2R2HA

Structure of s25-2 in complex with ko
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab, antibody fragment (IgG1k), light chain
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
total genus 51
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2hA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2hA01
5BOPA 3LCYA 4K3GA 5HPMA 3TPUA 1N59A 1KNOA 3W81A 1EFXB 3ROLA 3PWNB 4DEPB 3NH7L 2XKNB 1TZIB 2DL2A 1YECL 4KWUA 1J8HD 3GHEL 2AGJL 2CO6B 2W91A 3MA7B 4XMPH 2P7TA 5GGVY 1KULA 1G6RB 2H2SD 4QHKI 1FBIL 2B2XH 2EIEA 2Y9RT 1U36A 4L8CA 1AO7A 2C4XA 3NCJL 1A1OB 4OB5L 32C2A 2O5ZL 2OBGA 1K9TA 4P0DA 5BV7C 3DGGB 1MCBA 3P0GB 4PYGA 4HWZB 3BPNB 4KI5C 4J4PA 1GAFH 3LQAH 1BBDH 4URTB 3BWAB 2DAVA 4PJAB 4DUWA 3SY0A 1FDLH 5EU4B 1MRCH 4J4PC 1P7KB 15C8H 2XZQH 3PV7A 1WISA 12E8L 2FX7H 2OL3H 3FOMB 1MVFA 5E6IC 2C3GA 3C8KA 4ZPTA 4J8RA 2ED9A 3ULSB 4M1DL 3WLBB 1FFRA 4KY1L 1DEEB 4LSVL 4Z7QE 3V5HA 2Z92B 1MY5A 1UXWA 5ITFA 4OV6F 1OLLA 4M4RA 5DSCA 3N0PB 5GRJL 4HKZB 3D2UB 3D69A 3NZ8B 1MHEA 3MGTA 1P5VA 2A6DB 3WS3A 3S98A 1G84A 3CD4A 4L8BB 4MD4B 3OAUL 1XGQA 3CMOL 4G8FB 4D3CH 3TWCH 3I6KB 1F4WL 3HB3C 4TPRH 3VXOA 3D39A 3UTQB 3CGTA 1X3DA 3KJ6L 1KCUH 4AL8L 4YWGL 1M4KA 4Y2OA 5DHVB 2E9JA 3BGFB 2NX5E 4F3FA 3LKRA 1FIEA 3C5SB 4KQ3L 1WZKA 1F11B 1II4E 3U2SA 3EOBB 1V3JA 5D4QA 4NQCD 4W4OA 1D5MA 3U30B 1HIMH 3B3IA 1RZKH 5DA0B 1HEZB 3B43A 1HCVA 3CDYA 2SEBA 1QQDB 5J13C 3K2UH 2ID5A 4KRPD 5ETUA 1NH6A 1P2CB 4DK6A 4HH9B 2FWOB 2H6PA 4PJBF 4QXTA 5C08A 1KJ2B 4P2OA 3F7PC 3QRGL 5JHDA 5DMIL 1WBYA 3ULUC 4UNVA 1QSED 2VQUA 1RZ7L 4P2OC 5CUSH 4P3DA 5DK3A 4ELME 4HCRH 5GGUA 5KSUB 3DPBA 3I6GB 1A0QL 1S9YB 1FSKC 4EDWH 3BZ4B 3QUZD 4PUBH 3ME0A 5D6CA 2QR0A 4FQIL 1OAUH 2BNQE 1J88A 2FYYB 4J23A 4C56A 3WS6A 3VD5A 1NQBA 2FLRT 3WS6C 1BZ9A 4N8VB 4XPBH 4N0UA 2G2RA 4NIKB 4GXVL 5D8JH 3O2DH 4MWFA 4QXGH 4OGAD 4GBXB 1A7RH 4I77L 4WFHE 2A6KB 3T8XA 3I6LD 2ZSVA 4XH2A 3BP5A 5FM5M 3T77A 4G5ZH 5GIRA 1ZHNB 4P5KB 1J9CT 3U0PB 3TYFB 4GAGH 2ZOKA 5LGHH 3VFUB 5IJVA 4JZJB 3KYOA 5TFSH 1A6AB 2NY1D 2DQHH 5TH2A 5JPNA 2YPLD 4MX7B 2NR6C 4POYA 1BFVL 1EJ6A 1PKQB 4NUJB 5EOQH 4IEFB 4H1LH 4MAUL 2DQUL 1M7DA 5JXEA 3B4NA 2YA1A 1JWMB 1QPPA 4PJ7A 2CKNA 5JXEC 5D5MF 2GSIB 1ZT1B 5HBBA 4OZGA 3X12B 4TVPH 2EDHA 2F58H 3AC0A 1DQQB 3ECBB 4K7PH 1QA9A 4OFIA 5EZJA 1MI5D 4MJID 5J57B 4GH7B 5AYQA 3VXMB 5DUBB 2UY7A 3GMLA 4XVTL 5EU7E 1AHWC 5T1MB 2AXFB 2DQEH 1ULVA 2AJVL 2XA8H 5C0IA 4B50A 3U7YH 2EXYD 2R1XA 4G3YL 1FG9C 4YUEH 2XWJB 3GSXA 2NW2B 1MPAH 4IOSD 4TQEH 2ZCHL 4H5SA 4WI5A 3X3GL 3K1KC 1H0DA 4D0CB 4QF1A 3WNLA 1OWRM 1YNTA 3K46A 1QR1A 2EDOA 3WE6B 5H37G 3BSZH 3KXFD 2VXUL 3ULVD 3GSNL 2KQMA 3HMWL 5IFJA 1J0KA 1U58B 2C3XA 4X7DC 3RVXC 5F21B 1SMAA 3VWKB 1Y18A 1FNLA 4U1HA 3DYMA 3VMPA 3GI8L 1GGBL 1S78C 3KPQB 1MCLA 4DQOL 4NYLA 3B9KA 3QUKB 4KDVA 5HTSA 4NSKA 3O3DA 1FL3B 2C1PB 2EZ0C 1G7JA 3CX5J 5FV2A 5IQ7H 3B9KC 2QQNL 3S5LB 5GGSA 1AP2A 4NN5C 3DMMB 1R24A 1DUZA 3O81A 4R90L 3F7VA 3DX9B 2OP4H 3SEPA 4ODHH 5DRZA 5EO1A 4JFQA 1L4IA 1F2QA 3BQUD 3VFGL 1IGCL 2KZWA 1DTUA 5LCVH 4LHQB 1JZ5A 5DD5L 4X6BB 1U8JB 4H0HB 3GSUA 4OLWL 2AKRA 3I75B 5GGTH 1AH1A 1FZKA 3LPWA 3D6GA 1I3RA 5GZOD 3ZKNC 4HV8A 1G9ML 3SBWA 4I0PD 4EDXB 4NRZA 1FLRH 3G5XA 2WUBH 4CL7A 3MRNB 3KLDA 2VDML 3QDJA 2QADC 4P3CH 3X13A 4R4FH 1IZJA 3SBWC 3QWRA 1AJ7H 2AEQH 2HJLA 2K1MA 3ALWA 2UZXB 3EJZC 3HE7B 3CSBA 4Q9RH 2PR4L 1YJDL 3I2CH 4TNVF 1CD1B 2X4UA 3FONB 3SJVB 3NN8A 3MRGA 3DUSA 5ANMA 3CX5K 4R8WH 4JHAL 1FZMB 1NGXA 4LU5H 1HDMA 2IPKB 1NBVH 5CIPH 1QNZH 1S9XB 3RKPA 4EEEA 3QQ9C 2VLRD 2N7BA 4FXLA 5F8QC 1EMTH 4HJ0D 1IEBB 2FJHA 4QOKD 3V0VB 4Z9KB 2NTSP 5I75C 4M6MH 5HHPA 2R29H 3KDMA 4H20L 4MQXC 5EZLB 1UCTA 3GMMB 2VDKH 2HTLD 3V2AR 4GJTB 1FN4A 3PNWB 5FUCC 5E08L 4ODXB 4J3WA 1IAII 4HK0B 5TF1L 4DFIA 4U6XA 4N0FB 5KVEH 3EYOA 4MAYB 3L5XH 5HI3C 3U4EB 4KV5F 5I1EH 2W38A 3LN4A 3QXDA 5EBMB 5FGCB 1NDMA 3DSFL 3NFNA 1YEHL 3DSNA 2AVGA 4LMQI 4M8VA 1W0YT 2VABB 4J2XA 5MENA 3JWDC 3IU4H 2NXYD 1LEKB 3P0VL 4XVJH 4D9RD 4KJWD 4Y88A 4U7MA 2A0LD 4MGXA 1P53A 2YN5A 4UV7H 2R0LH 3CU1A 4W81A 1TQBC 4F33A 1QHOA 3QISA 3SQOH 3TBYA 3DJ9A 2W92A 4EN3A 5DI8A 1G7IA 4LSPL 5FYLD 2EYTB 1XF5B 3FQRA 4EN3C 1ZXQA 4LCUA 2ITDA 3TNNA 4Y8DC 2Y36H 4Q6YA 4ODTH 5FO7B 4OLYH 3KS0H 3RPIB 3DO3A 1MHPH 3HI6H 3HZMA 2B7DT 5DD3H 3ARUA 3VGAB 2LABA 3RU8L 1UYWH 4LRIA 5D71L 4UTBL 4PS4H 1XF2A 5SWSB 5ESVA 5DUMH 3RDTA 5E4EC 4LRIC 3TBWB 1U6AH 1DQLL 2A9NL 5BMFL 4NOBA 3DXAE 1ND0A 1UB5B 2ZJSL 4NM4L 2XICA 3RDTC 1I8KA 4LCYB 2X9YA 3OJ2C 4FQLL 1T89A 2OCFD 3QG7H 4DWHA 3CC5B 3HFML 3HPLA 4PGJA 3MSPA 1KN4L 1LK2B 4F15B 1T89C 5HYSG 5J89A 5DEGB 3GSWA 3NH7H 7FABL 3T0EB 4FFVD 3NPSC 4DFHA 3G5ZA 5EUOA 5DS8B 2DWEB 2AP2A 4KUZH 4JFEE 2CRZA 3O4LE 4X8JA 2BXZA 4NNYB 5DVMA 4Z7WA 3BT2H 3EOTH 5GGVH 5L9DL 3DTXA 3IDXH 4OB5H 5GPRA 1ZA6A 2O5ZH 4Z95L 4JKPH 3U7AA 2A2QT 2CO7B 3EZ8A 2BCKA 4RGND 1E27A 4TN9A 4RGOH 1W8OA 3GMNA 1LEIB 3IRPX 3KS0J 4WTXA 1RURL 4D0DB 2OZ4A 1GIGL 2A9MH 1BVKB 4K7FB 2PCPA 1U0QA 1CG9B 4ORGB 1WITA 2YBRA 3RP1A 4OZFA 4QRRB 2CLRB 3PL6B 1QVOA 1A6UH 4UIMA 4PB0L 3SDXA 4WRLA 2VL5A 3NIFE 7CGTA 3ARED 2IWGA 3O4OB 5EO0B 3UJTH 4HFWB 1YMME 5C3TA 4M9OA 3HI1B 1SJXA 4JN2B 2FBJH 3ARGA 3KWWB 4ZTPL 4ODUA 4O4YL 4FFYH 5F9DC 3VXPB 2CMRH 2PO6B 3ARGC 1UKTA 3LZFH 5C8JA 1C08A 2BOCA 1T0NB 2Z31B 3SGJA 4GQ9H 4K3EL 1I9JL 3KYMA 5FYJU 3P40A 4RRPG 2WIIB 1EO8L 1VHPA 3J8F7 4S1QH 1L0YA 1CGSH 1FC2D 2BVQA 2JIXD 5DYOB 1FG2A 1HH6A 3KJ6H 2JCCE 4AL8H 2OK0H 2BVPA 5TJWK 5EBLA 5EC1A 5TE7H 3ILQC 4OCXH 5J6GA 4X6EB 3BO8B 4LSRL 2EC9U 1WWWX 2APBA 3PDOA 4RNRB 1E4XH 4OJFL 4LLYB 1RUQL 1TVBA 5I74C 3OXRB 4M1CD 5I15H 4OF0A 5BZDA 3GUTB 2YC1A 3AVEA 4OI9A 3UZEA 5FK9B 1XR8B 1DFBL 4M6AA 1HHHA 3BEWA 3RWIB 5JUEH 4IIQB 5BQ7A 3MNWB 4Y2DB 1QRNE 3QPQC 1Q0XL 4KKLD 2G9HA 4XC1L 4ZTOH 2ERJB 4ZDHA 4D9LH 2NY2D 1RJLB 2XKSA 1L6XA 1T2QL 4HKXB 1JUFB 3W39B 1TFHA 1MH5A 4JDTL 1KOAA 3LS5L 4HC1H 1RFDH 1G7HA 2DQCH 5CBEA 5GS1A 4Z7NF 3HZYA 3U1SH 3L95A 5F7HA 1J7VR 5GS1C 1WAAF 5ERWB 4A6YL 2WBJD 5B8CA 3QJFA 1AXTL 3VXNA 4PJEA 4OCRH 4KROC 2W9EL 5B8CC 4GG6B 4WUUA 5HDQL 1XGPA 5I73B 3MYZA 3F6IA 4GRWF 3MRPA 3DI2B 3UTTA 1I7TA 1VKXA 2NX5D 3AAZB 3S36X 4F7TA 3NCBB 3MJ9H 4ZSOB 4RFEB 4QWWC 1R5IB 3ZT6A 5JDJA 2XV6B 4I77H 1JGLH 5F7EL 1G0DA 5L2KD 1I9IL 4O2EB 2Q7NA 4DZBA 4FQCH 4PRDB 1EGJL 4UTAH 2DKUA 2BOBB 4MAUH 4HS6A 4KMTL 1Z9LA 5IVXF 1KELL 2Y07L 3TFKC 5F1OB 5BXFA 4P9HL 3E1F1 3LKOA 5HVWA 3VH8G 4RZCB 1YZZA 4JN1H 3TIDB 5J6HB 5T33H 1SYSA 3O6FC 4PJAF 3H3KA 1F90L 5ISZA 3VXRD 4MVBC 1CLZL 2VXVH 1SM3H 5DD0L 1NC2B 2BNQD 5FAAA 3RKDD 3CVIH 5J1AB 4WDIB 3LEYH 1CI5A 5IQ9B 4KVNL 1ZKAA 1AI1L 2Q6WB 3AROA 1B0RA 3R1GH 3SCMA 5IEHA 4RAVA 2YHGA 4ZUVB 1H5BB 4ERSL 2F54E 5ICXA 4XVTH 5C0EA 5F93C 3WFCL 1C12A 3EOYG 4FG6C 4XC3L 2BMKB 2KZ1B 4GLRH 4PJIB 5DFWH 1ZANL 2CIIB 1RHHB 4WFHD 4H1LG 4MQSB 4CKVX 5B3NA 1T21A 3D0LA 2CRIA 2GJ6E 5CSBA 3V6ZA 5IWLA 2VXUH 2R69L 1GRWA 3IDNB 5J12B 3F12B 5IWLC 4PRHE 1IAOA 5DK0A 2Z91A 4GW5A 3PQYE 1PZ5B 3TV3L 5D5ME 1UXSA 3SE9L 5HD8C 2EEAA 1WC7A 3T1WA 3DO7A 4GUPA 2OYPA 4ZOAA 3GRWL 2H9GA 3MBEA 3CCHB 2B39A 4FOMA 2I9LA 1BLNB 1WLHA 4XP1L 1D5ZB 3MBEC 5SX5H 1UVQA 4YHOH 4TSBH 5I71B 1HXYA 3Q3GB 4QRPE 5JPMA 3ALXA 2ADIB 1H3TA 1A6VL 1S7RA 2ESVE 3IDMB 1S5IL 4JPKH 4JKMA 4UDUB 2APFA 3NA4A 3ILPB 2LAGB 4HZLA 3WFDL 3HRZB 3B2UC 3FJTA 4L3EB 3T0WA 1TMCB 2IEPA 1DL7H 3BZDA 5A2IH 3ZDZE 1XCTB 4DVRH 1EEQA 3Q1SH 5JW4M 1X5JA 1XAUA 5HHOD 1CFTB 1U8QA 2F8XC 1G9MH 1FH5H 3FT4B 1S7TB 4YEEA 1KV3A 4PRPA 1ZVYA 5F7DA 2VDMH 3DUUB 2DQJH 4LKCB 2I60H 1IAMA 3C60A 1KPUB 4NKMA 1QACA 2BJMH 3MQIA 3C5ZD 5E0QA 1IC7H 4U1JA 3RA7H 3G6JB 3QXAB 3C60C 5IW1A 3UXFA 4ETQA 4YIQA 4XPGL 4X6CB 5LWYL 2IBZX 1HSBA 3FN0H 3MROA 5IB1A 2IPUG 4UQ3A 4BKLB 1ZGLP 1PBYA 4XAKE 5TQ0H 4WHTA 5TDNA 3Q6FB 3V6OA 3EO1B 1IQDA 1L7IL 2DQIH 5CBAB 2D7OA 3B8YA 1VESA 2R2BB 4XT1C 5E8DL 4Q7DA 3BKYL 4HQQH 3V6OC 1PG7X 5EIIA 5F9WB 3WFHA 4WHDA 5E8PB 4IDJH 3U7WL 1YN7B 4H20H 43CAB 1CL7I 1P4IH 1BAFH 3WO4B 1F6AA 2X89D 1N64L 1NC4A 1V3MA 4DAGL 3TH2T 5FO9A 2CKBB 3U82B 1PG7L 4LSSL 3QZWG 4KJQC 4PRBA 2MOVA 5C09B 4HAGA 3BXNB 5IF0A 4XMKL 1Q0YH 2EDTA 5EG6C 3EUUA 4FRWA 3D85B 1RK1B 1H8OA 1HQRA 3FFDB 2WV3A 4YPGA 1JYVA 3W2DL 4NWUH 4Y4FA 1E6JL 3E8UL 5IESL 4ZQKB 3K8LA 1CDCA 4APQB 4MNGE 3QI9B 5FYKL 3S3PA 4BSWB 2VZSA 4CDHA 5KVFH 2NTFB 2R2HA 3E6HB 4ZYKB 1AGEA 3OBAA 5C0RH 3RTQD 3TO4A 3W0WA 4LGSB 3LDBC 1P1ZA 3MLUH 5CILH 2N1KA 4LLWA 3TO4C 5DFVD 4PRIA 1LO4L 3RU8H 4WU7A 5EU6E 4HJJL 3OX8B 4RMSA 4TSAH 4UTBH 5DQ9A 1F42A 3SKJH 5DMGD 1QFUH 2DS4A 3PP4L 1A1NB 1QBLH 1T0MB 2A9NH 5BMFH 5FUOH 2ZCKH 1H3PL 1HILA 1OLZA 2CD0A 4UB0H 4P48A 4KV5E 5MI0C 1S7QB 3RWDA 3R06B 2ED8A 3JV4B 3HFMH 3HUJB 3M1BB 5JW5B 4UU9A 4MJ5B 3QNXB 3MRIA 3EZJB 1V7MH 4XNYL 3V5DA 5FFLA 1NCBH 4FQXA 2WWMD 4HMDA 5I1KH 2DKMA 1MFDL 4G8GE 3DXAA 4HZAA 1AQDB 1NEZG 4FQXC 1WEJH 2VIRB 2ILLA 1D9KB 3IU3A 3TZVA 3WKML 1GZPA 3MGOA 2FZ3A 4FTVB 1MWAH 5GS2D 3RWJA 3TZVC 4E42B 5FHAH 4NO5A 1IAIL 2VLJE 3NABL 2X4QB 1AR1C 5CP3A 5IT2H 1RURH 1T5XB 4YHIA 1TENA 3BRFA 1RIVL 1KXVC 1OF2A 5K93A 5B39A 3X14A 3PIQB 5IOPA 2G60L 2JB6B 1EJOH 1MJ8L 5B4MC 4YO0B 3L5IA 4YGVA 4XHJD 2VR5A 5MEOA 4L9LA 3LPGA 2OMNA 1CFBA 2R23B 1K8DB 4LNRA 3HG1E 3VFNA 4L9LC 4KK8D 1Z5LA 1X5KA 1A3LH 2X4PA 1FE8L 1S9WB 1QEWA 3FQTA 3HC0B 2PXYC 4HAFA 1BZ7B 3GMRB 1E6OL 1GYAA 3GMPB 5IR1A 2ZUQB 1CQKA 5IBTH 1RIHL 5EB9A 4XBPA 5ALCL 4AIOA 1BGXH 1UM5L 2AAVA 2WWKT 4YHPA 3VFSB 2X4RB 5EIVA 1OWWA 1TTGA 4NO0B 4JFED 4RMRA 4XP6L 3O4LD 4WHCA 4LOUC 3T0ED 2P8LA 5TDOA 1IC4H 4M02A 1IGFL 1UB6A 2XI9A 2VZTA 4R26L 1BIIA 5C0CA 1U95A 4LSRH 4C83A 1IKFH 2YD5A 3W82A 1NMAL 4D0BB 2E6PA 3TPKA 2ZUUA 3OKNA 3QUYB 3IAPA 3DHJA 4GKNB 3TEUA 5D7LE 4B41A 5TDPB 4I3RH 1MCEA 5D2NA 4KPHL 2CJUL 5EU3B 5JW4N 2X4TB 5FB8A 3TCLA 3DIFA 4JRYB 4OD3L 1Q0XH 5D2NC 5JMRA 1NAKH 4IRSD 3HR5B 2OL3B 1YMMD 2DF3A 4O2FB 5FYJH 2NY0B 3TH4T 5I9QC 3L7FB 4OLXH 4XGZA 5EU5A 4JRXB 2X4NB 2Q87A 1T2QH 5KVGH 1FZOB 2X70B 4G6KH 2VR4A 2E3VA 3OF6A 4XZUB 2IANA 2AV1A 4XVSL 5GS0D 5D1XB 4NGHL 3C09C 3OKMA 1SJHB 1FVDB 2HFEA 5A2JH 3TBSA 3K81A 5I8EA 2I27N 3ELAT 3CSYB 3CH8A 4WWKD 2C3VB 1RU9L 4M61A 1Q9OB 5I1DB 1QFWI 2Z8RA 3WUWA 4LPCA 4L4VA 2P4AB 2VDRL 2IPTL 3MA9L 5C0GB 4OGYL 1H8NA 1RV6X 2HT4D 1ODAA 4ZNEA 5E9DE 4NKIH 2PTUA 5D96C 5F7EH 4MB3A 4V1DB 1ACYL 1U8OB 4NHCL 2C9AA 5F72S 2D03H 3MXWH 2XN9A 2BFVH 1CICD 1NCDL 1QRND 1SVZA 3MRQA 3Q2CA 3D3VA 1P7QB 4NZJA 4H26B 3IFNL 2Y07H 1KC5L 2ZWLT 3S3JA 3LOWA 2V5RA 2A6IA 2GTWA 4P9HH 4KK6D 5IHZB 2EDXA 3DETC 1IJ9A 4Y2DD 1F6FB 2CLVB 4YHKH 2NQCA 2FGWL 3RUGA 3QHTC 4PJBA 5DQJA 1FNEA 4L29B 1WAAE 3V4VH 1VGEH 1OHQA 3B9AA 1ZLVH 4L8DA 1CFVL 4LPTA 2W0FA 3O6MH 2DKSA 2WZPD 3UO1H 3CAFA 2D2OA 5EA0H 4GRWE 1IGYA 1LMKA 1IL1A 2B4CC 4ERSH 4Y4KA 4CNIA 3RWGA 3O3AB 1VERA 5E00A 4LKXB 4M7KH 5H94B 2WSKA 5KJRL 1FO0A 1KCVL 1GC1H 2H2PD 2PYFB 4WTZG 4Y4KC 3PV6B 3S35X 4GG8B 4U6TA 3ULVL 3IDYB 4XB7A 5F6HI 1TZHB 3HAEB 1PYWA 3OHXB 4UZGA 1UJ3B 3NCCB 2FEDD 1HHIB 3O2VL 3RWFA 3S35L 4CUCA 4MNQA 4QRQA 1CE1L 4XVUD 2F54A 4BUHA 1JYXA 1BD2D 2R69H 4O5LL 1MIEL 1G7PA 4X80L 5IVXE 1CDUA 4P2QE 1CXKA 3KNBA 4IMKA 4L5FH 3RNKA 3LKPB 1I3GL 4OI7A 1ZHBA 3WFEL 2AXGB 3HPJA 1L9MA 1MFAL 2IG2H 4IMKC 5AYUH 3SE9H 3T2NL 1NAMH 2IF7A 3GRWH 3RL1A 4CJ0A 1QLEH 3TBVA 1QFOA 3QIBB 1MCOH 2YUZA 1JJUA 4PRHA 5DLMH 2VISA 4MXVF 1R5VA 1AC0A 4W4NA 5CJBA 4YAQA 1U8PB 4POZC 5D5MA 3V7MA 1S5IH 1MUJA 2AK4B 2DYPA 4KRPC 3OSKA 3AXLA 2VC2H 4F2MA 2ADJA 1W72L 2DB8A 4BZ2L 3VI4F 4EZMA 1IAIM 4IRZH 4PLKC 2M8XA 4LIQH 3PGFL 4NFDA 2EDNA 3MUJA 5GGSY 3TIEB 4MJ6A 5ENWA 5FGBA 4FN0A 1UM6L 4MB5A 2XFXB 1CQYA 4LLUA 5E2WH 2QHLA 4AM0A 2D0HA 1CFNB 1Z3GL 2GJ6D 3O2WH 2MMXA 3THML 3WIHH 5IB5A 4HUXA 3FB6B 4PRNA 3JV5A 4LLMA 1HQ4B 1GL4B 3MO1A 4XPFH 4OD1H 1Y0LA 3PQYD 1EO5A 3ARXA 1DQTA 5GRVL 3ROLB 1Q8MA 4NKDB 2NCMA 4Z7VE 5KS9F 1BJ1J 4MA3A 4OGAC 1YMHA 5KSVA 2MJWA 1PDKA 1ZT7A 3BKYH 3KPRE 4HWNA 5ILTH 4X4ME 1UWEL 4JR9L 1SY6L 1C16A 5BV7B 5JW4Q 4JFDB 4KTYA 4S10A 2CLZA 2ESVD 3RPKA 4JFXB 4EOWH 4RWYH 5LGJA 3S37X 1JYNA 4BFGA 5ID0A 1LVEA 5KAQF 4BH8A 1N8ZB 3IFPA 1ORSB 3NTCL 4J6RH 2YSSA 3D25B 2OSLB 5I1HH 3QNZB 5E6IB 3S37L 2E8YA 2XZAH 4HGWB 1N7ML 5JDSA 1JPST 4HJGB 5FYLL 3LEXB 2VDNL 3MV8E 3O3BA 3W11C 5FUZL 1N2RB 1X5ZA 1VFMA 1F4XH 4G42B 1ZHLA 2BC4B 5J56B 4Q97A 2HG5A 5KSBB 4ZS6D 3UTZB 2N7AA 4R2GD 3FQNA 4YE4L 5KN5B 1K4CA 2VMFA 1DE4A 4XAKD 1T1YA 3FO2A 1AFVH 2EXYC 4UV4H 3ARVA 1R3JA 5DHYB 3UBXI 1LO2L 1RZJH 3OJVC 2V7NB 3KXFA 2XPGA 5GGRB 3O0RL 5GZND 3EJYC 3PP4H 1MJUH 5DJZA 3AY4A 5E2TH 3MLZL 3MLSL 5ADPH 2DMKA 1U2CA 3SGDI 4WI9A 3AY4C 1L7TH 4PIRF 1S7VB 4EVNB 1D5IL 3HZKA 3FO9B 5EPMA 1AD0B 2UWEB 3LV3B 3WIFA 4LK4A 2CPCA 1XGUB 1MCSA 4PTTB 3LHPL 3UX9B 1Q38A 4HXBL 3BIAX 3DRTB 5I1GH 5EUKA 5CJQL 5EO9B 3BZEB 1KCRL 3KPOA 5ID1B 3CUPA 3QA3A 3MRLB 1CL7L 4UQ2A 5L88L 3REWB 1JF1A 1QBMH 2OI9B 4UT6L 5IBLC 5I8OL 2QTEA 3D85D 3OJDA 4N0CD 2AJZB 5L8LB 4M1GH 1B3JA 3NABH 3SDCB 1U8KB 4Y19A 1A3QA 3PJSB 4Z78B 2NMSA 1YQVL 1G9EA 4LSUH 5CJ5A 5E6YA 4MMZC 4RIRA 3VXQA 2FR4A 1AC6A 1OGAA 4EXPX 1L0XA 2LU7A 4I0PA 4TVSa 2J5LB 3VG0H 4QXUL 3S97C 1U9KA 5GZOC 2J6EL 3BDYL 3L3GA 5CINH 4Z0BH 4I0PC 5H2BA 5EU6D 4QYOB 2OTUB 2VQ1A 2YXMA 4IJ3B 4LLDB 4BJLA 5I8CB 3G6JF 2FBOJ 1X5GA 3RWHB 3BN9C 1XZ0A 3OKEA 2BNUB 3C08H 4X6CF 4I4WA 1HYSC 5FKAB 1RZIA 4PJ5A 4NRYA 4BZ1H 4Y5VA 3SDAB 4LCWA 1EEYB 3T1FA 3UPRB 2YD6A 1RIHH 2WK2A 4AMKL 4Y5VC 3RHWF 4QOKA 3RIFK 1YEEL 5HXMA 4G8GD 4HJ0C 3U0TB 1CGYA 1LE5A 3KJ4C 2PYEA 5I16A 5SWZE 5IKCB 4U1MB 3OB8A 1KACB 4PBWD 4DJMA 3ARSA 3L7EA 1N6QH 3IETB 1TCRA 2HTLC 1JPFA 3GSVB 5F7MC 2VLJD 1SY6A 1LNUA 3STZA 1T1ZB 3L9RB 3HNTL 3IJYB 2B5IC 1G1YA 1UH2A 4BYHA 4JM2D 4Y1AB 5I17A 1T66D 5E1HB 4CVXB 4Z7UE 4P5TD 4X7SH 2Y5TB 5EZJB 1DBBH 3HR6A 1R3LB 4RFNC 2NZ9D 3H9SE 2C7UA 1CLYH 3WNOA 4UNTA 2YD8A 3A6BH 3JWOC 1AHWB 2DTML 4OD3H 2EYRB 1QSFA 2V2XB 4OIIH 3WL9A 3MTRA 3QR2A 2CDFB 4LVOC 3H42H 4ZO6A 3HG1D 3F62A 1YNLL 5ADOH 1K6QH 1HOCA 3D1MC 1T6WA 3EYVB 5HYIA 3A6OA 5IK3B 2YPVH 3N9GL 4PG9A 2X7LB 4P9MH 4NQEE 5IHLB 2V7HA 3MODL 1K2DA 3MV01 1YY8A 1Z9SA 3F8UB 3L6FA 1OCWH 4PJDB 4R96A 4Q9QL 3WHXA 3A67H 1UADC 4RWHA 1UWGH 2ADGA 4I5BB 1WCBB 3RZWA 5MEPB 4KZEH 2ORBL 3TN0A 4QT5A 3PWPB 4PJ9A 5EN2B 4HUMB 4M3JA 2AABH 5DJAA 2IPTH 4J7RA 3TN0C 5I8KL 1QKZH 4PJ9C 1NGYB 5T3ZH 1A6ZA 3SOBL 5M94B 5F6IC 4X98A 4YBLC 1LDPH 1WV7T 3P4NB 4K9EC 4LLQA 5D7LD 4NHCH 4FFVC 2B0SH 3DARA 4YX2L 1AQKL 4WW2F 1ZS8B 2GY5A 1OT2A 1GVIA 4ZUSB 3BAEL 1HKFA 3O9WD 3QUYD 1NCDH 1REIA 4JQIL 3MOAH 1YNKL 1U93A 4FS0A 4XCCL 1JVKA 3EYFA 3C5JA 1A7OL 3CH1B 5CWSA 5IHUH 4NQDB 5L0QB 5FECA 4NJAL 3T3PF 2BSED 4NZRH 5CMAA 3P4MA 5HDLA 5E94A 3ZL4H 4IS6B 3WDIA 4U3HA 3BKJL 3FOLB 3GBLA 5CLTA 5K9JL 4UINL 3VWJA 1HKLL 3LQZB 4WI3A 1P4LB 4GSDL 2Q8BH 3DURB 1CFVH 3VWJC 4YDKL 4Y16A 4Z0XA 3MLVH 2GAZA 2GHWB 2ICEB 1KTDA 2N4IA 4FXGA 5F44A 3BIKA 1OQOA 1KCSL 3IFLL 3OXSB 5D1XD 1BVZA 4PBXA 1M7IA 1MCRA 3RVVD 2J6EA 4W6YB 2AQ1A 1AGFA 1FFNB 3MREA 2L0DA 1HI6A 5K9QI 1BPVA 2C26A 4NBZB 3JSSA 5E9DD 4Y4HB 3A0OA 1IAKB 2OJZL 3PE9A 3MFFB 1EFXA 4G6FB 1HZHL 3PWNA 5KSAB 2H8PB 2R8SH 1MFEH 3BWUC 1QFWL 2XKNA 2EDBA 1TZIA 2ED7A 4NP4H 3WIIL 2HRLA 2DQDL 3MA7A 1MFAH 1JNLL 2DIAA 2HKHL 3MV9E 3HNVH 3IDGB 4KKCD 1G6RA 4V1DD 3TT3L 1N0XL 1FZJB 4NQSB 2EIZB 1AGDB 4F37K 3VDCA 4QRRE 1VFAB 1A1OA 3D9AL 4NWTL 3IS1X 2R1WB 1NFDE 2GCYB 1A4KB 3DGGA 2J1KA 2WINB 4HWZA 4PD4J 3TBTB 3BWAA 4JQVA 4PJAA 3JBG7 5EU4A 1E4WL 1P7KA 4OZ4B 5LAXB 5I30L 1GZQB 1UZ6F 4JQVC 3FOMA 4OQTL 5C0AB 3N1FC 4X7TB 5E2VH 2YPKB 3ULSA 3WLBA 3EYSH 2VDQH 1C5CL 1LO0L 1DEEA 3PGFH 1RZFH 3GGWB 4CW1B 6FABL 4HWEH 2Z92A 2E27H 1M1SA 1CTOA 4HDIB 3EW3B 5DURB 4HKZA 3D2UA 3Q5TA 3NZ8A 1FNSL 2R2CA 3QEQE 2HFTA 4DOHE 5AUMB 2A6DA 4JG1H 3ESVF 5HHNB 1F00I 3THMH 4O02H 5SV4A 4L8BA 4P2QD 3ES6B 4MD4A 2WBJC 2F74B 1CD0A 3ZTNH 3MNZB 4G8FA 5C3LD 1OAZH 2FEEI 3AB0B 3I6KA 4JO2H 3GSNB 4LRNH 4JAMB 2X4SB 3DROB 3SE8L 4GAFB 3UTQA 4FZ8L 1S5HB 4G9DB 1SJVA 3SKOB 4MXVE 5DHVA 1W0VB 2BVOB 3C5SA 4QRUB 1F11A 4YHYB 2NW3B 1DBMH 1UWEH 3EOBA 3BGFC 1A14H 1SHMA 5CGYD 5ACZB 3QIBD 3VI4E 1RJYB 5D1QB 2DD8H 1ED3B 1HEZA 5FKPB 4HS8L 1QQDA 3QUXB 3U30C 5IW6B 4XAWH 4XX1G 1NCWL 1P2CA 5B38B 4J3TA 5DMYA 3B6SB 2AK4D 4HH9A 1GJIA 2FWOA 3FFCE 4AQOA 3EYUL 4H8WH 5CJXC 4JREB 5F97E 1KJ2A 2DN7A 2J8UE 5GHWH 1OM3H 1T2JA 4EQ3A 3RGVB 1FRGL 4MCYB 4OLVH 5KSUA 5DD1L 3ZKSD 3CK0L 3I6GA 1S9YA 2OX5A 3BZ4A 5IGXL 1P7HL 1CU4L 2DM7A 1X7QB 2FYYA 2HKFL 1I8IB 5KS9E 2YD2A 3FN3A 3LAFA 5B3JF 3JWDH 3QFJE 1I9EA 4DGIH 1GH7A 4P4KD 2J88L 3VW3L 1XT5A 4N8VA 4HIIB 4RMQA 1LO2H 1A5FL 3ZTJH 1LGVA 4LPUA 1BMGA 3KPRD 4GBXA 2A6KA 2BVPB 5LQBH 4JZNB 1K8IB 4PJHE 1FORL 2Q8AL 5GJSL 1ZHNA 3HAEG 4P5KA 1A4JB 1LK3H 3U0PA 4GT7A 3TYFA 4OSUH 3DVIA 3VFUA 1X5HA 4JZJA 4EBQL 5IB4B 1A6AA 2YEZB 3KAAA 4XBEL 4CMMB 3U9PH 5GRUL 3V4PL 4MX7A 4JZJC 1PKQA 4NUJA 3WO3B 3LHPH 2DMBA 4JO4H 4PJFE 4X6DB 5ITBH 1CTNA 5CJQH 5CFHA 2DTSA 1NCUA 5D7IE 1JWMA 3U46B 5EOCL 1TETL 2GSIA 1ZT1A 3MV8D 3VXUB 3X12A 2DQGL 2VOTA 3ARBD 4XNQB 4JFOB 1W8NA 4AEIL 1DQQA 3ECBA 1S3KL 4M43H 2HFGH 2P5ED 4G7YL 2IALB 3VXMA 5DUBA 3UEZA 2Y1VA 4DK3A 4OQTA 4QXUH 5T1MA 2AXFA 3HTLX 3MXVL 4DGVL 1AE6L 3BDYH 1G9NL 3MLRL 4MSWB 2B1HL 1BOGB 1A9EB 1J05B 2XWJA 2NW2A 4WV1B 1CGWA 3I50L 3BP6B 5C07B 5BOZG 4OT1H 4WGWB 5ICYB 3FRPG 2NPLX 4D0CA 1I7TB 3WE6A 4UIKH 3WDHA 1J12A 4IRJD 3GJFK 2OZ4H 1JNNL 3MC0A 1FIGH 4OZFH 1U58A 3BD5A 2OLDA 4JDZB 3VWKA 3FT3B 4HLZH 3QQ4B 4ONFH 1ZE3C 3VWKC 4JFFB 4HGKC 4LCIH 4TTDC 3F7QA 1FNAA 3KPQA 3EHBC 2F53E 3JVGA 1MY7A 2X89A 1U8IB 4HIHB 3QUKA 1TJIL 1FL3A 2C1PA 4KI5F 3OG4B 4WO4B 1KJ3H 4OF7A 3JVGC 1Q9KA 2HJFB 1CXIA 4GW4B 3D0VB 3KYNB 3O6FB 1QFWM 3S5LA 1RAMA 2QQLL 3DMMA 3QBTB 1YEKL 3JUZA 1MWAB 1B9ZA 2EIDA 4P2RD 3DX9A 1FYTB 5IBUB 2R0KL 3DMMC 5C0BE 3RIAK 4K8RD 3O41B 4GRLD 1GOGA 1IEAB 4NN7B 2X4OB 4L4TB 1U8JA 1ERNA 4N68A 5E56A 1DDHB 3CLFH 3I75A 4WTWA 3RBGA 3CFCH 4TOYL 1G0XA 4IMLB 2X42A 5ALBL 4EDXA 4LEXL 5GS0L 3MRNA 3MOBL 4LQFL 2L7JA 2MFNA 4WHYG 1T7ZA 3P30L 3QIWB 4K3HA 5KSBF 1EA9C 4FA8A 2FB4L 2FH8A 3VI3E 3CVHL 3MRDB 2XZCH 4DVBB 3RBSA 3HE7A 4I3SL 3RTQC 1CD1A 3FONA 3SJVA 1CK0L 3HE7C 5I1IL 5JIKA 4FABL 2O5YL 1FZMA 2WM0A 5IROA 2IPKA 5A43C 4TUJB 1FLTX 4OD2B 3MBXL 1S9XA 5DMGC 3U4BH 2X41A 5SWZD 5IROC 1F4HA 1IEBA 1SYVB 4Q74A 3V0VA 1LO5B 3EFDL 2Q1EA 4HF5H 5EZLA 3EYQD 3GMMA 4NZUL 3IFOB 3VGBA 3SOBH 3PNWA 4ODXA 4F9PC 1B88A 3UTSB 1GHFL 4WEMB 5DO2C 4HK0A 4N0FA 2WWMC 4MAYA 4YXKH 4CU8A 3U4EA 2XQBL 3S9DB 4YX2H 3STLA 5EBMA 3F7RA 2D7TH 4PJXB 1F4AA 2VABA 3ULUF 1B0GB 2QV2A 1LEKA 4UT9L 3SDDD 4N9GB 1CBVL 4DW2L 5KW9H 3DVGB 4NJAH 5I1CL 4POUB 1BQLH 4WI8A 1ETZB 4BFBD 4U2YA 4KTDL 1RZGB 2EH7L 4OLUH 4U6VH 4AH2B 4HT1L 4Y7MA 5E2JA 4NQED 4ZXBB 3FQXB 1QRKA 2EYTA 1XF5A 4KHXL 4AEHH 5FO7A 1FGVH 3RPIA 2LVEA 1DVFB 1WF5A 4K3JL 3UJJH 3VFVB 1ZGLM 4LP4A 4XHJC 4TULH 2FECI 4J3OC 1T2XA 4A6YB 5J0BA 5SWQB 5CZVH 1T6VN 4GMTH 5SWSA 3VGAC 4PJCE 2AJXH 4KK8C 3TBWA 4JY5H 1G9NC 1MAMH 1JK8B 3GNMH 5F88B 1MQ8A 4KKAC 1UB5A 1IT9H 4HXAL 2NY5L 1KEGL 4GKZB 4LCYA 1B4JL 5CGMA 4EUPB 3CC5A 1JMXA 2VUYA 4HPOL 1LK2A 1YYLH 1QYGL 4K23H 3X3FH 4I2XB 5BS0D 4NC1C 1KIRB 1KJMB 3OB0H 4LBEB 5DEGA 4OUUB 3T0EA 1KTKE 3QDMB 5EZIH 3NBNA 5DS8A 1Q72L 2DWEA 1JE6A 3T2QA 3T0EC 2X1WL 1VSCA 2ITCB 1I1FB 1HHKB 3U0WL 4NNYA 4MS8D 5IMLB 3D9AH 4ZPVB 3VRLF 4OZHB 3BKCH 2A1WH 4K3DL 3UTPE 4JVUA 3UPAA 2L7UA 3EDJA 1LEIA 5DD6B 2XG5A 2WWKO 3X11B 4D0DA 1JPTL 1BVKA 4K7FA 4P23D 4WY7L 1CG9A 4ORGA 4KQ4L 2CK2A 3DX7B 3BKMH 2MHAA 4QRRA 1XIWD 5C70A 2CLRA 3PL6A 4NO2B 1IFHL 4JPIB 2Y06H 3AUVA 3AS2A 3PL6C 1X6LA 2YRLA 5EO0A 4KI1A 4HFWA 4ZO9A 2P43B 3HI1A 1JHLH 3L3JB 4JN2A 1OSPL 3KWWA 3O4OC 1J0JA 5E03A 3VXPA 1FNSH 2PO6A 1DBJL 4HW6A 4PP1D 1T0NA 1CDYA 1XMWA 3A6CH 2Z31A 5T5FL 1RUKH 2VAAB 2PO6C 5L2JB 4XWOC 3QHFH 2Z31C 3MV7B 4CU6A 2WIIA 3MV9D 1JWSB 2R4SH 1DSFL 1S8DB 4G6FD 5DYOA 2X2YA 1OARL 1C5DB 1DJSA 3SKUD 5D72H 5A2KH 5JHLL 3BE1L 2IBGA 2R0WL 5AAMA 4X6EA 3BO8A 1KPRB 4ONGH 4PJ8D 4Q9BA 1GZPB 1KFAL 4RNRA 1Q1JL 4LLYA 2VKXA 1UZ6E 3OXRA 1KB5H 1NLDH 3SGKA 2IAMB 3MX0A 3GUTA 4QXWA 4JQXA 5FK9A 1XR8A 2CUHA 4S2SB 1QLRB 3RWIA 4YHIB 4IIQA 1I4FB 3MLWH 4LCCB 3MNWA 4Y2DA 1IBGH 1OF2B 3RL2B 4PTUB 3RY6A 2JE8A 3OB0K 4KK6C 3FL7A 4Y2DC 3NFSL 2Y6SD 2BNRB 2V17L 3FO1B 1RJLA 4C4KT 3GEWB 1A7QH 3T0DA 4HKXA 1JUFA 3W39A 5AZ2L 3VXSE 1T22B 4L9LB 3QEQD 3CK0H 2R15A 5A2FA 3HI5L 2PXYB 4OCWL 4F57H 3QHZL 4YQXH 4U6HB 3L1OH 4ZFZB 4HKBB 5ERWA 5GXBB 5DTFB 1YEIH 2DI9A 1FL6B 4JKWA 4FQHB 3NACL 4XX1E 2H2PC 4FQJH 3GFUA 3VFWB 5I18H 4GG6A 3KPSB 3P2TA 1MCCA 3C6LD 4HWBA 4LP5A 1BX2B 1CFQB 2JB5L 1CLOL 3AAZA 3Q6GL 3I9GL 5F9OL 5HPOA 4ZSOA 4RFEA 1R5IA 3WNNA 2B8OT 1MF2H 5E99L 2DM2A 5IFHH 5F7YC 3T65B 2FD6L 3NVQA 4TUOB 3TVMD 3GO1L 2FEEL 1QTYT 4OM1L 5GJSH 1DBAL 2FATH 2NY5C 3P9MB 4O2EA 2RCSL 4LSQH 3DHMA 4PRDA 4XBEH 4KKBC 4GAJL 3W5MA 4XWGL 5D1QD 5T3XH 4MZ2A 1OPGH 2BOBA 2P45B 2HTKD 3HMXH 2NY3D 1KENL 4X4YB 2MPAL 1EERB 4RZCA 3QJHB 3TIDA 5J6HA 2W0KA 4JZOB 5L8KB 4KTEL 4JM4H 2DQGH 1R3IL 5BJTB 5HGAB 3QPXH 2D31B 5D7KE 4ALAL 3RZCD 5B3JE 5AWNL 1NC2A 2BHZA 5SX4H 5J1AA 4WDIA 1YEFH 3KYKH 4LPWA 1S3KH 4QTIL 5IQ9A 3P0YH 2IGFH 4G7YH 2Q6WA 1FAKT 3RY4A 5GRWA 3L5WB 3QFJD 4ZUVA 1H5BA 2E7LC 3O6KL 1RUAL 1S7UB 2OMBA 2Z9TA 4E41B 5D1ZB 5D7SH 4KK5D 3QCVH 2XNAB 1H5BC 1QUNA 1HWGB 2BMKA 2IMMA 4PJIA 1M05B 1JGEB 2CIIA 1RHHA 3LIZH 3BPLB 3WD5H 5KTEL 4M03A 4LVEA 4YBHA 4GKOA 4KHTH 1NCNA 5CP3H 4C59B 1IC1A 5BRZE 5BO1L 1JNNH 5JIIA 3FRUB 3BDXA 3IDNA 1CZ8L 2V5TA 3F12A 1TJHL 4JO3L 4AT6B 2VJXA 2AEWA 1J8HB 3HZVB 4MMXC 3OGCB 4BFIB 5EUOF 5FDYA 3S4SB 5J12C 4XTRD 1PZ5A 5HHMB 1LEGB 1P6FA 2ENYA 1HH9B 1FV1B 2AV7B 1JGVH 5IMOB 5HYJE 3CCHA 3MRRB 4MA8L 3CZFB 1WBXB 1BLNA 1D5ZA 4G6ML 4PY7B 2A6IB 3Q3GA 4U05A 2ADIA 4FQ2L 4MB4A 3GSOB 4W6XB 3IDMA 4UDUA 3O11B 4PGCB 4XB8A 5FHBH 4MLIA 5I71C 3MZGB 5F3BB 3ILPA 3HRZA 2K7PA 3QQNA 4L3EA 4ZMAT 2WQRA 3SDXF 1CD8A 2COQA 2HH0H 1XCTA 2VLLB 4N1CA 4DGYH 3BPOC 1LP9B 1KCLA 3SPVB 2NYYC 5B38G 1T03H 1JI1A 1CFTA 3ARTA 4FMKA 3FT4A 4PRAB 1S7TA 2AEPL 3RWGB 4KZDL 1F3DH 2J2ZA 4E0RB 5D2LB 1RMFL 3DUUA 1Z0MA 2HWZH 5IB3B 4LKCA 3P30H 3JV6A 1MJJB 3U6RB 1EXUB 5FGSA 1RVFH 5ACMA 3F58L 1KPUA 2HLAB 3CVHH 4EKXA 3MRKB 3OKYA 1MCPL 2IFGA 5DZLA 3RJDA 4OGXL 4ZS6C 4JFYB 3G6JA 3QXAA 5C07D 4LDOB 1AO7E 1BF2A 4X6CA 4LVHB 2EDQA 5DRNB 5AZEH 1I7UB 2EC9T 1WTLA 4BKLA 2YK1H 2JJWA 4HX1B 4KI5E 1E4XI 3GMQB 1JMZA 2W1NA 2O26U 3Q6FA 4MQ7B 1ORQB 3EO1A 5CBAA 2HFFB 2I24N 2R2BA 4XMPL 2B2XL 3EFDH 1YPZB 5E8PA 4NQCB 43CAA 1YN7A 4NHUB 1WK0A 2VXTH 4XPHH 4Z8FH 5GISL 3IDJB 1D6VH 5F9WC 5CD3B 5C0BD 1SBSH 2CKBA 4WO4D 1HHGB 1IEHA 2G75B 3WO4C 1RK0B 4ZO8A 5T5NF 4KRPB 4N0RA 5C09A 1GAFL 3LQAL 1BBDL 3V4UH 5DGRA 1H9VA 3BXNA 2PETA 3VFPB 2XQBH 1FDLL 3IYLW 2I25N 1MRCL 1F3RB 2YMXL 15C8L 2XZQL 4NKOB 1JTTA 1F3DJ 3D85A 1RK1A 2FX7L 5EOTB 1YQ2A 3FFDA 4IOIB 5T5NG 1D7FA 1QSEB 4DW2H 1A7BA 4ZQKA 1D3CA 3BESR 5I1CH 4APQA 5IM7B 3QI9A 3MUHL 5JQHC 3CLEL 3QUZB 1FPTH 4BSWA 5I6XB 4QRTB 1NFKA 3QI9C 2NTFA 3LRSB 3D39E 1TVDA 2Z8SA 3E6HA 3QIWD 3NCYP 4L1DA 4CN1A 4ZYKA 1SVCP 4P46D 5FA4B 4PJEF 1I85A 3DOSA 1ZWIB 3ZKQD 3IF1B 3EAKA 1I1AD 1I85C 1YEJL 2DIBA 2B1AL 4D3CL 3TWCL 3P3YA 5DJ8B 3UZQA 1U41A 1U91B 3B8SA 4RMWA 3Q5YA 5A1AA 1A1NA 1KCUL 1T0MA 3VE0B 1CDGA 3H3PH 3MOQA 1OD7A 5J9PB 4N1HB 4I8DA 1S7QA 3R06A 2QSQA 4ODWB 3JV4A 3PWJB 3HUJA 3M1BA 3MJGX 5JW5A 5F9JB 1KN2H 2NY1B 4OM0H 3ULUE 1QYGH 5C08E 4CJ1A 4MJ5A 3QNXA 2B4CH 2YPLB 1HIML 3B9EA 5L7XH 4M7LH 4ZUWB 1RZKL 5JHDE 5LXGH 5H8DA 1Z0NA 2ZCLH 3QEHB 5C92A 25C8H 3K2UL 1OAYH 4NCC2 1AQDA 1FO0H 5T3ZE 2VIRA 1D9KA 1N5YH 3MRHB 2ZG2A 4FTVA 3BYTA 2IQ9H 1D9KC 3FQWB 3IJHA 4MYWB 4E42A 1RQ5A 4W6WB 5C0ND 5GSRB 3FCTB 2YKLL 1Z6JT 4K3DH 5CEYB 5ACLA 2X4QA 4I3GA 3KG5A 4KAQH 2X1XR 3MJ6A 5CUSL 4HCRL 1MI5B 3NIGF 1T5XA 4MJIB 5J8OA 2YUXA 1OT1A 4KRMB 1K4DB 4EDWL 2ZG3A 4PUBL 3BPCB 3PIQA 4N0UE 4LHUD 2NZ9C 1OAUL 2JB6A 1C8PA 3T04D 2MQCA 4ZXBD 1G7MB 4S1SL 3MRJB 3B83A 4OAWB 1WZ1H 4YO0A 3QXTA 1WSST 5I76B 5C9JB 4HWUA 2O5XH 2P8MB 1CE6B 5TF0A 1MFCH 1U3HD 2EH8H 3RGHA 1F8TH 5IJKA 2R23A 1NSNH 1UC6A 3VFMB 3QDGB 1JNJA 4XPBL 2W9DL 2C3HA 3LD8B 5IJKC 4P2YA 1S9WA 3O2DL 4QXGL 3HC0A 3GI9L 1BZ7A 1A7RL 3EO9H 3GMRA 2P42B 1JWUB 2UYLB 3GMPA 1MCKA 4P4RB 3RNQB 3MCKB 2FECL 1MHCA 2IQAB 2P5WB 3FZUD 4GAGL 2ZUQC 4KDWA 5LGHL 2DI8A 2I5YH 4OZGE 5CD5C 2DQHL 3VFSA 2J12B 2KBGA 2X4RA 3VRLE 4NO0A 2Y4SA 1FFPB 3VGGA 3MLTB 2ZP0T 3H2WA 5FCUL 5H37H 3BE1H 3BI9X 2R0WH 5TPWL 3FB8B 4EI5B 4K7PX 3UTPD 2MKWA 3S96B 1AD9B 4D0BA 2BVTA 3FKUS 1PY4A 3HS0B 1JF5A 3QUYA 4JHWH 4GKNA 4RAUB 5HGBB 3TA3D 3VFRB 4DN3L 3BQUB 3CFJB 3CDCA 4K7PL 3BOVA 2F5BH 2J8HA 3QUYC 1NLBL 4L4JA 3O8XD 5TDPA 5JIHA 5EU3A 2X4TA 2CH8A 1S7XB 4JRYA 3LQAC 4OZIB 1SJEB 1W72B 3HR5A 2OL3A 4O2FA 3L7FA 2DQEL 3VU2A 2DOCA 2LE9A 2V17H 3SE4A 2XA8L 4RFOH 4JRXA 3CMGA 2DIJA 2X4NA 3U7YL 2HMIC 4WENB 1EEZB 2NY0C 2VTFA 2D3VA 3SE4C 4YUEL 4HUWB 1FZOA 5F7WC 1MPAL 2BERA 4TQEL 2X70A 5JTWA 1QO3B 3TO2B 4XZUA 4BQCA 5D1XA 2RBLA 3EOAB 1SJHA 4G9FB 3ZE1F 1FVDA 3VGFA 1KGCE 2FDBP 3D18B 5D1XC 5IMMB 3CSYA 3RVVC 2QHRH 2C3VA 2VLRB 3HC3H 1Q9OA 5I1DA 5DC9B 3CXHJ 4QOKB 5JORB 1I3VA 2EO1A 3WNMA 3ZDYF 3V79C 5C0GA 1ZEAH 4L8SB 1KLUB 4OFYA 5CKAA 5E99H 3WUZA 4MZ3A 5IQ7L 3GO1H 4XP9H 5JA8B 4V1DA 1U8OA 2I9TB 2VLMD 4Z5RB 2JKXA 5C71A 1TTUA 2OP4L 3QDJE 4ODHL 1P7QA 1BQSA 2AI0H 5HI5D 4H26A 2NXYB 5LCVL 1RZKC 4OZHF 1U92A 2E5EA 3HC4L 4WFFD 5GGTL 5IHZA 2CLVA 1NANH 1IM9D 3OKKB 1CDIA 3VXSD 4L29A 4KTEH 1FLRL 4FNLL 5ANME 1CT8B 2WUBL 2BNRD 1S7WB 3GJFB 3VCLB 4R4FL 1A9BB 1AJ7L 2AEQL 4HCRA 5DJXB 3CXHK 2YWZA 4B7LA 4G8IB 1EAPB 4Q9RL 3I2CL 1UZ8B 1KLGB 3Q0HA 1OY3B 3O6KH 5FUCE 2XQYG 3O3AA 1GCFA 4LKXA 5H94A 1BFOB 5C1MB 2PYFA 1B90A 1HK6A 3PV6A 4NJ9H 1NBVL 4GG8A 3O6LH 5DVOA 1QNZL 3SN6N 4QHNB 2VLKB 2VO5A 3WCYA 1TZHA 1EMTL 4QHMB 2HT2C 3HAEA 2GK0B 1EZVX 3IDYC 4M6ML 3OHXA 1UJ3A 1HHIA 3O2DA 1KLFA 2R29L 4PJGB 2EE2A 4E9LA 5MENE 4XPTH 2VDKL 3CXDH 4J3SA 4WFGE 2GI7A 4K2UH 4ZFOL 5GJTH 3LKPA 3QDAA 4O9HH 1MSPA 2CQVA 2AXGA 5CSGA 1J1OH 5B21A 5KVEL 2OR9H 5I1EL 2JELH 2K9UA 1WWCA 3LKQB 4QNPE 5DWUH 4LPVA 1JZ4A 4R9HA 2Z4QB 1BBJB 5MHSD 3QIBA 5ESAB 4WNQB 4FXKB 3IU4L 4K8RL 2GT9B 4XVJL 4RGNB 5CGYC 3QIBC 1WZLA 3OTTA 4I9WE 2EKSB 4UV7L 2R0LL 4PY8J 1M71B 5DJYB 5DRWB 1U8PA 2APXA 1RSFA 5FM5O 2AK4A 3RAJH 3S88H 3DV4B 1AY1H 4HS3B 2A73B 3PHOB 4S0TD 2EYSB 5CSZB 2Y36L 3AREB 4ODTL 4OLYL 4HUUB 1NUNB 1MHPL 1EHNA 3HI6L 3QUML 5B39G 5DD3L 3TIEA 3HLAA 1F02I 2HAZA 3HE6B 2AEPH 1DR9A 5EBGA 5FA3B 3WJLA 4PS4L 4WEBH 2XFXA 4X5WB 5DUML 3QXVA 1NCCH 2DWDB 1CFNA 3QULB 2MKLC 4PP2B 3WJLC 5AAWA 1U6AL 3F6LA 3F58H 5EUOE 1HINH 1MCPH 2ICWJ 3L3KB 3FB6A 4UMGA 1HQ4A 3M8OH 3QG7L 4Z7WE 5E8NB 5DQDH 2BX5A 2ICCA 2JIXB 4KXZI 1BFTA 5F7NC 4NKDA 2WANA 1ROWA 5HYJD 1MHHB 3H8NA 3UC0H 5J7CC 1OGTB 5HHMD 4KUZL 1EVUA 2BK8A 3RVTD 2DDQL 5HHXH 2YD4A 3BT2L 3EOTL 5GGVL 3SDXE 3IDXL 9CGTA 1RIUH 4JFDA 2MQ3A 5GISH 1B0WA 3VJ6A 3QIUD 4JKPL 4JFXA 4RGOL 4UDTB 1CXFA 1N8ZA 5EDXA 1ORSA 4MQTB 1KEML 4B53A 3D25A 2OSLA 2A9ML 3GJEB 3LRGA 3QNZA 4KGJA 4X99B 5LKNA 5E6IA 4AY0A 2YMXH 1X5XA 4HGWA 1A6UL 4GW1B 3IJSB 2NY2B 1VEMA 4XI5C 4JANB 4HJGA 1HCFX 2XRAH 3LEXA 3ARBC 4ELKB 3RY5A 1PD6A 3E2HB 3UJTL 5KZCD 1ZT4B 1N2RA 3GSRB 3BGMB 3VA2C 3CLEH 2FBJL 4G42A 2BC4A 4RBPH 4FFYL 3WYRA 3ESUF 2CMRL 5KSBA 2X9XA 3LZFL 1AO7D 3LN5B 2WBJB 1UM4H 3UTZA 4HPYH 5JOFB 4OTXH 2RFXB 3OZ9L 1OP5H 3H7BB 1YY9D 4GQ9L 3NGBB 5JQ6H 5F7LB 5KN5A 2HVKB 4KI5D 1N4XH 3G9VA 5EH1A 2VDLH 4KMLB 1YEJH 5DHYA 2B1AH 3CDGB 4J4PD 4S1QL 1CGSL 2V7NA 2NX5B 1IM3B 5GGRA 1FFOB 5DRXB 2Q7YB 4O2CB 2CXKA 4MJ2A 2OK0L 1UACH 4IRJC 3CFIC 1CGUA 4NC0B 5ABDE 5TE7L 2KL6A 3WUWG 4OCXL 5L2KB 1S7VA 2GIYA 4EVNA 1E4XL 1PLGH 3FO9A 3EKCA 3MACH 1AD0A 2UWEA 3LV3A 3OL2A 4BK5A 5I15L 1IGMH 2CUMA 1FHGA 1XGUA 3F65A 4PTTA 5T1KD 1T0PB 1UEMA 3DRTA 1HE7A 5EO9A 1KBGH 3BZEA 5E95B 5JUEL 3QCTH 5ID1A 3S4SG 2FX8H 3K4AA 3MRLA 3PWUB 3REWA 1XR9B 4ELMB 4HIEB 3Q48A 3RUGF 4ZTOL 2KPNA 2F9BT 4RDQF 2ATPB 3VXRB 5JLZB 4YR6B 3MUGB 2AJZA 4U1GB 4D9LL 2OI9C 2YKLH 4GRWH 3SDCA 2DLTA 4PJEE 5KOMC 1U8KA 3ROOB 3MMEB 2BNQB 3ZO0A 3D39D 5JO5B 4HC1L 1RFDL 2D4DA 4GRLC 4WUUE 3PJSA 3JTTB 1LP9F 3SDCC 4Z78A 2DQCL 3DECA 2GSGB 5TE4H 3UTTE 3ETBF 4I13B 4RDQG 2R4RL 2CK0H 3U1SL 1E28B 4S1SH 4C54A 1G6RH 5D2LF 5GS3A 3MNVB 2J5LC 4P3WA 1BQHB 4QYOA 4HUVB 4OCRL 1MVUB 2OTUA 4F7CA 2M2DA 5C7XH 2XY2A 4LLDA 5I8CA 3RWHA 2W9DH 1GOFA 5F3HB 4IJ3C 2BNUA 4MD0B 3MJ9L 1M6OB 3GI9H 5FKAA 4YDIL 5DR5H 3SDAA 1JGLL 5C08D 3ULUD 5DK2B 4P2OD 4G8EB 1EEYA 5IW3A 2K3TA 3UPRA 5JHDD 4HMEA 3SDAC 1EDQA 2P24B 1LILA 2OTWB 3LRHA 4FQCL 5ISZE 3BUYB 4KJYB 4OKVB 3U0TA 4UTAL 5T3ZD 4ZUUB 5IKCA 1MCDA 4U1MA 4YHZL 1IGTB 1NPUA 4X9HA 5FCUH 3ISWA 3IETA 3GSVA 5TPWH 4C56D 4JN1L 3JUYA 1T1ZA 5T33L 3L9RA 3IJYA 1RUML 5I19H 1NJ9B 1FFQA 5BZWB 4Y1AA 3PGCB 2VXVL 4DN3H 4CVXA 1SM3L 4UUJB 4DUVA 1NLBH 2Y5TA 1CWVA 1P69B 3CVIL 4HULB 1R3LA 3LEYL 4U1LB 5DDHB 1MLCB 2QL1A 1AHWA 5HHOB 2EYRA 3R1GL 2V2XA 1LWRA 4LASH 5DHVH 4Z18A 2O93L 2CDFA 2NR6D 2ZUSA 3MR9B 3GIZH 1R0AH 3VMOA 2XT1B 3EYVA 2F8OA 1QZ1A 4JGUA 5IK3A 3C5ZB 3W9EB 4ODVH 5JXED 4R0LB 2X7LA 4M93B 1MAJA 1O7VA 3QDGD 5EBWB 1JGUH 3MLYH 4PJDA 4S11A 4IM8A 4I5BA 4BQ6A 1WCBA 5MEPA 2EXWC 1KJ2H 2KUTA 3BJLA 2P5WD 4K94L 4QHUB 4YZFE 3PWPA 5EN2A 3NCFB 4G7VH 5F71A 3NFPB 4FHBD 2LV4A 2C4FU 5CKGA 1I7ZB 1NGYA 2CR6A 3FT2B 3RX5A 4YDJB 4YHOL 1Q9KB 4TSBL 4DUXA 3WKNA 2D7MA 3RI5F 2YZ1A 4EI5D 3P4NA 5DVLA 4GQPH 5JXAL 4M7JH 4JPKL 5HDBF 1SEBB 1KB5B 1TCMA 4EI6B 1ZS8A 4ZG1A 4ZUSA 4PRPE 4RQQB 5EZOH 1DL7L 1YEDB 2IH3B 4XCYB 2X6MA 2H32B 4DVRL 3CH1A 4NQDA 3HC4H 3E3QC 3Q1SL 4IS6A 5CHNB 3QO0B 5L0QC 3FOLA 4Q6IC 2WW8A 1FH5L 3ZE1E 4MA7H 5GRYA 1S78D 5F7UA 1WZMA 4FNLH 3LQZA 4PGBB 1XGYH 3ZYOA 1P4LA 2DQJL 3DURA 3TT1H 1NBYB 2I60L 2EZ0D 3V6OE 1ZGLB 4MXQD 1ADQH 3B9KD 4NM8H 5DHXB 3RTQB 3DX6B 2BJML 2R9HD 2ICEA 1IC7L 3RA7L 3L5JA 3OXSA 5LBSH 1L0QA 3ZDYE 2XTJE 2XYCA 4X8XA 3FN0L 4G9FD 2H3NB 4I2XE 1CF8H 1D5XB 1FFNA 5TQ0L 5HHVH 3ULVF 4XXCC 3CX2A 2DQIL 4YFLF 4U1IB 4WGVB 1XH3B 4HQQL 1VFBB 4Y4HA 4J1UB 5KVDH 3MJ9A 3QXUA 1IAKA 1CN4A 1OTTC 4IDJL 1A7NH 3MFFA 1RPQA 1P4IL 1BAFL 4Y4HC 2QADD 5KSAA 2H8PA 4N5EC 3OR6B 4M7ZB 3U48A 2X44D 1OTSD 3QDJD 1NGPH 5KSAC 3QWRD 3IDGA 1NMBH 1Q0YL 1FZJA 4NQSA 3STLB 2EIZA 1AGDA 4Z76B 1VFAA 3QEGH 4LVNB 1OQXA 4PJ8C 4Q2ZB 3VD4A 2R1WA 5DVKA 4K8RH 4NWUL 2GCYA 4WWID 4OF6A 3TC9A 1A4KA 4YK4B 3W0WE 4ZAKB 1OAXH 3QQ9D 2WINA 4LFHD 5T3XE 4UILH 3TBTA 3OPZL 4PRIE 4OZIF 3NIDF 3SO3B 5KVFL 4OZ4A 5LAXA 4OCYH 2WBKA 1GZQA 4XNUH 4UOW1 2VXSH 5C0AA 2AJSH 3U9UB 4X7TA 2IPUK 2YPKA 5C0RL 3GGWA 4CW1A 1MCJA 2V5SA 2AJ3B 3MLUL 5CILL 1CFSB 3MV7E 3QUMH 2QKIB 5DJ0B 4HDIA 5EORH 8CGTA 4TSAL 3ZE2F 2EICA 3SKJL 2UVFA 2DM3A 4RMTA 1QFUL 3GZKA 3RWEB 1QBLL 5AUMA 5HHNA 3HN3A 2Z8VC 2VLKD 5FUOL 2AJYH 2ZCKL 4NFBA 3TNMB 4WFGD 1IILE 3ES6A 4UB0L 2F74A 4AENB 3MNZA 3KYAA 4C4KO 1JGDB 2J3SA 3GSNA 2F5AH 4C55A 2UZIH 2C3WA 2X4SA 3DROA 4JAMA 5KANI 1NDGB 4JFEB 1V7ML 3AB0C 1S5HA 3O4LB 4G9DA 3UBXB 3O3EB 4EN3D 1NCBL 3SKOA 5I1KL 4NNPH 4N1EA 4LSTH 1W0VA 2BVOA 1WEJL 1Q9WB 1F58H 4N90E 2JJUA 4WW1B 4QRUA 1F45A 2NW3A 2RAMA 2DDQH 1A8JH 1BWWA 1MWAL 2FX9H 2YN3A 3IGAB 4H0IA 4PB9H 5ACZA 5FHAL 4YHYC 3CFDB 4X9FA 5H35B 1RJYA 3I3BA 5D1QA 1ED3A 5J3HC 5FKPA 1WGOA 3QUXA 3QH3B 5IW6A 5D1QC 5IT2L 3RDTD 1KEMH 5B38A 4P57B 3I85A 2HTKC 3QUXC 3B6SA 4N0YH 1VDGA 2MHAB 4IRSB 3TJHC 1OP3H 1YMMB 1EJOL 4RMUA 3BHBB 1G0YR 4DZ8B 4JREC 3RGVA 1F3JB 1F4YH 4MCYA 1N6VA 3HCVB 1MRDH 5C6WH 3RGVC 1J0YA 4N8CH 5HHQB 3HE6D 4KUCD 1DUYB 1G9MC 1X7QA 1A3LL 1YEGH 3AGVA 1I8IA 1DQJA 1MRFL 3CVHB 1ZAGA 3OZ9H 4P49A 4WCYL 2LQRA 4WWKB 4KK5C 5IBTL 2V2TB 5C0CE 3QG6B 1ES0B 4ODSH 2JCCB 2UV3A 4XRCB 3IKCB 2JJTA 5FDWB 4HH8A 2XACC 1BGXL 1UA6H 4HIIA 1YJDC 2JJTC 1L6ZA 2AJUL 4H88H 1Z9OA 4XP4H 2E6QA 1H3WM 1IC4L 5MEQB 2WIMA 4JZNA 1K8IA 5D2NE 3MYJB 4LLAA 3SDYL 4TSCH 1QG3A 3F5WB 4FFWC 2XIDA 1A4JA 1MIML 1IKFL 2RJMA 1DQDH 5IB4A 2YEZA 1T3FB 4CMMA 1CICB 3T0AA 1QRNB 3ARGD 2BDNH 3LKSB 1I7RB 1ZV5A 4X6DA 3IXTB 4D8PB 4I3RL 4MDJB 5GSVB 4HKJB 5FYKE 5EWIH 1BHGA 1T4KB 5EC2B 3U46A 2IANE 4Q0XH 1NAKL 1TPXB 4MJ4A 4RA0C 2DBLH 2ZUVA 5FYJL 3VXUA 4E41E 4OLXL 4XNQA 5D93B 4JFOA 4ODBD 4MXWH 4JDVB 4OCSH 5KVGL 2YWYA 1FNFA 1PSKH 3ILQD 4XNMB 4G6KL 5DMKB 5I0DA 1TJGH 4JY4B 4L4VE 2IALA 2FJGB 2R4RH 2HN7B 3PHQB 1A1MB 3OJMB 1RUPH 4LAJH 1WIPA 1X5FA 3TCXA 4MSWA 4ZNEE 1BOGA 1A9EA 1J05A 2IFFH 4WV1A 3GBNH 3QPQD 4UOJA 5C07A 5ICYA 3BP6A 2XN9E 4GXUM 5INDB 4WV1C 1BD2B 4JEGB 3D3VE 2WLYA 1NL0H 5IUSA 2Q86B 4YDIH 4U1SB 2XWTB 4NKIL 2J8OA 2X9WA 4JDZA 3FT3A 1NUGA 3BP4B 3MFGB 3QQ4A 3B5GA 2E9IA 4PJBE 3RUGE 2D03L 4JFFA 4QHLB 3MXWL 2NNAB 2BFVL 5A40E 4M8QB 4WU5B 3WXVH 5K59F 3IVKB 1U8IA 4YHZH 4HIHA 1QFHA 4WO4A 4L9DA 2HJFA 1LP9E 4GW4A 2FHCA 3D0VA 3K0WA 3KYNA 3O6FA 4KROD 4WO4C 1MWAA 4YHKL 3MCLH 4ZFGH 2DBJA 1FYTA 2VWEC 4DN4L 1RUMH 2VN4A 4WUUD 2YZ8A 3V4VL 1VGEL 4LDLB 1RULH 4HIXH 4QWWD 3O41A 4O00A 2PUQT 3UTTD 2R56H 4G6AC 1IEAA 4UNUA 2BVUA 2X4OA 4L4TA 3O6ML 3UO1L 4NN7C 1DDHA 2A38A 5EA0L 3V5KB 1FAIH 4Z6AT 2HJKB 4U7KA 4IMLA 4UBDD 4MNQE 4BQ8A 5IMKB 4XNZB 5HGHB 35C8L 4M7KL 1GC1L 4FQ1H 3QIWA 3H9HB 1BM3H 2GJ6B 3ZZ1A 3MRDA 3QQ3B 3QIWC 4CAGA 4DVBA 5F1NB 2DLEA 3WFBH 2NXZB 3V6FB 5BVPH 3VFOB 3GIVB 1JZ3A 4F7MB 3PQYB 3GSQB 4OKDA 1WFTA 4UT7H 5ISZD 4L5FL 4TUJA 1UJTA 3CU7A 4U49A 4OD2A 3T2OA 2KH2B 4NRXB 3VA6A 2IG2L 4NNXB 5J11B 5AYUL 1SYVA 4K94H 1LO5A 3HKFA 1DP0A 1NAML 4QRPB 2Q20A 1QLEL 3N1GC 4I0KA 4R4BB 4E5XB 3BRGC 3SCMD 2ESVB 1WWAX 2ZUWA 4FG6D 3TESA 1MCOL 3IFOA 2PN5A 2ZUTA 3UTSA 5DLML 4JG0H 5JXAH 2FJFB 2ZPKH 4ELMF 2VC2L 4PJXA 3DVNB 1B0GA 3BPOB 3OKLB 4N9GA 4IRZL 3DVGA 4JVPA 4LIQL 3FMGH 1F5WA 5KOVC 1V8HA 1ETZA 5CP7B 1RZGA 4L3CB 4AH2A 2DQTH 1RD6A 4ZXBA 5E2WL 3FQXA 3JV6B 3MBED 3ARZA 3O2WL 4R2GB 4ZXBC 3WIHL 3PWLB 3V95A 3NA9H 1DVFA 4NKQB 4HGMA 3VFVA 1U3HC 4XPFL 3B2UD 1DVFC 4FP8H 1KIQB 4OD1L 4A6YA 1OVZA 3IDIB 5SWQA 5IFAH 3C6SB 4KH2A 4U1NB 1A3RH 3SKMB 1JK8A 5AD0B 5F88A 2VQTA 5HDBE 4GKZA 3H0TB 3PXHA 2H41A 5ILTL 4N8VG 4EUPA 4G6JH 4I2XA 4RCAA 1KIRA 3WV0A 1KJMA 4LBEA 4EOWL 43C9B 4RWYL 4OUUA 4NN6C 3DNKA 3QDMA 3QSKB 1PX3A 4J6RL 3T09A 3C60D 5I1HL 1EGJA 2ITCA 3EFFB 1XEDA 5CGTA 1I1FA 1HHKA 3VD9A 1IGIL 2XZAL 1YYMH 5IMLA 4MNGB 4JLRB 3TA3A 4ZPVA 4YFEA 1WWBX 4OZHA 1OL0A 3TA3C 1GGCH 5F89B 5DD6A 4QRSB 3HNSH 3OPZH 3X11A 4P9HC 1F4XL 3DX7A 3B5TA 4KJPC 3KXFE 4CVZB 4BFEA 4NO2A 5SX5K 4ETYA 1FGNL 1MCQA 4JPIA 2XTJD 2H1PH 5EU6B 5FGRA 2CDEB 4KJQD 5E8OB 1NC4D 2NY4D 2G5BB 4X0KB 2EDWA 4ENED 4UV4L 1AFVL 1VB9A 1I1RA 1FVCB 3L3JA 5EULV 3FB7B 1RZJL 4KVCH 1AGCB 2X10A 4K7PY 1GC1C 1MJUL 1OTUC 1MQKH 1T1XB 1V7NH 4H25B 4M5YH 3UMTA 5E2TL 2VAAA 1UQSB 5ADPL 5L2JA 1V3LA 1A02N 1HWHB 4Y4FD 1XGTB 1L7TL 3AM8A 4YDLB 3MV7A 4GMSH 2Y5EA 2W65B 1FJ1B 2DQFB 2I07B 4G8GB 5CEZH 1JWSA 3AM8C 1S8DA 3PWVB 1ZK9A 4Y19E 1PJ9A 3FB5B 1C5DA 1Q94B 2ICWB 4F80A 5I1GL 1OAQH 3ZHKA 1ZTXH 2VLJB 4EIZC 1T5WB 1A22B 1KPRA 3GRWA 3TO4D 3W0WD 6CGTA 4OZIE 1HYRC 1WJ3A 1OGAE 1QBML 1FL5B 5T3XD 5HDOA 3IJHB 4JM2B 1J1PH 4HLJA 2IAMA 4M1GL 4NPYB 5A16B 4P5TB 1P5UA 4S2SA 4ZAKD 1QLRA 3B9VA 5HYSB 1DN0B 2IAMC 3GK8H 4QY8B 3S5LG 4ACPA 2HLFC 4LDEB 1I4FA 2P8PB 5C0DB 5HI5C 4LCCA 1K5NB 4KFZC 4LSUL 3UYRH 2ARJQ 3RL2A 3M07A 4PTUA 3V52H 4LCCC 3KGRA 1MREH 1U8NB 3VG0L 4PJ5E 2BNRA 4JJ5B 3HG1B 3FO1A 5CINL 3GMOB 4Z0BL 4PR5B 4LCWE 4X4ZA 5I0ZA 3EGSB 4PLOB 1T22A 2ZOLB 1N3NB 2QEJA 3S34H 4QOKE 4CMHB 5TQ2H 2PXYA 3DXAD 3P9LB 3TYGH 3C08L 4JKKA 3TZVD 1P6AB 4U6HA 1Y6KR 2PYEE 4EQ2A 4ZFZA 4HKBA 1MRFH 3OG6B 4BZ1L 5DTFA 4BSVB 3WIHA 2A6JB 1FL6A 4WCYH 3GBMH 4FQHA 3C2AH 1MHCB 3VFWA 1MFBH 5E4IA 4XPAH 3KPSA 4LQ1A 1JZ7A 1BX2A 3WNKA 1CFQA 4BUGA 1WTGT 2AJUH 4N90D 1X5IA 4UI2A 1QLFB 4NBYB 5B4MD 3KLHD 1GOHA 1X6NA 3T65A 2ADFH 4TUOA 1TVHB 1N6QL 1A64A 1FQ9C 2GJZB 5D7LB 1QSFE 1MIMH 4KXZH 3P9MA 4JKLA 3JTSB 3O9WB 5FYLE 4QGYA 5GGRY 4X7SL 2X1QA 5BVJB 1DBBL 4YC2B 3W9DB 2CGRH 2ATKB 2ZNXA 4X4YA 1CLYL 3A6BL 4S1RH 1MCWW 3QJHA 4OIIL 4JZOA 1BJMA 5BJTA 4NO3B 1R3KB 2R2EB 5HGAA 3T08A 3H42L 1EBAA 2D31A 2WQ8A 3QFDB 3KPNB 5ADOL 5I2IB 3L3DB 1K6QL 1EZVY 3NCEB 2Q76B 4PV9B 2VDPH 1PFCA 4U3XA 2YPVL 3QEUB 4X7FC 4YHLH 4JB9H 4R3SB 4R4NC 4P9ML 5E2UH 3L5WA 3L3IB 4QCIB 5C0CD 1S7UA 1RZ8B 4E41A 5D1ZA 1OCWL 2V2WB 4YBQD 2XY1A 2XNAA 3A67L 1UWGL 5D1ZC 1JN6B 3WFZA 1M05A 1JGEA 4XMLH 3KPLA 3QCUH 4KZEL 5E9DB 2Z35B 2ENSA 1JPSH 3RHWK 2AABL 1JHKH 2P47B 3BPLC 5ECJE 1RZJC 3VRIB 5HVGB 1QKZL 4YPJA 1JZ2A 2VERN 2A77H 3FRUA 3CJJA 5T3ZL 5F1SA 4AT6A 1NCAL 5MERB 1J8HA 3HZVA 3OGCA 1QBBA 4BFIA 1LDPL 2C5DC 1I8MB 3S4SA 2FLBT 1LEGA 3K1DA 4MD5B 3LH2H 1HH9A 2B0SL 1TNNA 1FV1A 2AV7A 3KHQA 5IMOA 3IRZA 4TYUA 1DANU 2H2SC 3MRRA 2GEEA 3CZFA 1WBXA 2IAND 3MOAL 2FIRT 1BF8A 2I26N 1TNMA 4OV5B 1U92B 4NC2B 5IHUL 1C5BH 3LKNB 3ZDXF 4PY7A 3QT2A 1EK3A 4NZRL 5FOBB 3ZL4L 1I1YB 4Z7NE 3GSOA 3O11A 4PGCA 4WI6A 3QO1B 4OBSA 4DN4H 5F3BA 5K9OB 5HVHB 3T4YB 1VACB 4GRWB 1YN6B 3FAXA 4ONOA 4L4VD 4P59H 3G08B 2Q8BL 3M45A 4CRPA 2VLLA 2VH5H 3MLVL 5C9KA 1LP9A 3SPVA 2X1PA 2EDFA 3MZTA 1CVSC 2D9QB 2W60B 4PRAA 2FO4B 35C8H 3VH8B 4E0RA 5D2LA 2XN9D 1N0LA 3U6RA 5IB3A 1MJJA 1EXUA 2CRYA 5JOPE 3FTGB 4NQXB 3D3VD 2HLAA 3MRKA 5IVXB 4P2QB 3BMWA 3DETD 4JFYA 1VGKB 5I1LB 1YY9C 2JCCF 2BRRH 5DRNA 5K59E 1I7UA 1H3UA 1B2WH 2DICA 1A7PH 4HX1A 2R8SL 4ZS7L 3GMQA 1MFEL 4LVHC 3GB7B 1BQUA 4NP4L 4MQ7A 1ORQA 2HFFA 3P11H 4XCNB 3HNVL 4ZD3H 4PJAE 1YPZA 4WI4A 4F7EB 1AIFB 3LMJH 2R1YB 4NQCA 4NHUA 4H1LB 4GAYB 4D2NA 4Y89A 3IDJA 4Y4KD 5CD3A 1XGRB 2GJJA 1BJ1H 1HHGA 5T1KA 2G75A 1RK0A 3VFPA 5EIQA 4YFDB 4M6OH 2NZIA 4JRWA 2D7NA 4NKOA 3ARYA 1JFQL 5EOTA 3ZHDA 4MNQD 4ZUTB 5E2VL 2F54D 1INQB 4IOIA 3AMLA 1MCFA 4AG4H 4JFZH 1QSEA 3EYSL 1V5JA 2VDQL 3BIBX 1RZFL 5IM7A 4HWEL 3CPLB 2EEBA 2E27L 3HLAB 3QUZA 2BSTB 4B5EA 1QSZA 4QRTA 3LRSA 1QOKA 3QUZC 3IXAB 2EDEA 4GFTB 4HFUH 4QEGA 5I6XC 2AXJA 4JG1L 5FA4A 4LNVA 4O02L 4I48B 3OKDB 1ZWIA 5T1LB 2BZDA 3IF1A 4P4KB 4GG6F 2ZUXA 1WIOA 3P73B 4POZD 2NXZD 4PRHD 4W4OC 4Z7VB 5D7JB 3ZTNL 5L2KE 1OAZL 4JO2L 5DJ8A 4LRNL 1ZLVK 3TGXA 4J12A 3KPRB 5AG8A 4OIAA 1U91A 2DYPD 2WUCH 2IADB 3VE0A 4D9QE 2F19H 2UZYB 1ZSDB 5LJYH 4PLKD 4U0RB 5J9PA 1KIPB 3WSQL 1EHXA 4RISH 4ODWA 1DBML 3S8WA 3PWJA 1T7WA 4QRPD 4BK4A 1A14L 5F9JA 3VXRE 1WBZB 1Y6MR 2YPLA 3VJ6B 2FO1A 1C1EH 4ZUWA 2DD8L 2NY1C 1KJVB 3QEHA 2J4WL 2RR3A 3MRFB 4XAWL 1JL8A 3ZYZA 3E6FB 3LN9A 3INUH 5SX4I 3MRHA 4IHOB 3O45B 3MV8B 4P5MA 1IGIH 4H8WL 3FQWA 4LAQH 3ARBB 2V5YA 3HAEH 5GHWL 5GSRA 3FCTA 4HBCH 5CEYA 1OM3L 5KAQG 4NCDA 4V2BA 4M3KB 4OLVL 1MI5A 4MJIA 1FYHB 3QZWB 1K4DA 2P5EB 1QPXA 3BPCA 4HD9A 1KPVB 5DT1H 3VGHA 1G7MA 1IC5H 1FGNH 1U8HB 3MRJA 4OAWA 3MUY1 5I76A 3JWDL 5DJ6B 3VFTB 5C9JA 4PJIF 2P8MA 1CE6A 4GO6B 4ZNCD 4DGIL 3T0VA 5HGDB 3G04B 1S7SB 3VFMA 3QDGA 2VYRE 1MEXH 1JPGB 1LDSA 1DBKH 2HT3D 4FQQB 4IRJB 1PKQE 5CIPB 3LD8C 1JWUA 2UYLA 5LQBL 4P4RA 3RNQA 3ULVC 2GK2A 3MCKA 2IQAA 3W11D 2P5WA 1LK3L 2D0GA 2BHYA 3VGDA 2YOCA 4OFDA 4OSUL 4OF8A 4XNXH 4LLVB 1XCQB 1C7SA 3U9PL 4ZFOB 3L3OB 1FFPA 3EDEA 3MLTA 4JO4L 5ITBL 3Q5OA 1KXQE 3QWQB 2DM4A 3FB8A 4S1DD 3ZDZF 4EI5A 5HHOE 1XF1A 4JO1H 2VDOH 5K9QG 3VXME 1R5WB 4P2RB 3S96A 2BSRB 1AD9A 1VA9A 4EI5C 2AW2A 5HSFA 3HS0A 3VFRA 4RAUA 5HGBA 3EJYD 3BQUA 4GRLB 3CFJA 2QQKH 1H3VA 1BP3B 4M48H 4ZFFB 5KBNC 5F8RC 3E0GA 3WEXB 3BQUC 3V0WH 5MP6H 4S0SD 1S7XA 4M43L 2HFGL 4OZIA 2LU4A 4U31A 1SJEA 1W72A 1NEZB 4YXHH 1BEYH 2VSDA 1AXSB 3K8KA 4NCC1 2NY7L 1EUUA 3CSPA 1EEZA 4PLJD 4MNHB 2GITB 5BV7H 1B4RA 4HUWA 4F7CB 3QUMB 5L6YH 1JNHB 5DXWA 1QO3A 2O61B 4N5UA 4MXQC 3TO2A 3B2VH 2L4OA 4OT1L 3LQMA 1YDPB 2R9HC 3EOAA 4XCFH 4UIKL 5IBLD 1T1WB 3DGCR 4G9FA 1UKSA 3TM6A 4TUKL 3D18A 2OZ4L 5FF6B 5IMMA 5K9KB 1FIGL 2VLRA 1D6EB 5SWZB 4Y19D 1F13A 5JORA 4ONFL 4WHYH 4LCIL 2A74B 1G6VK 1HHJB 1ZHKB 5D70H 1B6UA 4FZEH 1EUTA 4L8SA 1KLUA 1OGAD 1CLCA 3RX8A 4D94A 1KJ3L 4L8SC 1DLHB 4Z7UB 3QYCA 1OTSC 1KB9J 4NBXB 2I9TA 4Z5RA 2IH1B 3BN9D 5DC4B 3H9SB 1HYSD 4AK1A 1YA5A 2UVEA 4ZODA 5CCKH 3CFEB 5TE6H 4LARH 2VXQH 4DKFH 3SDDB 4U7SA 5CJ8A 4PJ5D 4YXLH 1FNGB 3WXWH 3AU1B 5ESQB 1OD9A 1J0IA 2NXYC 3CLFL 5M95B 3CFCL 1OW0A 4LCWD 5DFTA 1HNFA 4KJWC 3OKKA 1Q9LB 1G1CA 2A0LC 3SJVE 1WVZA 5JW3H 4XP5H 3PXJA 1OW0C 1ZLUH 1CT8A 4H8WC 4NQEB 1S7WA 3GJFA 3VCLA 1VADB 1A9BA 4ORZC 4Y5YB 2PYED 2Z8WC 5DJXA 4U1KB 2PTVA 2XZCL 3DUHA 1JHTB 4G8IA 1A2YB 1EAPA 4X9IA 1UZ8A 1KLGA 1EIBA 4O58H 5CZKA 1OB1B 1IKNA 5C6TL 1BFOA 5DUPH 1X4YA 4OLEA 5JOEA 4AEEA 1GPOH 1IKNC 3KHOA 4QHNA 1P4BH 3U4BL 2VLKA 1I8LA 4XCEB 1KB9K 3ULUH 1V05A 4QHMA 1A6TB 2GK0A 4UAOB 5FGCE 1TQCB 1I8LC 3K4ZA 3G6DH 3HUJF 4PJGA 4HF5L 1SEQH 3TJEH 1QSFD 5BS0B 1R3HB 4M5ZH 1NCAH 3K8MA 3RJQB 4F9LA 5JZ7D 2EC8A 2RB8A 2WP3T 4WUKH 2DLFL 2E7HA 4YXKL 4F9LC 4GS7B 2PW2B 1NGWB 2D7TL 1NKRA 3LKQA 5JW4R 2Z4QA 3LSOB 1BBJA 1NGQH 4MA1B 4JM2F 5ESAA 4WNQA 4FXKA 5GGQH 2GT9A 3MJ7B 3OGOE 4Z7OF 5KW9L 3KVQA 4Q6IB 3VRJB 2EKSA 5DJYA 4F58H 1M71A 5DRWA 1EHLH 4RGNC 4P23B 1BQLL 4OLUL 2Y72A 4TRPH 4U6VL 1XIWB 3G5VB 4HBQA 3SDYH 3TN0D 3CFBB 5SWSE 3DV4A 4AIZB 4PJ9D 4HS3A 2A73A 3PHOA 5ICZB 4R6UA 3BRDA 2EYSA 5CSZA 4AEHL 3AREA 1FGVL 4HUUA 3QWOB 2GUOB 4ESKA 3UJJL 5FO8B 1YECH 4NC1E 3AREC 3GHEH 2YXFA 2AGJH 4TULL 1ZA3B 3HE6A 2ARJB