2R2HA

Structure of s25-2 in complex with ko
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, antibody fragment (IgG1k), light chain
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2hA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2hA01
2VNCA 4XNUL 1WWWX 2Z31A 4XC1L 4P9MH 4NJ9L 2PO6B 1KXTB 5CP3H 4KXZH 4N0RA 1R5VA 1L7TL 3FTGB 4LGSB 5C07E 3OHXB 1GAFL 4Y2DC 2ENSA 4HH9B 4JFPA 1INEL 1KCKA 5SV3A 3V52H 1FIGH 5C2UB 3U9PL 4HUWA 2EE6A 35C8H 5I74C 1UADC 5ACZB 4M6ML 1OAXL 4GRWB 1S7WB 4GAJL 5H37G 4W4OC 1UXSA 2XWBA 3U36B 4D0DB 5HYJB 2Z35B 5T1DL 1MF2L 5JORB 1ZOXA 2RR3A 5SWZB 4PD4K 5DO2D 4HIHA 4LP5A 4X6BB 5E2JA 2CDFB 1FYTD 1P7QD 4K3HA 5EU5A 3GMMB 1FO0H 4F7MB 5GRXG 4LCYA 2CKBB 5C92A 4OF8A 1ZS8A 2BNRA 4KK5C 1PFCA 5IBLC 3HG1E 4K8RH 4QNPF 1DUYB 1UM4H 3EZJB 4IDLA 1U0QA 5EU6B 3LQZB 5J9PB 2J4WL 4M02A 5DLML 3V5DA 4JDZA 4MX7A 3CFCL 2DAVA 5I1CL 1JGUH 3QNZB 1I7UB 4WV1A 3T4AB 4K7PL 1TQCB 5SWSE 2PXYB 4MQTB 5D1XB 2PYEB 3D69A 2Y06L 4ZUTA 3TIDA 2P44B 4MSWA 1XGUA 5F21B 2GFBB 4OUOA 4WFGD 4HS3A 5IESH 3NFNB 5MEQB 5F1NB 1YEKL 1X4YA 3IGAA 1TQBC 2YEZB 4DN3L 3MRIB 3FRPA 4HKZA 4BFIB 2OQJB 4NFBA 3KPNA 3LQAH 2GSGA 2VAAA 4P57B 2NY0C 5KS9A 1SEBA 2KUTA 3OG4B 5K9KA 1DQQA 4U6XA 1MAMH 5DUPL 3D0VB 3VRLF 1FJ1B 3IDNA 5J13B 1BBDH 1M1SA 4MD5A 3K81A 3UO1L 1Q9KB 5DA4A 5GZOD 4PGZA 5DQDL 5HHPA 3DI2B 3REWA 4OFYA 1BQSA 1M7DB 4JRYB 1I9JL 3HS0A 4JRXD 2ADGA 4XNUH 3ZTNL 4ZD3H 3MGOA 3NCMA 1RUMH 1NCBL 2HKFH 3DGGB 4J4PA 4Z7WF 4NJ9H 3KS0J 4JVPA 3TF7C 5IBUG 5KZCB 5IIEB 4XNMB 3G5YA 1L7TH 2CUMA 5E2VL 1FO0B 1LDPL 1IC1A 2WAHA 4C4KT 2MQ0A 4ODHL 5CEXB 4LOUD 4GG8A 3KJ4B 5BVJB 4U1KB 3L1OH 3MRHA 1U8KA 3IXTA 4R4NC 4I8DA 5JW5B 2PKDA 5F7YC 2EZ0C 5DEFB 5DRNA 2DQFB 3NAAL 1JHLL 1WEJL 1NFKA 4M6MH 1OAXH 1Q9LA 1U8HB 3L3HB 5SWZE 1ZHKA 3DUUB 3GSVB 1AHWC 1TFHA 3NIGE 3UXFA 3D5OF 1A9BB 3ARFA 1SJHA 2E7CA 1ZGLA 4MCZA 1YMME 3RRQA 4NN6B 3QWRA 1XR8B 3M8OH 4OFYD 4LARL 4WNQB 5EU6E 4PG2A 3FB7B 5AYQA 1EX0A 4JB9L 3GIVB 2IAMC 5L2KE 4FN0A 3TFKC 4M6OH 3SKOA 2IGFH 4J4PD 4MQ7A 5GGTH 3G6DH 1WC7B 2F19L 5J3HC 5I8CA 5C0BE 2HTKC 3OKEB 1MFAL 2VLJA 1TZHB 4XNYL 1KPUB 5CJ8A 5L88L 2FD6L 4K7PH 3HMXA 3K46A 3IDIB 1QSFD 1J0KA 2DQTH 3CIQA 3A6CH 3Q3GB 4KJYA 1AO7D 1NKOA 2FJFB 2WMPA 4X7TA 2O5ZH 4MVBC 4ZO6A 3HC3H 3BP6A 3TPKA 1GHFL 2GSIB 1YEKH 4XPGL 3U4BL 2YR3A 3IAPA 4WFHE 3UTPD 3V4PH 4DN3H 2FH8A 4FQPA 1M6OB 4KDVA 2XKSA 4JFZL 5JOPD 1EVUA 3VI3E 5CIPH 5IWLC 1OW0C 1NUFA 4FXGA 2YMXL 5GGRB 4TUOB 3ARFD 2A0LD 1IGJA 4U1GB 4AK1A 3RDTA 3FFCB 1VFMA 1L6XA 2ZG3A 3GNML 3L3KB 1RZFH 5LGHL 2CLVA 2QQKH 3HZKA 4P9HC 4ZO9A 4RRPA 4Z7OF 3EYFA 3QUYB 4HV8A 4MD0A 2JCCA 1SYVB 1UA6L 3S6CA 3F6LA 4WEMB 1WIPA 2H9GB 2VLJD 4OFDA 4Z0BL 1DEEA 3QCUL 1I1YB 5ENWB 4KQ3H 3TWCH 2NCMA 2F54D 5GPRA 3LS5L 4DZBA 4PJDF 3MRQA 1ODAA 4TNVK 1FDLL 5E2VH 5ICYB 4XPBL 4NT6A 2PO6C 1ZLSL 3RY5A 5KSBE 2UUDH 4BQBA 4QXGH 5IF0A 4UNVA 2D7TH 4MNHB 3CCHB 2HT3D 5TF1H 4OD2B 1D5XA 2ADJB 3RPIA 1NBVH 3TBTB 4LF3A 1WEJH 2VR4A 3JV4B 4HC1L 4JANA 1CLOL 1K4DB 3QIBA 4BQ8A 2EKSB 5HJ3B 3U1SH 1HEZB 2H32H 4OGXL 5DD6B 1CF8L 5DT1H 1TZIB 1CDGA 4X4XB 3QDGA 2SEBA 3MOBH 4LPWA 2P8LB 3HNTH 2DMKA 3VXNA 1ZEAH 4ZXBB 5F3BB 2FJGB 5F8QC 3H9SE 1DLHB 2MCPL 3BWAB 1TJHL 3WKNA 4GW4B 3VXQA 5I30L 3DBXA 3S4SG 4JB9H 3FO2A 4NSKA 4XH2A 1MAKA 5DD0H 4PJAE 4IM8A 1KLUB 3DIFA 2F19H 3PABB 4HDIA 2EIBA 5CIPB 4EZMA 1XH3B 3MV7E 4CU7A 4KTEL 2ATPB 1MNUL 5FAAA 3QFJE 1V7MH 1DBAL 2DQHH 5IB3A 1AJ7H 3WE6A 5KS9F 3Q5TA 1J88A 4I1NB 4MJ5B 1FRGL 5TJWK 4I48A 3B9KB 3KPQA 4HIIA 2MHAB 1TQCC 4PGBB 2PXYC 4L4VB 4TVSa 8FABB 2HJLA 3T0AA 1QLRB 4XPGH 3RWGA 4AIZA 3KVQA 1HH9B 1B0WA 4E41E 1CD0A 4ZDHA 2YMXH 5MP6L 3LQMA 4YBHA 4PS4L 4XP1L 1L7IH 2B1HL 2ZUVA 5LGHH 5H2BB 4OD1H 4LHUG 1NGQL 5IQ9B 3A0OA 1CFTB 1UZ8B 4K94H 5J13C 4OCRL 3CSGA 1F13A 1KYOJ 2FGZA 3I6LE 1UA6H 2H32B 4HS8L 5INCA 1C7TA 3FB5A 1G7LB 1A14H 2X4SB 2V5YA 3RAJL 1OTTC 1JI1A 3PP4H 3QRGL 4PJGB 5JW4R 3UTQB 2HP4A 3RHWF 1XGTB 4WU5B 1S9VB 1RY7B 2C7UA 2XQYK 1I7ZB 3W2DH 4TPRH 4RGOL 3HE7D 3K3QA 1T6WA 1T4KA 5IR1B 1NGPH 5C1MB 2F53A 2HAZA 3G04B 4OFVA 3F7QA 1RZKL 3DYMA 1FL3B 3O2DL 4K8RC 3KJ4C 1IC5L 1B88A 1P53A 2J6EL 1CF8H 1S7RA 3V2AR 5E08L 2FIRT 3SDXB 2VISB 1S78C 3MRKB 4BKLB 3KDMB 4LEOA 4PV9B 1CDCA 1PEWA 4ZS7L 1TJHH 2YSSA 5EBLA 3QB7C 3PHOB 5IVZB 3GMOB 4Y8DC 3MLWH 3FQXB 4QWWC 1OPGL 5C6TH 5C0GA 3KJ6L 1IEHA 5DHVA 4K07A 3GKWH 5JDJA 4X6DA 2BCKA 3TBVB 4GMSL 4NN6C 1REIA 4K3DL 3KPRB 4L5FH 4OZ4A 4Q58C 2YPKB 1JRHH 5ICXA 1X3DA 3O6LL 3OX8B 4TQEL 3IJSA 1MNUH 1W2KT 3AROA 3LQAC 4R7DB 3EOYG 1DBAH 3S36L 5LG1A 3DHMA 3PWNA 2XN9A 3GSOA 4CN4A 3BVNA 3V6OA 1FZJB 4RA3A 5EO9A 3A67H 1MH5A 3M07A 4D3CL 4WY7L 2ZNXA 1RUAL 5CZXC 2W65A 3VI4E 1KN4H 3U0WH 5T5NG 3OB0H 4DOHE 1HYSC 4KUZH 3B5GA 1MFEL 2JB6B 4CDGC 2J8OA 1G9ML 1ZSDB 4BYHA 2Z91A 4L8SB 4N8PA 2CLZB 5D2NA 5DQJA 4WVRA 3L5XL 2JCCF 2HFEA 4X80H 5MP6H 1J5OH 4PTTB 2YD6A 5MEND 4MJIE 2ICWI 1T03H 1CFQB 1HINH 2B1HH 2A2QT 1SJXA 2KBGA 1NBZB 5EZLA 1NGQH 1MCSA 4F7CB 5E5MA 4K7FA 1JWSA 1JF5A 1BZ7A 4FQCL 1KLFA 4U1GC 4MJ6B 4OCRH 4MQXD 4GUPA 3QULB 4EN3B 4EUPG 1ROWA 1ZT7A 4ODUB 1BZ9B 1TZGH 4JFOB 5AWNL 2W60A 2P49B 4NQDE 1F02I 3QUYC 1CR9L 3CZJA 4BSVB 3P40A 3SGKC 2I26N 2X1XR 1FNLA 4M03A 2BJML 4RGOH 2I24N 5C0DB 4PJBB 3PWPE 3BT2H 3IB4A 4OZGE 4RWYH 1VADB 3TA3A 4NQEB 5T3ZD 2JJTA 2ORBL 5EUKB 4ORZC 3BZEA 3WJLA 4G6JL 2CDGA 5E1HB 5JZ7D 4BQ9A 3OMZA 5MERB 3LKQA 5KVGL 4K3EH 1T0NB 2B7DT 2B8OT 3WS3B 3IKKA 5E08H 2E7MA 3CZFB 1AY1L 4U1SA 2AK4B 4FZEH 2CD0A 2YBRA 3MLZL 5J0BA 2Y07L 3NIDE 3TO4B 1NCDL 3MODL 4XBGA 4XMPH 1J8KA 5KN5A 4MDJA 1WAAE 2ICEA 3SDDB 4AQOA 3VXSD 2GJZA 3DV4B 4ZXBC 3MV8A 5GHWL 4L1DA 3HR5B 3ALXA 5L2JA 2NX5A 3CSPA 4GMSH 4K3DH 3C08L 3WXWH 2P5WB 2HH0H 3O3BB 4PJEE 1DVFB 4FQ1H 4TVPL 3O6LH 5KVEL 3N1MC 4Z9KB 4N9GA 1FFRA 3OPZH 2NXZB 3U7WH 4HJ0D 3M1BB 2NW3A 3EDDA 5DD3L 1RFDH 3TA3D 3QIWB 1D9KA 1RUAH 5EZOL 5D96B 2ZSVA 1MWAL 1Z6JT 1DQDH 3MCG1 5JHDB 5EU4B 2FX9L 3B9KC 1MFEH 1G9MH 4XAKD 1FV1B 5BRZB 1IEAA 1MELA 2YKLL 5HGBA 1W0WA 5ITBL 3FQTA 2Y5TA 3CMOH 3D48R 4M5YH 3X14B 4CU6A 1CE1L 5JR1L 4DGVL 4F7TB 4HKXA 5DMIL 5F1OB 4PGCB 1A2YA 3NZHH 1FQ9C 5T1LB 3MV8D 4XPTH 1XF4A 3QXAB 5JUEL 3ZDXE 4HBQA 4OZIB 2NX5D 4NNPH 4X6CB 4K23H 1U91B 2R2EB 4LASH 1UEMA 3ILPA 1IFHL 3GMNA 3Q5YA 5DUMH 4X5XA 2XTJB 1CR9H 2XNAA 2A6IB 1E6JH 5DRXA 3OGCB 2P1YA 4WEBH 2BSTA 2XQBH 4PJBE 3W82A 1D6EA 3U7AA 1V3MA 1AR1C 5KOVC 3FO0L 3WHXA 5DSCB 5LCVL 4XHJD 3VFNA 3UPRA 4R6UA 2C4FU 3EHBC 1KC5L 4CVXA 1JPSL 4G42A 3W39B 5JDSA 1RJZA 4QYOA 5CSZA 5A2FA 2ORBH 2VH5L 3N06B 4G6JH 3VH8B 3MBXL 2FIKA 2NZ9D 1N5AA 2H3NA 4G6AD 2IANA 3O41A 4LP4A 2W0LA 5KVGH 1KCVL 5K59F 2ARJB 3AXLB 4X6DF 1NMAH 5E6ID 1AY1H 1U92A 3CH8A 5ANMA 1EEQA 3ARBB 5D70L 5DDHA 1P4BH 5FHAL 5IMLB 5MHSD 5H35A 1NCDH 2KKQA 3MODH 4R26H 4APQA 4NQTA 3UAJC 2YD1A 1EDQA 3L7EB 2XXMB 6FABH 4J23A 1MRCL 4QTIH 4ZOCA 3ROOB 4NOBA 2PW1B 1Z3GH 1KJMB 2WBJB 2Y6SD 2L4OA 3V95A 4PJIE 4PJ5B 4JQXC 3U2SA 1ONQA 5IG7A 3QBTB 4HLJA 4I0KA 4PV8B 4TVPH 4CGTA 2R2HA 3QH3B 2P7TB 4FQJL 2HWZL 3RWCB 3BP5A 1WLHA 1UB5B 2GJ6E 4H26A 4XZUA 1MCPL 5HD8C 3LEYH 5DD3H 4JQVA 4YDIH 5AZEL 1T5XB 5EBMB 5EUOA 2V2XA 5JHDE 3GB7B 1YMHB 3PWVA 1G6VK 1WZMA 4MDIB 4YHYB 3DURB 5TE6L 2R1XA 4J1UA 4N0FA 2IAND 5BRZE 4UU9A 4L3EA 4D2NA 3LZFH 1KB5A 3D85D 4ENEC 4K94C 4E0RB 2YHGA 3OG6B 4G7VL 3S3PA 3MYJB 1CICA 1JPFB 3MJGX 5JTWA 1CE1H 5EPMA 2BK8A 5JR1H 5I15L 4UIKH 4UOW0 4L8SC 3PP3K 15C8L 1J0YA 5T1MA 1AC6A 1YJDH 1JF1A 1FVCB 4GBXA 4KDTC 2BC4B 3SGEH 3MBED 3DVNA 1PQZB 3F7YA 2EDXA 2XTJE 3PJSB 3L5HA 3PIQA 1IFHH 3MNWA 1GC1H 2OR7A 1X4XA 3FOMB 1G7HB 5F9JA 1MJ7L 4NZDA 4EN3C 2DTSA 3BZFA 2BSSA 4NO5B 5GRYA 5BQ7A 4NO0D 3R8QA 4DUXA 2ZUYA 5LCVH 4YPGB 4ODVL 1TCRB 1A47A 5B22A 1I3GL 4ODSH 4ERSH 4Y4HB 1T0MB 2DQDH 2Z4QA 3SKUD 3VFSA 3I6GA 5C86A 3MBXH 3WIHL 5FK9B 5AAWA 4GXVL 1ED3B 3WO4B 4U1HA 5DEGA 4KROB 5IHZB 4Z5RB 2HJFA 3Q5OA 1CGWA 1T7XA 5CBEA 5FA3B 5D70H 4YBLB 5FHAH 3BXNB 3HAEH 5GGQL 1KCLA 4U2YA 2G2RB 4YZFE 1RK1B 3NABL 4GBXD 5K9OA 4MXVF 3G5VA 4Y5XB 3WFDL 3PWUB 1J8HD 4ZYKB 1E4KC 5F9DC 3TO4C 4QRTA 1XF3A 1GZPA 4PJ5E 1BFOA 1MPAH 3AMLA 3WUWG 4DW2L 3EFFA 4LSSH 1YYMH 3IYLW 2FX8H 3SDDC 4XPFH 3LKNA 2V17H 3TVMD 5I17A 1AXTL 3JSSA 4PR5B 1F90H 4Y16B 3GHBH 2HWZH 3ULUL 5E9DE 3K2UL 2M26A 2NY3B 1LP9E 5HI4D 4R3SB 1VHPA 1D5IL 5CLTA 1K8IB 1DVFC 1JNHB 2OZ4A 5KSUB 4K2UL 2E9JA 3QUXA 1QVOB 4LVNB 4ZTPH 2VZOA 4MS8D 3DRTA 4X4ME 3GUTB 3EUUA 3O6KL 2APFA 2NXZC 4HSQA 3D18A 4GQ9L 5TE6H 5FF6A 1I7RB 1Z9LA 2FEDC 2DQGL 4P23A 2D2OA 1DQJA 3IDGA 4MAYB 1PSKL 4ETQA 4LSTH 3EYOB 3QIWC 3V6FA 1QSZA 5EN2A 3SGDI 4IOSD 5D96C 1HHIB 1KTLA 2HFFA 5B38G 4LCWA 5LAXB 3OKLA 3EYUH 1WF5A 3GMQA 4JAMB 2Y36L 1JGVH 2OL3L 4V1DA 2YXMA 1BM3L 4G9DB 3IXAB 1FVEA 1MCDA 1XF1A 4LKXA 3VFWA 1RZIB 3O9WC 3QEGL 1MIEH 4YE4L 1LO2H 3WN5B 2PW2B 1BQHB 1E28B 2NXYD 4G8GD 4NO3B 1P2CB 3WNMA 5GS1B 4TOYL 4UILL 1JNJA 1KNOA 3LPFA 3NPSB 4POZC 3JTTA 3OKDB 2XPGA 4Q2ZA 5GRJL 4P3WA 4NQXB 1U95B 5HHXH 2PR4L 2D31B 4R96B 3PDDA 3HAEB 4DKFL 2EDHA 4O02L 3MRPA 1H8SA 1QHOA 1SQ2N 2B1AL 2A9MH 3QUXD 4WO4A 2RB8A 2XTJC 4P2OB 2DYPB 4Q9QL 4ODVH 1EJ6A 4KZEH 3QO1A 5DD5H 4Y2DD 1I3GH 3OZ9L 4IDJH 5F96L 4LIQL 5DJAB 3ULVH 3W11C 4TVPE 4JLRB 1CK0H 4P23D 3VJ6B 1PY9A 3CDCA 3AGVA 3ZYOA 4QXTB 1QA9B 3ABZA 5TDOA 4CADA 5J6GB 2FHBA 2COQA 4GG6E 1HQRB 3MACL 1B3JA 4LCWD 1WFTA 4XP6L 2Y25A 3MX0A 4LHUA 4FZ8H 2NTFB 2H2SC 1F6LL 3RIFF 2VLLA 3HCVA 5FKPA 3NABH 3MRGB 1MHPL 2XA3A 4EOWH 4LRIA 4DAGH 1YPZF 4DUVA 5FO7B 2XWTB 4ODXB 3ARBC 5IFHL 4DGYH 4KK5D 4X6EA 3CSYA 2ED7A 2QTEA 5IBLD 3H8NA 1IAIL 4XBPA 4HPYH 2ZJSL 1BPVA 3WSQH 5EUOF 1LO5A 3MRJA 5C0IB 4CVZA 3L3GA 4JN2A 1AXTH 4CUCA 1UG9A 5IHUL 1L0XA 2R0KH 5AG9A 4TNWF 3V7AE 4A6YL 2EYTA 2WBJC 2P24B 1EFXA 2HYMA 4D94A 4WO4D 4M6NH 2NY2B 3QI9A 4NQSA 5DJ0B 1QPPA 1A5FH 2A1WH 5GJSH 5DUBA 2GYSA 5D7JA 5FB8A 5DMKA 1YNTB 5FM4A 3EBAA 1U8PA 3CXHK 3TBWB 2VLMD 4CL7A 5IBTL 1HILA 1KUMA 4XX1G 4KJWC 3IFOB 1SY6L 1WGOA 4C58B 1PSKH 3PDOB 1HIML 1B4JH 1NC4A 1S5HB 3VE0A 4OCWL 1UWGH 2NY0D 4YHYC 4R4FL 3B6SB 4Y19B 4P4KA 2VUYA 4L29B 3ARZA 5ERWB 1KCUL 5D2LA 3H9ZA 2D0FA 5GS2H 1PKQB 5CEYA 3BYTA 4NUJB 4F8TA 2EE2A 5EFIA 4MWFB 4ZOEA 4R7NB 1MRFL 3ARTA 4D0BB 4X7SH 1I8MA 2IPTL 4ZFFA 4OCYH 2H6PB 5GRJH 4RQQA 3RX8A 2EDKA 3O3AA 2GTZB 2PR4H 3G9VA 1JGLH 4P3DA 3ULSA 3LRSB 3QI9D 4FTVB 4JPWH 3ROLB 4X7CC 1RZGA 4ALAH 3DYPA 4OZFG 4K55A 4LHJB 3L5WA 4K9EH 3JTSA 3BUYA 1I85C 5D7JD 2C1PB 4RFEB 5CJOH 3ZT6A 1QKZH 2LU4A 1PAMA 3DROB 4EJ1C 5C2BL 4YHOH 3DSFL 4LIQH 5DVMA 5IB5B 1FPTL 3GSUA 1X44A 2FJHA 4G9FA 4R4ND 1NC4D 3W0WA 1TTGA 2Y9RT 2EZ0D 1N64L 1AKJD 4Y4KB 5I2IA 4Y4HC 2E6QA 2FECI 2H41A 4KI5D 5JIKA 4XP6H 3FB6B 5E1AA 2VAJA 1OY3B 5C0EA 5FFLA 3VFPB 2IH1A 2XRAL 5C3LD 1VCAA 4J6RL 3WO4C 3P11L 2ZUXA 4N5EC 4DQOH 4KROC 3T1FB 2FNBA 4GOSA 3EO0B 1E4XI 1BD2B 3G6JE 3RI5F 4LSRL 4YBLC 1XFPA 2W9LA 1MQ8A 2R2CA 1JHTB 1JZ8A 4Z7VA 2O61A 4Y5XC 3GI9H 3GEWB 2QJDA 4KY1H 5FCSH 5J3HD 2HTKD 1MCHA 2EXWC 1QSED 2BVOB 4QHUB 4NKMA 4MA3A 3WFCL 4Z7QE 4IHOB 3AVEA 4X98B 4WHTB 5CHNB 4Y16C 1NFDA 3Q6FA 1JZ3A 2AJUL 2NY3C 3LEVH 4DKDC 3V0WL 4MVBD 5IVXB 1AI1L 2E7HA 1YJDC 4OLUL 1L9MA 3H7LA 4Y5VA 1J1OH 3E6HB 4LVNC 3DXAE 1NEZA 3DLQR 3GJFK 2DQUH 4ISVB 1WUNT 3TJHC 4HH9A 1UZ6E 1GC1C 4R4FH 5E7FA 3ESUF 4MAYC 5GIRB 3VFTA 4OLWH 5IW1B 1QR4A 4PJ8B 1W0VA 1GVIA 1KCUH 5HYSB 4YGAB 3UYRL 5D71L 5TGBB 2FR4B 3O6ML 1QBLL 1Z0NA 4D0DA 1NGZB 4TTGA 1GRWA 4JG1L 4AEHH 5HYJA 1OAZH 4HMCA 5I1JH 4NZTH 1FBIL 4Y1AA 4JG0L 3MROB 4B5EA 1IKNA 1B90A 2BNQB 3D25A 1PX3A 3WN5C 4NCC1 4PJFB 3GMMA 2F9BT 4DZ8B 4FG6C 5GS1C 1E27B 3NPSC 4M8VA 3QUKB 4RA0C 2DLEA 4KQ4L 4X8JB 5JLZA 3UTOA 5HDBF 3WDHA 5DQ9B 5TE4H 4EXKA 1KEML 2XI9A 4X9FA 3FO1A 4IRSA 3DV6B 3UJIL 2PO6D 3I75B 1EO7A 3DSFH 2VZTA 1N8ZA 4H1LH 1KCRL 1R3KB 3T4AA 5H94B 4H88L 4P2OC 3TN0B 1YEEH 3ULUE 3S35H 5D1XA 4M62H 4GQPH 1EAPA 2IMNA 2LV4A 1DJSA 3UTTE 4ZFZB 1OLZA 1ZXQA 3RNKB 5DFWH 1FVDA 4HWZB 1FN4A 4LL9A 5C0CA 3CGTA 1I7TA 4LRNH 2ICWJ 2WUBH 1T1XA 2FBJH 5GXBB 4M9PA 3CH1A 2YEZA 4EVNA 1KEGL 5C08A 3MRCB 4PFEA 2UZIH 4LDLB 1UCTA 3T3PF 1KPRB 5HYJD 1XF2B 1FZKB 4OBRA 2FWOB 5D5MF 1Q94B 1S9XB 1C12B 4LLMA 2CK0H 3IVKB 2AV1B 1OP3H 4ZPVB 1KJ2B 2AAVA 1E6OH 3CAFA 5T1KA 3HUJE 4LSUL 4UMGA 3CC5A 4O4YH 3OTTA 3CVIH 4XHQA 3F12B 4L8CA 1A7QL 1ND0A 2XZCH 2B4CL 3WFCH 3EYVA 3GIZH 5BXFA 1M7DA 1AD0B 1YQ2A 4X0KA 1HHJB 4I0PA 5IVXE 2X1PA 1J7VR 1FZMA 2XYCA 4KI5F 5TPWL 3ZHLA 2YPLA 3MRFB 4P0DA 5DVOA 1LO3H 5DJDB 2NY2C 3KWWA 4FRWA 1C5CL 2PXYD 2QBWA 2V7NA 5BW7C 5D1XD 2PYED 4OLUH 3DETC 5IFAL 3WFZA 4KAQL 1T66C 1CZ8H 1UC6A 4NQVB 3VDCA 5C0CD 3WL9B 4FFVD 3CFKB 5TQ2L 1O7SA 3CFIC 4IOIA 5TF0A 4AEIH 4Q74A 4NN5B 4Y5YA 4LIQE 3WFHB 4X4YB 1IKFH 2E7LA 3OXSB 5C09E 5J06A 5E5UB 1J1PL 5HGAA 2HKHL 3MUJA 5JXEC 5LGJB 1PW3A 4KJQC 1FZOB 4H1LB 5FV1L 1N3NB 1TETH 2JK5B 4JO3H 5T1KD 3KXFB 1UKTA 5DGRA 5T5NF 1QFWL 3ULVC 3L3JA 3MOAL 1SEQH 1KACB 2X9XA 4ONGL 5FGBA 3GSQA 2I9TA 1OTTD 3H3PH 3U83A 1A6ZB 5BV7L 5J1AA 1INQA 4JRYD 4IS6A 43CAA 2F8XC 2BOCB 3PGDB 5I76A 3OKMB 2VDQL 2WUCL 1AE6L 4PP1C 1FNAA 4W81A 3C60B 2VDRL 3IJYA 3MFFA 1QRNA 4XCYB 5E4EC 5KZCD 4HUUB 2ZG1A 4H88H 1FLRH 5I1AB 3JXAA 3AAZB 4XNQB 3JWDH 2D0HA 4MNGE 2DQCH 2VL5B 4K8RD 1OARL 5A2IH 4PJCE 3MXVH 2XZQL 1MCCA 1H0DA 4Z7VF 4KXZI 4F9PA 5KW9H 3RGVA 1P4IH 3BRGC 2ZOKA 3MLTB 4Y4KC 4G80A 1QBAA 1MCKA 1S78D 3KPMA 1JVKA 2ESVE 3IFPB 1LO0L 5LQBL 1A6PA 1ZHBA 1IQWH 4QRRB 3NN8B 4P4RB 1NFDF 3QG7L 1A0QL 4LFHD 4OKVB 1S7SB 2DM4A 3T65A 3UBXB 5HGGS 4D8PB 4XVJL 1P7HL 3IJHA 4Z0XA 3QP3A 5CP7B 3DRQA 2B4CH 1MVUB 2WK2A 5F7DA 5IMMB 3X12B 1RIVL 4FXKB 1NBQA 5JW3L 3AC0A 4DWHA 2Q1EA 1Q8MA 2D7MA 1DFBH 4HFUH 3V4UL 2I27N 2DTML 2E3VA 3DMMA 2ZP0T 3LH2L 5CZXD 2XWJA 5E2WH 5LVEA 4LSVH 4KZDH 1HYSD 4HCRL 2WIMA 5BZDA 5EZJB 2QSCH 4PRPB 5BVPL 3X17A 1F8TL 3OKKB 3QXVA 3RGVD 2VXTL 1QFPA 5TQ2H 4AG4L 3RWHB 3CFEB 1CL7I 2J1KA 2ITCB 2ADJA 5D72H 1CQKA 3CLFL 1UVQA 3GKZA 1ZHNA 4KU1A 4ZFGH 4L8BB 3KXFE 2DDQH 4JFEE 4K9EC 1CFNB 3WUWA 3BP4B 5AYUL 3PWLA 1K8DA 2R1WB 4NRYB 5EIQA 3KYKH 3LKSB 2N7BA 1M71B 4HUXB 1Z5LB 2OK0L 5KVDL 2BY0A 3FFCD 4YHPA 1FAIH 1G7JA 3DVIA 3JVGC 4ONGH 2BY2A 5B21A 4TUKH 1K3IA 1CGSL 1MIML 2JTDA 3O3EB 3VXPB 4M7LH 3QUYD 1ZMYA 1C5DA 4YXLL 1JNNL 1PG7X 3SCMB 1K5NB 1I9IL 1CLYL 3MR9A 1JGDB 4JM2A 1T22A 4LPTA 3ME0A 1LGVA 2EDYA 5KTEL 3DMMD 3QDMB 4OFPA 4M61B 4S0TD 1ZWIA 3SHSA 3X13B 3TJEH 2HLAB 1FNSH 5B38A 1LHZA 4OF7A 4N8VB 5KSVB 4JQIL 3RWEB 1CDYA 1NQBA 4NKOB 1IRAY 4IRZL 4HQQH 1GGIH 3TN0C 4KJPC 4XPHL 3SDAA 3BJ91 4I2XB 5D7IA 3F7VB 1XGRB 3J7HA 5IB2A 1RZ8A 2VDLH 1SVZA 1MFBL 1H3WM 1IGCH 3B2UC 5DTFA 4QRRE 2GTWB 4F37K 2OJEB 1P4LB 1LO0H 4IMLB 1XR9B 3BPCA 4I5BB 4L4TB 2R2BA 4QRPB 1MJ8L 2WWKT 3OJ2C 4ZXBD 2EO9A 4XXCA 2RFXA 3QG7H 3G6AB 4Q0XL 3V5HB 4OB5L 1T1ZB 5D7SH 5GRWA 5H2BA 2R15A 3PQYA 3VFMA 4EKXA 3AFLA 3VWKA 4BUHA 2EDRA 1QBMH 1RIVH 1EHXA 4JFYA 5LXGL 5JW3H 3KPPB 5CINH 5C0AE 1CXLA 2DQJH 3BPLB 2M8XA 4JFDB 4OBSA 4Z7UA 3TPUA 1CT8A 5ETUB 2WZPD 3UTQA 1ETZB 1KXQE 5AZ2H 2X4OB 4Z7WB 2VLRE 2Z93B 1F2XK 3ARDB 1HHGA 3VXTB 1EXUA 2QQLL 4HAFA 3T0EB 3NMEA 2OP4L 4HX1A 1S9KC 4DCQA 2YPVL 5HHQA 3NZ8B 3ARXA 3S37H 3B9KD 1Q1JL 4L4VD 4NRXA 4MD4A 1UJ3A 3EJJX 5HYQA 1A8JH 5EWIL 5C0NC 1IBGH 2R9HD 3ZTJH 4JZOA 2QEJA 3NIFF 3ZE1F 3K8MA 5JO5A 1FL3A 2DWDA 5JQHC 1HQ4B 4NOFA 3N50A 4JPVH 4WFFD 5ITFB 3SKMA 4JY4A 5BO1L 4I9WE 3TT3L 3C5ZB 1KJ3L 4NJAH 3O4LA 5J56B 1EUUA 1D5MA 2OM5A 3IDMB 2IH3A 2QQNH 1T5WB 5HVHB 3VWKD 3P4NB 2NYYC 2ZPKH 1HWGB 4RX4A 3U30B 4U4BA 1JNNH 1KGCE 1EA9C 4GKNA 5EC1B 3QDME 1RULL 1JI2A 4AM0A 4NO2A 4S0SD 3CFDA 3C8KA 2AGJH 5FECB 3EHBD 1XGQA 2AV7A 1A21A 3H0TB 3PL6A 4N0UB 4GS7B 5JMOC 4BSJA 2KH2B 1AGEB 4M7ZB 3TNMB 1T3FA 3C60C 4ZTOH 3UTZA 2DBLL 4IRZH 1MHCB 2O26U 2DMBA 1BVZA 1RJYB 5J89A 5DJ8B 4PRNA 2R69L 1MFBH 4PB9H 1FYTB 4YLQT 4O9HL 4Y4FA 5LWYH 3RY6A 4P2RE 3UAJD 2W9DH 1IC7H 1MJ8H 4ODTH 5HY9B 5TE7H 3VRLE 4LLVB 5KVFH 2Z31B 2A9NH 1GGBH 4OLVL 2ZUQB 2FGWH 4I77L 2JELH 3GSNB 4BK5A 4O00A 5DR5H 3MTRA 4OZFA 1FE8H 1R5VB 2E9IA 4W6WB 2IFFL 3V6ZA 2BDNH 1IMHC 3KPRD 4Z7WE 2QR0A 1DDHA 2NR6C 1PG7W 1EO8L 4Z95L 5HD8D 4HUWB 3T0EE 4OT1H 3MJ7A 1F3DH 3QDJA 4BSVA 1S7XA 4ELME 1BQLH 1KCSL 2VABA 3D2UB 4H20L 5JHLL 3E3QC 3VXRA 1UXSB 2XWBB 1X4ZA 3V4VH 1Y6MR 4JHAL 4YHKH 4ENED 1Q1JH 5FHBL 1J1XL 1IL1A 3ZHDA 4NQCA 4HIHB 5EU5B 3HI6L 4Y4FD 4F8QA 1RIUH 4LCYB 1F4WL 5I19L 3L3DA 4JFXA 1ZS8B 2BNRB 2FH6A 2EIZA 4HUNB 3WNPA 5BO1H 2EC9U 3TT3H 1HK6A 4KKCC 1LK2A 1LDSA 3NCYP 3V5DB 4JDZB 4MX7B 4X5WA 4JM2F 4ZFOA 4PTUA 2V2TA 1UQSA 5HPMA 4J8RA 2ZNWA 3O8XA 1I1RA 2HLFC 4IRJB 3LN5B 3OAUL 3V79C 1T83C 5HSFA 5DMYA 4GXUM 3JWDC 3F6IA 3D69B 4ZUTB 3TIDB 4EN3D 4MSWB 1XGUB 3FO9A 3OKNA 4HS3B 2OR9H 4N0UE 5D7IF 4YR6A 3O3BA 3SCMC 2H1PH 1FG9C 2X5PA 4JJHA 5F7WC 4U6VL 3KPNB 2GSGB 2VAAB 5KS9B 1SEBB 1YN7A 1IM9A 4NQCD 1S7VA 5IQ7H 5K9KB 1DQQB 4NWTH 5DJYA 4U6XB 1FYTE 4NQED 4CAGA 3HMXH 3IDNB 3VGBA 4MD5B 3B83A 2B4CC 3STZA 1VPOH 4Y7MA 1KXVC 1GGCL 1NMBL 1VACA 5HHPB 1A9EA 2HVKA 3REWB 4JCLA 4GAFB 2AK4D 3QHFH 1PJ9A 3HS0B 5J4MA 4MA8H 2ADGB 2FBOJ 2UVEA 4Z7UF 1ZT4A 3O8XD 2HG5A 3MGOB 4MXQC 3TO4D 4HIJA 4OLVH 3SDDD 5T5FL 3ES6A 3G5YB 3CUPA 3BSZH 5ALBL 3O4OB 4OTXH 4GG8B 2P5WD 1DVFD 3MRHB 5D7KD 2VQUA 1U8KB 1T1WA 3IXTB 4PJDE 4YWGL 5DRNB 1D6VL 5T33H 1P84J 3UJTH 2NXZD 3BKJL 1Q9LB 4H20H 3BPLC 2EIEA 2R4RL 5JHLH 2FEDD 1ZHKB 2IMMA 1DSFL 1NLBH 4XMKL 1F58L 3VFVA 3QIWD 5HPOA 2AXFA 1J1XH 5FHBH 2HT4D 5TDNA 4OF5A 3RBSA 3ARDC 3WMSA 3ZKNC 4DVRH 3I3DA 3T0EC 1EEUA 2BNRE 4CKVX 5CMAA 3ARFB 1SJHB 3V5KA 1ZGLB 3HI6H 3HTLX 4NHCH 1U2CA 5I8OH 4QF1A 4OSUL 3WDJA 3P77A 3MPCA 5D7LA 3LB6C 3TZVA 4JRXE 5DRZA 3T4YA 3FCTA 3HPJA 3SKOB 3F5WA 2DIAA 4CVUA 4RISH 3UTSA 1Q0YH 3N85L 5IMLA 5I8CB 2FO4B 4LU5L 2VLJB 1P7KA 1F00I 3UJJL 4YBQD 3C5ZC 5D1QA 3HMWL 1AGDA 3KYOA 4YHIA 2PW1A 4KJYB 1FFPA 2DL2A 5FOJA 4X7TB 5HVHC 4HGMA 5HGHA 2LE9A 2X40A 3BP6B 3U30C 4PV8A 3T2PA 1JYWA 3QH3A 3ARSA 4U6VH 1IQDB 3GBML 1WZ1L 5HHOA 4JO2H 3LIZL 1CVRA 1CGVA 2B2XL 1C1EH 4F58H 2WNGA 4FXGB 1MOEA 3MLVH 3SOBL 4GS7C 1OAKH 1IGJB 1NCTA 1BFVL 5E94A 3RDTB 3MUGA 2CLVB 3HZKB 4HUMB 1GGCH 3TZVD 3LS4L 2VXQL 3R06A 1F11A 3EYFB 4HV8B 4MD0B 1I9EA 3CMGA 1VFOA 4YXHL 3CLEH 3MCLH 2JCCB 3ARBD 3KPSA 3D39A 1KIUA 4XMLL 5T3ZL 3GSWB 1VSCA 1DEEB 1R3HA 2Z8VC 2QSTA 4DZBB 3MRQB 1QSFE 2ZG2A 1U9KA 2Z31C 2ZUQC 2WBJD 1AO7E 4NT6B 5DHYA 5L8KB 3UZQA 4NNXA 2W9EH 5IF0B 2BHUA 1VEMA 3TCLA 3UTPE 2GQHA 5HHOD 1D5XB 1YEHH 4JZNA 4WUUA 3RPIB 2VLKA 4YWGH 1EZVY 1W8OA 5I1HH 4LF3B 3RVTD 4Y0GA 2PTUA 3MRMA 1FAKT 4JANB 5JOPE 4KJWD 3QIBB 1OQOA 3OAYH 1HE7A 4HFWA 3QDGB 1F58H 2SEBB 3AMKA 5GGVL 3VXNB 2Z9TA 3R0MA 5MI0B 1G1CA 4KPHH 1KT2A 3WLBA 3S88H 4YJZL 1KSRA 1MRDL 3VXQB 2V5TA 3DBXB 1ED3A 2AI0L 5ISZA 3FO2B 1E4WH 4NSKB 3KPSD 4XH2B 3RL2A 1KB9J 2UY7A 4UZGA 4NDMA 4JO4H 2VLJE 3DIFB 4HPOL 2HMID 1S8DA 4HDIB 2F54E 3SE9L 1NSNL 1K6QL 4LEXL 5GZOC 3QUMA 5D1ZA 2D7OA 1QD0A 3WE6B 4ONFH 4R8WL 3EDKA 2D7NA 4H8WL 4I48B 3KPQB 4HIIB 4WV1C 4Z78A 3O3DA 4Z76A 3SKNA 4WUUD 5E8DL 2HJLB 3CX5J 1INDL 4MA7L 3LOWA 2VR5A 3RWGB 4AIZB 2P8PA 3GBMH 5BS0A 5DHVH 4DK6A 1DANU 4KUCD 3LIZH 1TJIL 4JDVA 3GGWA 4LOUC 1CD9B 1EEZA 1WQVT 2AK1H 1J18A 5BZWA 1MQKL 1KLGA 3VD5A 4ZDHB 3VG0H 5AUMA 3OAZK 3IDJA 2X09A 3F7RA 1BFVH 1Z9SA 4F2MA 3ZE2E 4N5ED 2XACC 3EYOA 1UM6L 3LS4H 3KLSA 4OZIF 3K4ZA 1CD8A 5IKCA 1HSBA 3OAZH 4JM4L 4TSBL 3TNNA 4YXHH 2AJ3A 5DJXA 1YNKL 2VIRA 5D8JH 5INCB 3FB5B 1BJ1J 1A6UH 5T3ZH 4NGHH 5D1ZD 5DD1L 5T3XH 3VA6A 5CD3A 2P45B 2XY2A 4HIXL 3VDAA 2C7UB 2VXUL 4FQQA 4HWEL 4TN9A 1L4IA 4YHNA 2NY6B 2W38A 4H0IA 4J4PC 5SV4A 1ERNA 5HYFA 3LEXA 1BF8A 3BO8A 1T4KB 2WSKA 1LVEA 1GOFA 4WU7B 4Y16D 2JLLA 5BS0D 1U95A 2F53B 3O4OC 1UGNA 2NY3D 1RUPL 4MJ4A 4PJ7E 2D31A 2ZSWA 4UNTA 3BIKA 1KOAA 2Q20A 3QISA 4JFFA 2DQIL 3PE9A 4ZO7A 1S7RB 1PYWA 4YUEL 1KPVA 5C3TA 4OCXH 1IC4L 4LEOB 1CN4A 3FN9A 3GM8A 1ADQA 4MAYD 1RAMA 4ZMAT 1RJLA 2YSSB 5EBLB 2C3GA 1JN6A 1MRDH 3I2CL 3TP4A 1QP1A 4PJHA 1N7ML 1OHQA 1HQRA 4QRSA 5C0GB 5F9AC 1W72L 5DHVB 3ARFC 1MI5A 1IILE 4PG2C 4OZ4B 5HHVH 4BK4A 1YEGH 5ICXB 4F80A 4LEXH 2IQ9H 4G6ML 3IJSB 1XAUA 5FA4A 1ZVHA 3H2WA 3D9AL 3H3KA 4LCUB 3PWNB 2XWTA 4CW1A 2XN9B 2VWEE 1YYLL 3GSOB 4NIKB 2EE9A 3BVNB 4P46A 5EO9B 4UV7L 2RJMA 1IARB 1XIWA 1MH5B 5C07A 2Q8AH 2ZCLH 3FN0L 4PD4J 4U1JA 1MFCL 1KFAL 2W65B 4F57L 4GFTB 5I1IH 1Q0XL 4OM1L 2E9WA 1II4E 3UYOD 4NNYA 2F5BL 4P2OD 2DYPD 4M1DH 4V2BA 3OBAA 4BZ1H 2Z91B 5D2NB 1YY9C 5DQJB 1UACH 5KG9A 4GKSA 1YNLL 1QFUL 3AY4A 2HFEB 2BFVL 4PLKC 2FL5A 4UB0L 3NCJL 1X5HA 3DX6A 1IAIM 4W68A 3JBG7 4BUGA 1HI6A 2WW8A 3HC0A 5EA0L 3T0BA 5EZLB 4BQ6A 3BAEH 5E5MB 4K7FB 1JWSB 2XQYG 3EDEA 3GZKA 5DGQA 1A1OA 1BZ7B 1K4CA 2VXVH 3RDTC 4GUPB 3BN9C 5JW4N 5IW6B 5IB4A 1ULVA 1L0QA 2W60B 4IMKA 2X4NA 2R0WL 3QSKB 3P30L 3FQWA 2R0ZL 1I1FA 4AMKL 1AQKH 4XCFL 4NUGH 3W9EA 5E8PA 4XVSL 4KUCF 1X5IA 3MJ9L 4O58L 1OL0A 2IJ0C 1JUFA 2CQVA 1NLDL 5MEPA 1X5JA 5EOQL 2ZZUT 3GI8L 3GMLA 2HA1A 2HJKA 3BZEB 3A6BL 1U8LA 2NY2D 2CDGB 3QDAA 2EH7L 3QWOA 3LKQB 3B2VL 4M43H 3DETD 2ZCHH 2V9QA 1T66D 5DJZB 4U1SB 5CUSL 5DK3A 5EO1A 5MENE 1M05A 1SYSB 2YBRB 4U7MA 1X9QA 3LRHA 1I3RA 1JV5A 3QIBC 3ARGA 2AEWA 2DN7A 4XBGB 5KN5B 4MDJB 4OCSL 1MCWM 4M93B 2ICEB 4NKDA 4BFEA 4X6DE 3EGSB 3N1QC 5MI0C 2GJZB 3BPNB 5IROA 5JXED 2C4XA 3MV8B 4OIAA 2F5AL 4Y19D 5L2JB 2IG2H 4J3XA 3RA7H 2A38A 5KSAA 3ULVD 2HFGL 5TDPA 2BRQA 4N9GB 3D9AH 1YYLH 2E8YA 2NW3B 5HHMD 5FYJD 1H3PH 3UC0L 3JV5A 4UV7H 1UH3A 5F71A 12E8H 3S35X 3FZUC 4HT1L 3MJ6A 3W9DB 2YC1A 5T3ZE 1MFCH 1D9KB 3ZKXB 2ZSVB 3QNYA 2DOCA 4FTVD 1Q0XH 5D2NE 5FYLH 1BF2A 4P3CL 1RZ7H 3RKDC 1Y6NR 5FUZL 1IEAB 1S3KL 4LDEB 5HGBB 1W0WB 3MLYL 3FQTB 2JJSA 2Y5TB 4JY5L 3QCVH 2QKIA 4FMFA 1NAML 2JIXA 4LPYA 4HKXB 3GSXB 4KTDL 1A2YB 4R97C 4TNWK 1RU9L 5EA0H 3U46A 3VXSE 2GIYA 1EFQA 3E6HA 4PYHA 3HFML 1XF4B 1LO4H 1YMMA 4PYGA 3IS0X 5BJTA 3QXTA 3ILPB 3BX7C 5CJQH 3ZE0F 3GMNB 5L2KA 4PJ8A 4X5XB 1KB5H 1MCOH 1MJUL 1F4YL 1NCUA 1BD2D 4RFOL 2XNAB 2A77H 3V0VA 4TTDD 3C2AL 1FNGA 3L7FA 5DRXB 1K2DB 5ALCH 5C0BA 3NACL 2BSTB 1D6EB 4XVSH 5F7LB 3G08A 5IMOA 4HKBA 2VN4A 5GRZA 2ID5A 1BX2A 4NC2B 3WHXB 1Z0MA 3NBNA 4WTWA 3VFNB 3UPRB 3PWJA 3W81A 4CVXB 4HG4K 4G42B 1G0YR 5JDSB 1RJZB 3GI8H 4QYOB 3C6SA 1J11A 5DURB 5GJTH 3HC4H 3KHQA 4M48L 1QLFA 3A6BH 4M5ZL 3I6KA 2FIKB 1N5AB 2H3NB 4XAKE 5EU7E 5GS2D 2IANB 4RAUA 3O41B 4PJHF 3VH8G 1K9TA 2CJUL 3MRDA 4LSDA 5CS7A 5IW6A 1XGPA 1U92B 1G9NL 3AREA 4KRPB 5ANMB 5EOCL 4HXBL 4M3KB 5DDHB 4ZUSA 3VD3A 4APQB 2ERJB 3VGAB 3B43A 1G6RA 1F4AA 2IBGA 5H94A 3MV8E 1BIIA 1A4KA 1HXYA 2NX5E 2EXYC 4YDKH 1AP2B 1WTLA 3BDYH 1WFUA 4KVCH 5F6IB 1UCBL 4PJ8D 2R4SL 4LVEA 2CXKA 3LV3B 3BGAA 3U2SB 1ONQB 2APXA 4YQXL 4XP9H 5IG7B 4MXVE 1ITBB 2R2HB 4O5LL 1NGXA 2L0DA 2VXSH 3BP5B 2NPLX 5D6CA 2EEBA 4MQXC 4PRAA 4XZUB 1NUGA 4PIRF 3KYNA 4KGLA 1CS6A 2DD8L 4ZPVA 1KJ2A 2BNQD 5EUOB 2VSDA 2BSRA 4HT1H 2V2XB 3ZKQD 3PWVB 3ZHKA 5FXCH 5KSBA 4XPAH 2R1XB 3LRGA 4J1UB 4N0FB 1NDGA 4UU9B 4L3EB 3V6OC 1KB5B 4P3CH 3RI5K 5IEKA 5AG8A 1FH5L 3MCKA 3LMJL 4TUJA 3K8LA 4CRPA 1CICB 4JY5H 2KZ1B 3BKCL 1A6AA 5MHSE 5FO9A 5EPMB 3BPOB 5F6HI 3N9GL 1KTDA 3TN0D 5JZ7C 4KJPD 5D2NC 3ZKMC 3HPLA 3O45A 5T1MB 3LKOB 1JF1B 2OZ4H 4GBXB 3H9SA 3B2UD 4XVUC 3DVNB 4HJJL 3F7YB 3HKFA 5KANI 2AQ3A 3PIQB 5DK0B 1EK3A 3CVHA 2DLIA 4PJAA 1I8LA 3OXSA 1NFIA 5F9JB 4IIQA 3C2AH 5EB9A 4OGZA 5LGJA 3NACH 1KELL 1BREA 3MV7A 3BZFB 1SJVA 2BSSB 1Q72L 4CJ1A 2RGSA 1LEKA 3QFJA 5B8CA 1VFAB 1XCQA 3F8UB 1AR2A 5FGCE 3RJQB 4DN4L 2XA8L 3U4EA 1A7RH 1ZT1A 2Z4QB 1AGFA 2IANE 1QYGL 3FONA 3VFSB 3I6GB 1IAII 4ZS6C 4M48H 3RIAF 5E99L 4HJ0C 5IGXL 3PV6A 5ANME 4U1HB 2IBBA 5DEGB 5J6HA 2QSVA 2BOCA 3TA3C 2JJTC 2HJFB 5L7XL 1G9NH 3WJLC 5EOCH 5CBEB 3OR6A 4HJGB 2OJZL 4E41A 4XWGL 3FB8A 5INDA 5C0ND 4Q9CA 5EU7C 1QFWM 5K9OB 1UYWL 2VDML 1FSKB 3G5VB 5E8EA 2YD9A 5IT2L 4G43A 2AEPH 4QRTB 1XF3B 1GZPB 1BFOB 3EFFB 1YQVH 4MAUL 4OUUA 4M93C 3LHPH 3QQ3A 3E6FA 3P0YH 3LKNB 4OD3L 3BPNC 4OZHE 5I17B 3INUL 1YPZE 3O2VH 4O5LH 3MYZA 4YC2B 1N2RA 2BMKA 1C5BH 3TYFA 2EYSA 2Q3AA 3KGRA 2Q76A 4EDWL 1GZQA 5EUOE 4W6YB 2NYYD 4OLYL 5E2UL 2DIJA 4YFLI 2DD8H 4P4RA 3QUXB 3EOTL 3V7AG 2NQCA 1QHPA 3DRTB 3QAZB 2NNAA 2ZOLA 1N6UA 3EO9L 3NIGF 1DQMH 3QA3A 3NFPA 4OIBA 1KULA 1DQJB 3IDGB 4ETQB 1MVUA 4P9HL 4F33A 2NMSA 1FH5H 1B2WL 5EN2B 1D9KC 3VW3L 2Y72A 3ZKXC 1GIGL 4Z77A 1KTLB 3C60D 2HFFB 4LCWB 2I5YL 2ENYA 3OKLB 2GK0A 4NBXB 2PYFA 4R0LA 3GMQB 1YEIL 4V1DB 3S4SB 4R90H 2D03L 1Y0LA 4LKXB 1J8HE 3VFWB 3I50L 1E4JA 4CN6A 4PRPA 3SGJA 3D0LA 1KNOB 2IQAA 1U93A 3WIIH 3JTTB 1RQ5A 4QHLA 2XPGB 4Q2ZB 1YEFH 2QSQA 4PJFF 3MV11 4I4WA 3WFEL 4ACPA 2J8UE 2O5XL 1DTUA 4EQ3A 2GCYA 5F88A 1ZGLP 4KMTL 2WBKA 4TSCH 2G60H 3MRPB 1NL0L 2G5BA 4WO4B 4YO0A 1M71A 4KRLB 2VSCA 4YXKL 3QO1B 4YNYA 3S37X 3C8HA 4N1HB 1QYGH 4YHZL 4C56A 3QIUA 1BLNA 4W70A 4OI7A 5TDOB 1XCTA 4CADB 4G6KH 2YA0A 3DUSA 4XBEL 2FLRT 1K5NA 3WKMH 2I60L 4ZQKA 2OBGA 5ILTL 2CKBL 1H3GA 3VFGH 1NCNA 4HUKB 4LHUB 1FCGA 2VLLB 3HCVB 5FKPB 3O6FA 4PRPD 4KRPC 5IVNA 2FCBA 4G8GE 4NM4L 4WUKL 3S5LG 2HLAA 2X4RA 1CDUA 1LE9A 4X6EB 2OMBA 5KSVA 4APQC 3LKRA 3T04D 5CCKL 2ERJC 3VGAC 1LO5B 3MRJB 5C8JA 1MREL 4CVZB 3L3GB 4KKCD 4JN2B 4OD3H 3TBSA 5KSBF 5I1GL 5J11B 1MHHA 2CDEA 2EYTB 5F6IC 1A3LH 4YX2H 3RX7A 5F7HA 1ZLUK 4PY7A 1EFXB 4NQDA 5JNYA 3HNVH 4L4TA 3QI9B 4NQSB 1P1ZB 4OLYH 1OAUL 4N0CC 3NCFB 1IGIH 2CRZA 3G6AA 5D7JB 1F3RB 5DUBB 5FB8B 5DMKB 2A73A 5GGRY 4C56D 1RIHH 1HILB 3QIUD 2H26A 1ZLUH 3PWPA 1LNUA 3KYAA 1U2HA 1HN1A 3SCMD 4JQVC 4S10A 5H8DA 3QCTH 4GXUN 1B2WH 1NC4B 4LCWE 4LCIH 4Y89A 3VE0B 5DI8A 1J10A 4JY6A 2IALA 2AKRA 4JCMA 2H2PD 3V52L 1HZHH 4P4KB 5IJKA 3WLWD 35C8L 2IBZY 5D2LB 3WEXA 3O6FD 2RCSH 5LBSL 2DB8A 3BDBA 1EHLH 2GW5A 3L3OA 5IMKA 1JPST 5CEYB 1CICC 2X4PA 1NAKL 5EFIB 1I8MB 3BEWA 4P5KA 4LNRA 4JKMA 2LABA 3LY6A 2OTUB 4KHXL 4Q6IA 4GSDH 2D7PA 4RQQB 4GBXC 2A6KA 4MXQD 3O3AB 3BH8A 1FO0L 1T89A 2O5XH 4P3DB 3ULSB 4PRBA 4L4TD 4QRPD 4PJEA 4KMTH 4YDVA 1RZGB 4K8RL 5ITFA 5DC4B 3L5WB 3JTSB 3BUYB 1PDKA 1ZA6A 1KF9B 4PUBH 1D7FA 5I0DA 4K7PY 3K4DA 2BHZA 5CILH 5B3NA 3MFGB 2VLME 1OM3H 1IAOA 3WS6A 1JGUL 2FATH 2DJUA 3GSUB 1CDJA 3M45A 5HI4C 2UWEE 1U8MA 4FQXA 4G9FB 4LBEA 3W0WB 3O81A 4ESKA 5I2IB 4XBEH 3B9DA 4JFDD 4MS8C 1JHKH 5DK2A 2BRRL 4NHUA 1BJ8A 5E1AB 5C0EB 2YD7A 5ILTH 4XAWL 2AW2A 4KK6D 5I75B 4QT5B 1HSAA 2R23A 3OKOB 5CSGA 1P5UA 4QHKI 1A3RL 3B9AA 3LQAL 5EH1A 4NM4H 4BFGA 3D1MC 2N56A 4HC1A 5JQ6H 1SBSH 3LB6D 1F4XL 2EDLA 3HHRB 4LLAA 4Z7VB 1MAML 1MREH 1FSKC 3SE8H 5ADOH 2O61B 1BBDL 5CJXA 1CU4H 5I1GH 5D5ME 1A6WH 1MLCA 2W92A 4NKMB 5DVLA 1I9RH 3C5ZD 4MA3B 5HY9A 1I8KA 1OAUH 1BEYL 4JGUA 4YC2C 4ZD3L 3K4AA 1NFDB 3GBLA 3Q6FB 1RUML 2XTLA 2HKFL 3SO5A 2PTVA 2L7JA 1TIUA 5FGSA 2R39A 4D0CA 3GSNA 1D5BA 3UDWA 2Y23A 4Y5VB 2QHRH 3QUXC 1NEZB 1QFWI 1N5YH 4U49A 3QAZC 4KI5E 1VGKA 3FRUA 2D9CA 3BP7A 3S3SA 4P23C 3L1OL 3VFTB 2CKNA 4O2FB 3P9LB 3BJLA 1VEOA 1W0VB 3TESA 5LBSH 4WRLA 4HUVA 1I8IA 3D2UA 3WNKA 2A6DA 2OCFD 1NAKH 1WFNA 1A7OH 1ZLVK 5KANG 2P48B 4HIEA 4ZSOA 1T7ZA 1I1AA 4KHXH 4Y1AB 5CZKA 3D25B 3DWTA 4BSWA 2QV2A 1QSEE 3M8OL 1DQLH 5LKNA 1CLZL 1HNGA 1PX4A 1ZLVH 3VI4F 4HW6A 5JLZB 4OV5A 1AFVL 3V9FA 1HOCA 4DKEH 2VERN 2Z31D 1G9NC 1J0HA 4M6OL 5CSBA 2IGFL 2GJ6A 3FO1B 4KK9D 1OAQH 4IEFB 4IRSB 5GGTL 3MRRA 1DE4B 2FZ3A 3G6DL 4JE4B 5JIIA 1N8ZB 3UMTA 5B3JE 4IRJA 1YUHA 2L7UA 2I07A 3LN5A 4WO4C 4ZPTA 1PGRB 2V2WA 1DLFH 1EAPB 1ZANH 1DBKH 1LEIA 5I18H 1FVDB 2DQTL 3A6CL 4WWKA 4LQ1A 1U3YA 2BRRH 2FYYA 2DLHA 1FN4B 2G75A 2O5ZL 5C0CB 1I7TB 1FGNH 1T04A 4XAWH 1NCCH 2I9LA 3HC3L 1T1XB 1HNFA 1RUQH 4UUJA 3CH1B 4OQ1A 5E8NA 3V4PL 3D2UD 3TYGH 4EVNB 3VFRA 3QQ9C 5C08B 3N1FC 1A3RH 3THMH 5EDXA 5JXAH 3IF1A 4LLMB 1I1AD 3O2DA 1DBJH 1JGEA 3FFDA 1F4XH 5EOTA 4PG9A 2J6EA 5T1KB 5A2JH 4LRIC 5E7BA 2B0SH 3CC5B 3I9GH 3KR3H 2LAGB 2BNRD 5F7MC 3P2TA 4L8CB 1ND0B 1RZFL 4UT6L 2QQKL 3VGFA 1JTOA 1IGYB 2VC2L 2VDKL 3WJJA 2AXHA 1NFDE 2CK2A 5F89A 3EYVB 4FQIH 1KTKE 4LPUA 5BXFB 1BEYH 1SM3L 4KRNA 4X0KB 5A16A 3KPLA 2DI8A 3NCCB 4I0PB 4N5UA 4C57C 5J11C 1FZMB 4IRJD 2YPLB 4FS0A 1EJOH 4X9HA 1MCFA 3W5MA 3KWWB 2IPKA 2X7LA 4KQ3L 4WW2A 3TWCL 1AGCA 3QI9C 2V7NB 1SBBA 5IB1A 1K3ZA 1HCFX 2OS7A 3NIDF 4AENA 4B50A 5D7JC 3IETA 4WWKD 1G7IA 2YN5A 4XP4H 2Q8BH 3CK0L 3CFBA 4QXGL 1IGFH 4NN7B 1X5ZA 4IOIB 5KBNC 2D7TL 4Y5YB 4EIZC 4GRWE 5TF1L 1FFQA 2X89A 2YK1L 1NBVL 4RFNB 3SDCA 5HGAB 4UAOB 5HYJE 2VDOL 1NCAL 4KI5C 3U1SL 4P4KC 5JA9A 3B5TA 2LU7A 3NA9L 5DT1L 3MOBL 3HNTL 1X7QA 4CMHB 1D5ZA 1ZEAL 3EFDH 3L3JB 2F15A 4H0HB 3GSQB 4WEUD 2I9TB 2EH8L 1F97A 2C5DC 2ED8A 2AP2A 2VN7A 5J1AB 1CLZH 1INQB 4YFEA 1ZHLA 1AFVH 1CFSA 1LEGA 4FOMA 4IS6B 43CAB 2JJVA 5DD0L 3BYYA 5E9DA 5I76B 1KENH 3MRLA 4EI6A 1LP9A 5E5RB 5D9SA 3H42H 4FFYH 3IJYB 3MFFB 1QRNB 3OL2A 2FO4A 1Q9WA 1X6LA 2PYEE 1Y18A 4NFDA 2LTQB 4YHMH 1T20A 1V7ML 4X4MA 4I3RH 2BVYA 2DQHL 1AJ7L 1DBMH 5C0CE 1MCNA 4QXUH 2GUOB 2PETA 4WTZA 3T0XA 4WDIA 5L8JB 1H0DB 3RGVB 4YIQA 2X89D 2ZOKB 3EW3B 4G80B 5E8OB 3B4NA 2W59A 1DEDA 3QEQA 2P8MA 1IQDA 2EDJA 3KPMB 5E95B 2EEAA 2VO5A 4WI3A 5I75C 1T7WA 1ZHBB 1SVCP 5I8EA 4OJFH 2AJSL 1FGVH 1UXWA 2DLFL 4U1LA 3HE6B 3T65B 4QHNA 3QWRD 1L7IL 4NC1E 2ICES 4G8FA 4OD1L 4UINH 3IJHB 4UT6H 4Z0XB 4JRYE 3DRQB 2VC2H 2VDKH 2F74A 4S1RH 5F7DB 4K94L 3RP1A 1S7TA 1IT9H 1SM3H 5B4MC 1JZ4A 5M95B 4U31A 1A14L 3S34H 1FL5A 3GSWA 32C2A 3PP4L 2UUDK 3VD9A 4YAQA 4PRHA 3DMMB 3DO3A 2XWJB 1QFHA 3B8SA 3OB8A 5HVGB 3VRJA 3W2DL 4TPRL 3E8UH 3F58H 5BZDB 5GSVA 3EYQD 4Q6YA 3CK0H 4Y5VC 4AY0A 4GG6A 1YY9D 1NGPL 3U6RA 4PLKD 3QEQD 1PG7L 3VFOA 1QEWA 2YK1H 1UVQB 4MNQB 3LN9A 2VDOH 1ZHNB 1MWAA 2VE6A 1NCAH 4QGYA 3O11A 3RWIA 1KIPA 3WUWB 3NA9H 1HDMA 3PWLB 5ESVA 2VR9A 1K8DB 3Q48A 2BNUA 5ACLA 2YOCA 1EHAA 3NIFE 3RDTD 1B9ZA 3BN9D 4YHPB 1F2QA 1G7JB 3I02A 4MGXA 3TV3H 3CXHJ 2EH8H 4HKJA 1I3UA 4Y88A 1U58A 3MLWL 1C5DB 5C6TL 3RU8L 1U8IA 1IKNC 3EO1A 5A1AA 4D9LL 2VB5A 3S97C 3BUTA 3GKWL 1JCKA 3OSKA 3MR9B 4P2YA 4JM2B 1T22B 2X4UA 3RTQB 4L5FL 3STBA 25C8H 5EC2A 1JRHL 1R3IH 1JMZA 1FFNA 4GAGL 4OI9A 1ZWIB 4IRSC 2D0GA 1A1NA 5FYKD 5B38B 5LJYH 1IAKA 3S96A 1G1YA 3A67L 5F6HJ 2ICWB 5D1XC 1TPXB 4ZOBA 5D7IB 3SDAB 2NW2B 2R0LH 1EMTH 1KN4L 1ZK9A 3U0WL 5IB2B 1RZ8B 5CWSA 4KUZL 2P42B 3NA4A 3QIBD 3JWOL 5DTFB 3FOLA 4NRZA 3ARUA 3BPCB 1PD6A 3QDGD 4FFVC 1DN2A 3GHEL 4OF6A 2R2BB 5F3HA 3GMPA 1MCEA 2AJSH 5M94B 3VMPA 4HHAA 2GEEA 3FFCE 2RFXB 4X80L 2DLFH 1J5OL 3C6LA 4J3WA 4WW2F 1T03L 1HINL 1GGUA 3RKPA 3QZWG 3S7GA 4JHBA 3PQYB 3VFMB 3VWKB 2ICCA 4JFYB 3S8WA 3OXRA 4LPXA 4XC3H 3TPUB 4Z7UB 4PJXA 4F7PA 1CT8B 1TZGL 5EBWA 1RURH 4NC1C 3FZUD 4UDUA 2W0PA 2V9RA 3T8XB 3WD5H 2ZCKH 1HHGB 1EXUB 5DC0A 4ODWA 4LKCA 2EDFA 4I0PC 4HX1B 4B41A 4DCQB 2CIKA 5HHQB 2RIKA 3RKDD 3MRBA 1U8OA 4NRXB 4LAQH 5FM8A 2UYLA 1F5WA 3UEZA 4MD4B 4XB8A 1UJ3B 3BT2L 5HYQB 4XT1C 4WU7A 4JKLA 1PG7H 3FMGH 4O2EA 4OZFH 4PREA 4RWYL 3QEHA 1R24A 3IDYB 4N0YL 4OLZH 4WHCA 2FEEL 3RGHA 4JZOB 5JO5B 3S5LA 2DWDB 4NN7C 1WK0A 3FQUA 1QOKA 3JV6A 4JY4B 4K3EL 4KH2A 3H9YA 4Y5YC 3SKMB 2E7LC 1C8PA 3I3BA 1BZQK 3O4LB 1LP9F 3G6JA 3WNNA 4RFNC 1D5MB 3C6LD 4FZEL 4UAOC 3LD8B 2IH3B 4XMPL 4Z6AT 1CTOA 4CMHC 2JJWA 1PKOA 1V7NH 3RU8H 2H8PA 4GKNB 5FGBC 3CNKA 2DQEH 4D9LH 4PGEA 5I71B 3BKML 4PJ9A 2ED9A 4HZLA 4AM0B 1BJMA 4NO2B 3WXWL 3CFDB 1YDPA 2HH0L 3C8KB 4FQ1L 4NZRH 4RGMB 3MXWH 1XGQB 2AV7B 2MPAH 4GRLA 4KKAC 5GQBA 3PL6B 2ZUTA 4NM8H 2NY6D 4GAGH 4UV4L 4UTAL 5DZOA 1PZUB 3OB0K 4LCUA 4EDXA 1T3FB 3OPZL 3U7WL 2LQRA 4L4VE 3UTZB 5D7IE 3QWQB 5FDWA 2AVGA 2LTQC 3DXAA 4FA8A 2Q86A 2CMRH 1RFDL 2F53D 1RVFH 1F6AA 1DQDL 4PRNB 3TO2A 3H3BC 4AT6A 3JWOH 1R6VA 4WFFE 4Y4FB 3MO1A 2IPUK 1IGMH 4F9PC 1OP5H 3RGVC 3K74B 3GHEH 2CGRL 1JJUA 3OV6A 3WIHA 2EXYD 2BZDA 1KIQA 1CLCA 3CMOL 1U41A 4LCCA 4G8IA 4M5YL 5AEAA 4F7EA 4UQ3A 3VXMA 3NZHL 4G5ZH 2X44D 2EC8A 4OZFB 5I66A 1WWCA 4XPTL 2QL1A 4NNPL 3V6ZB 1WV7T 4PJGE 4K23L 3ZTJG 4LASL 2QR0B 1JYVA 1DDHB 1J05A 5DUML 3VXOA 3MJ7B 3QDJB 2OSLA 1F42A 1S7XB 1OOAA 1E6JL 4QY8B 2VABB 2XN9D 4WEBL 3VXRB 2XQBL 5ECJE 1KG0A 1IL1B 3DMMC 2NZIA 4NQCB 3LKPA 4OQTA 2GT9A 1YY8A 2F58H 4N0YH 4XP5H 5T3XD 3L3DB 4JFXB 3RPKA 4Y2OA 2EIZB 3ZKMD 3SDXE 3ZDYE 3SBWA 3FT4A 2APWA 5DJZA 4XVUD 1NMAL 1LK2B 4ZFOB 4X5WB 1T2JA 1SYSA 4PTUB 2V2TB 1UQSB 1P4BL 5HPMB 4J8RB 2OTWA 1EV2E 3VXMD 3O8XB 1KJVA 3CDFA 4R26L 1BAFH 4UT9H 1WCBA 3HUJA 3WFBH 4V2CB 6FABL 3RVXC 2OL3A 3GK8H 3EGSA 1AD9A 4QTIL 2IFGA 3KPRE 1Z3GL 3BKMH 3FO9B 4GLRI 3OKNB 4LQFL 3RNQA 4AH2A 3L9RA 4YR6B 5FCUH 4ONHA 4H25A 4BZ2L 2W0KA 2R29L 4LAJH 4UV4H 4UTAH 4JM2C 4ZS6D 5ADPH 3TM6A 1YN7B 4H5SB 1IM9B 2J7LA 1S7VB 1T21A 3LEYL 3IRZA 4YDIL 5DJYB 3U82B 3W9DA 4KKLC 3H9HA 4JKPH 4CNIB 3DO7B 3B3IA 4YEEA 1ZA3A 2FO1A 2OMNA 3STZB 2ATKA 3LPGA 3LZFL 2XICA 1VACB 1A9EB 2HVKB 5C09A 4X99A 1TPXC 3SDAC 2CGRH 1XGYL 1WZKA 1ZT4B 4PJXF 2HG5B 4HIJB 2R9HC 4UIKL 1OSZA 3GSXA 2B20A 3ES6B 2VQ1A 3BE1H 1YJDL 4XXCC 3CUPB 1WJ3A 4MXWH 4ODBD 5HVFB 2V5MA 2C1OA 3C5SB 3PHQA 3I3EA 1N6VA 1GC1L 4DJMA 1T1WB 2CIIA 3VWKC 3UCRA 1K2DA 2AABH 1R5WA 3NFSH 3MOQA 4L9LA 4U6YA 3SE3A 3HNSH 1OCWH 4NQCE 4A6YA 1U8JA 5EG6C 3VFVB 2AXFB 3G6JF 4NQEE 5TDNB 1D9KD 3HZVA 1GJIA 3DOSA 4MNGA 5E70A 5EIIA 4ODSL 4ERSL 2DQDL 4PJCA 3DX8A 5CMAB 4RDQF 3V5KB 5JPMA 3WV0A 1RZJH 4QHKJ 5K9JH 3GDBA 3VXUA 4QF1B 1RPQA 2A83A 3P77B 1UJ3C 1JBJA 2AK4E 5D7LB 1SY6A 3TZVB 5DRZB 3IDYC 3T4YB 2ESVA 3FCTB 3HPJB 4JRWA 3F5WB 3UTSB 4Z7QF 1JK8A 4FQ2H 5FIEA 1XF5A 2E27L 4WJ5A 1P7KB 4E5XA 4O2CA 3ISWA 5D1QB 3LD8C 1AGDB 3KYOB 1AP2A 4JDTL 4YHIB 4ZOAA 3RVUD 3GJFA 1DL7L 4NYLA 1FFPB 2P5WE 1MPAL 4LLWA 4LQFH 4LSSL 5D7KE 4PLJC 1YYML 2IADA 2FX8L 5HGHB 3LV3A 4XPFL 4RMTA 2V17L 4BZ2H 1F90L 3LN4A 3VA2C 1WBXA 1S9WA 1IAMA 2R29H 5I71C 5HHOB 1QR1A 3GHBL 3T3MF 3JZ7A 2FB4H 4DK3A 4HBCH 2NY1B 1CDHA 4EBQH 4JKWA 2EDEA 4RGMC 1MCWW 2VOTA 3PL6C 4ZTPL 5DURD 4ZNEE 3RWFA 1CXIA 3VXUD 3LPWA 5E94B 2NY4D 2J88H 3MUGB 4GRMB 1CTNA 3WIFB 4N8CH 2CXGA 3O0RH 4LSTL 3R06B 5FUCC 3NTCH 1F11B 3DJ9A 1E0OB 4CU8A 1B0GA 2YWYA 4KRPD 3X11A 1OF2A 1JZ6A 1XGYH 4ZAKA 3KPSB 5CJBA 3D39B 4M3JA 4JFEA 4Y4FC 4APQD 1VA9A 3RY6C 3EYUL 5HDQH 3IAGC 1R3HB 2VTFA 1JGVL 3NH7L 4OZIE 3EOAA 4X6CE 3LKOA 5FYLD 4PBWD 1MIEL 4UIMB 1LO2L 1X5AA 3ULUF 2YRPA 1X5XA 5DHYB 4NNXB 5DZNA 5DK0A 4N0CD 4P2CG 5BMFH 1H3TA 3TCLB 4JZNB 3BQUA 4WUUB 2VLKB 5HHXL 3P0VH 4C55A 3MRMB 4ZODA 2A9ML 5KJRL 4HFWB 4DFHA 3FQNA 4L3CA 1VFAA 3Q6GH 1C16A 4KZEL 5DD5L 4U6HA 1IEBA 3RL1A 4IDJL 3B9EA 3KPOA 2EDTA 3ULVL 4L3ED 1KT2B 1CK0L 3WLBB 1RMFL 1FL6A 3HUJF 3TH3T 4S1QL 4RMSA 2VITA 5ISZB 1CICD 3RL2B 3GFUA 4NDMB 3SPVA 3DECA 1S8DB 1VKXA 4HJGA 3FT3B 4FZ8L 1BBJA 2E27H 4XNXL 3QUMB 5D1ZB 5EO0A 2XY1A 3IKCA 3FAWA 4PP2A 3C5JA 4PB0H 5HI5D 4EOWL 3ALPA 4A2LA 4DAGL 1MEXH 3BWUC 4JDTH 4DGYL 1JWMA 1U6AL 3O8XC 1DL7H 3T2NH 5IHLB 3GO1L 4HPYL 1UT9A 2J3SA 3RUGA 3WSQL 4Z78B 1XEDA 3O3DB 1E4XH 1ADQH 4U05A 5F1IA 5I0ZA 1BOGA 4Z76B 5HHOE 3CSBA 3BQUD 3SKNB 1N4XL 3WXVH 5C0AA 4XI5D 1CFBA 4P5TA 3JWOC 2R0KL 4OGYH 5L8LB 2P8PB 1YECL 1QACA 2MKLC 1ZLWH 5BS0B 2VJXA 4JDVB 4M6NL 3GGWB 2VLRA 1EEZB 5BZWB 1U3JA 1HKLH 1KLGB 1A5FL 2ADFH 2A1WL 5AUMB 4DKAA 2EDOA 5GJSL 3IDJB 4AL8L 4U1MA 2MFNA 4F2MB 2AQ2A 2EO1A 3FJTA 3MA7A 4JHWL 4LGPB 5J7CC 3KPSE 1B4JL 4G8EA 2HT4C 2P47B 5IKCB 4XWOC 1HSBB 1UWGL 3TNNB 4GO6B 2AJ3B 1MCLA 5DJXB 2VIRB 4EIGB 5C0JA 4LMQE 2LVCA 1DBBH 3EZ8A 3UX9B 5CD3B 1EBAA 3NH7H 4CVWA 4FQQB 3S4SA 4JVUA 5A2KH 3EOBA 4YHNB 3GRWL 4NFCA 4X7SL 3LEXB 4OCYL 4DFIA 4WUUE 3MREA 3BO8B 1GSMA 4B7LA 4P5TD 1JPGA 1WIOA 4PJCF 4YBQC 1A64A 3TH2T 1J9CT 4BJLA 1JGLL 2ADIA 2ZSWB 5E2TH 3BIKB 1PLGH 4JPWL 4JFFB 4NQUA 4ALAL 4KWUA 3L95A 4K9EL 3UPAA 5KJRH 2K7PA 1NC2A 3ARVA 1PYWB 4HH8A 5CJOL 1KPVB 1IE5A 1QKZL 5DEZA 3X3FH 4YHOL 4FFZL 3QNXA 1B0RA 3ARRA 2WWMC 1HHKA 5IHBA 1RJLB 3HB3C 1RMFH 1JN6B 1AXSA 1WITA 4O51A 4S1QH 4YFLF 3WYRA 4PJHB 5FYJH 4KKBD 5CAYB 4QRSB 3LCYA 5JA8B 4PLNC 1NCWH 4P2RA 1MI5B 3MLRH 5F97E 5EZIL 1EAJA 4V1DD 3QZWA 4XNXH 1U8QA 4LVHB 4DQOL 3TZVC 4HF5L 5SWQA 1X5YA 5FA4B 1A1MA 1MFNA 4CW1B 3ZT7A 2XOTA 1NDMA 1U6AH 2APBA 4P46B 3GO1H 3MGTA 1XIWB 1Z9OA 1EUTA 5C07B 2MQCA 5D1QC 3KLAA 4U1JB 1UKSA 4JFHD 5BS0E 4CMMA 3GI9L 2GY5A 1N4XH 4KY1L 3BD4A 1AHWB 2NY7H 3BHBA 1R5IA 2XKNA 1YECH 1OD9A 43C9A 4EI5A 4NNYB 5FUOH 5EORH 1CFVH 2CR3A 4P99A 4ELMA 1P1ZA 5KG9B 4GKSB 2FL5B 4AEEA 4OF3A 3LEVL 4GH7B 2NY1C 3DX6B 4L1HA 4XVTH 1LE5A 4FXLA 4AL8H 3RVTC 1HI6B 1S7UA 3HC0B 4LK4A 4JHWH 1J1OL 1CXHA 1ACYH 3H6JA 1KJ2L 3QQ9D 1A1OB 4BELD 2DQUL 4JN1H 3STLA 1F45A 1K4CB 2AJVL 1JE6A 3HG1B 4LHUD 2YXFA 4EEEA 4OLWL 5IB4B 1MLBA 2X4NB 3FQWB 1N6QL 3ETBF 1R3JA 3QHZL 1I1FB 3BFOA 3VU2A 3W9EB 3ZYIA 5E8PB 3ZE0E 3QFDA 2HMIC 3GRWH 4AEHL 4MJ2A 1OAZL 4HWBA 4N90D 3SJVA 4DTGL 1JUFB 5I1JL 4NZTL 2C4FT 4WI2A 4TSAH 4NPYA 5HHMB 2OTUA 5MEPB 1FNEA 4JPKH 1CBVH 1RZJC 3GMLB 4GAYA 2HJKB 1EFXD 1U8LB 1HHHA 2MQ3A 5ESQA 3QWOB 2JB5H 3HLAB 1G0DA 3SO3B 2APTA 5TE4L 3PGCA 4C83A 3SDYL 5EO1B 1AGBA 1M05B 3V7MA 5JPNA 1OAYH 1TVBA 4FFZH 1I3RB 1JV5B 3ARGB 4X7DC 2BVQA 3MMEA 1P7QA 1MJJA 3C09B 1YEEL 5DJ6A 3S35L 3UYPA 4M62L 4NKDB 3DX9A 1EGJL 4MB3A 4U1NA 3ZL4H 2QADD 2WP3O 4HCRA 3RUGF 4P4KD 3SQBA 1QSVA 5EZIH 4LRNL 2WUBL 5EBGA 3SKJH 2FBJL 4QT5A 4LPCA 5KSAB 3OKOA 3OR7A 4HF5H 5F7EL 5TDPB 1WT5A 1J12A 1M4KA 1UKQA 2UZIL 5KOMC 3MLSL 1OGTA 5GGUA 2A74A 3SJVD 4Q9RH 4EUPA 2GITA 2CK0L 2BX5A 5D1ZC 4U6TA 1TNMA 2VDPL 3K0WA 1E6OL 1G6RH 2YC1B 1AQDA 1F6FB 5F9WB 2C3HA 5DYOA 4O4YL 3QNYB 3CVIL 2XZCL 4M7KH 4PJDA 2R8SH 2Y7QA 2UY6A 2YD5A 4GMTH 3MLXH 3GIZL 4K71B 3PXHA 1U3HA 5DJCA 5I1KH 5DHXB 3EDJA 4R4BA 2QKIB 3RZCA 3HZMA 4M4PA 1LO3L 2JIXB 4U33A 4P2QA 4POUB 3DGCR 4G9FD 4D9RD 3W0WD 1LWRA 3U46B 3QJFB 1H15A 3JWNC 5KVMC 1KJ2H 1YMMB 2B39A 1CZ8L 3TEUA 4Y19E 2AJZA 3BZDA 2YUXA 5BJTB 3NPZB 2AJVH 4AEIL 3QPXH 5C71A 5L2KB 1PKQE 4JRXA 3VRIA 3VGEA 4MLSA 4O2FA 3ULVE 1IKFL 3P9LA 5F1SA 3U0PA 4DVBA 5F7UA 5I1EL 1N6QH 3CXDH 3V0VB 1FNGB 1W8NA 3L7FB 3QHZH 1RUKH 4RZCA 5C0BB 3ZDZF 3QUZA 5HHME 1CL7H 2KQNA 5FYJE 5IMOB 3G08B 4HKBB 1TETL 4ZO8A 4JO3L 1BX2B 4DTGH 3PWJB 1A4JA 1BVLA 1WBZB 5B4MD 1SEQL 4KKNA 2MKWA 3C6SB 4FTVE 1YN6A 4HXAL 2LVEA 3H3PL 4ZUVA 1OGAA 1QLFB 2UZXB 3I6KB 1EVTC 4RAUB 1U3HD 1UJTA 4X7EC 3CVHH 1PZ5A 3M17A 3MLUH 3RZCD 2X4QA 3MRDB 3IU4H 4U7KA 3DVGA 4G6FB 1A7BA 1XGPB 4TRPH 3AREB 4TULL 3SDYH 4HAGA 4P2QD 1DE4A 3BMVA 4WCYL 4ZUSB 3P73A 1OB1B 1G6RB 3QJHA 2EKJA 1FLRL 1BIIB 3WDIA 1A4KB 1N0XH 3A6OA 1HXYB 3S3JA 3JWDL 1EGJH 2PN5A 3GM0A 5D6DA 1C08A 2DQCL 3BW9A 5JW4M 3MXVL 3VD7A 1I1CA 3VMOA 2OYPA 2W07A 1NBYA 5KW9L 4Z7NF 1R3LA 5B39G 1P4IL 4XC1H 1OP3K 1BD2E 3P9MA 5GS0D 1OWWA 3QUZD 1NGXB 5F7EH 1JTTA 1J86A 1RHHA 3MLSH 5D6CB 5CBAA 3L3IA 1VERA 3DYOA 4HS6A 4ELMF 1FIEA 1GAFH 4AIOA 4PRAB 1IQWL 5CGTA 4LVHC 3KYNB 4Y1AD 1QSFA 1FC2D 1INEH 2VDPH 2BSRB 2P5EA 3GMRA 1AO7A 3U9PH 3TBYA 1OGAD 5KSBB 3FN3A 1NDGB 4P46C 1XIWC 4LDOB 5A43C 1IGYA 5IEKB 4GAJH 3W5NA 1EO5A 3MCKB 2XIDA 1MF2H 4IRSD 4XCNA 3L5JA 4TUJB 5T1DH 4HMDA 1BMGA 1A6AB 1DFBL 5FO9B 4HFUL 1KTDB 5D2LF 3HPLB 5E2WL 3O45B 3AY4C 4LSVL 4KZDL 3H9SB 2X9YA 4QCIA 2QSCL 3CU7A 1KBGL 1AIFA 2J4WH 5DLMH 3JV0A 3VGDA 4YEFA 3CFCH 4IOFD 5I1CH 3CVHB 3KG5A 4PJAB 2RQ8A 1JP5A 5C08D 1NFIB 5D72L 5I1EH 4IIQB 2GAZA 4QEGA 2F54A 1JWUB 4F37F 3ZZ1A 4B0MM 3MV7B 4ZFGL 1OT2A 2DDQL 2Y06H 1VESA 1LEKB 3QFJB 4LPVA 2P5ED 2BNQE 4IMKC 5B8CB 1XCQB 3KYKL 5DVKA 3F65A 4PJFE 3U4EB 3O2WL 3OGOE 1SJEA 5IK3A 1ZT1B 1FAIL 1AGFB 4TUKL 3FONB 4RAHA 5F8RC 4HXAH 5D4QA 4M7LL 4MZ2A 3PV6B 3P4OA 5J6HB 4I0PD 1HWHB 7CGTA 2YPLD 4HLZG 2VZSA 4TULH 1V3JA 1CXEA 5DUPH 3OR6B 4WCYH 2N1KA 3AS3A 1G7QA 4RSVA 4E41B 1G7PA 1HXMA 3MJ8A 3UZVB 1JYXA 1LD9A 3FB8B 3SO3C 2LAAA 1M7IA 3D3VA 3UO1H 5INDB 4N1CA 2YS4A 5DQDH 5E4IA 3TJEL 5E8EB 4JFQA 1FNSL 4G43B 2PCPA 3ARGC 2GUOA 3T0DA 1I9JH 3EJZD 4OUUB 4HQQL 3ZTNH 1GGIL 4QXWA 5I6XB 3C09C 2GJJA 1NCBH 3QQ3B 3E6FB 1GOGA 3SQOL 5E8OA 5IROC 2VDLL 2Q3ZA 1IGCL 1N2RB 2BMKB 4HK3N 3TYFB 2EYSB 2Q76B 1IGTA 1GZQB 2BOBA 1FNFA 1LDPH 4XCEA 3ARPA 4ODHH 5KSAC 2Z92A 1HYRC 3FHAA 2X9WA 3OF6A 3LSOA 2NNAB 2ZOLB 3HE6A 4TTDC 5TFSL 2YD8A 4NBYB 5D7SL 1X5KA 4D9QD 3NAAH 3QA3B 1JHLH 3NFPB 2PTTA 1KIRA 4F33B 4KKAD 5F9WC 3G5ZA 3MNZA 1DUZA 1QBML 4PJ7A 3ZKSD 4MB4A 4Z77B 3R4DA 2XG4A 5CINL 1QRND 2DQJL 4KMLB 4JGMA 5CLWA 4JJ5A 4KK8D 2GK0B 4RAVA 1DN0A 2PYFB 2R1YB 3D3VD 4R0LB 5AZ2L 2XKUA 4K71C 2WLZA 4JPIA 2BP3A 2JJSC 4LARH 1Y0LB 4UQ2A 5HDLA 5C70A 2AXGA 2UZYB 3ECBA 3S37L 1KBGH 1RI8A 3D0LB 2IQAB 1U93B 3GSNL 5AAMA 4QHLB 3V6BR 5DS8A 1AXIB 1IBGL 1MFAH 3BEVA 3TIEA 4I4WB 3TT1L 4XNYH 4MNQA 2GCYB 5F88B 2YA1A 2FD6H 5HXMA 5L88H 3RBGA 4YH6A 1GCFA 1CE6A 4JPVL 5K9QI 5AD0A 2G5BB 4PJ8C 3OF6D 3AM8A 3HE7A 4NJAL 4YO0B 3BISA 3HE6D 5ELIA 3O2WH 2O5YL 4YNYB 4ETYA 1GHFH 2QQNL 3U4BH 5ID1A 3MZTA 4HK3J 4C4KO 4XNZB 5F9OL 1WCQA 4C56B 3QIUB 1BLNB 2ZPKL 1XCTB 4FQHA 4DOHB 2CRMA 3DUSB 4JFZH 1A6TB 5K93A 4ZQKB 2WV3A 3RTQA 1Q9OA 2AGJL 5F7FA 1GYAA 5I1LB 3GNMH 1V5JA 5ICZA 3O6FB 4YDLB 3AREC 3ESVF 4MJIB 4XRCA 4ZTOL 2X4RB 3QXDA 4S1DD 5C6PB 1LE9B 3Q2CA 3LKRB 5C8JB 5I73B 2OI9B 1QG3A 2ICWA 3VWJA 4Z0BH 2NW2A 3QCUH 4MNQD 3SQOH 3TBSB 3T1WA 1RD6A 4PB9L 2XZAL 1MHHB 2CDEB 3U4AA 1CCZA 3LS5H 5LWYL 4PY7B 4NQDB 1FDLH 5JNYB 2W9DL 3T0WA 1IC7L 4ODTL 4XPBH 4I18A 5TE7L 3RVXD 3DHJA 4I0CC 5KVFL 1ZLSH