The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
145
|
structure length |
121
|
Chain Sequence |
KSYKTWDVPIAKINIFAVAEYTDTQKIKVTVKGKILEGNTLPKSMVQVYLLEDKNHVLRGAVNGIWGEEFVNLKDYLYTYAVEPLSGMSFVAENYSIVAFVYDVQTFEVYDVVHVKINPQS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Membrane protein
|
source organism |
Porphyromonas gingivalis
|
publication title |
The crystal structure of a domain of the outer membrane lipoprotein Omp28 from Porphyromonas gingivalis.
rcsb |
molecule keywords |
28 kDa outer membrane protein Omp28
|
total genus |
23
|
structure length |
121
|
sequence length |
145
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2007-08-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF11551 | Omp28 | Outer membrane protein Omp28 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |