ZA 4XMLH 1EHXA 1QRND 3T4YA 4YE4H 3MRKA 1FLRL 5KSBB 2CKBB 3EDJA 4C83B 1G0XA 3AROA 5JORB 4N5EC 1S7WB 2AJVH 4K3EL 5B38B 2YK1L 2KDGA 3F7QA 1ZHNB 1KOAA 5ETUA 3BSZL 1X6LA 5CEXB 2YMXH 4M62H 4P5TC 3QDGE 5ERWA 4HEPG 3X11A 2DOCA 2APFA 3WKNA 4D0BB 1N5AB 1MAML 2MCPH 2AJ3A 4X7FC 1KG0A 2Q8AH 5DEGB 5F8RC 5C08B 3O9WD 5GS1A 3DSFL 4UZGA 4CBPA 2NMSA 3GDBA 1IEBB 2OK0L 1AGFA 5BO1H 2ZG3A 5GS0L 3OJDB 3CVHB 4QRUA 2V2TB 3VI4F 4JCLA 4Z6AT 2ZPKH 1NGWB 3HNSH 2DLFL 1WZMA 4MJIE 1BQLH 4NO2A 1OQXA 3QXDA 2QLVB 2HT3D 3RNKA 5L7XL 5DJ0A 5C0ND 3HAEA 3J8F7 1FAIH 1X5IA 5E2WL 1NFIA 4EXPX 5TQ2L 4UIKL 2DWDB 4M6OL 3NA9L 4LQFL 2P49B 3BN9D 1KJVB 3VFVA 1INEL 4J4PD 5EBWA 5E5UB 3MRIB 3NZHH 5E08L 4KTEL 2ARJB 4OFYA 2V2WB 5F7KC 2AV7A 4MMZC 4ORZC 4YPGB 1KELL 1KB5L 3VXQA 5GS2H 5IB5A 4MXVF 2QQKL 1EBPA 2R9HD 2VIRA 4GKSB 1YNKL 3L3HB 3MXWL 4HXBL 3CZFB 4JPKL 3GO1L 5EU7E 3T77A 3PL6D 5TH2B 1BREA 1KEMH 1P4LA 3DO3A 5GS0C 4ZDHB 1I9RL 4KUCD 4UINH 1R5VB 2YXFA 4ZSOE 2APTA 3CH8A 4G9DA 1RFDL 4O2FB 2Q86A 3QIUB 2H26B 4OZHF 2DWEA 2YRLA 4UV4L 3FO2B 1GGCH 1VFMA 3S4SB 5F9WC 3OKLA 3WS3B 2FHFA 4PLJC 2IC2A 3OTTA 2Y36H 3ZYOA 3W0WD 3P9MB 5T1MA 3FO9B 4XZUB 3U6RA 4PP1D 1J10A 3MRMB 5EU6B 3BW9A 3I2CL 3MRHA 2XG4A 1AGBB 1LO4L 4CJ1A 3WE6A 2P42B 4NZUH 5GGTA 3TA3B 1JRHL 5KSBE 4CNIB 1A5FL 2Z93B 1UEYA 1P7KB 5IUSA 3GMPB 4GSDH 3G6JB 4QYOB 2VE6B 5CEZH 3BEWB 3BDYH 1CLOL 3OMZA 4P4KD 5EFIB 1IRAY 2CDFA 4LBEB 3T4YB 2Y5TA 3THMH 2DLEA 5I71C 1AO7E 1MFEH 4W81A 3AUVA 3MR9A 1JGVL 3Q0HA 3W2DL 1KENL 3C5SB 1CK0L 5JTWA 2VQUA 2A9NL 3IRZA 5C2BH 5FXCH 2FCBA 5TFSH 3GSNH 4GRLB 2B1AL 1KJ3H 3W9DB 3MNVA 2VDKL 3NFSL 3X12A 2J3SA 4G8GD 5HYSA 1KCUH 4DKFL 1PKQB 1ACYL 3U9PH 2E8ZA 1QSED 3SDXA 3PL6B 3IJHA 3UYRH 2J5LC 1WCBA 3TJEL 2IH1B 3LHPH 4XX1G 1NFDE 3RL1B 3T0XA 3UXFA 2NY5H 3MGOA 4K3DL 4X6DB 2PTVA 1EXUB 4X6DF 3MXVH 3IFPA 3Q5TA 4NFDA 4FG6D 1B0GA 4Z7VE 4ZTOL 3CFBA 4OF5A 1DQDH 1RIVL 3CPLB 1BIIB 3KVQA 4BFIB 2YD3A 3RX5A 1J1OH 4ELME 3DETD 3RU8H 3GSNB 4DOHE 3ALXA 2DM7A 4AH2B 1CLZH 1OGAD 1RULH 5DI8A 2Y25A 5EU5A 1EO8L 4H1LA 3SDYL 5J13B 3V4UH 4IRJB 1KYOK 3D39E 5C0CD 4DZ8A 1V7NH 4EIZC 3AFLA 2EYTB 5CGTA 4JQVA 1W72B 1MJ8H 3DECA 5IW6B 5LGJA 3MRJA 3D9AL 5CP7B 5IVXA 4DCQA 3U2SA 3JTTA 4PJ5A 4RGND 4P23B 1IAIM 2A6DA 5CIPB 2VITB 1ZT7A 5ICXB 2FZ3B 2F54D 4GKNB 1UM6L 4EN3A 4MLIA 2VSCA 2DQCH 5D2NA 5IVZA 4Y4HA 5DJXA 5J89A 4QTIL 2AI0L 2WINB 1CT8B 1Q9LA 1WBXA 2XV6B 4UIMB 2ZCKH 3LSOA 2V7HA 4NNPH 3LPGA 4RGMC 2Y6SD 1IAII 5BQ7B 1B6DA 2BP3A 3LMJH 2X6MA 5MENA 1Z9OA 2CXGA 4NN5C 3SBWA 5DQ9B 5L2KA 5C0RL 1JRHI 1SYVB 4Y4KD 3S97C 3UPCA 1MCDA 1NEZB 3DGGA 2NY3D 1Q9WA 4YXKH 4XPHL 4Y1AA 3T77B 4QRRA 4ZS6D 4RZCA 3N0PB 4Y2DB 5LGHL 3MV11 1NMAH 5DRZB 1TVDA 2DBLL 2VQ1A 1BOGB 2D7OA 5EBLA 5DHYB 4B53A 3B9KD 3MJGX 1T80A 1IQDA 5DMJB 1RV6X 3EKCA 2W0PA 1CL7H 3EOAA 2P45B 4XCYB 4YDLB 2BXZA 1ZV5A 3WFDH 3HCVA 4F7TA 4OUOA 1DBMH 4F15B 3W0WB 1PLGL 3O4LE 3UDWC 1S9KC 1WVZA 1IGFL 1S7QA 1NFKA 5E00A 4Q6IC 5I1HL 2DD8H 5ETUB 4CVXB 4K8RD 5EOTB 2P5EE 1FH5L 3VFSB 2E27H 4PUBL 1F8TH 5EO0A 3VD9A 2GT9A 3EGSA 1ZLVH 5BXFB 3SDDC 4N9GA 3GMNA 4XNXH 4A2LA 2I60H 2VWEE 5ID1B 4HFWB 1AXIB 3OR7B 2R9HC 3G6JA 4PJ9D 4QYOA 1MELA 4LLDB 4QWWD 3PDDA 4M93B 4Z7NF 4KRNA 4PRDB 2W9EL 5C0IB 3BPCB 1A3RL 2X2YA 4K9EH 5C0EB 5DSCB 4WEUD 2R2CA 1TQCB 4LSUH 1FIGH 4C55A 2AK1H 4R26H 1JWSB 3AM8A 5DR5L 4NNXA 4XNZC 2OR8A 4P2OB 2FYYB 3BUYB 4U33A 1R3KB 1KV3A 4PS4L 3TCLB 1BX2A 1G7IB 1AJ7L 1CZ8L 2J8UB 2VNCA 4KU1A 3PF2A 3MLPA 3MUGA 3SJVA 3M1BB 3VXUB 1IEAB 2HLAB 2HT3C 3CFIC 4MZ3A 4Q7DA 4TULL 2QKIB 3LEXB 3FCTA 1EAPA 3PWNB 3LB6D 2IJ0C 1C5DB 1MCPH 5E0QA 4PLJD 4PRIE 3LV3B 4HUNB 4IHOA 3W2DH 5A2FA 4L4VD 2EDYA 3WMSA 5D7SL 3HE7D 3PWUA 4MAYA 4F33B 4AEIH 4X6FA 2H2PC 1Z2KA 1CLOH 3IVKA 4L8SC 3ZKNC 5CEZL 5D1ZA 2YSSB 4DTGL 4XXCC 4FXKB 2KQMA 4H8WC 3S88L 3F7YB 3S98A 5SWSB 1QG3A 1IM9B 1JV5B 4M9OA 5B8CB 4PJ8C 3W11D 3PL6C 2P7TA 1INQB 3QO0A 2LQRA 4QXUH 5DZNA 4DZ8B 1LO5A 1DBJH 4KRLB 4G9FB 1CFNB 5TE6H 3MLTA 4KAQL 4IJ3C 1E6JL 1S9WB 4MWFB 4NZRH 2ICWA 3OHXB 1R3LB 5BZDA 1Q94B 4ZYKB 4DUWA 4DVBB 3QCTH 2NYYD 3WHE1 3NIDF 3SGKA 3QUZC 4JG0H 5HHME 4QO1A 4YLQT 6CGTA 3QIUA 2Q86B 1J18A 3T0ED 4N8PA 3QEQE 1IAKB 3T0EA 1S7UA 4NCC2 3I6LE 1OAZL 4ODWB 4Y89A 2V7NB 5CJOH 1KEML 5E6ID 5HYQA 2R0WL 1KC5H 4MCYB 4ZNCD 4Z8FH 2YUZA 3BH9A 3EO1A 1OSPH 4IDJH 4NN7C 5B3JE 5DR5H 3UMTA 4KJPC 1RJZB 1HQ4B 2AK1L 2IAND 2XKSA 4YHIA 1S9XA 3LQAL 5GSVA 4XAWH 3QHTC 1FG2A 4IS6B 3S8WA 4U1HB 4HIEA 2JJVA 4KJQD 1FZJB 1AGBA 3ALWA 1HXMB 1QFWL 2XWBB 3PV6A 3WJJC 5I75B 2XY2A 3A6BH 2AQ3A 2UWEE 2E7HA 4NZDA 4MJ2A 1ZA3B 3PP4L 5B38G 1F8TL 3B6SB 4LQFH 5IG7B 4P2QD 5IEKA 1KG0B 1I9JL 3H7LA 4WY7H 3VGHA 3P73A 2ZSWA 1KSRA 5EFIA 1T0MB 3AB0B 3F7PC 4X6EA 1GGUA 2ADGA 2Q7YA 4L4VB 5L7XH 5JMRA 1IM3A 4J12A 5I1JL 4YHZL 4LVHB 3TBYA 3JBG7 3ULSA 2V2TA 5FGBA 4KK5C 2HVJB 3SDXB 3TWCH 1I9EA 1U8PB 2OSLB 3O2WL 3O3AB 3W39B 4M6ML 4DAGH 1QBML 3IGAA 4QWWC 3T0WA 4RA0C 3JWDH 4H8WH 4POYA 4L9LB 5F89B 1ND0A 5AUMB 1N6VA 2QBWA 5J6HB 4JFHD 3SKOB 4PJBA 2C3XA 4NNXB 4PGBA 4POUB 4HKXA 4JZNA 4E41D 1L7IH 2MCPL 3ZE2E 1C08B 3M45A 2VDNL 1DN0B 4FTVA 4EI6A 3CMOH 3EYUL 5EIVA 3RI5F 5EBWB 5IHUL 3U4EA 3TM6A 3WFEL 4RIRB 2WBJC 1DVFA 1JUFA 1Q72H 3H9ZA 3MJ9L 4IJ3B 1C7SA 2WW8A 2EXYD 2DTML 2I9LA 4HZLA 1E4XH 1ITBB 3ZKND 4K3EH 5T5NG 1FNAA 5ILTH 4W4OC 1H15B 1BFOB 3F58H 5DJCA 1QBLL 3GSUA 4YBLB 4ERSL 3KXFE 3O45A 2MNUA 5FV1L 4M5ZL 4YE4L 1C8PA 4I0PA 1ZE3C 1UQSA 3NVQA 4DCQB 1WBYA 3TPUA 3SDCA 1YQVH 3GRWH 4YPJA 3VI3E 4X9HA 2YSSA 2D0GA 4UT7H 2Y72A 1X5JA 3FO2A 4BQ8A 1B4RA 2Y4SA 1YEHL 5I8KL 2ZUYA 3RWGA 2BVOB 4NDMA 4YR6B 5D4QA 3DUHA 35C8L 5DVOA 3X3FH 2HMIC 1BHGA 3V0AC 3MRHB 1U92A 3UTOA 3ZT6A 4P5TD 4BZ1H 3RTQB 4WUUE 1LEIA 4WTWA 1NEZA 5DWUL 4WUKL 4RSVA 1HH9A 4UT6L 1QSEE 3SDDA 1FGNL 1BPVA 5EUKA 4G80A 2MKWA 4LSRH 4DK6A 3EOAB 3LD8B 1VCAA 4MJ6B 1KCUL 2CK0H 7FABL 4JGJA 3DV4A 2X4TB 3IXAB 4JO4H 3I9GH 4X9BA 4JKPL 4PJHE 4E42A 2VZOA 3MOAH 5K9QG 3U9UB 1UWXH 1OCWL 2APVA 2HT2C 4LLUB 3THML 2OJEA 2R2EB 5D7KE 3TBWA 4M5YH 4OGYL 3BDYL 3NIDE 1IC7L 3UTSE 4PS4H 4R9HA 1AXSB 3GB7A 1PG7W 3BGFB 5A40E 1OY3B 3G6AA 4Z7WB 3QRGH 3RGHA 1T04B 2NNAB 1VFOA 1J8HD 2P5WD 2R4SH 2EEBA 4OZHE 4U6HA 4OZIE 1LO4H 3UPRB 4NCC1 2OP4H 2CRYA 3GJEA 2GIYA 4J1UA 4Z95L 3SBWC 5I1DA 4WGVB 1LP9B 1PX3A 2OQJA 4TUOB 4LCCB 4YHMH 4X9IA 4L1DA 1EXUA 1OAKL 3FT4A 4J4PC 1U3HD 4HKZA 3KPLB 3WLWD 3T1FB 2J8UA 4NKDA 1U2HA 3WUWG 4U1IA 4XNXL 3JWNC 4KQ3H 4QRPB 4YX2H 4PJ7F 5GRYA 1BVLA 3WNKA 4XNYL 4HPOH 3QDAA 4GFTB 5I8EB 3BRFA 2P24B 4DFHA 1KT2A 4LP5A 2VXUH 3AGVA 1N8ZA 5IWLC 1H0DB 1YNLL 5HHOB 4OKVB 3OKNA 3EUUA 5D71L 1X7QA 3SCMB 5K9KB 3ULUL 4ODVH 5F70A 1VESA 3QYCA 4X98B 4FS0A 1CDIA 1CXLA 4QTHA 4WFGD 3QXAB 4MA8H 3NBNA 1LK2B 4KK9C 5C9JA 1VADB 1PQZA 3BP5B 1VKXB 4PGBB 3L5HA 3REWA 3HB3D 2I9TA 1CICC 5GGTH 3PQYB 4HZAA 2Z9TA 4Z78B 3TVMB 4RWYL 1XGQA 1JMXA 3VDCA 4X7EC 4K55A 4EQ2A 4LSSH 7CGTA 5EWIH 3R8QA 4KI5E 2ICEA 2HH0H 4ZO6A 5I8OL 3EYFA 4XC1H 4FQLH 3STBA 1DQQB 5EO1A 5ESQA 4U6XB 1IAMA 4A2MA 4GAYA 5F1OB 1NMBH 1INQA 1GC1H 1D6VL 4ENED 3F6IA 1B88A 2D03L 2VL4A 4NKMA 2MQ3A 4UNVA 4XP9H 4XXDA 2QSCL 3KDMB 1BQLL 2WUBL 3KYOB 1WGOA 1DVFD 2PCPB 2LTQC 1ZHKA 2NZIA 3N1MC 4U3CA 2IQ9L 2V5YA 5F3BB 2VMFA 5HYQB 3P11H 2BZDA 4XPAL 4GRWE 1JF1B 4JJ5A 1EEZB 3V5DB 2OK0H 1TLKA 1BD2D 1QSFD 1S7UB 4FQXA 4QHLA 2FH6A 2J5LB 3MBEA 5DJYA 4GRWF 5D6DA 5DD5H 3RAJL 2C4FT 4GAGL 2QSVA 1R0AL 4ISVA 3BN9C 2BFVL 3Q6FB 4QT5B 4HS6B 1CR9H 4U6VL 4OGXL 1HQ4A 4MHHI 3ZHKA 5JW5B 1CFVL 5E94A 3RY6C 1D5MA 4MHHG 1OWRM 1U36A 4G6KL 3VFGL 1HXYB 4FMFA 4O4YL 5HHXH 1J12A 1A2YB 4LCCC 1YN6A 5E8PB 2V2XB 1MAKA 2KQNA 3TESA 1FZJA 5FFLA 3OR6A 3PV6B 4NC1E 4GBXA 1BIHA 1M7DA 2RIKA 4IOFC 5F93C 3IXTB 3TJEH 4NQDE 3IDYB 1L4IA 2D3VA 1BQUA 3G6DL 3VGEA 1KTDA 1ONQA 3GBMH 5SX5H 4XBPB 4PP1C 3P40A 1IQWL 2FEDC 3VXMA 1XGUA 1NC4B 3DARA 5EZLA 3ZYJA 1KBGH 1VDGA 4NUGH 2NY2D 4ELKA 3C08H 5JUEL 3IGAB 1RZKC 1HEZA 3MTRA 5C08E 1FNSL 3LEXA 5LQBL 2FEEL 1GGIL 1LP9F 4JFQA 1I8LA 1T20B 3TC9A 4OLWH 1QEWB 4JRXD 1JF5A 2BSTB 3H9HA 2E7LC 2OTUB 3MO1A 3QAZC 5F7DB 5E6ZA 3TJHC 4HQQL 2X1WL 2GK0B 1TETH 2HLFD 4P2YA 1SMOA 3S37X 4LVOB 3EIFA 4F33A 3R0MA 1T21A 2PO6A 3VFWB 1A9BA 1EEUA 1GZQA 3N1FC 2C1PB 2G75A 2ZUVA 1HIML 3M8OL 4ZO8A 2ESVE 1XAUA 4YO0A 2GAZB 4FTVB 3QQ3B 2B4CL 4HZLB 2NY1B 4FQCL 2W0FB 1WIUA 5HHQA 3I2CH 4U1NA 3C60D 3EO0B 1CGVA 1CDCA 4N1CA 4HV8B 2IAMB 3GBNH 2ZG2A 1UZ8A 3VWKC 4PR5A 5CJ5A 4YWGH 1LHZA 2IANB 4F9LC 1AQDB 5HI3D 3TBTA 2WZPD 3MOBH 1S78C 4YXLH 3BIKB 5FECA 4XI5D 4XGZB 1EZVY 1WWCA 4OV6F 3UBXI 4G9FE 1OWWA 3O6FD 3QULA 1G6RH 4LCWA 3O2VH 1WBYB 3TYFA 4PJIB 4RAUA 4HX1B 2AGJH 1FVDB 4OM1L 1ZTXL 4P57A 1RIUH 4WI5A 1SYSB 2MTPA 1EFXD 4P9MH 2W65B 5F9OL 4WW2A 5CBEA 5I30L 3MUZ1 3KPSA 1MFAL 1Y0LA 2NY2B 3L5IA 1MNUH 3CDFA 3QB7C 4JM2B 4OLYH 1NJ9B 4U4BA 3UC0L 2AJYL 4JG1H 2VB5A 1JNNH 1MJ7L 2FD6L 3RZCA 3SHSA 3CUPB 4U2YA 5IJKC 3QG6B 4G42A 1JPFB 4HJJH 2O61A 4WHTB 3LKNA 4WWKC 1T66C 2GJ6A 3V5DA 4Q2ZB 1S5HA 4OBSA 5EOCL 4S1SL 3DROB 5FHBL 1CXHA 3EYSL 4RMQA 5BRZE 2FJFA 2IPKB 1KTKE 5IF0A 4XCNB 5JIIA 4YK4C 3VXSA 1AE6H 4XPFH 4HCRA 1F4WL 3RPIB 3MRLA 5IOPA 5I9QB 4KK5D 4OD3L 3TA3A 3OZ9H 2BCKA 2VXTH 5ITFA 1P7HL 4NRZA 4Z7UB 5C0BB 4NOBA 5DA4A 4N0UB 3GJEB 3STZA 1WIOA 2R39A 3DX6A 1MI5A 1MFNA 3B3IA 3P3YA 1JYXA 5JIHA 2Z31A 3BAEH 3QIWA 2VUOA 1ND0B 1ZS8A 1FO0A 4JR9L 5E6IA 3T1FA 4LP4A 1IC5L 4D94A 3DIFA 2A74B 1B4JL 5DO2C 1HDMA 3HAEH 4MA1C 2VN4A 4QRPA 3FQUB 3MLRH 4WI4A 4Z18A 4QRPD 2OXGA 4TPRL 1O0VA 4IOSD 1A6VL 3ULVF 1T7YA 3X3GL 1KN2H 1N8ZB 3G5XA 3U1SH 2VLKA 1OP5K 4PJGE 2IBBA 4P9HC 5IHBA 5K9KA 3RNKB 3PABB 3KPOB 3BKML 2F8VA 5IFAL 4MB5A 5LWYL 4D9QE 5MI0C 4YIQB 4GG6F 5CHNA 5DQJB 2HG5A 4LAQL 1AKJD 4G5ZH 1R5IB 1T2QH 4FNLL 1YECL 1AGEB 3TLRA 3RPKA 1JGUL 4PB0H 1UQSB 4HGWB 4MAUH 3NFNA 1Z0MA 4KTYA 2LU7A 12E8H 4LMQI 4Q58C 2R69L 5ISZD 1GAFH 1MREH 3EOTL 1P2CB 1A6AA 4JY6B 3DETC 5FYKH 1K2DB 3H3KA 4X4YB 4WNQB 1S9VB 1X5GA 1YN7B 1U8QA 1CFBA 2BVPA 4JPVH 1IZJA 2BHYA 1MCWW 2Q8BL 1GGTA 4XNMB 3QDMA 3HI6H 3TGXA 4AIOA 2JLLA 1CD9B 1CGSH 2YD5A 2O5XL 3C5JA 2F9BT 2J8HA 4PJAA 5EORH 3TPKA 5DMGC 5L8KB 4HPYH 3ZE2F 4LLYA 4JHBA 4DJMA 2DQHH 1AGCA 4OD2B 4TVPE 1I1AC 4MD0A 3S4SA 2VYRE 1QUNA 1NGYB 3FO0L 1F4XL 4K94C 1HKLH 1A3QA 5J11C 2JB6B 5KVFH 1CD1A 4LK4A 2DQHL 4I4WA 3B4NA 1KCLA 4XAKE 1KTLB 1Q0YL 4NSKA 4I13B 4QHLB 4QOKA 5FO7B 4JVUA 4N8VG 2R0KL 1M1SA 1CGSL 3PGFL 5LCVH 3MOQA 5CEZD 2B1HL 1TXKA 1DUZA 4M43H 1SJXA 4HBQA 1D5IH 5DHYA 3O8XA 3QI9D 3RKDC 4ODTH 3HE6D 4WFGE 1RIHH 1RJYB 3QG7H 3B9DA 3Q48A 1QVOA 2E7MA 2EC9T 1TJGL 1FJ1B 3HCVB 4LLMA 4GBXB 4LU5L 3OKKA 1IL1A 1IT9H 4P48A 1JVKA 1DUYB 3CFEA 4PRPA 3FT4B 1S7QB 3ZYIA 3CCHA 3IFOA 4HUMB 5JA8B 2GEEA 4GJTB 4ZFZB 3E3QC 4HIXH 1SHMA 4Y2DD 1OTSC 1HZHL 5E8OB 1LP9E 2R29H 3RVVD 4DZBA 3UYPA 4ZUVB 2CKNA 1MHPH 3IJHB 5I66A 1INDH 4OQTL 3H9HB 4P3DB 1KPUB 3U1SL 3QPQC 3F6LA 5F71A 5TF0A 3B2UC 3QCUH 4JANB 4GLRI 2QEJA 5EU3A 2PO6B 3QUYB 3ARZA 5I15H 2A74A 5TDNA 3VRIA 4ODSL 3REWB 4XCEA 2JCCE 5E9DE 4LASH 1GC1C 1U3YA 1C12B 3ILPB 1OLLA 1MI5D 3EO0A 3GKWL 1RQ5A 4CADB 1MJJA 4G8IB 4CMHC 2XQBH 3TFKC 4WCYH 1AC0A 4PIRF 2K7PA 4XTRC 3PQYE 2A6JB 4HH9B 1KLFA 5I15L 3MLSH 1AQDA 2D4FA 4URTB 2CGRH 3JTTB 1IKNA 5TE4L 1F4WH 1YJDH 3NTCL 3DURA 2WBKA 3GMOA 2FHCA 5GZND 4JO2L 5DT1H 1QNZL 5FO9A 5FV2A 1F3DJ 4OIIH 3K3QA 3UZEA 5ALBL 1IBGH 3O11A 3BQUC 5CILH 1MQ8A 5FYJH 5E2TL 4NRXB 3VFRA 3WV0A 2XTJB 4MNGA 2J12B 3KYAA 4HJJL 4PRHE 2D9CA 2B5IC 5EB9A 1JV5A 5B8CA 5EZJA 4IRJC 4UQ2A 4NHCH 4LFHD 4RRPA 4QKXB 1JNNL 1MF2L 3EZ8A 3MBEB 3MUHL 4XPTH 5DJYB 3C6LA 2DKMA 4WO4C 5TQ0L 3INUL 1A0QH 1RK1B 1CFSA 5MEOB 3RWFB 2ICWB 4HIIA 4NJAL 4NT6B 4JFPB 3VXNA 3D39B 3P0VL 3VDAA 5E6IC 1RIHL 5EC2A 2IBZY 3QG6A 5LVEA 1MCHA 2YD7A 5CGYC 3REVA 4ZD3H 5E8PA 4YHPA 5D72H 1AP2B 3H9SE 5HHNA 1UEMA 1II4E 5GSRB 4PBXA 2Y5TB 4HFUH 5K9OA 3IS1X 4MX7A 3D25A 1ED3B 1G0YR 2EDKA 1CIUA 2ESVD 1BP3B 4XCCL 3HPJA 2XTLA 5JHDE 5KVFL 1EERB 3N85H 5L6YL 3P4MB 4PREA 2UWEA 2CK2A 1KIPB 4N0UA 3V4PH 2YKLL 3VGGA 1F3JB 3IU3A 2AJXH 3CC5B 1NCBH 4GXVL 3CMGA 4UAOC 1I1CA 1LDPL 5E99H 1JYVA 3BPCA 1YEDB 2BX5A 4NFBA 3L3DA 1U8NB 2B4CH 4LPUA 2ZOLA 3HZVB 5GRWA 1FLTX 4D2NA 1WLHA 1YEJH 1X5ZA 1SEBA 2EIEA 4TOYH 5ACZB 4HJ0D 3KPRB 2WLZA 2QHRH 5HSFA 2BSED 5TDPA 3VFTB 1NUDA 3AY4C 2LAAA 4G7VL 1K3ZA 4GMTL 1NGQL 2QKIA 3U7WL 2F53E 12E8L 3BDBA 1D5ZB 2HVJA 3IF1A 4POZC 5L2KD 3LKPB 1YECH 4XCCH 3KYMA 5F89A 4OM0H 5AUMA 2FX8H 4NQEA 3L9RB 3IVKB 2MWCA 5EN2A 1PKOA 1ZLSH 5LWYH 2A6DB 5CIPA 4YGVA 1ZT7B 3TN0D 4ZFGH 5MP6L 1WAAA 2X41A 3G6DH 4TNVK 1OTUD 2W59A 3VWJD 3QULB 4LCWB 4IRSA 2IANE 4WJ5A 4H5SA 1WBXB 4U1KB 4KGJA 4FQ1L 5F7YC 4RBPK 1D6EA 1NQBA 1P4IL 4NP4L 2VL5B 4G3YH 1A22B 1B4JH 2XZCH 4HT1H 4A6YH 3ET9F 2DQIH 1OAXH 3OAUL 1K2DA 4X7DC 3IDGB 4LPYA 4MSWA 1NDMB 1BECA 3HUJF 4Y5VA 3QISA 1AGCB 3L3IB 1JTPA 1YZZA 4LIQE 4OD2A 3VGAB 1JPSH 3QHFL 1F90L 3HFML 1IAKA 4RGOL 1MY7A 1T0NA 3K0WA 4AMKL 2A9ML 1V5JA 1IQDB 3RZCB 2VXTL 5IB4A 3RIAF 1V3LA 1EJOL 1N7ML 2OX5A 2DQJL 1I7TB 1CD1B 5E2TH 4PGCA 4WWID 3E6FA 3EFFB 3SDAA 3SE8H 1HSBB 2AJSL 4WFED 4YAQA 3JUYA 3TO4C 5FA3A 1Z5LB 1IGML 3H8NA 4LARH 5SWZE 5TE4H 1LK3H 1P4BL 3QHZL 4ZNEA 1RZ7L 4Y4KC 5ALCH 5GGSB 4NSKB 5T5NF 2EDHA 1SY6H 4QOKB 1IGJB 2DBJA 1NCNA 1WF5A 3WS6C 2DKSA 3FFDB 2VQTA 2O5YL 4JFFE 4B0MM 2A0LD 5F7UA 4P23D 3GHEH 4PRID 5D5MF 5ANMB 1CDUA 5GPRA 3FB6A 5EWIL 4HW6A 2AJYH 3ZZ1A 3QA3B 5DRXA 4NO0B 2H6PB 5TDOA 4RWYH 3NAAH 5HHMB 5IW3A 5DYOA 4I0KA 4XC3H 1HHHB 3BRDA 1MPAH 3CK0L 2VR5A 5TGBB 5F9OH 5JPMB 2ZSVB 4YDKH 1YPZE 4LLMB 5KS9A 3L3GB 4OB5H 3ZKQD 1QACA 2PW1A 1BX2B 3U0WL 2H8PB 1INDL 4OQTH 3O2VL 3GSWA 3RL2A 4FFWD 5L2JA 2HLFC 2VDPH 1OARH 2R23B 2VJXA 4CMMA 4ZUVA 4Q97A 4NC1C 5GIRA 5CEYA 1JIBA 2XA8H 1MRCH 1DSFH 1QSVA 1QZ1A 2QL1A 4U1LA 3ARPA 2NY3B 1EVTC 2VN7A 2R2BA 1C08A 4XCEB 3RWEB 1DN0A 2X42A 2WWMD 5CSZB 3VXOB 1BQSA 2X5PA 1RZJL 4HGWA 3ILPA 4OJFH 4YBHA 3S7GA 5FF6B 4RGNB 1FPTL 3RP1A 5I1GL 1MJJB 2D7PA 2I9LB 1TPXC 1LO3L 1OM3L 1CU4L 2ERJB 4JM4H 5LXGH 4PJ5E 1D5IL 5E1AA 2ORBH 2RQ8A 1J8HB 4O02L 1HKFA 4L3EB 5I9QC 2APWA 5KVGH 4P3CL 1I7ZA 4BH7B 5EZIH 4LHQB 5K59F 5I1LA 1RK0A 2YWYA 1NCDL 1S8DA 3MRFB 4NQVB 1F4XH 4JY5L 5H94B 1OCWH 3QDHA 2R0ZL 2GY5A 3QO1A 3NACL 1K6QH 3DRTB 4OI7A 4OCWL 3EO9L 4TTDD 1UT9A 1JL8A 4X6DE 3R06B 1WWAX 2V7NA 2HAZA 3H3PH 1JF6A 1E6OL 3GBML 4NQSB 1G7HA 1LEIB 3RKPA 3RX7A 1WV7T 3H42H 4BZ1L 1KEGH 3C8KA 1PZ5B 2NY6D 1T1WB 1JP5A 2GFBA 5FYLL 3HMXH 3N1QC 2YA1A 4OLVH 3KDMA 1I3VA 2UVFA 1GAFL 4CDGC 5JW4M 5I76B 1RUAH 2X4TA 3IXAA 4HHAB 3D39A 5JXEA 2B0SL 1FL3B 3BKJH 3HN3A 2X7LA 2KBGA 2V5MA 5C0DA 4NJ9L 2FB4H 3B5HA 4TNWF 4M48H 4M8QA 4ZO7A 4MJ5A 4EUPA 4OGXH 4Y7MA 2X89D 4XPGH 1CGWA 4LDEB 3LD8C 5JDJA 4RA3A 1CBVL 2DL9A 5FA3B 4MD4A 5DVKA 5DLML 3PGCB 1MFCH 3QQ4B 4MJID 5ANME 2IPTL 5D2NE 3PUCA 1EAJA 1ZLVK 3TBYB 5J7CC 1FE8H 4FZ8L 4ERSH 3HPJB 3G9AB 1DEDA 3VI4E 4ESKA 2IAMC 4Z7WA 5C1MB 1G9NL 3JSSA 2AV1A 5KAQF 5CINH 3LAFA 2BJMH 4XBGB 2V2XA 1J1PL 4WWKD 5DJ6A 2EIBA 4HKJA 1WT5A 4WRLA 1T83C 1QSFB 4X5LA 2VZVA 4JZOA 4N5UA 3FQRA 2IH3A 3RRQA 1UCTA 2PN5A 3WDHA 5FUZL 4UU9A 1NC4A 5I8OH 1CLYL 1MCJA 1QFPA 5T1DL 3C6LC 2BHUA 2YBRA 4WO4A 3Q5OA 1GIGL 4HIJB 1NGWA 1A6WH 1EIBA 3BP6B 1XF3B 3FB7A 3JWDL 5GGRA 5HHVL 4NO2B 4PJAF 4X7SH 4Y5XA 3WN5B 2X70A 2GJZA 4ELKB 3K8KA 3QFJB 2P46B 1UXSA 3O4LA 4R90L 5D7IA 3CX2A 1MAJA 4JFQB 5JQHC 1BJ1J 1T20A 1C1EH 2JJUA 2VZUA 3T04D 5TF1H 4MA7L 4EQ3A 1TVBA 1AE6L 4YHOH 3SO3C 4HK3J 4HUUA 4K8RL 3UBXG 5I0ZA 3K8LA 3GMOB 5FHBH 3O6ML 3LKPA 4NPYA 1FAKT 1C5CL 3RY4A 3BQUD 2F58H 3ULUH 5JOEA 1S3KH 2Y07L 3MRIA 4KTDH 3L5XH 3UYOD 4R4ND 5E7FA 4KJPD 3O6KL 1BJMA 5HDLA 1I7RA 3MNWB 4G8GA 5E4EC 1L6ZA 4GW1A 1X3DA 2C7UA 1UCBL 4RISH 3PXJA 3HUJE 1Y6MR 4NDMB 1UYWH 3IJSA 4QCIA 2R8SL 1T6WA 4KJYB 4NOFA 1MFAH 3L3IA 5SWSD 1J1XH 1NL0H 2BVYA 1MCSA 1PYWA 2I26N 3E0GA 1ULVA 1YMMB 2NW2A 5JIPA 4NYLA 2P5WE 2CDEA 5H94A 1YUHB 1U93B 1BZ7B 3R8BB 4WI2A 1DFBH 4LHJB 2ITCB 2H26A 2N7AA 2G5BB 5J12B 3DVNA 3E2HB 4L8BB 4PJCB 3TH3T 5KSAC 4K07A 3ARGD 4JHWL 4OFPA 4C56D 1MVFA 5FGBC 2LTQB 2VZ3A 3Q6GH 4ZAKB 3U6RB 3HG1E 1F58H 4LGRB 2WIIB 2CIIB 4LLVB 1CQYA 4NGHL 1JK8B 5DHXB 3I9GL 2VC2H 3DHMA 4KAQH 3MGTA 4BELD 2WQ8A 1DFBL 1HHIB 4ZUSB 4D0CB 3E6HA 4XMPH 1E28B 2F5BL 5C6TH 5BRZB 1ZSDB 1W8OA 1QKZH 4PV9B 1A7NL 4S2SA 5IBTH 4U1GC 4JFEE 1KLGB 5D9SA 1YEGL 4WI3A 3CDCA 1I7UA 3UEZA 1A1NA 3BQUB 3QWOA 5FGRA 4HAGA 3CFJA 3RDTB 3RGVA 5C7XL 4I77H 3L5XL 1U91B 2X1QA 1F2XK 3MRRA 3DUSB 3G04A 5GQBA 3QQ4A 2QQNH 3UZVB 5D7JB 3ARRA 4AEEA 2JK5B 4KKBD 3GHBH 1YC7A 3ZMRA 1GGIH 2WK2A 5A1AA 1FC1A 3BJ91 4MA7H 3MUJA 4OFYD 4JFZL 4LLQB 5FDWB 3PG2A 3QDJA 2CQVA 1HQRB 3U82B 2H8PA 5F1NA 5KSAA 3WIFA 4U1LB 3QEUA 5IBLC 4LIQL 2VLJB 4F37K 3OKNB 3QPXH 4PJEF 5INDA 3DMMD 4QXGL 2B20A 5MEPB 4CMMB 1MRDL 3ZTNL 1A6WL 3EYQC 1A7OL 3WXVL 2CJUL 4QRPE 3QUZA 3JTSA 4XVUD 3F5WB 4HDIA 1A9BB 1AD9B 2FO4A 5BS0E 4YDVB 1I85C 1T7WA 3JWOC 5DJAB 5DMGD 1HDMB 2C4FU 5HGBA 2GAZA 1FIGL 2V6HA 1KXQE 2XZQL 4N90D 5AZEH 4H1LB 1J8HA 3MRPB 4F8TA 5CEXA 4M9PA 3QFJA 4NZJA 5JW4N 2BJML 2JKXA 5IHUH 1A7PL 3SKNA 3OAYK 2VDNH 4IBLT 4PJ9A 3BPLC 3AU1A 3KNBA 1OAUL 3N1PC 3C8DA 1MLBB 3TO4B 1ZGLB 4GAGH 4L3AA 1JGEA 1XR8A 1FVCA 1G7QB 3BPNB 3T65B 3EYVB 2IMMA 3M17B 1HCVA 4FQQA 4P2OC 3X17A 4LVNB 2F54B 1IGCL 2VDQH 1KTRL 4XCFL 1IEBA 1N6UA 2A6IB 3WFDL 4JFZH 3KXFA 3BRGC 4J2XA 5CP3H 3IDUA 3EFFA 1I1FA 1CBVH 4P2RE 3R06A 1ACZA 1Q9OB 4CW1B 1PY4A 4XPGL 2D03H 4MA3A 4I5BA 3MJ9A 1T1WA 1FZKA 1AH1A 1BLNA 5FYLH 3RTQC 3V95A 1NMBL 1KEGL 4GRWB 5IFHH 4Z76A 3HC0B 3WLWC 1VB9A 3DYPA 4LNRB 4C56E 2DWDA 2IG2H 3ARVA 1E6OH 1YUHA 3OAZK 4M8QB 1WC7A 1GSMA 1UJTA 2FECI 3D2UD 3LQZA 3OBAA 4Y5VC 4F7EB 1FC2D 3H42L 4HHAA 1N0LA 4R3SB 4OI8A 3I6KB 4PJDB 3RNQA 1QSEA 3FRUB 5J4MA 5DHVB 4OZGB 5DUPL 4HH8A 3V7MA 3LKQB 3EDEA 4MA8L 3TYGL 3KYNA 2A6KA 4D0DB 3D0LA 1JK8A 4HBCL 2PW1B 4IRSC 1BFVL 1DL7H 5ID1A 1G84A 1DQJB 1H3TA 3JV4A 5ID0A 3T8XA 4ZUSA 3CXHJ 1F6AB 3IDMB 3MJ8A 1W0WB 1EO8H 1X44A 3S5LA 4HS8H 3NCBB 4KDWA 4J6RH 3T0VA 4WENB 1DP0A 1OTSD 4Q9RH 2XZAL 3QUML 3UBXA 4QOKD 1RJCA 3HC4L 2VDMH 1E6JH 5E03A 3DV6A 4BQ9A 3DUSA 3JV0A 3MREB 2YPKA 4QXUL 5IW1B 3PIQB 4BYHA 5E6YA 1UCBH 4S0TD 4J6RL 5AEAA 2HMID 4HS8L 3TH2T 3S88H 5I18H 2C3HA 4U0QB 2YHGA 4EN3D 4DTGH 1CFTA 2NXZD 5D1QD 2L4OA 4GW4A 5D1QA 1EUUA 2EYRB 3OB0K 3WDIA 5DJZB 3GMPA 1NLBL 4HV8A 4M5YL 3BEWA 4HBCH 2F58L 4M1GL 4I2XB 4ZUTB 2VDKH 4HWZA 3BYTA 3ILQC 4YDJB 1MCPL 5EU7C 5DHVH 1R3HB 1OD7A 1MPAL 2EE9A 5FYJE 2BDNH 4Q9QL 2ZP0T 3K1KC 3O3UN 3P0YL 3L95B 3ZDZF 1TZGL 5F8QC 4X6CA 2P7TB 1QRNA 4YDKL 4LSRL 5IFJB 3X12B 4X4ME 1BMGA 3S34L 5IT2L 5HYSB 2OL3L 5GGVL 4XRCA 2O5YH 1JRHH 5B4MC 5C0AE 3X3FL 2R4RL 1SY6L 2GCYA 2NW2B 3MLZL 2HT4D 3RWHB 1WCBB 4GW5B 1NAMA 4XP5H 1MUJA 1QFOA 5MENE 1YEHH 4J8RB 3P9LA 1PD6A 2NY5C 5D93C 4RMSA 1ZLUH 1P1ZB 4NO5B 3LQAC 3T0EB 1MFDH 2CXKA 3CDYA 5GRUH 4M3KB 1E4WL 3ZTJG 2ADJA 1RZ7H 5ALCL 5IVXF 1UWGH 2YUVA 1A9EA 4Z77B 5IVNA 2FRGP 4RRPG 4KH2A 2R2HA 3W11C 2EDJA 3HLAB 4NWTL 3MLWH 5JHLH 1VGEH 4X83A 3U4BL 3V6FA 2X4SA 3OX8B 4JM2C 1IGFH 4IRJA 3SGDH 4I5BB 2V5RA 3D85B 3V6OE 2I24N 5SWSE 5K59E 3VE0A 4X6BA 1N3NB 4K7FB 1CDJA