2R2HA

Structure of s25-2 in complex with ko
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, antibody fragment (IgG1k), light chain
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2hA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2hA01
2ZJSH 4PRPE 2EDHA 1EEUA 4WDIB 2JJSC 2AJSH 5CZKA 5DMKA 3WFBL 4L8CB 2E7LC 2CK2A 3ARVA 3TN0D 3RUGF 5DJXB 4JPVL 4ONHA 3QNYA 4JQIL 1IQDB 5GISH 3LH2H 4WO4A 3W9DA 1KV3A 4ODVH 4ZO6A 2F54B 4O58H 5E99L 3DVIA 3PJSB 1EEYA 2X4NA 4MD5A 3L7FB 3MLVH 1BF8A 4PS4H 4JJ5A 4L8SC 3JV6A 1OAZH 5K9KA 1UM4H 4WUUE 3G6JB 4WV1A 4QGTA 4MGXA 1KB5L 2VN4A 3D3VB 4BUGA 1L7TH 1FYTA 4E0RA 2I9LB 3IRZA 3X12B 5ADOL 2B5IC 1L9MA 1ZVHA 2AXFB 2R1WA 4YLQT 4IHOA 4GBXC 1UXWA 3TNMA 2R2BB 2QQQA 4BH7A 1I7RB 4MNHB 3SKJL 1NC4B 2BSED 1FZJB 1SJEA 4WTZA 4PD4J 3FRPG 3RWFA 2BOCA 3JWOC 4GKZB 4XCFH 1YN7A 5CJQH 1J8HA 1I9IL 3C5JB 4PB9H 1VACA 4NQSB 1JL8A 3GSVB 1XF4A 4LL9A 4XVTL 3C5ZA 1RK0B 4E41E 1UB5A 5IFAH 2OL3H 5D1QC 2D7PA 3T2OA 5C07D 3HC3L 2W0FB 4J4PD 2FATH 1T89A 1E4WH 2PW1A 3ESUF 3F65A 2DIBA 1I3GH 5MERA 1A7OL 1A3RL 2HRPH 1U8OB 1KB9K 3E8UL 1BOGA 2K3TA 2P5EB 1Q38A 3RI5K 2QLVB 4XNUH 1RSFA 2JCCA 4N0FA 4XAWH 4GRLD 2BVPA 2SEBA 2H6PB 2D2OA 3QULB 4U1HA 1DEEB 2JLLA 4IMLB 4R90H 3O3EA 4Z95H 1OCWH 4M6MH 2RIKA 3MUJA 1XF3A 2IPKB 5D1XB 1SEBB 1YC7A 3KJ6H 2HN7A 5T1LD 5JW5A 1QSVA 2R0WH 4Y16D 1X7QB 1VKXA 4MNGB 3TBYB 3RWEA 2XZCH 4M6OH 1WWBX 3SBWC 2HKFH 5IEHA 4Z78A 4NN5B 3L3HB 3V5HA 1TQBC 1B3JA 1Y18A 3K0WA 2OM5A 4F58L 4PJAA 5ICZB 4KVCL 3L3IA 3RUGE 2R69L 4YXHH 1S78C 5I8EA 1X5AA 1K8IB 4LSSL 4QOKD 1EA9C 4WTZG 1BFVH 5EFIB 2CLVB 5HY9B 3B9KA 4IDJL 1YEFH 5JW4R 4YHOH 3ULVL 1MCPL 3IFLL 4XCCH 4XT1C 4N0UB 4FQ2L 4LLVB 1I75A 1MEXL 3Q6GH 2QQKH 3IFOA 4HFUH 1E27B 1J12A 3U0PA 2KZWA 2C3VA 2VXQL 5IP4A 1YNKH 2ITDA 1OWWA 1CF8L 1FIEA 4NBYB 2PUQT 5DVLA 4WRLA 1E4JA 43C9A 3WLBB 3VXRD 2WBJA 5ECJE 4H8WL 3SE4C 2G2RB 3WEXA 5DD5L 4M4RA 3RWCB 3BKYH 1PG7H 1ZLUK 4U0RB 5FHAH 2DBLL 2ZPKH 4P57B 1IGTB 1UQSA 1N26A 2BSRA 5DT1L 5C0GA 4Z5RB 5GZNC 1NSNL 1S9XA 4MS8D 4PJIE 3STZB 2HJKB 3EYVB 2A83A 1H5BA 4PRHA 4RA3A 2L7JA 4L5FH 5DLML 3S36L 1KSRA 1NEZA 4BSVB 1G7HA 2BFVH 2FHFA 5JPMB 1Q9KB 2NXYC 5D2LA 1OW0C 2HVKB 3UXFA 4WNQB 3ARYA 4WHTA 4XH2A 4U31A 4XPFH 1MAJA 3FKUS 5ICXB 5JW3H 3PHOA 4BUHA 3QH3A 2BY3A 2X1PA 5CLTA 4G8FA 3TA3C 4HKBA 1YEKH 4XPTL 5GS1C 2HAZA 5EIIB 4M48H 2H8PB 2HTKD 3CDFA 4KI5D 4DAGH 2WNGA 2J12B 4AT6B 5FYLH 3WYRA 3G5VB 5AYUH 1CLOL 2O93L 5DS8A 4OV5A 4R26H 1QRNE 2BRRL 2VXVH 4GRLB 4RBPK 2DYPB 3CFDA 3D2UD 4LCYA 4LPVA 5KOMC 2O5YH 3MJ7B 4M4PA 1RK1A 1Z3GH 4XCEB 1J5OH 3BKCL 1DQQB 3ELAT 2HFEA 1WSST 1RJZA 5T1LB 4OI8A 1F3RB 2IGFL 3EYFB 3TT1H 1KLGB 2JELL 2Q8BL 2YHGA 5KSUA 2AJXL 5H94A 3LEVL 2C1PA 4JGMA 1MWAB 4Y16B 1HXMB 4P0DA 4RWHA 1JHLH 3VD7A 1T21A 5D7SL 3G5YB 2AV1B 1SYVB 2AK1H 4LGRB 3HAEB 4HKJB 3C9NA 1FH5L 4LF3A 1KEML 1WFUA 3EDFA 4BK5A 5GJSL 4ZFGL 1FC2D 1HDMB 1EFXA 1A6WL 4U6HB 2WQRA 4KROD 4DZBA 4WW1B 1NMAH 3DX8A 4OB5H 2VLKE 4RA0C 5JW4Q 1OAQL 4P3CH 3V0WH 4IIQB 3QCUH 4QOKB 2AABL 1ZHNA 3BPOB 3IDXH 1SJXA 1RZ7H 5I1AA 1HQ4B 1IJ9A 3E0GA 3E3QC 1I8KB 1A7NH 5A40E 3CFCL 5EU7C 2A9MH 1HHHA 5FYKE 2ED9A 1PZ5A 3TBTA 2JCCF 2IG2L 4G6KH 1YEJL 3MRBA 4KFZC 1NEZG 1DSFL 2CJUH 3QQ3A 4OKVA 4X4XA 4XNQA 2CDFB 3W5NA 4MXWL 5IQ7H 1UXSA 3QPQC 4PJCB 1DN2A 5EU7E 1ZAGA 3C6LC 4HK3J 4CVWA 1NBZA 1X4ZA 3GB7B 3HC4L 5CP3A 1GOFA 3K1KC 2C3WA 1JWMB 1RUKL 4HUMB 3WDIA 1T04B 5BW7A 1U8PB 1UVQB 5KVMC 3PWPA 1DBAH 4LEOB 3V0AC 2D7NA 2ZSVB 3ETBF 1MIML 1G7MA 4JPWH 3VXRB 4NM8H 2B1HH 3MXVH 5I71C 4TNVK 1ZT4A 3LB6C 3BJLA 4P99A 5KSBB 4WO4C 1WEJL 4MHHI 3ISWA 1UH3A 1BEYL 2Z31D 4PJAF 4MCZA 3NA9L 1NAKL 1J87A 1UJ3B 4E41D 3WMSA 2ZKHL 4CDHA 3AU1A 1KT2A 3VRLF 3P77A 4O2EA 5DMJB 4UT9L 2UWEB 4WV1C 2FX9H 5EZLA 1NUFA 1JGEB 1FPTL 3OTTA 3PGCB 4ELMB 5GHWH 5A3IC 1KXQE 4NYLB 4NKOA 4GAYB 5D1QD 1A6TA 3BD3A 3MNWB 5B8CC 5TE7L 2DMCA 5IFJB 5AYQA 1RIUL 2FJGB 3MRMB 1FYTE 2E5EA 1KBGL 4GAJL 1CXKA 1S5HA 5HD8D 2HA1A 4KTDL 3LD8C 3GJFK 5KVEL 4U7KA 5E94B 1A9EA 2ZCHL 4OT1L 4FNLH 4ZPTB 3RWIA 4AEFA 2YEZB 4LNRA 1Z9MA 4X0KB 5LGJB 3BIKA 3C5ZC 4M43H 1J8HE 3PWNB 5F89B 4TPRH 3N9GL 2XI9A 4YBQC 2ARJQ 3D0VA 3IDNA 4OZGB 4X8JB 2IQAA 5DFWH 1AJ7L 5TF1L 3X3FL 4QNPF 4Z7QF 1GGIH 3KNBB 1T89C 5EO1A 3HMXL 5ID0B 1N5AB 3GDBA 2UVEA 4Y4HD 4RFOL 5DD1L 4ZG1A 3NZ8A 4HCRA 4WU5B 3WFBH 1GJIA 4XNZC 5EBMA 4S1RL 4XCNB 3FT3B 4NKIL 5F9WB 1ADQA 3DRQA 4AEIL 3TNNA 3B2UC 1KYOJ 5D2LF 1T4KB 1CFSB 3IU4L 4KROB 4CRPA 3OKLA 1WISA 1JZ4A 3SY0A 1LE5B 3QG6B 1Z5LA 4NQXB 2JCCE 1BQSA 1H3VA 2DQHL 2D4DA 4HG4J 4OLYL 3BWAB 1E6JH 4YPGA 1MQ8A 2VLMD 1QYGH 3PL6D 2GJZB 1JI1A 5JORA 2DQJH 4EJ1C 32C2B 5ADOH 4JQVC 1PY4A 2CO7B 3ZSTA 5MEQA 3Q1SL 2UYLA 5DC0A 3BH9B 5EBGA 1VFAB 4H1LH 1FBIH 4YPJA 3T0XA 4XP9L 2EIZA 3KXFA 3ZSSA 3CVIL 4AM0B 4F8TA 1JGDA 2AGJL 4KJPD 4ZOBA 5E95B 4FS0A 5DMGC 2VITA 5E6YA 4PJAE 3N85L 4FZEH 1X5HA 2CRZA 1P4LB 3B9KC 3MRQB 3VRLE 4LLUA 5FO9B 2XZQL 1T6VN 3IXTA 2Z31B 1MCNA 3FT4B 5HGGS 2Q7YB 3HC3H 1OAUH 4QRTB 1AXIB 5IEKA 3NZHH 4GXVH 3WFEL 5BCAA 1VPOH 3CUPB 1A3RH 3D39A 1PG7X 5FYJH 5DUBA 4PJXA 3UJJL 3VFOB 3GHEL 4F8QA 5DEFB 1BQHG 1HHJB 4EUPA 2ATKB 5EUOB 3MR9B 4PLKD 2R9HD 3GK8L 2C1OB 3L3DB 5C0NC 1QACA 2CRMA 3G5ZB 5J11B 4KZDL 3HZYB 5SX4H 3BD5A 3H7LA 4BZ2L 1QRND 1OP5K 3BMVA 4BQ6A 1G0YR 3ARBA 1ZA3B 2VYRE 4KMQA 1H5BC 3KYOB 1XIWC 4U1LA 3RX5A 3HNTH 4ZFZA 3QXDB 5DUML 5FDWA 4QNPE 4Z7QE 3HZKB 1R0AL 4CW1B 1XCTB 4OGZA 4XNYL 3MREA 2BNQA 4YO0A 1EO7A 4PRHE 2L7UA 3QEHB 4KVCH 1OAKL 2R69H 4HV8B 5E8NB 2EXYD 3SE9L 2YUXA 5D2LE 3RL2B 4Y4HB 5JO5A 1NMBL 4LSSH 5B39B 2VL4A 1C16A 2EDQA 3QHTC 3JV0A 2QSQA 2CKNA 3RUGB 5L0QC 3PNWA 1BD2A 1E28B 2OR7A 2ZUWA 1WCBA 3ULVH 3MRJA 5SWQA 3MGTA 5K59E 1NFIB 4X5XB 4HDIB 3LN4B 4M7LT 4CMMB 2HFFA 4OZFA 4ZD3L 5I2IB 1H8OA 1MEXH 2IFGA 1MLCB 4TSCL 1P4BL 4MDIB 3MCLL 5FYKD 1J0HA 4HX1A 3PL6B 5DD0H 3IU3B 3GHBH 2GK0A 4I4WB 4L8DA 4XWOD 2GI7A 1GOHA 4WI2A 1Q72L 1CBVL 4NSKA 4QYOB 1U8QB 5EOTB 1LNUB 3MRFB 5CIPA 4H8WH 4ESKA 3RWHB 4XTRD 4EUPG 2P24B 3OXSA 3UTZB 3VFRB 4S1QL 3VE0B 5DT1H 1MVUB 2A9NH 3KGRA 1XR8A 1NSNH 2DWEB 3FO1B 1IM9B 1UZ6F 4YBHA 3T8XA 3S97C 1FO0B 4FQ1L 3S36H 3O81A 5HHPA 2C5DC 1P53A 5BXFA 4AEHL 3QRFM 1DBBH 5L2JB 3PQYD 3T2NH 1EERB 2OP4L 1CGXA 2XICA 4AENB 3LB6D 2GJ6A 1RZKC 4KHTL 5D6CA 2PXYA 1X6LA 2W92A 4X6EA 5JQHC 3X11A 2JB5H 5DJAB 1DQDL 3S35H 3L3KA 5BW7C 5BS0D 1BZ7A 2EKJA 4CNIB 3EZ8A 4YEFA 1D6EA 1GGBL 2FH6A 3MACL 2JF1A 1AQKL 4X99B 1EBAA 1FE8H 4O2CA 1I1YB 4JFYB 4ODUA 1FZOA 3BKCH 3SKOB 3PWPE 3R06B 1MRDL 3HB3C 1P6FA 4DWHA 1QRNB 3HC0A 3SGKA 1WC7B 2AJXH 4B41A 1FVCB 4XGZB 2VTFA 1NJ9A 1QFWL 2ITCA 2JIXA 1J8HD 1CZ8L 5D7SH 1NPUA 1RUAH 1ZHBB 3JTSA 1GSMA 4IS6A 2ENSA 1VENA 4M8VA 3BE1L 3MUHL 2J88H 1FH5H 2GTZA 4R2GC 2FBJL 3GSNL 6FABL 1K4CB 1UCTA 4ZFGH 5KG9A 1OTTC 3DBXA 1A6WH 2R8SH 2YK1H 2Q8AL 1BJ1J 3IB4A 1OAQH 3BZFB 3BYTA 1PQZB 2DQGL 1IAIL 3RPIA 1ZGLM 2WV3A 3ZE2E 1N7ML 2AABH 3O2VL 1D7FA 4P2QA 1SMOA 4DUXA 5FUZH 1U6AH 1WUNT 2V9TA 4PJXF 4YR6B 4FOMA 1GPOL 3CFCH 1QSZA 3LPGA 1P7QA 3L3GB 4WENB 2IG2H 1N59B 1X5XA 1YEJH 1DSFH 4QXUL 5EOCJ 4LQFL 2W65B 4YHYB 3HC4H 4TUKL 4FXGA 1ROWA 4F7TA 1A21A 1RUKH 3O2DA 1KULA 5GS0L 2X09A 3L3JA 2K7PA 5D1XC 2VDOH 5GRUL 4C83B 4RWYL 1KC5L 5F9JB 5D4QA 5J8OA 1ZVSA 1IAOB 3EYUL 7CGTA 2ICWA 1ZXQA 1XH3B 5C0BA 1IAKB 4RMQA 1HH6A 4NZTL 1BEYH 3PGDA 4U6TA 1QPPA 3QUXA 1OD7A 5HGBB 3FZUC 1NAKH 3V2AR 3MRRA 4CN1A 1DCLA 3TM6A 5EUKB 4UT9H 4JFOA 4WFHD 1FPTH 3PQYB 1NGQL 5HJ3A 3QNYB 3MNVA 4EQ2A 2H1PL 5I1LA 3WIHA 3EOAA 1BX2B 1R3LA 1ZLUH 5IW6B 1MJJB 1S3KL 4PGBA 1RIUH 3CFEB 4MD5B 4JFZL 1R3IL 4HUUB 1F4YL 1KBGH 1F8TH 3RFZC 4JJ5B 4GAJH 5GGSA 1PX4A 5BS0B 4JKWA 3GIVA 2IPTL 1GHFH 2J2ZA 2HP4A 1OGTB 4U6YB 4OT1H 4UQ2A 3BH8A 3P73B 2X4TA 3KXFE 2VISA 5DC9B 4XVSL 2WK2A 4WU7A 4BFBD 3KPNA 4LBEA 2WBWB 2WBJD 4BH7B 4F57L 3B9AA 1X4XA 4Z7OE 2MHAA 1SJEB 5GIRA 4WWKD 2BVEA 3VFNB 3WN5B 3X3FH 5EO0A 4XHQA 3RZCD 3HMXH 1YN7B 1J8HB 1O5DT 2WIIA 2R2CA 3MA7A 4RFOH 1IC7H 4PRHD 3ZDYF 1U8NA 5E8DL 1QTYT 3CCHB 3GMMB 4RBPH 1XF4B 4S1RH 2C3XA 4AEIH 1OM3L 1N64L 3D39E 1E4XH 1WBZB 1A6AB 5EBLA 5A2JH 4PJXE 2GAZB 2NY3C 4LSTL 2ZSWB 1H3PL 1HCFX 2WQ8A 3C6SB 1JHKL 2AXHA 4Y5VA 2QHRL 1L4IA 4KPHH 2NNAB 4NT6A 4PUBL 4OLYH 3HPJB 1LE9A 3MLTB 1OF2B 3ARBC 5LCVL 2X05A 4GAFB 4PGCB 1BGXH 3FQRB 4PRNA 4OLEA 4AIZA 4D9QE 3ARFD 3BSZH 4YXLL 4ELKA 1HSBB 4NC1C 5DR5H 1A47A 1M6OB 3OSKA 1I3RB 3A6BL 4WEBL 4JREB 3PHSA 2VDKL 5HYSG 1U8KA 1PDKA 4XP9H 4FQCL 1UWEL 4GLRH 3U4BH 3CVIH 5I19L 4NC1E 2BNQE 1F13A 1K8DA 3QXAB 5JUEH 2AGJH 3BRDA 2AJUL 3I75B 4KKCD 3WKML 5CZVL 3GIZH 2YUZA 4C57C 1PZUB 5H8DA 2A2QT 5IEHB 3H7BA 1AGDB 5I8CB 1WIUA 3G04A 5BMFH 4PV9A 5JPNB 1OARH 1HHGA 4FG6D 2B20A 1P7KB 1I1FA 1LO3L 2XZQH 5DRXA 3L6FA 2EEAA 4I77L 3NCYP 3I02A 3OX8A 2LE9A 1BD2E 3MJ9A 2R1YB 3T3MF 2W38A 3DV6A 1JYWA 5C9KA 4P9HC 5DRWB 5ANMB 4PFEA 4BM7A 4P5MB 4OCXH 4PJ8D 4RISL 2VXSL 3VWKA 1HHIA 4K71C 4Z18A 2ZUQC 2XYCA 4PJ5A 4ODWA 3MGAA 3S36X 5F1IB 3GNML 1WFTA 3GMOB 1NGYB 1LDSA 3K4ZA 5C08A 1N6QL 4UILL 3LRSB 1YEIL 2BVQA 4KJWD 4KZDH 4PJDB 2IALB 3O41B 4APQD 4M8QB 2EH8L 4L3EA 2OTUA 4HZLA 3X3GL 3MCKA 4ZUUA 1FJ1A 4G7VL 5C0EA 1B0GB 2VSCA 2VZOA 2WWKT 1YC8A 2DQIL 4JRYA 5E2WL 2ZNWA 1EHLL 2V17L 4NUGL 2X10A 1YPZB 2WBJB 3T04D 3WEXB 2R56L 3WHE1 3KPOB 1AD9B 5FECB 4N0CC 3ZDYE 1FDLL 4LIQE 3MOBL 4WWKB 3PV6A 2BC4B 1V3JA 3GMQA 3RZCB 1OAKH 5BRZA 3QFDB 3SE9H 4MB3A 4PRHB 1NMBH 3GJFH 1OP3K 1RZJH 2GJ6E 1T7ZA 5C8JA 1C5BL 2GKIA 3UTTA 1U8MB 3HG1A 2FIKA 1NDGA 3CVHL 4X98A 3RBSA 3LQMA 3QIBD 5FF6A 1TLKA 1FVEA 3RKPA 1HNFA 1DANT 5HVHB 3VWJD 5DJDA 5C0JB 4B7IA 3G08A 3SGKC 1VFBB 1IC4L 2AW2A 1KJ2H 4QXTA 3MCLH 1G6RL 1CXLA 3FRUB 4KMTH 2NW3B 3OR6A 2BVOB 4KVNL 5E9DD 1CLZH 3REWA 4YHLH 4AG4L 2Z35A 3ARFB 1HQRA 1U9KA 5I75C 3OJDA 5I76A 3T65A 1HI6B 3F7YA 3S98A 1JWSA 3QHZL 4H25B 1MQKH 1YUHA 4OGXL 1RJCA 4S1QH 2C1PB 1QEWA 3DYMA 4JN2A 5HHVL 2VDPL 4GQ9H 3BW9A 2LAGB 2G75B 2EH7L 5KS9A 2RHEA 1M7XA 2ICEB 2E6JA 4KU1A 1CDJA 3BX7C 1BQLH 1EMTH 4FZ8L 3T3ME 4CJ1A 5HHME 4HC1H 4MX7A 4P2QE 3ARDD 4JANA 4QHNB 5GJTH 1F4HA 1AR1D 3VG9C 2DD8H 5E2TL 1ZHNB 3C8DA 1GIGL 3ECBB 4LGSB 5FUCC 2JJVA 1S7XA 3NCYS 4NHCL 3HRZB 1BAFL 5IQ9B 4PJ8B 1GGBH 4JPIB 3MODL 1AQKH 4AY0A 1FFPA 1MJ8L 2X41A 2YPLD 1QLEH 5FUCE 4X4XB 3HMWH 1MRDH 2OTWA 4TSAH 4HWBA 3I50L 4APQB 1EO8L 1PFCA 4DKFL 1YMMD 4O2FA 4P4KA 3RVUD 5F6IC 5DEGA 3QUXC 2QQLL 4JO1L 1ZA6A 4LASH 1QFWH 2VLJD 2N4IA 3F5WB 3KR3L 3RA7L 3CXDH 1G6VK 5C0BE 1CZ8H 2VJXA 1EZVX 4JM4L 4XWGL 4OQ1A 4X6CA 3O8XA 4AH2B 1XF1A 1UWGL 4PY8J 4WJ5B 2VZVA 3TPUA 3GSNH 3UPRB 4PREB 4NJ9H 1JBJA 1ZKAA 3LPFA 4LKCB 2Q8AH 5BO1H 1OP5H 5IM7B 2I60L 4PJHA 1IAIH 1T80A 4HGKC 4RAUA 5JHLH 1CFTB 5EU5A 3O2VH 3AU1B 3P77B 3LKOB 2DTML 3ZYZA 1XR9A 3MSPA 3KWWA 3V4PL 1BMGA 1AXTL 4HW6A 1KCLA 5B38A 4QHKJ 2CKBB 3QIBB 5D7JD 4BSWB 4QCIA 4N90E 4NKOB 4KKBC 4P3DB 3VWJB 3LN5A 4LDEB 1A6TB 2CIIB 4YHKL 5F1OB 2W1NA 5IJVB 4LLQB 4QXUH 1A7PL 1D5BA 4LCCA 3NVQA 4F37F 3ARQA 4PP2B 1OOAA 5J3HD 4D9QD 5E9DB 2YPKB 4I13B 3ZYJA 3OHXB 1C5DB 1QKZL 4R7NA 4U1JA 2N7BA 1GZQA 1PKOA 4P59H 3WO4B 5GS0H 3ARBD 3R0MA 2YSSB 4XI5C 4LAQL 1G84A 3C60A 2IMNA 4RWYH 2C4FU 3H9HB 1WK0A 1WIOA 1U58A 3PGFL 4KZEL 3EO0B 2BNQD 2NY2D 1BFTA 1BVKA 4XAKE 4Z8FL 3SDDA 3K4DA 4Y8AA 4UINL 1BQHB 4FQJL 4YK4C 4ZS6D 1GGCH 1G7QA 2AJZA 1NUDA 3NZ8B 1BJMA 4U05A 1LEIB 2XZZA 1SBSL 3U7YL 1P1ZB 3KHQA 4OD3L 3HR5A 1NGQH 1YECL 3EJZC 2FNBA 2W91A 3MRPA 5H2BA 4N5EC 4OLZH 3CXHK 3ARDB 3OKLB 1QVOB 4J3UA 1LD9B 3L5HA 3MJ8B 3CLFH 1PVHA 4HH9B 1NMCC 2R4SL 5ESAA 4GKSB 5HXMA 4JFZH 1F4YH 1OY3B 3TZVA 3MMEB 4PY8I 3UC0L 2Q20A 2RCSH 4LNVA 4Q9RL 4IOIB 2R2EB 2YR3A 5IK3A 3JV4A 4PLNC 3VFGL 2YPLB 4XMKH 2CLZA 4ZYKA 4G6MH 4HF5H 3U4EB 1TDQA 3UBXA 4F57H 5B38G 1EAPA 1YMMB 1CFNA 2VDNL 5IG7B 3RP1A 5AZEL 3WXVH 1ACZA 1PBYA 5FEBA 1QBBA 1TNMA 4RMWA 4LLWA 4QHKI 2VLJB 3NMEA 4Y4FD 1LK2A 4MJ2A 2ATPB 1NC2A 3EO9H 5E8DH 4Z76A 5E4EB 3IAQA 3VGGA 4K3EL 5KS9F 3Q5YA 5CFHA 5LBSL 1T1XB 1OM3H 3QDGD 4F7CB 4XMPL 1KIUA 1MHCB 1PSKH 3IDIB 4UV4H 1CFVH 2D7TH 1DL7L 2DS4A 2GJ6D 4NKQB 5E1HB 4N8CL 5IEKB 4K7PL 3P11H 2PXYD 2X70A 4LSTH 1N0LA 2Y72A 4I3RL 1DQML 1H3PH 2K1MA 3MNZB 5EO9A 4PUBH 1IQWH 1URLA 3E6FA 5DUBB 4PJ5E 3QIWB 5BVJB 4PV8A 3PWVA 1RULL 5LCVH 1YA5A 4UIKH 2B2XL 5C08E 1B0RA 5CILL 5D7JB 4EUPB 4JY6A 2FHBA 2FO1A 4L3EE 4JPKL 3T4YB 4UTBL 4YXLH 4R4FL 5JW4M 1QBLL 3A6BH 4WEBH 4CVXA 1MWAL 43CAB 2JK5B 1H9VA 5B22A 2EDDA 2E9JA 4JFXB 5K9QI 2X2YA 4JRYE 2VDML 5BV7H 4FQCH 1UWEH 3MBED 5H37G 5I19H 2DQCL 1IMHC 1UACL 2YXMA 2OQJA 2OJZL 1KIPA 2JIXD 2ENYA 3U7WL 5CZVH 3WKMH 3O9WA 1TCRA 4U6XA 3DYPA 3TC9A 4F33A 2V2TB 2F58L 4X6CF 5BRZE 4G43A 5HTSA 3GEWB 3VRJB 1FN4B 5AD0B 2NY2B 2P8LB 2OJEB 2AEPH 1AY1L 3KYKL 2A74A 1MRFL 4ZO9A 2XZAL 1KN4L 1DBJL 3RVXC 1LO3H 3HZVB 4PBWD 5IVOA 3ZT6A 4BFIA 4QRUB 3KPRA 4WHYH 2WWKO 3UTTE 3HG1E 1QA9A 1R5WA 5GGRY 1AD0B 3MLUL 1XEDA 3QI9D 5ALBH 1EO5A 4FP8L 1JRHL 1C16B 4UT6H 1KPUB 1S9WB 4Y19B 5FHBL 5F96H 5HHMD 4P2QD 1UM5L 1T20B 5HDLA 3CSBA 5HHQB 2XA8H 3BP6B 1RJYA 3QUMA 2VXSH 1F3DJ 4NP4L 3AAZA 3MGTB 5FYJU 3ARGD 5F7DA 4TUOA 3VGEA 1TJGH 2G9HB 1HE7A 1W72L 5FKAB 5HI4D 4EXPX 1N6QH 1QSED 1YEIH 1ACYL 3GBNH 1OVZA 3ZO0A 1RHFA 4HUVA 3X3GH 4F7PA 4JHWL 2UV3A 3ABZA 3GJEA 1CVSC 2I9TA 4HUKB 1F4WL 4QLRA 2H32A 2V17H 3ZYOA 2DRUA 3WJLA 5I8KL 5CKGA 1DN0A 1V3KA 1X9QA 2EEDA 1T0NA 4Z6AT 1CVRA 1ND0B 5BZWA 1RHHB 2VDRL 1FDLH 2BNRB 3MOBH 1Q9OB 3OXSB 3V6ZB 1S7WA 3WFCL 2DQUL 5SX5K 1T2XA 4OZIA 4ZUSB 2YC1B 5KS9E 4ZODA 1DQJB 3QQ9C 5BVPL 4Y4FB 1NCBL 2CIKA 1Q9WA 3OF6A 3JUZA 5I1CL 4WW2A 3DMMA 3RNQB 1E0OB 1HN1A 3SOBH 3PXHA 2V2XA 1F3JB 1C5BH 3RVTC 5KVDH 5L6YL 4CVZA 1D5XB 5HVFB 1MHHB 4GKNB 3QDGB 2DI9A 2J8OA 3FTGB 4WVRA 2A1WH 1AE6L 2A0LC 2AKRB 4HLZG 3CU1A 5IFHH 2VIRB 4GG6B 2GCYB 4RMSA 5D6CB 3I6GA 4R7DA 2FL5A 4X6EB 2A6IA 1O0VA 3OBAA 1G6RH 5LGKA 1N6VA 2HT4C 3BZEB 2DQFA 2FZ3A 2O5ZL 3U7AA 3DURA 3O45A 12E8L 1K5NA 3KYNB 4P49A 3EHBC 1KFAL 1ZGLA 4AG4H 5FA4A 4C56A 2KQMA 2J6EL 5GGTL 1NGWA 1DLHB 3TT3H 1PJ9A 2JE8A 5F3BB 3ORJA 3S5LA 4HS8L 3QHZH 2R4RL 1CDGA 4NWUL 3SE8L 4I3GA 2BNUB 1JRHI 2LU4A 3MBEB 4X6CE 4FFVD 4NKMB 3I9GH 4HKZB 1MAKA 2IPUG 3DXAA 4QRRD 5HHVH 2JIXB 3RTQA 2VDPH 3W0WD 1CT8B 4XI5D 2ICES 3JTSB 4XAKD 2EDFA 3HNVL 3LEXA 1T7VA 4YFDB 3DROA 4YQXL 4PJHE 1TVBA 2ORBH 1NCUA 3GI8L 2MFNA 2IBZX 3DBXB 1RZGA 4G8IB 4LPTA 4Y89A 3N1FC 1OSZA 3AC0A 4NRXA 3KDMA 1OT1A 3CJJA 1NEUA 2HWZL 3EGSB 3QI9B 4LCCC 2FIRT 3RPIB 5L8JB 5I73B 4Y2DA 3P4NA 5KSVA 5JIKA 1LO5B 3L9RA 5EZJA 2IBGA 4HS6B 2ADJA 4NHCH 5I17A 2ICWJ 1UC6A 4JJHA 5DD3H 3C60C 1NAMA 3MODH 3NACH 3ARGB 2GSIA 3DPBA 2FO4A 4M3JA 3ZKXB 1QSEB 4UNUA 4PRBB 4D0BA 5GRWA 1EO8H 4DKFH 1KIQB 1A02N 1MCIA 3SDDC 4DGVL 3ARWA 4WI7A 4CMHC 4P4RA 3KLHD 2D03L 2QQLH 5D2NB 4M61B 1AXSA 2A6KB 3F58L 3UJTL 1F6AA 2Y5EA 4XWGH 3V0VB 1SYSB 4AMKL 2LU7A 4LARH 1UWGH 3REVA 4EDXB 3MYZA 3FHQA 3T0ED 1A1MA 1CD9B 3HFML 3C2AL 4ERSL 4JFQA 1CICA 2NY5C 5FV1L 5IBUG 4DJMA 2Z4QB 2I60H 1TFHA 2BP3A 3I6LE 4U1MB 3TZVC 4KDTA 1JPFB 5EBWA 3D69B 1AH1A 4GUPA 4NO2B 4XP1L 3V4PH 5E8PA 1AXTH 3K74B 4LPUA 3MV9A 1W0VA 4NZUL 4XPBH 5BJTA 1BIIB 2YKLH 5HYSB 3Q48A 2BXZA 3VWKD 3VXPA 4F9PA 3EYSL 5DQ9A 1A9BA 3EOAB 5ESVB 1TPXC 4EXKA 4PJ5D 5TDPB 1HXYA 4YHKH 4YDIL 5C08D 2D7MA 4GO6B 1AFVL 1EBPA 1FZKB 1RY7B 2ZOLA 3ES6B 2GYSA 4L3ED 2XWTA 1OP3H 3K8KA 3GI9L 1IARB 4HIHA 3UTOA 2AEQL 1TVHB 4LAQH 5EOQH 1R5IA 3TESA 5J9PA 1WT5A 1ZHKA 4JRYD 2ADGB 2X4RB 3F62A 4WU7B 4JKPH 4HFWB 1AC0A 3R1GL 3NCJL 2X9XA 3LKNB 3PGFH 4KZEH 4POZD 2NY4C 2DMBA 3M07A 4JFFB 4YBLB 2CLRA 5A16A 5KZCD 3PABA 2OI9C 4OZIF 4BQ8A 3I2CL 1NCAL 4QRRB 4UINH 4HT1L 4FQJH 3W0WB 4ZOEA 5IMKB 1F58H 3BXNA 3EOYG 4YGVB 1RFDL 2OR9H 4GSDL 4O51B 5DO2C 3UTTD 3THML 4P23A 1YECH 4D3CH 3AM8A 3D48R 3FQNA 3WO3B 3MRHB 2B8OT 4YHNA 1JNHB 3W2DL 1G9NL 3SKMB 2XIDA 4OF0A 1EXUB 4F2MB 1I7UA 2R4SH 3O3BA 4Y5VB 4M62H 5FK9A 3LVEA 4LP4A 4Q9RH 2GTWA 3LSOA 2R0KL 3QWOA 3OKMA 5MHSE 4EBQH 3MOAL 1DTUA 4JHAL 3O9WC 3MFFB 4KRPB 5DRZB 5F3HA 2ZCKL 4HWZA 3V5DA 3SQOL 3DO7A 2RFXB 2AK4A 5J6GA 1A1OB 2VDNH 3MRCB 2N56A 2X9WA 3D18B 2B0SH 2APTA 3VFPA 2FX8L 1FO0L 2CQVA 3SN6N 1YEEL 3NAAL 3LV3B 2V5RA 3V6OA 2DICA 3UTSA 4DTGL 5C0RL 4Z0BL 3HS0B 3FQUB 4I0PD 3KPRE 1CK0H 2OL3A 3T0EB 4K3EH 3VI4E 5JNYB 1T0MA 5A1AA 2WAHA 4GMSL 4MA1B 3UX9B 3LKRA 3B3IA 3MZGB 5T3ZH 1MAML 1NGPL 3FO0L 3PWLA 1T5WA 4GW1A 4K7PH 4PP1D 4KTEH 4OF7A 1XCQA 3MO1B 3CC5B 1SEQL 2WUCL 2HJLA 3H3BC 4OJFL 4ODSL 1DQMH 1YY9C 5J13B 1FVDB 3M17A 4EEEA 3V5KA 4HK3N 1GVIA 4U1GB 3G9VA 2B2XH 2FB4L 2FLRT 5CILH 3SDAA 5A2KH 1JHTA 1WAAA 4LCUA 3VG0L 1HHIB 1LILA 4ONFH 4JPKH 3WJLC 4UTBH 1J1OL 3WBDA 2YPVL 4C55A 3I3BA 4M00A 4YC2B 4XVJL 1F02I 1ULVA 4ORGB 3MRKB 4Z77A 1JZ8A 4X5WA 4HZLB 1QQDB 4U1KB 1LP9A 4FTVA 4NDMA 4P4KD 5I6XB 3JWNC 3MV8D 2OMNA 1KN2H 1Q9LB 2DQCH 1FJ1B 4DOHE 4MDJB 4WW2C 2ADIB 3DMMC 2I26N 4JRYB 5B21A 5LWYL 1Q94A 1W0YT 4OF8A 4LPWA 3U7WH 1YNLL 4ZFFB 2UVFA 4OZIE 3BHBB 5C6PB 1U3HC 4JFED 3O8XD 4M03A 4M1CC 3T2PA 1RURL 5ENWA 2H9GB 4K8RD 1AY1H 5KZCB 1MRFH 5HGAB 3BGMB 3L3OA 1MI5D 4OBSA 2ILLA 5C70A 5TFSL 4JO4H 1RZ8A 3MZTA 3WFZA 3DRTB 4M6NH 2GK2A 2GT9B 3BN9D 4LCWA 2JKXA 1FG9C 1KTDB 3RVWC 3MJGX 3KLAB 3AXLB 3UTTB 4ONGH 2NZ9D 4X98B 4H0GA 3QBTB 4NP4H 1KTLB 3B8SA 1LEGA 4X4ZA 4YAQB 5IOPA 2EDWA 1LMKA 2APXA 4D9RD 4NN7B 1SJHB 4HEME 4TQEH 3QNZB 1MVFA 4WTXA 5DK0A 1ETZA 2HLAA 4FQXC 4C56E 1U8JA 1CDHA 5D93C 4JCLA 2ERJC 2HJFA 3QZWG 2LABA 1U0QA 2V2WB 3LQZA 1F4WH 2AJ3A 3NN8A 3BKMH 3C60D 5IF0A 3WUZA 4UIMA 3BI9X 2VE6B 3TYFB 5I8KH 1OD9A 4WEMB 3T65B 1AGEA 3WFDL 1NCDH 3DXAE 1CIDA 3O3DB 4YDJA 5D5MA 3D9AL 3WFCH 1OAXL 2DQUH 4FMKA 4LLDB 1AHWA 4XXDA 4LOUC 2DQEH 3ULUC 4QTIL 4KJQD 4JN2B 1S7VB 4Y2DC 5IB4B 4YHIB 2NX5A 2NY7L 1XGPA 1A6UH 3G9AB 4U1IA 4HHAA 3PHQB 1AGCB 4I0PB 1A1NA 4LSUL 5KS9B 2Y9RT 4MMZC 4M02A 3U2SB 1RZFH 3ZKMD 4WY7H 1IRAY 1EV2E 3GKWH 3OAYH 5L6YH 3FMGL 4RZCA 1JPSL 3L5WA 4OSUH 5I1GL 2VO5A 3I6LD 1EHXA 3NTCH 3D0LA 4MX7B 1BJ8A 2EKSA 3MXWL 1T22B 1YEGL 1VCAA 1FL6A 4HSQA 2R1XA 4MJ5A 3MA9L 5I15L 4XC3H 4U2ZA 1G9MC 1PLGL 2O5ZH 1H3XA 1NDMA 4HQQH 3VXNB 12E8H 3QUYA 1KFAH 2QBWA 2BDNL 1QLRA 4Y5XC 3GSXA 1AKJA 1ZTXL 2IH1A 1JV5A 3LHPL 3X14B 2GUOA 5CSBA 4TOYL 2ADFH 5EU3B 4HS8H 4JLRA 1MCCA 4OQTL 1UT9A 4FQPA 2R4RH 4L9LA 5T3XE 4JDVB 4P4KB 5CEZL 3MV8B 1LK3L 4MJIA 4ZDHB 1FFQA 1VGEL 2AJVL 2COQA 3QJFB 1NCNA 4PGDB 3TO2A 1QSFB 3MRGA 4RRPA 5CMAA 4KDTC 1WFOA 4JFEB 4OLVL 3O8XB 3BFOA 4GRMB 5TQ2L 1ORQA 4UU9A 1HKFA 3LY6A 5D7LA 1U2HA 4HK0A 3HNVH 4R4BB 1I7TB 5GRYA 3FFCD 3TVMA 2OYPA 4JM2F 4ZMAT 3GI8H 1JPGA 3RIAF 3WNLA 4F9PC 1YDPA 1MI5B 5E5MB 3WLWC 2EIDA 4MYWB 1X6NA 4HIEB 3QDAA 1TIUA 1MHEB 3MV9E 5HYQB 1NBYA 35C8L 3OJMB 3PDOA 2EEBA 3VMOA 4QHUB 4HXBL 2HKHH 3TO4A 3SCMA 1A7RL 4DEPC 4Y5YB 3V6BR 4XHJC 3MCG1 2I5YH 2HLFC 4KTYA 1WT5C 4GG8A 4NO3B 1A0QL 1WAAF 3WIFB 4XP5L 1AGBA 3ZKSD 1A2YB 8FABB 1OT2A 1D5BB 1BVZA 5MHSD 2ZUTA 5EC1A 5F88A 1I8IB 5CD5C 2PW2A 3VMNA 1LP9F 4H0IA 4R7NB 4U1JB 3IVKB 4R96B 3T09A 4G42B 5MI0B 3PWJA 3QQ4B 1WZMA 3F58H 1TZIA 4AMKH 1FL5B 3FOMB 1U58B 4X6BB 2EO9A 4P23C 5GGRA 3AM8C 3CZJA 3JWOH 2QSCH 1BVKB 3HFMH 5E08L 1VEMA 1GC1L 1XGYL 3TBVA 3C2AH 4KY1L 3U9PL 5EZIL 5E7FA 1ERNA 3KPRD 3HUJA 5GRJH 1FG2B 4HS3A 1G7QB 3P0YH 3H6JA 4IRSC 5HYJA 1R5VA 5I9QB 3BQUA 2XKNB 4I18A 5CGYD 1D9KD 4EI5A 3VFVA 4YFLF 1FFNA 3FQXA 4NCDA 1MJUL 4A2MA 1U36A 4NZUH 3BRFA 1QFWM 1VGKA 3OG6B 2DOCA 1OTSD 2H3NA 3T77A 1U91A 1WQVT 4FQIH 4KHXH 3OAUL 4OZHA 1ZOXA 4XNMB 4MJ6A 2NXZD 2XNAA 1JF1B 1XGTA 1AFVH 2PCPB 1XMWA 1BBDH 3S4SB 2XWJB 3GO1L 4ZXBD 3GI9H 4TN9A 3UPAA 4PJ9A 2XG4A 4K7PX 2AK4E 5EC2A 2AEQH 2GJJA 4WCYH 1IAIM 1OQOA 4P5TA 1CG9A 3OKKA 4ZPVB 2CLZB 5EU6D 3R1GH 3V6OE 3OKEB 3UTSE 1EAPB 1LO4L 1CFNB 2HVJB 3KS0H 5KJRL 4I0KA 3M1BB 2CMRL 4IRJA 5D5MF 4YDVB 5D8JL 4RIRA 3I2CH 1NCAH 4HT1H 4I2XA 4XBPB 3RRQA 3RY5A 1J0JA 5F9AC 1XF2A 3OF6D 3P0GB 4Q6IC 2K9UA 1M7IA 1GXEA 1UYWL 4OTXL 3FFCB 3TBSA 3BP4A 1RFDH 4GSDH 3ALPA 3SDAC 5AZ2L 1U8HA 1IKNA 3QO1B 5CS7A 4UB0L 3W2DH 1FIGL 4G6JL 1WAAE 4UOW1 3U0TA 1KB5A 5EO9B 1S7TA 2PKDA 3MV11 3VXTB 4TUJA 3PWVB 4D0CA 5IMMA 2YUWA 3P9LA 1DVFA 3IDJA 4JY6B 2R0KH 2XN9D 4YHML 3DVNA 2OK0H 4PRID 1G9EA 2WINA 4C56D 2FX7H 4JHAH 4MQSB 3PWUB 1LP9E 4FTVE 5CUSL 3S3SA 4OCLC 1GZPA 2IADA 4H1LA 1JGUL 2ZCKH 3RGVA 5GZOC 1TZHA 4XNXH 4S1DC 2AXJA 3K7UA 3VJ6A 2HMID 2UZIL 3PG2A 3EO1A 3ROOA 1QG3A 2FX8H 2QR0B 4V2CB 5ITFA 1YEEH 1CTNA 4I5BA 5F9OH 1NBVL 1IKFH 1IGJA 3OKDB 3RTQD 2CD0A 3V6FB 1TCRB 2NY0D 4PJ7A 4U6XB 4F33B 1KPVA 3G6AB 4G43B 4JFDA 3HE7A 3O6FD 5DFVD 5HHNB 4OCYL 4LCWE 1YN6A 3KPRB 1MAMH 1NGPH 3IDUA 3BYYA 3FO0H 5GGQL 1ED3B 5GGUA 3GM0A 1MUJA 1AGFA 1JN6A 5DSCA 3QRGL 2WUCH 3DX6B 4J3WA 2B39A 5I1DB 1D9KB 1MFAL 4QT5B 2CK0L 2FSEB 2CR6A 2FB4H 3BDBA 2DWDA 3B83A 2F74A 2KZ1B 4GAGL 1CR9L 3VG0H 1H8NA 3P9MA 4HUXB 3FB8B 1J1OH 2YOCA 2P8PA 3WS3B 1C5CL 5ACZA 4OFKA 2NXZB 5IB2A 2V7HB 2ARJA 3UTQB 5CEXB 1HYSC 4FFWC 5INDA 4ZXBB 1AHWC 5C2BL 2VL5A 3VFMB 3GMRA 4JCMA 4PLJC 1B4JH 4L29B 4YX2H 5D5ME 3BUYA 2HT3D 2KPNA 4X7TA 5JXAL 2C7UB 1PYWA 1KIRB 5EU6B 1NGZA 4FABH 1JMXA 2OZ4L 1RURH 3WD5L 1DN0B 5I18H 3PXJA 4N8VA 2B1AL 5FGBA 2NX5E 3NPSC 1WFNA 4G6AC 5IV2A 4OZIB 1Z9OA 5HHOA 3EYOA 3HPLA 5IB5A 5TFSH 4C4KT 1CICD 3RKDD 3B6SA 3HUJF 2Q6WA 4XZUA 2WSKA 4OCSL 2DM3A 2CKBL 3HI1A 3U30C 4ENED 5L9DL 4P2RB 4D2NA 3QEQD 4PRDA 4OD2A 5SV4A 3QIUA 4FQHB 3QUYC 2Q7NA 1P7HL 3I85A 4YWGH 5IBLD 5DTFB 5FYKH 3MGOA 1JUFB 2A6IB 4LFHG 2IBBA 3VRIA 4L9LC 4OZHF 5KSAA 1ZV5A 2EDXA 3W81A 4LVOB 5I1IH 2BCKA 1B90A 4LKXA 4G6FD 3RWGB 1K5NB 3QWRD 2XN9B 3DX7A 2VAAB 3ULUL 1KEGH 1YMHA 4PRIB 1J11A 4ZO8A 4C56B 3IXAA 3IS0X 5FO8B 1F6FB 3CPLB 5AUMA 1JFQL 3BD4A 2BMKA 5HHXL 4NRYA 4PBVC 4MJIE 5TQ0L 3WXWL 4NZJA 1CD0A 1JGVL 1ZEAL 3RIFF 1EVTC 2X89D 5CBEA 1ZANL 4PJEB 3D9AH 5F93C 3KYMB 4HIIA 4XBGB 5D7LE 3UO1L 5FA3B 3KPLA 1T1WB 3OB0K 4TVPL 3RTQB 5HSFA 2NY7H 3QP3A 2NY0B 2EDNA 4R4NC 3OL2A 1NLDL 4UDTA 1AI1H 3OPZH 4NBXB 3SCMC 2K7QA 1IC5H 3LEXB 3S3PA 1U41A 2KKQA 5C0IB 3O6FB 3OKNB 4F3FA 4LHJB 2UZXB 3FMGH 4OIBA 3EFDL 5I1GH 4GXUN 3HCVB 1B4RA 1YQ2A 1NCWL 2I07A 1I7ZA 4N8VG 4A2LA 4PJBA 2NTFA 6CGTA 3MA9H 5I15H 3O0RH 1NCCL 3D5OF 5EZJB 1PLGH 5SWZD 5BQ7B 2ADJB 5B3JF 1ITCA 3FCTA 1YNTA 1J88A 5EZOH 5E56A 1A6ZA 1JIBA 3LHPH 1KGCE 4Z7VA 1C08A 3VFWB 4X6FB 4XX1G 4RCAA 4OQTH 3B5TA 4HEPG 1EJ6A 4IRZL 4MQ7B 3U46A 1TJIL 4KRPC 5DRNB 2M8XA 3RZWA 3Q6FA 1FNHA 4Y1AD 5T1DH 1VGEH 2AJVH 1T5XA 1CXFA 3JV5A 2Y6SD 2ZP0T 1B88A 3BGFC 5DI8A 1AXSB 3UTSD 4RAVA 3P4OA 3BQUC 1F6AB 5E6ID 1JNJA 4MZ2A 4I18C 1KJ2B 1J0KA 5TQ2H 4E5XB 4EI5C 3REVB 4PJ7F 1UCBL 1U92B 3HUJE 4JM2D 3QAZB 4LVNB 5E70A 1JWUB 4NNPL 4CBPA 5HYJE 3BIAX 2XKSA 3CDCA 2X1XR 4RNRB 1CICB 5DF0A 3UZQA 2D31A 4MAUL 4YNYA 3WSQH 35C8H 3QEQB 3N1GC 2ZJSL 3H0TB 1A7RH 3QUZA 4OZHE 2XKUA 3NFSH 1MCBA 4ZAKD 5GPRA 1ZVYA 4MWFA 1QBMH 1BIHA 2J8UA 4L8BA 1HH9A 3IJSB 1IT9H 1AP2A 3IGAB 4ODVL 1KJMB 2ESVA 3CLEL 4IRJC 4MHHG 4G6FB 2XWTB 1RJLB 2JB6A 4FTVD 5JR1H 3MLVL 4ZO7A 3GSQB 4UUJA 1R5IB 1A7QH 1HEZB 1UM4L 4OGAD 2P49B 2ID5A 1MOEA 3QFJA 1L7TL 3WE6B 3TIDB 2GIYA 4I2XE 5ESQB 2AQ2A 2XTLA 3KPQA 4L1HA 1IKNC 2P42B 5JHDA 2W9LA 1ZS8A 4YHPB 1GC1H 1XGYH 3U9PH 4KY1H 4FXLA 2P7TB 2F53B 2XY2A 4ZOCA 1HHKA 3KPMA 1UZ8A 4JRXD 5IHZB 2VAJA 1PEZA 2YWZA 4LRIA 4XCFL 1ZLWK 1EK3A 5CJQL 1DUYA 3C8KA 4U4BA 4PB9L 4NQVA 1NL0L 3NGBC 1DVFC 4KQ4L 1AO7A 1MJUH 4NRZA 5DK2A 2CDEB 2P4AB 2NY6C 1CU4L 2ZCLH 3RGVC 3OAUH 1BZ9B 5C86A 4MAYA 1KJ3H 1U2CA 3C2SA 4HJ0D 2LTQC 5E8OB 4LHQB 4HJGA 5C0CD 4HXAH 3KJ4B 2VDQL 5SWZB 3E2HC 1E4WL 4KK9D 1I3GL 1UJTA 2HRPL 1RMFH 1V7MH 3LKSB 3NIGF 4G8GB 1BLNB 4PGEB 1MFNA 2GEEA 2X4UA 5I74B 1WV7T 4HWZB 3HE7C 4XAWL 3DO7B 4CUCA 5LVEA 3EOTL 3EFFA 3HMXA 5KJRH 1NFDA 3D25A 2EDRA 2CDGA 4PJ7E 4Y1AB 4M6ML 2XRAH 1GCFA 4G9DA 5JDSB 5FKPA 2X4SA 4JFDE 3R8QA 3HZMB 3NIFF 1XF5B 5E6IB 5D9SA 2R0WL 4JZJA 1UYWH 4JM2B 1T0MB 4M6OL 5IVXF 2OMBA 5AZ2H 5D96C 4UB0H 3HE6C 4G8EA 2V7NB 5TE6H 3QZWB 1FIGH 1AIFB 1T5WB 4GW1B 5D7IA 2WUBL 5CD3B 4YXHL 4PJBF 1BVLA 1JMZA 4OBRA 4XRCA 4KK5D 3ARTA 4QTHA 4MD4B 3S96A 3U48A 4ZAKB 3IETA 2Y7QA 1NUNB 4LRNH 1BFVL 3MFGB 2BXYA 2VLRB 3VI3E 3JUYA 1UB6A 2BSTA 5CUSH 1YEFL 1CLCA 4YHOL 3WNPA 1VESA 2EYTB 4S0TD 4Z7VF 4ZTPH 4Y4KA 4GRWF 5KTEL 3S3JA 5JTWA 4X5WB 5T5FH 1PKQB 2NR6D 2QQKL 1INQA 2R29L 5DJ2B 1ONQB 3LAFA 3FONA 2XWBA 3QCTL 3EKCA 4QXWA 4YDLB 1NBVH 3NABH 3ULVC 1YNKL 1BZQK 5HHOE 3QIUC 4Z7UF 5ENWB 3TVMD 1TJHL 4BZYA 4JB9H 15C8H 5DQJB 3ULVE 3LS5L 3BJ91 3BKYL 1WIPA 2EE9A 3QDMA 4JRXB 5FHAL 4XX1E 3WKNA 1T6WA 4GW5B 4Y7MA 4CJ0A 2OCFD 3FFDA 3W9EA 2HT2D 2QSVA 3O3AA 3GGWB 3IF1A 4LLMA 4JVUA 2HG5A 1MFAH 3EUUA 3WHXB 3K46A 3TO4D 1HILA 4L5FL 1RZKH 1RZIA 3NPZB 1BFSA 4GW4B 4H8WC 5HI5C 5IB3A 1LEGB 2BOBB 5CSGA 2WANA 4C4KO 3DECA 2BERA 5CP3H 1QO3B 4QHMA 2J8UF 4XPFL 3VFTB 3NIGE 5JW3L 2HLAB 5C0CB 4AJ0A 3OG4B 5F7MC 2M1KA 1YEKL 3DUUA 2BHZA 5C2BH 5IKCB 2Z92A 3VXUA 4D0DA 1KGCD 4DAGL 4UAOB 5FYLL 4RFEB 3LQZB 2EC8A 4BKLB 2AJ3B 1C7SA 3WUWG 1DDHA 5JXAH 1XZ0B 4ZUWA 3MLRH 4UV7L 4FQQB 4U1SA 4F37K 2OZ4H 3WD5H 3F12A 3U6RA 3NIFE 2O5YL 3LQAL 2B1AH 2OSLB 1G7JB 5J6HB 5IMOA 1ORSB 1QHOA 3GJFA 2WM0A 1S7SA 3TT1L 3H3PL 2CXKA 1H0DA 3QUKB 1T1YB 5I30H 4BFGA 4HUWB 4V1DA 4HHAB 1JHLL 3L95B 4J8RA 2XOTA 4EOWL 5ELIA 2MNUA 4KKLC 4RZCB 3WFHA 1WBYA 3L7EA 3BPNB 2FGWH 4PJBE 4OZ4A 3SDXF 1ZSDA 3D0LB 1IGMH 4Q2ZA 4RGMC 2EKSB 4LQ1A 1H15A 1H3GA 1T66C 3GMLB 5F1NA 1TTUA 4DGIH 4M93B 4JN1H 1NMAL 4OB5L 1OTUD 1FLTX 3MX0A 3V0WL 4JEGB 4Z7VE 4R97C 4GRWE 4CADA 1VADA 3NIDF 4H20L 3IDXL 5F7WC 4PJ9D 1RZ7L 4M7ZC 4CU8A 1I8MA 5EPMB 4PTUA 2VNCA 4P5TD 1JFQH 3RHWF 2OR8A 5F9DC 1R24B 4JLRB 3CMOL 1FNGA 2AV7B 2VC2L 5EORL 3RL1A 2Q3AA 5GGVY 4G9FD 3T2QA 1DBML 3KVQA 5IQ7L 5JA9A 1NFDF 4HCRH 1FL3B 4OKDA 3BOVA 4MA7H 3ILPA 2J4WH 3MRGB 3QYCA 3VGDA 5BOPA 1NKRA 4AYFA 1JZ7A 1NLDH 2PTVA 4LMQI 5CHNB 1XT5A 3QUZC 3TVMB 3ARZA 1DANU 1QNZL 3VGAC 1G1CA 4OF6A 4NM8L 2B1HL 3MXVL 2QADD 2QKIB 1KCVH 2BK8A 1NCWH 4LSRL 5DYOB 1ZWIA 2FR4A 3O4LD 3ZL4L 5D7IF 4DGYL 2JJWA 3CFBB 4P2OB 5A2IH 1NCCH 2CUMA 2J8UE 4PB0H 3OQ3B 4QXGL 3C09C 3GMNA 1BM3H 3Q5TA 4IJ3B 4QY8A 3BPLC 3UPCA 2APVA 4NO0A 2ESVE 5CZXD 3EJYC 1X4YA 2NY6D 4NN6B 1MCJA 5T1KA 1EGJL 2NQCA 4J2XA 4XP4H 5EC1B 1K9TA 5FM4A 3QFJE 5F1KC 1HSAA 3SDCB 2R39A 2VABB 4UBDD 3CX2A 4NQDA 4JGUA 5K9OA 2EECA 2VUOA 3JTTB 5JHDE 2YN3A 3S34L 1JF6A 2IAMB 3JZ7A 4LRIC 3FT2A 3GSNA 4NUJB 1YY8B 4P46D 2DKSA 5HGDA 5M7QA 1UCBH 4YXKH 3X17A 1C12B 3U4AA 4LFHD 4RQQA 4M5YL 1QBAA 1YEDA 2Z0BA 4M43L 1J9CT 4MAYC 1BBJB 3HUJB 4PY7A 1AO7E 4G80A 4DVBA 3U36A 3VH8G 5GGVH 4NCC1 1SM3H 4EUPH 2W59A 3BZ4B 3VFVB 4X7DC 3MRIA 3TFKC 3ARUA 2H3NB 4RGNC 5DJ8A 1HCVA 3C5SB 1P84J 1P2CA 4W6YB 4X9FA 3NIDE 2B4CL 4ODXB 4LCIH 3BDYL 2FYYB 4RGNE 3CLEH 3LDBC 2I25N 4B0MM 5D7KE 1NQBA 1D5MB 5E00B 3JWDH 4PJ9B 1BFOA 4R3SA 4Y8DC 4OFYA 1E6JL 3IKCB 2VQ1B 4JZJC 1QYGL 3BEWA 3TIEB 1QLFA 3OGCB 4DCQA 1NFDE 4NQEA 4X4YB 5I8OH 2NYYC 3TJEH 2DQJL 2Y23A 3GUTA 4FN0A 3QEUB 1EAJA 1M7DA 2XFXB 1LDPL 2VR9A 4G9FB 5LQBH 2DM2A 5B8CA 1NKOA 3QO0B 3CFKB 5I16A 4KJYB 4LVHB 4MCYB 5H35B 1FBIL 4I2XB 4ZUVB 4GMTH 4R0LC 4WI4A 5DK3A 1I9JL 1IEBB 1M7IB 4PRAA 2YD7A 1Y6NR 1NL0H 1S9YB 5D1ZA 3E6HB 4KQ4H 3QIUD 1V7NH 5D7IE 4FZEL 1T1ZB 2QADB 3FQTB 3BO8B 3QEGH 3SPVA 4KK6D 1CU4H 2FJHB 4PJIF 3LKPA 4AEEA 4TTDC 1PGRB 2BSSB 3O4LB 4Y4KC 1A3LL 4P9HH 5KSAD 4YH6A 1OAUL 3BPCA 2VDQH 3AB0B 3NZHL 3OB0H 4GXVL 1GGYA 3SDYH 4RMVA 4RMUA 1VPOL 3P9LB 2GW5A 5CKAA 5DURD 4U49A 2Z93B 5FYJL 1WVZA 5T3ZD 5L2KA 2AAVA 2WINB 1T2QL 2AVGA 1QFUH 3X13B 4NNYA 1TZHB 1WTLA 1S7QA 4X80H 1K2DB 3VCLB 3EOTH 1BPVA 2IAND 3RNKB 3RWDB 1OGAB 4JO2H 4LHUA 3RJQB 3ULSB 4OAWB 3FQWA 4DFHA 5DMIL 5MEPB 5FB8A 4FXKB 4I5BB 3VXSA 4WHCA 1FFOA 4P46B 1N4XL 2X4PB 4PJ7B 1EPFA 2H26B 3SJVB 4G5ZH 3HNTL 3QDME 4JQVA 4MLSA 5DHYA 5INCB 1JK8A 1KELH 1B6UA 3BEVB 3FHAA 4HULB 3CX5J 4QRSB 2YRLA 5DMYA 3F6IA 1JN6B 1BWMA 5DVMA 3RDTD 2WUBH 5E7BA 1KTKE 2R0ZH 1RUMH 5DZNA 3T0DA 1L0QA 4NC2B 1F2QA 2F8OA 5EB9A 1RVFL 1MF2L 3Q3GB 2F74B 3DSFH 2VXUL 4F7EA 3KG5A 3VGHA 1AQDB 3TN0B 5JOEA 4JDZB 5ITBH 3ARED 2R2HB 4MVBD 4QF1A 1L0XA 1A14L 2P8PB 5DJ6B 4NKDB 3DGGA 3VXUE 4HPYL 5ACZB 2EZ0D 5ISZA 3NFNA 5IB2B 5KTEH 4U6VH 5IIEB 1FNLA 2QHLA 5F7UA 3UMTA 5JOFA 1U3JA 4NWTL 1N2RB 4Q0XH 3I6KB 4JKMA 2R29H 5C09A 1A4JA 4QRQB 1RU9L 3QCTH 4AIOA 5DD0L 4K8RL 3GHBL 3MRLB 2X4QB 1ZHLB 3FN0L 2GFBA 2DTSA 1ZMYA 4TTGA 3IS1X 5GGSY 2PO6A 3BP5B 3A6CH 3OR7A 3PDDA 4KRNA 1TJHH 1U8LB 4GKOA 1INEH 4V1DE 4U2YA 3V8CA 2FECL 2RBLA 3LS5H 3SO3B 1I1AD 1Y0LB 2DI7A 4WFEE 2DJ4A 1CFQA 1TQCB 1XFPA 2Q6WB 3EZJB 2A9NL 5LAXA 1QR4A 3VDBA 2LQRA 5C0AA 4CN4A 4N0RA 3ILQC 3W11C 1XIWA 2FJFB 4ACPA 4L4TA 5AWNH 1YJDL 3DGCR 3TLRA 5AAMA 1TETH 5L7XH 1DBBL 3GRWL 3T2NL 4HIJA 1L7IL 4QHLB 5C07B 1RIVL 3O2DH 4K7FA 3UZEA 3DVGA 5KSAB 5SX4I 4MD0B 3CGTA 2P8MB 2ESVD 1KLUB 3DTXA 5DURB 5MEND 1ZLWH 3DJ9A 2XPGA 2JB5L 1N3NB 4HZAA 4KWUA 3VXQB 4IOFD 5CEYB 3S35L 1IL1A 2X7LA 3TGXA 3QISA 3RVVD 4LPXA 3IDGB 2PETA 3DX9B 4MMXC 5AUMB 2X4OB 4HIXH 3UYOD 2IPUK 4UV7H 2NW2A 3IJYA 3FO2A 3B8YA 5FO7B 3LQAH 1FE8L 2FEDC 2IANB 2ZUVA 2XQYG 5I66B 3NCMA 4LSPH 4UQ3A 4XP6H 3FN3A 1QFPA 3TBWB 3H3PH 2E7HA 1IBGL 1A6VH 5TDOB 5DJYB 3QJHB 3CVHA 4JFPA 5EIVA 1K85A 5IVXB 5FM5O 3WIHH 4OUUA 4EOWH 4F3FB 3VXOB 1RUAL 1KB9J 5GS2H 2Z91A 5ERWA 3LS4L 3O6MH 4RMTA 2J88L 3RAJL 5GSVA 2I07B 1G6RA 1S8DB 4PRPD 1T3FA 3RDTB 2R8SL 1MH5A 1A4KA 4ZQKA 2YK1L 1I85A 4EDWH 4XCYA 5CJBA 5T1MA 5FYKU 2HFTA 1F11A 2Q76A 3BVNB 3T1FA 4ORZC 2BHYA 5EU4B 4H20H 4YZFF 5FUZL 1U6AL 1GGUA 4N9GB 3AREB 4NQCA 2PYEA 5LXGL 4Z0XB 4Z7VB 1C08B 4GRWB 2FECI 4NQDE 3CMOH 4P2CG 2VC2H 5EORH 4EN3C 3E3QE 3DARA 5AG9A 5KVFH 4WUUD 4L8CA 1J05B 1IM3B 1DBMH 5DJXA 4NZRH 5C6TL 5JOPE 1D5ZB 1IQDA 2XTJC 5DI8B 4G3YL 1OSPH 1WWAX 3MBXH 2VN7A 3EIFA 4Z7UB 3SEPA 2F54A 3PJSA 2NYYD 5HPMB 2VDOL 3L7FA 4Y0GA 1QNZH 4X83A 2X6MA 1FAIH 3G6JA 4RX4A 4P9ML 4MQXC 4GBXD 1G0XA 3D3VA 4IBLT 4LSRH 1I1AB 2I9LA 3X12A 5C0DB 2AXFA 3ZL4H 5GS0C 4DGYH 2IF7A 2R2BA 4NQUA 4MA8H 2Q3ZA 1I7RA 1C8PA 4QXGH 4KAQL 4MNHA 1EIBA 2EDYA 1NC4A 1HOCB 3ZT7A 1ZT1A 4GKZA 3OJVC 5I1HL 3C5JA 2R23B 2H41A 2VWEC 1EGJH 3HHRB 4I1NB 2QEJA 4YGAB 3GSVA 4NQEE 4PJGB 4NBZB 1RK0A 2JB6B 5MENB 3U82B 1F8TL 3MLPA 1QRKA 2VWEE 3S34H 2EDOA 2W0FA 1GHFL 2DM7A 2E8ZA 1G7PB 3D2UB 3HKFA 5D1ZC 1RD6A 4K2UH 1U8OA 5F1SA 3AMLA 2YN5A 2JJTC 1ZS8B 1MCWM 4M5YH 2P5EA 5KN5A 3MJ9H 4K9EL 4JY4A 1HHKB 5EWIH 3QULA 3CH1B 3STBA 1DEEA 4IMLA 1W8OA 4CDGC 4J1UB 1IC7L 1WICA 2IPKA 4WUKL 5D1XA 3SDXB 5EN2B 3ZDZE 3NFPB 3L5XH 5HDOA 1X7QA 2ZUSA 4MNGA 1N5YH 3TBYA 2Y5TB 1FSKB 4PRPB 2B4CH 4YZFE 3VFSB 5F70A 4KDWA 3O3UN 4HGMA 3U83A 1E4XL 2EDJA 5DHVA 5L2KE 2MQ3A 2VZTA 4MB4A 4L3CA 4HJGB 4BH8B 3BDYH 5HPOA 1HKLL 1D5IL 4D8PB 1KG0B 1S78D 3CZFA 2NY1C 3L3HA 1I1RA 4KPHL 3OB8A 2EYRB 5ICZA 5K59F 5F6HJ 3OAZK 1DJSA 5BZDB 3MLWH 3UTPE 1BGXL 3IKKA 5F8QC 3BSZL 4UAOC 3VXSE 1S7RB 5J1AB 1LDPH 5DR5L 4WUUB 3D85D 4PGZA 3J7HA 5EFIA 4M1DH 2CLVA 5HY9A 4TSBH 3HI6H 2VZ1A 3NH7H 1MFEH 1X5YA 5FKPB 1DUZB 3FO9B 1E4KA 4L8SB 5IT2L 3U4BL 5D9SB 1I9JH 3BAEL 4KH2A 4N0UA 4LLVA 1R3HB 5CAYB 1OQXA 2YRPA 4X9IA 5JUEL 4PYGA 2YA1A 1E27A 2B5IB 3GIZL 3TCLB 2EYSB 4WFED 2HFGH 3DIFB 4GBXB 3J8F7 4XB8A 5J06A 5BMFL 3K2UL 1EH9A 1MSPA 5BV7C 1OARL 3DVFA 4P5KA 1U95B 1A3LH 5C9JB 4PBXA 3WLBA 1M05B 3GBML 1RIHH 4X7EC 3WUWB 4XRCB 2MCPH 5IROA 1SMAA 4YEEA 4E41B 2G2RA 3JXAA 3MRDB 5CWSB 5GSRB 4R9HA 5GZND 1G7IB 1IC1A 3RWCA 2KH2B 2Y7QB 5ISZE 4P57A 1T2QH 4XPHH 4Z5RA 3GSRB 1T2JA 1CD1B 3STZA 2HJKA 4OCXL 3EYVA 2NXYD 1KENL 5C09E 4GS7C 2PO6C 4OF3A 5D1QB 3OKOB 4S2SB 4BA8A 4BSVA 4X7CC 3TH2T 5JPMA 1Q9KA 2HVKA 3TA3D 2AQ3A 5DMIH 1ZLVK 2XWBB 2CRIA 5ICXA 3DUSB 1H3UA 5IVZB 5FOBB 4J4PA 1IFHL 1N4XH 5ID1B 4HWUA 5EIIA 2H8PA 4H0HB 4QWWC 4X6DA 4AT6A 1E4XI 3G5VA 1U8IA 2FEDD 3A67H 5C0AE 4F7MB 4HWNA 4GRLA 2DYPA 3CFJB 4L4TE 5F6HI 3MJ7A 4OCMC 3FFDB 1DQLH 4XCEA 5J12C 3IFPB 5AEAA 1FV1B 5TPWL 1WBXB 4HJJH 2AEWA 4NO5B 5T1LA 2MQ0A 3EYFA 4PTTB 3RIAK 1RVFH 3U0WH 1MF2H 1RZJL 4JZNA 1KLGA 5DZLA 3TF7C 4Z9KB 2VXUH 1KNOB 1MWAA 4Y16A 1DE4A 1HXMA 4HWBH 2VLKD 3V4VH 4NO0D 1A14H 1TQBB 3KPPA 3O4OC 3DETC 3AGVA 4HPYH 4LSVL 3ZE2F 3MROB 5TH2B 3CSYB 4KKAC 4DFIA 3G5YA 2AV1A 1SYVA 3OXRB 5IMLA 3HAEA 4HKJA 4GLRI 4NWTH 4R8WH 4KKNA 5CSZB 3ESVF 1FRGH 1KJ2L 3EOBB 1HDMA 4KMTL 1RU9H 4U6HA 1J10A 4I9WE 1CLZL 4K8RH 5DJCB 4U1NB 4JY5H 2YA2A 1X5LA 4YHLL 2QJDA 2MKLC 4IIQA 2GSGA 3FN0H 3GSUB 4QOKA 3AROA 2IC2A 4UDUB 5DDHB 2UZYB 1T7YA 3D85B 1HQ4A 2IAMC 1I8KA 3VFUB 1F00I 2O26U 4LSDA 3VD5A 1MQKL 4H26B 3QPQD 4LLYB 3C6LD 4AQ1B 1EJOL 1R3JB 1I85C 5J1TC 4C59B 2CDFA 4X9GA 1QR1B 4OCRL 4PJCA 4GQ9L 1Q0XH 5JLZB 3GB7A 4U33A 1W72A 1JWMA 4LAJH 3TH4T 3O11B 1YJDH 2AP2A 1EEZB 3P30H 1T04A 2YMXL 3E1F1 1U8PA 4K23H 1UVQA 4PJIB 1BQLL 1EMTL 3GRWH 2Z8VC 4LEOA 1L7IH 3P0VL 2EXWC 4HC1L 2ZSVA 1RIVH 1CGTA 3ET9F 3VXRA 4WO4D 5GJTL 4NHUB 5TDNA 1YYLH 4NQCE 5HDQH 4A6YB 2PYEE 3QA3A 1T7WA 3SKNA 5DA0B 3N1QC 5CBAB 2DD8L 3EYQC 4K3HA 1Q8MA 2CPCA 5KSBA 4KRMB 4OFYD 1NUGA 1VSCA 2X1WL 4PTUB 3MRNB 4K94L 2NXYB 1ZT7B 4XPAH 5A3ID 4M3KB 1UJ3A 1KPRB 1FYTD 3RY6A 3VH8B 4JZOB 1QLEL 2UWEA 1OB1B 3HMWL 2WBKA 3ARPA 4S1SL 3TA3B 1JGEA 4TSAL 4ELMA 2F54E 3PGCA 5GS1B 2W9EH 1T0PB 2RGSA 4NYLA 4MLIA 5IGXH 3KLSA 4O4YH 1IBGH 5JMRA 4GAYA 2O61B 3MNWA 1K4DB 3G6JE 3HAEG 3A0OA 4WI5A 4OZFG 5IFJA 1L6ZA 4LASL 3D3VE 2W9DH 2FJGA 3CXDL 3MRMA 5TGBB 1GRWA 1MY7A 3PUCA 1MFBH 5H37H 2NY5H 4Z7OF 1BWWA 3LS4H 5EA0H 3R4DA 5E94A 3RAJH 1Z9LA 1MIEH 3C5ZD 1MRCH 4NJ9L 4ZPTA 1ZWIB 2FR4B 4YBQD 2YEZA 4HBCL 5BO1L 2W60B 2F15A 1M71B 5LGJA 1GOGA 2J6EA 3LZFH 5GGTA 4JVWA 3PWNA 2NLJB 5F89A 5JHLL 4X8JA 5KOVC 1CE6B 5L2KD 4JG1H 4MXQC 2VLKB 5FFLA 1JTOA 1JPTH 5IJKC 5LXGH 3B5HA 2DL9A 5ID0A 3B2UD 3C08H 2Q86A 3LOWA 4PR5B 1N8ZA 4DVRL 4XVUC 3GFUA 3PIQB 4WU5A 3ZHLA 4O9HL 3FT3A 4P2YA 3M45A 4ODTH 4YDKH 1T4KA 5C6TH 1CFSA 2DM4A 1KCSH 5IBTH 3O2WL 3LN9A 4G3YH 5KVGH 4D9LL 2P5EE 3FT2B 4P59L 4BQ9A 1DP0A 1LE5A 5C6WH 3QG6A 4NQXA 2C26A 2WWMC 4PG9B 4X6DF 5T5NG 4P9MH 2GJZA 5DGQA 3Q2CA 5HGHB 3C6LB 3FB6A 1SY6L 2AXGB 1UM6L 4FFZL 4NN5C 1GGCL 4MNGE 3BH9A 4KAQH 5DMGD 4UNVA 2NPLX 5DMKB 5MEOA 5GQBA 5F7EH 1AR2A 4AM0A 4TNWF 5DJ8B 3FAWA 5I1HH 3ZKNC 3B9KD 4ONHB 3D87B 5I71B 4MA3A 4OLZL 4WO4B 5ISZD 3W9DB 5J56B 3TN0C 3G6DL 5HBBA 1P4LA 3CLFL 4HLZH 1EEYB 2X4NB 3MRQA 1E4KC 1QFWI 1TZGL 3JV6B 2Z31A 5K9KB 2RCSL 4LPYA 4WV1B 3FT4A 2Q7YA 4O5LH 4QRTA 3SE3A 4PIRF 1FYTB 4E0RB 3TYGH 1NCTA 2R1WB 4XMKL 4IHOB 2MPAH 3VFOA 4N0UE 4G6ML 4HF5L 5B8CB 1UXWB 3TNMB 5C0ND 5DEFA 1FFRA 4K9EH 1HHJA 3QXUA 2ATKA 1IAII 3WXVL 5EUOA 5I0ZA 4ZFOL 3MR9A 3FAXA 4FA8A 5SWSA 3RWFB 2C1OA 2BOCB 3L3DA 3LD8B 5IROC 1MREH 3QUMH 1HWHB 4F9LC 5F7HA 1VACB 2P47B 3HZYA 1UH4A 4U0RC 4WUKH 2AS5M 1XIWD 3EO9L 3WDHA 3T3PF 1E6OL 1HK6A 1J0IA 3C5ZB 2KQNA 1CGSL 1UB5B 1ZA3A 3KYOA 1VEPA 3CDYA 4LPCA 2Y06H 2EC9T 3QXDA 4QGYA 1PSKL 4UV4L 3HZKA 1CFVL 2D7TL 4YHZH 1XCTA 1OAYH 4OI9A 3P11L 1S7UA 1HKLH 1D5IH 4J3SA 3SGEH 2PW1B 2H32H 2YD9A 3G5XA 5MERB 5T33H 2EICA 1NLBH 1IQWL 4J3VA 5DVKA 3QEHA 1BOGB 1WGOA 4J4PC 1PG7W 4XNZB 4HV8A 4UIKL 5E8NA 3RL2A 5T5NF 3LRGA 2JCCB 5F7YC 4N0FB 5B39A 1S7QB 4ZNEA 2BVPB 2SEBB 4U1HB 3O3EB 2ED8A 4I9WD 2UWEF 1E28A 2D9CA 5C2UB 4GRLC 1XF3B 4ELMF 5JW5B 2HN7B 5EDXA 1NFIA 4X5XA 4X6DE 4HDIA 5BV7L 5C0FA 5IT2H 1FFOB 2F19H 3LN4A 3BAEH 4CMMA 1VKXB 5I2IA 3RWEB 1MLCA 2HYMA 3RIFK 4MDIA 2IQ9H 4KI5F 5GRZA 1IAMA 3WS6A 4Y16C 9CGTA 1JK8B 3IU3A 4Z78B 4I4WA 3K2UH 3V5HB 2AEPL 1Y18B 1VFUA 1XGUA 1EFXD 4PJAB 4QYOA 1U8QA 3L3IB 1UENA 5EOTA 1LNUA 3GBMH 1B9ZA 5I8EB 3MRFA 4J3TA 2B7DT 2VZ3A 5ALBL 3RWHA 1EEQA 4V2BA 4UT6L 1REIA 3GBLA 2P24A 4DUWA 5F96L 2WLZA 4M7KL 2BY2A 2G5BA 3UTZA 3VFRA 5FM8A 2E27H 2AJYH 3B9KB 4IIQC 2PYED 2DWEA 1IM9A 2XA8L 4QF1B 3V95A 1KENH 3DGGB 2NZIA 2FEEL 3STLA 3BPOC 5ISZB 1FO0A 2DLFL 1TJGL 5JOFB 5L2JA 3IFOB 4QOKE 3GBNL 4AENA 1CXIA 3U0PB 3MOQA 2C3VB 3WIIH 1IFHH 2ITDB 3PWPD 4M5ZH 2F54D 4AZ8A 1H3WM 3INUH 1IGIL 4LDLB 4TYUA 3B5GA 43C9B 5DJAA 3S35X 4CNIA 4JDTH 4PJCE 3HB3D 1MCKA 3T3PE 3ZYIA 3RX8A 1UQSB 1CFQB 2BSRB 5K33A 5C0GB 1I1YA 4JFYA 1S9XB 3O6KL 3SKOA 5TPWH 3R06A 4M7LL 2A83B 1H5BB 1XIWB 1WC7A 3SOBL 3ALXA 3VXRE 1NEZB 1FVCA 4MS8C 4XGZA 1G7HB 5KVDL 1CL7H 5D2LB 3UP1A 1UJ3C 1CCZA 2YD5A 5IFHL 2A1WL 4WHTB 4R2GD 4XH2B 1F42A 4LSVH 3RY6C 3PHOB 5KSBE 1ZHBA 1OTTD 3AVEA 3QH3B 1J0ZA 5JMOC 4G8FB 4HKBB 5T3XH 1MCOH 3V4UL 1LHZA 1K4CA 1G1YA 4S0SD 2UWEE 1IGCH 5L0QB 5DS8B 3BZFA 4ELME 1PQZA 2HTKC 4KI5C 2EIBA 4OV5B 3CFDB 4LCYB 3TT3L 1RK1B 4HKXA 3HRPA 5K9JH 4YR6A 2HFEB 1R3KA 1RJZB 1IGFH 4KI5E 2DQDL 5E1AA 3L3GA 5KSUB 1EJOH 3UJIH 4N0YL 1N59A 3FRPA 3I9GL 5EUOF 5H94B 4OCRH 1T21B 1W0WA 3OAZH 2XY1A 3HTLX 4XMLH 3RX7A 5D1XD 1EHNA 2YMXH 3C9NB 2VR4A 4LF3B 1I3UA 3FOLA 3QHFL 2ORBL 1T3FB 1EFXB 3P0VH 4C83A 3LEYH 4DZBB 5F9JA 3DX8B 3LKQA 2E6PA 4HD9A 2VXTL 5C1MB 1IAOA 5F9WC 4LVEA 4LSQL 1WWWX 1FSKC 3OZ9L 1VERA 3FZUD 4KROC 5I1AB 1RI8A 2PYEB 1H8SA 3HNSH 4K94H 1HHHB 5DD3L 5HGBA 3HI5H 3IRPX 3VU2A 3ZKND 3NACL 2BY1A 4WTWA 1PZ5B 3TBTB 3MRBB 4XBEH 5EUKA 4OKVB 3QQ3B 1JI2A 4XNQB 4S1SH 1UXSB 3PQYA 3H42L 4WFGE 1NBZB 4Q9CA 1BX2A 3CK0L 5D70H 3KXFD 5IW6A 3PWPB 4RMRA 1MJJA 3MV01 4FQLH 3CFEA 4HUUA 5D72H 1G7MB 4GFTB 2QQNL 5IHUH 5BS0A 4LARL 2EE3A 3FB5A 4OM1L 5FGRA 1OGTA 1ZT4B 4U6YA 1T7XA 3P73A 3S37H 4HBCH 1ZLVH 4MCZB 4KXZH 5ALCL 1OPGL 1KT2B 3D39D 2Z31C 4O2EB 3WN5A 3VFNA 5EZLB 2KBGA 4OQTA 3SE3C 1ZT1B 4EVNA 3W5MA 2J8HA 4OCWH 4R2GB 4XPBL 2YKLL 1X5IA 3K8LA 2X42A 4DVRH 3CCHA 4D94A 3GMMA 4ONOA 1Q1JL 4O9HH 2NY3D 2A77H 4JO3L 1WBZA 1A6AA 1S5HB 3O2WH 5IHBA 4D9LH 2GAZA 2DLEA 1A9EB 1G7LA 3B9EA 5J11C 5EOQL 2ZSWA 5HD8C 5DJ0A 3C6SA 5EUOE 3RWIB 1MFCL 2NNAA 1X5JA 3HPJA 5SWSE 4LNRB 4JKPL 3MLTA 1OF2A 5KN5B 3BIKB 3ZTJG 1FGVH 4JY4B 3D0VB 4PGCA 3FQRA 3IDNB 2EE2A 2DYPD 1SY6H 2IQAB 1UM6H 1HSBA 1M6OA 4FFZH 1DLFH 1I3RA 5EO1B 2VB5A 3VD3A 1MFDH 2C3GA 2W07A 1F58L 4MJ4A 1CDBA 1INDH 1Q0YH 5EBMB 4JRWA 2HH0L 2OR9L 4KQ3H 1BD2D 3DRQB 4Y4HC 3QXAA 3TNNB 4D3CL 3I75A 5DHVB 4OFDA 5DGRA 4L3CB 2AI0H 3SY0B 3G6DH 1AGDA 5I8CA 3BISA 3CZFB 3GM8A 1Z5LB 4L4VA 1V5JA 5JPNA 1TZGH 4ZNEE 1P7KA 4N9OB 4YPGB 5DVNA 1HIMH 4M62L 4EKXA 5JORB 3ROLA 4EBQL 1G9NC 3OAYK 2R1YA 1II4E 3O6LH 3PL6C 3WS6C 1I1CA 5MEQB 2F9BT 5DRWA 5ANMA 2UYLB 4QRPA 1MLBA 2OXHA 4X7SL 4P5MA 5M95B 2B0SL 2EIZB 3KXFB 2VLME 5F1IA 1JGDB 3GMOA 1ZLSH 1NGYA 3WNMA 3LRSA 4PJDA 2IALA 3O41A 2VITB 4M8QA 5BOZG 1NH6A 1E6OH 1CK0L 4KJPC 1B0GA 1CGSH 4TVSa 3PDGA 4LLUB 4P5KB 2RJMA 4N0CD 2CO6B 3IXTB 5T3ZL 1YPZA 4KTEL 5FECA 3KPOA 1AD9A 3L5IA 3VDCA 3D39B 4C58B 3PF2A 4WWKA 4PJXB 2BC4A 1JF5A 3V7AE 3RZCA 2OXGA 3QFDA 4M1GL 3MLZH 4NFCA 1Y6KR 4HMEA 2R0LH 4ONFL 1CDYA 1U8MA 2NY3B 4YUEL 4PLKC 2R9HC 1BHGA 2P43B 1KN2L 3RHWK 3ARBB 1R6VA 5C0JA 1Z9SA 1QUNA 1FLRH 4U1LB 4ZFZB 5FDWB 1VFBA 1X5ZA 1CDUA 3OWEA 3FRUA 4N8PA 4X6DB 2NW3A 2BVOA 1U8IB 2UY6A 3CFIC 3MREB 2BNQB 4YO0B 1F97A 1KYOK 3ARFA 1J0YA 1SHMA 5KANI 4JO4L 1CDIA 2DDQH 4UOJA 1HI6A 3N50A 1TITA 4M6NL 3UBXG 4H25A 5JO5B 4PJHF 5DEZA 4JZNB 1IGYA 4HG4K 4M7KH 2EXYC 4ONGL 1DE4B 1A22B 3PNWB 1BD2B 1WCBB 3KPPB 3MRJB 5SWQB 1P7QD 2G75A 1TENA 3JBG7 5K93A 2DLFH 5IMLB 2ICEA 5DVOA 2HFFB 4OZFB 4TQEL 4I0CC 4AL8H 4HAGA 4HX1B 1I4FA 3TJHC 2GK0B 4QHNA 4L8DB 2GSGB 4W81A 4QO1A 4YHYC 4WFGD 1IGIH 3BKML 4NSKB 4B50A 3ECBA 4K71B 2ZUQB 2V5MA 3N0PB 4XWOC 5CIPB 3ZHDA 3HRZA 4GH7B 1NCDL 5IQ9A 4PJ8A 3VGFA 3B2VL 4JPIA 5L8KB 2GITA 1JNLH 3CXHJ 1OLZA 5C0BD 5J4MA 5JW4N 2DQEL 3RBGA 1XR8B 3O6KH 4XTRC 3QUXD 3T8XB 4M7LH 4K3JL 4APQA 1A6UL 3QXTA 1W72B 1JNNH 5E2JA 1RZFL 5HHPB 4WY7L 1U3HA 3GKWL 1G0DA 5BXFB 2RQ8A 4OSUL 1KACB 3BKJL 3F5WA 1SJVA 3NTCL 3K4AA 2GJ6B 4AH2A 5TDNB 2PXYB 1CD8A 3QA3B 7FABL 4WJ5A 2AQ1A 5GS2D 3SKNB 3X11B 1CXHA 3V4UH 3N06B 3UPRA 4PREA 4XC3L 1J1PL 2GHWB 2OZ4A 4N90D 3L3KB 3S37X 4HQQL 4LKCA 1BZ7B 3L5JA 1I9RL 5IM7A 1D6EB 4JR9H 3PQYE 4LQFH 1CFTA 4O2CB 3LKOA 3UEZA 1QZ1A 1FZOB 4K07A 4KKBD 3LPWA 4ODUB 2ADFL 5CJOH 3TPKA 1CI5A 4N1CA 3HC0B 2CKBA 3QIBA 2DQDH 4FQXA 4BSWA 2Y1VA 4G7YH 4FHBD 2VZSA 4P3DA 4N0YH 3VWJA 5BS0E 2CIIA 5SWSD 1V05A 4DN3L 2YD3A 1NJ9B 4ZNCD 4LLQA 5IJVA 2ITCB 3UDWA 1CGYA 4PP2A 1A6PA 5I75B 4PJDF 3H8NA 5E9DA 3WN5C 4IS6B 2YPKA 3HLAA 5C3TA 3OHXA 1C5DA 3VW3H 2GTZB 1UA6L 3QHFH 2YSSA 5KG9B 4BQBA 2D0FA 3KPTA 4B7LA 3H9HA 2VXTH 1YPZF 4LSQH 1SVZA 3EO0A 3OZ9H 3H9SA 1D6VL 3CNKA 5CEZE 5HHMB 4P2QB 3QG7H 2HKHL 1BQHA 2I5YL 1P7QB 3EJZD 3MV7A 2Q86B 1N8ZB 4N5ED 1LEIA 2CUIA 3ALWA 1YEHL 1P1ZA 5JA8B 3VG9B 2FLBT 5LGHL 3H42H 4JPVH 1ODAA 3T0WA 3FJTA 4JQIH 4FXGB 4NC0B 2NCMA 3ARDA 1XGQA 4F7TB 3CK0H 1QVOA 4YFEA 3SQBA 1LD9A 4JREC 3MJ8A 4HH9A 3L3JB 5E99H 4GKSA 5HYIA 3MMEA 4Y5XA 2QQNH 5IW1A 1ZVSB 3ZE0F 3DV4A 1KB5H 2ICWB 4IOIA 4OM1H 3JWOL 2R2EA 3LRHA 2QSCL 5C0BB 3FB6B 1QFOA 2YPLA 1HH6B 5F6IB 3PGDB 5GRJL 3QUXB 3RU8L 3S5LG 3U4EA 3VI4F 3P0YL 5FV2A 2D0HA 1YMMA 5IG7A 3SKJH 3MRRB 5ALCH 1OPGH 5MEOB 4RGOL 4JFOB 3DYOA 2VLJA 1FNFA 4L4VE 3GSOA 1GC1C 1I9IH 4CVUA 5HJ3B 3MNVB 1IM9D 4MA3B 3BP7A 2ATPA 5I1LB 4FQIL 4TRPL 4KHXL 1R3LB 2EDBA 1Q1JH 4XB7A 4PGBB 4XVTH 1T1XA 1A8JH 4F7CA 4JO3H 1MHCA 1BBDL 3ZDXF 5GGSB 3IDIA 4WFHE 3GIVB 4W6WB 5ANME 2XXMB 4QRPE 3DOSA 4POUB