2R2NA

The crystal structure of human kynurenine aminotransferase ii in complex with kynurenine
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
425
structure length
425
Chain Sequence
b'MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase mitochondrial
publication title Crystal structure of human kynurenine aminotransferase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 135
structure length 425
sequence length 425
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2r2nA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2r2nA03
4LW4A 3WZFA 1MLYA 3WKSA 2OGAA 4WYDA 1DJEA 3JWAA 1KKPA 2PB0A 2VMQA 1LS3A 2VYCA 3PIUA 1BQAA 5TF5A 2CSTA 3A9XA 2E7UA 4A0FA 1JG8A 4W1VA 3T32A 1BKGA 2ORDA 3GETA 4A0GA 5J8QA 2Z9WA 2WKAA 2VMSA 5HHYA 1C7OA 1ARHA 4E77A 2Z9UA 2VGTA 1ZC9A 4WYEA 4WB0B 1UU1A 1Z3ZA 1BJOB 1PMOA 2F8JA 4KYOA 2W7GA 2VMOA 3COGA 3D6KA 4OTLA 3W1JA 1KKJA 2VGWA 3NUIA 3NRAA 3AOWA 4TN4A 1ARSA 1B8GA 1IAXA 1UU2A 2YKYA 1M0NA 1S0AA 2ZC0A 3E2FA 2BI1A 4WYAA 3NUBA 4IX8A 2G6WA 4F5JA 1AAWA 3QI6A 2QB2A 4ZASA 1D7UA 1WKGA 3FQAA 2EZ2A 3KGWA 4KXKA 5DB5A 2QBTA 4ZM3A 2HP2A 3FDDA 2ZY3A 3A9YA 3MADA 3PAAA 5EAVA 3G7QA 1FG7A 3RCHA 4A0HA 2DR1A 2CH1A 3DRDA 3EI8A 1J32A 4WBTA 2YHKA 1WKHA 1BJOA 1WYVB 4LNJA 4N0WA 1GEYA 4F5HA 3LWSA 3PDXA 1C7GA 3AEMA 4WLHA 4BA5A 4JEYA 1DJ9A 4LNLA 1S06A 1H0CA 1AY5A 3LVKA 3K28A 3LVJA 1QISA 2CJHA 3BN1A 5G09A 1JS3A 2DGMA 2JGTA 4K2BA 1S09A 4A72A 1Z7DA 5LH9A 3AEMC 4TMRA 1N8PA 2BIAA 3DR4A 5EQCA 3ZRRA 2HZPA 4FL0A 3B1DA 4GE4A 1TPLA 3MAUA 4TV7A 4DBCA 2W8JA 5G4IA 4ADCA 3GJUA 4ATQA 5M4BA 1EJIA 4A6TA 3MAFB 4Y0IA 2JJEA 2HP1A 3AV7A 1BQDA 4ADBA 1IVRA 1T3IA 4IYOB 4U1TA 4W1WA 1AKCA 4AO4A 3KE3A 4E1OA 1CS1A 5FT8A 3TATA 2AATA 4IXSA 1GC3A 2FQ6A 2QMAA 1WYTA 3QGUA 1AKAA 3ZRQA 4ZWVA 2VLFA 3NTJA 3EIAA 2HUUA 4W8IA 3QM2A 2D7YA 4P3MA 4GE9A 4ZDLA 1GC4A 1O69A 2YCTA 4P7YA 4MQPA 1W3UA 2VMPA 4OC9A 4KAMA 2OKJA 3ZZKA 4EFFA 3II0A 1YJZA 2ZY2A 3AATA 5G2PA 2HUFA 4GE7A 3MAFA 1QIRA 2V0YA 2ZSMA 1AMRA 1B4XA 2OQXA 3CQ4A 4IYOA 2QLRA 2HUIA 3CAIA 2X8UA 1XI9A 3W1HA 5BJ3A 1KL2A 1RVUA 2R5EA 1LW5A 3AOVA 1SZKA 4L0OA 2AY6A 3FQ7A 1N2TA 3VK3A 2C44A 4R2NA 3QPGA 1DTYA 5DJ9A 1M0PA 1QJ5A 5HXXA 1X0MA 1U08A 2GB3A 2VGZA 4ADEA 4JEVA 2QB3A 3HLMA 3GWPA 2R5CB 1LK9A 4A6RA 4CXQA 3HT4A 1ELQA 2EZ1A 1JS6A 2OGEA 4WB0A 3FVUA 1AIAA 3NYTA 4ZM4A 3NU7A 2GMSA 4M2JA 1V2EA 4OMAA 4ZSWA 1ASLA 1AMAA 3WX9A 4AO9A 3R9AA 1S08A 3AEJA 1ZODA 1LC8A 4ATPA 4M2MA 1AHEA 3WKRA 4BA4A 5K8BA 2BI2A 1YJYA 4MKKA 1MLZA 2BI5A 4RJYA 4PIWA 2W7LA 1G4XA 1ORDA 2BI3A 3FRKA 3ISLA 3KKIA 1AHYA 2VLHA 3TFUA 2BYLA 2D66A 4U2HA 4ZSYA 2Z20A 4JEZA 3BS8A 3AEJC 3UE8A 4BMKA 1XEYA 3EI5A 3GSBA 4UHMA 1IX8A 4XEWA 1BJ4A 4O6ZA 2R5CA 2CJGA 1AKBA 1AY4A 4WXGA 3E2YA 1W23A 2FN6A 3RBLA 3WCNA 1BW0A 2BI9A 3ELEA 1MDZA 4OCAA 2E7IA 2HOXA 3QN6A 4IY7A 2Q7WA 3HQTA 3PJ0A 2CINA 1VJOA 4M2KA 4JEXA 4R5ZA 4WYGA 3RCHB 4ZAHA 1G4VA 3BWOA 2PB2A 3H7FA 8AATA 4OYTA 4E3RA 2AEVA 4DGTA 2JJHA 3P1TA 4AZJA 3DU4A 1FG3A 3JW9A 1AX4A 2AY5A 1E5EA 3I5TA 2ZY4A 2CH2A 4UHNA 4WLJA 5IWQA 1GEWA 5G2QA 2DKBA 1ASMA 2W7KA 3G0TA 4Q6RA 4MY5A 3ZZJA 4Q75A 3GZDA 1PMMA 3JZLA 3FTBA 5DJ1A 3WLXA 3F0HA 1GC2A 1GDEA 1CQ7A 5D5SA 2VIBA 2YRIA 4LW2A 1IAYA 4UOYA 1CQ6A 1LKCA 2JJFA 3BCAA 2W8TA 5EUNA 2BIGA 3GZDC 1AHFA 4GEBA 4W5KA 2VMVA 5E3KA 3DXWA 4A0RA 4F5FA 1C0NA 1B9IA 3A2BA 4ADDA 4WYCA 3VOMA 1UU0A 3NU8A 5F8VA 3BC8A 1LC5A 1DKAA 3W1IA 2W7JA 5C6UA 2X3LA 1WYTB 5AX8A 1M4NA 1TOEA 4GRXA 2W7HA 2VMXA 1PG8A 3FQ8A 5E5IA 1M0QA 4W1XA 3LG0A 3FZ8A 3LY1A 1C9CA 2D64A 3FSLA 2AY3A 1DJUA 3QHXA 5FT6A 1YAAA 1B5PA 3DXVA 1AICA 1SFFA 1CZCA 2ZP7A 2AY1A 1I41A 4H51A 1D7VA 1SVVA 2XBNA 3FZ6A 2X5FA 1AIBA 1KL1A 4UQVA 1QGNA 4AH3A 1IUGA 1AHGA 1M7YA 2W8WA 2CJDA 4J5UA 3FKDA 3FD0A 2JG2A 4Y0DA 3L8AA 1W7NA 4MSOA 1GEXA 3EI9A 4Q76A 1QJ3A 1YNUA 5M46A 3IF2A 1IBJA 1MDOA 4MKJA 1N31A 2C7TA 4RAEA 4AOAA 2HOYA 2AEUA 2RFVA 3A9ZA 1WYUB 1BJWA 1X2AA 4MQQA 1B5OA 2VMZA 3CBFA 5M49A 2VGVA 2O7CA 3I16A 3FFRA 5E4ZA 4E3QA 2TPLA 1ZOBA 2CY8A 2AY2A 4RJ0A 1ASGA 3E2ZB 1Y4IA 1H1CA 4IW7A 3FVSA 2FM1A 3PDBA 1AMSA 1CL1A 1I48A 2AY9A 3UAKA 2ZY5A 3MC6A 3ASBA 4WXBA 5EFSA 1KMKA 2ZYJA 3FCRA 2YKUA 3AELA 1YJSA 1IX6A 1OHWA 3HMUA 1WYUA 2BIEA 3ZRPA 2AY4A 1TASA 3MC6C 1EQBA 1BS0A 2JISA 2Z67A 1ARTA 4A6UA 2CTZA 2YKXA 2VGSA 4CVQA 4WD2A 4EU1A 3E2ZA 3DYDA 3P6KA 1SF2A 1D7SA 1OHYA 2AY8A 1I43A 2W7DA 4F4EA 3H14A 3EI6A 3E9KA 3N75A 1AY8A 1TOIA 4XQ2A 1QZ9A 4ITXA 3RI6A 4Q31A 4GSAA 4JF0A 3LV2A 3AENA 4HVKA 1S07A 3N5MA 4F5IA 5EAAA 4IXZA 4JEWA 5F9SA 2Z1ZA 3USFA 2YRRA 2VGUA 5D95A 4R8DA 1TOKA 1TATA 1V2DA 1DGEA 4K2IA 1D7RA 3DODA 3RBFA 3PA9A 1EG5A 1YOOA 3A8UX 1W7MA 2FNIA 3FVXA 3NYSA 3QBOA 4RIZA 2XH1A 4MGRA 1ECXA 3RUYA 4EB5A 4F5KA 3GZCA 3OP7A 4A00A 4GDYA 1ASEA 4MQRA 1ARGA 2Z9XA 1SPAA 2BYJA 4IXOA 3HL2A 3NYUA 3B46A 4NOGA 4OBUA 4PFFA 1DGDA 2VI9A 3G8MA 3MBBA 4WYFA 5FT5A 2ZJGA 2E54A 2EPJA 5EUDA 3EIBA 3ECDA 1GCKA 4XAUA 3OKSA 3TQXA 3GR9A 2D63A 1OXPA 1WSTA 3BV0A 4K2MA 1ASAA 4XK1A 3L44A 2OATA 1KMJA 4LC3A 2WK8A 2EGYA 4RKDA 5FT4A 3WCOA 3NX3A 4BHDA 3TCMA 3FZ7A 4XJPA 3FDBA 3VK4A 4PFNA 2R2NA 1ASDA 3PD6B 2CFBA 5DX5A 4WP0A 5JAYA 1M6SA 1YIZA 2GMUA 1AMQA 2FYFA 4W91A 2BWPA 2VMTA 1GC0A 1P3WA 2WK7A 3BWNA 3WY7A 5EUEA 2ZUKA 3BB8A 3NNKA 3VK2A 1SZUA 3E6GA 1RV3A 2GSAA 2O0RA 1GD9A 4B9BA 2VMYA 1CQ8A 2OKKA 3BWNC 2W7EA 4XJMA 2O1BA 2Z1YA 2VMNA 2DOUA 4JF1A 9AATA 2EH6A 1RV4A 3DC1A 3PD6A 1ASFA 2YOBA 1GBNA 4XJLA 5M4DA 3TFTA 1OATA 1J04A 1YIYA 3MEBA 4ISYA 1O62A 1VEFA 2DKJA 2E7JA 3F6TA 4Y0HA 3BCBA 3F9TA 2BWNA 3ACZA 4ZDOA 1X28A 1AJRA 1C7NA 4J8LA 3EZSA 4RKCA 3DZZA 1SZSA 1CJ0A 3AEPA 2QA3A 3ELPA 1RVYA 3E77A 4HF8A 4R5FA 3K40A 1FC4A 1CL2A 2D61A 3K7YA 1G7XA 5EIGB 1QITA 1PFFA 1MAPA 1AJSB 4N0BA 2DGKA 2BKWA 1OHVA 4RM1A 2NMPA 3PDBB 1CZEA 4QGRA 1IX7A 3HBXA 4B98A 2Z61A 3BCXA 5LHAA 2W7MA 2C0RA 3JWBA 1G7WA 3LVMA 1IJIA 3NDNA 2R0TA 2D65A 2YCPA 1DFOA 3HDOA 1WYVA 4ZWMA 4F5GA 3ASAA 3N0LA 2C81A 3R4TA 4F5LA 4RLGA 4WXFA 5EIGA 1MGVA 4PVFA 1LC7A 1BJNA 2AY7A 1D2FA 3VP6A 4FFCA 2EO5A 4OT8A 1LW4A 1AJSA 4ZLVA 2VMUA 2Z9VA 1E5FA 3JTXA 3EUCA 3LVLB 3VAXA 4BQ0A 2VMRA 1W7LA 3AENB 1O61A 2FNUA 2YCNA 2W7IA 3PPLA 1MAQA 1M0OA 1ASCA 1V2FA 3UWCA 2HORA 1V72A 3CQ6A 2BHXA 3M5UA 1AAMA 2DGLA 3B1EA 2D5YA 2VIAA 3I4JA 5I92A 2GQNA 4RITA 3HVYA 1M32A 2WK9A 3MKJA 4XJOA 2V1PA 5HDMA 4EMYA 4CBRA 1TARA 1O4SA 5BJ4A 3PGYA 4F5MA 4I8AA 1ASNA 1OXOA 2YKVA 1BT4A 4CBSA 3RQ1A 4OBVA 4EB7A 1ARIA 4CXRA 5G0AA 4ZDPA 2BWOA 3EI7A 5G4JA 4ITGA 1ASBA 4JE5D 1X29A 3EZ1A 3DR7A 1JF9A 1MDXA 2W8VA 3B8XA 3Q8NA 1TOGA 7AATA 2D7ZA 3WGBA 1AHXA 3WGCA 4AZKA 1UKJA 2PO3A 3GBXA 1TOJA 2JJGA 1I29A 2X5DA 3ATHA 2W8UA 3JU7A 3B1CA 2ZSLA 1VP4A 2CB1A 1B9HA 4UHOA 2CANA 3KGXA 2VMWA 4LNMA 3FFHA 1C4KA 3AEOA 2HOZA 2W7FA 4JE5A 3IHJA 4DQ6A 1ELUA 3CQ5A 2VI8A
chains in the Genus database with same CATH superfamily
4LW4A 3WZFA 1MLYA 3WKSA 2OGAA 4WYDA 1DJEA 3JWAA 5KTBA 1KKPA 2PB0A 2VMQA 1LS3A 2VYCA 3PIUA 1BQAA 5TF5A 2CSTA 3A9XA 2E7UA 4A0FA 2KFPA 1JG8A 4W1VA 3T32A 1BKGA 2ORDA 3GETA 4A0GA 5J8QA 2Z9WA 2WKAA 2VMSA 5HHYA 1C7OA 1ARHA 4E77A 2Z9UA 2VGTA 1ZC9A 4WYEA 2FKIA 4WB0B 1UU1A 1Z3ZA 1BJOB 1PMOA 2F8JA 4KYOA 3N7NA 2W7GA 2VMOA 3COGA 3D6KA 4OTLA 3W1JA 1KKJA 2VGWA 3NUIA 3NRAA 3AOWA 4TN4A 1ARSA 1B8GA 1IAXA 1UU2A 2YKYA 1M0NA 1S0AA 2ZC0A 3E2FA 2BI1A 4WYAA 3NUBA 4IX8A 2G6WA 4F5JA 1AAWA 3QI6A 2QB2A 4ZASA 1D7UA 1WKGA 3FQAA 2EZ2A 3KGWA 4KXKA 5DB5A 2QBTA 4ZM3A 2HP2A 3FDDA 2ZY3A 3A9YA 3MADA 3PAAA 5EAVA 3G7QA 1FG7A 3RCHA 4A0HA 2DR1A 2CH1A 3DRDA 3EI8A 1J32A 4WBTA 2YHKA 1WKHA 1BJOA 1WYVB 4LNJA 4N0WA 1GEYA 4F5HA 3LWSA 3PDXA 1C7GA 3AEMA 4WLHA 4BA5A 4JEYA 1DJ9A 4LNLA 1S06A 1H0CA 1AY5A 3LVKA 3K28A 3LVJA 1QISA 2CJHA 3BN1A 5G09A 1JS3A 2DGMA 2JGTA 4K2BA 1S09A 4A72A 1Z7DA 5LH9A 3AEMC 4TMRA 1N8PA 2BIAA 3DR4A 5EQCA 3ZRRA 2HZPA 4FL0A 3B1DA 2WB6A 4GE4A 1TPLA 3MAUA 4TV7A 4DBCA 2W8JA 5G4IA 4ADCA 3GJUA 4ATQA 5M4BA 1EJIA 4A6TA 3MAFB 4Y0IA 2JJEA 2HP1A 3AV7A 1BQDA 4ADBA 1IVRA 1T3IA 4IYOB 4U1TA 4W1WA 1AKCA 4AO4A 3KE3A 4E1OA 1CS1A 5FT8A 3TATA 2AATA 4IXSA 1GC3A 2FQ6A 2QMAA 1WYTA 3QGUA 1AKAA 3ZRQA 4ZWVA 2VLFA 3NTJA 3EIAA 2HUUA 4W8IA 3QM2A 2D7YA 4P3MA 4GE9A 4ZDLA 1GC4A 1O69A 2YCTA 4P7YA 4MQPA 1W3UA 2VMPA 4OC9A 4KAMA 2OKJA 3ZZKA 4EFFA 3II0A 1YJZA 2ZY2A 3AATA 5G2PA 2HUFA 4GE7A 3MAFA 1QIRA 2V0YA 2ZSMA 1AMRA 1B4XA 2OQXA 3CQ4A 4IYOA 2QLRA 2HUIA 3CAIA 2X8UA 1XI9A 3W1HA 5BJ3A 1KL2A 1RVUA 2R5EA 1LW5A 3AOVA 1SZKA 4L0OA 2EYQA 2AY6A 3FQ7A 1N2TA 3VK3A 2C44A 4R2NA 3QPGA 1DTYA 5DJ9A 1M0PA 1QJ5A 5HXXA 1X0MA 1U08A 2GB3A 2VGZA 4ADEA 4JEVA 2QB3A 3HLMA 3GWPA 2R5CB 1LK9A 4A6RA 4CXQA 3HT4A 1ELQA 2EZ1A 1JS6A 2OGEA 4WB0A 3FVUA 1AIAA 3NYTA 4ZM4A 3NU7A 2GMSA 4M2JA 1V2EA 4OMAA 4ZSWA 1ASLA 1AMAA 3WX9A 4AO9A 3R9AA 1S08A 3AEJA 1ZODA 1LC8A 4ATPA 4M2MA 1AHEA 3WKRA 4BA4A 5K8BA 2BI2A 1YJYA 4MKKA 1MLZA 2BI5A 4RJYA 4PIWA 2W7LA 1G4XA 1ORDA 2BI3A 3FRKA 3ISLA 3KKIA 1AHYA 2VLHA 3TFUA 2BYLA 2D66A 4U2HA 4ZSYA 2Z20A 4JEZA 3BS8A 3AEJC 3UE8A 4BMKA 2QSRA 1XEYA 3EI5A 3GSBA 4UHMA 1IX8A 4XEWA 1BJ4A 4O6ZA 2R5CA 2CJGA 1AKBA 1AY4A 4WXGA 3E2YA 1W23A 2FN6A 3RBLA 3WCNA 1BW0A 2BI9A 3ELEA 1MDZA 4OCAA 2E7IA 2HOXA 3QN6A 1KAFA 4IY7A 2Q7WA 3HQTA 3PJ0A 2CINA 2A1VA 1VJOA 4M2KA 4JEXA 4R5ZA 4WYGA 3RCHB 4ZAHA 1G4VA 3BWOA 2PB2A 3H7FA 8AATA 4OYTA 4E3RA 2AEVA 4DGTA 2JJHA 3P1TA 4AZJA 3DU4A 1FG3A 3JW9A 1AX4A 2AY5A 1E5EA 3I5TA 2ZY4A 2CH2A 4UHNA 4WLJA 5IWQA 1GEWA 5G2QA 2DKBA 1ASMA 2W7KA 3G0TA 4Q6RA 4MY5A 3ZZJA 4Q75A 3GZDA 1PMMA 3JZLA 3FTBA 5DJ1A 3WLXA 3F0HA 1GC2A 1GDEA 1CQ7A 5D5SA 2VIBA 2YRIA 4LW2A 1IAYA 4UOYA 1CQ6A 1LKCA 2JJFA 3BCAA 2W8TA 5EUNA 2BIGA 3GZDC 1AHFA 4GEBA 4W5KA 2VMVA 5E3KA 3DXWA 4A0RA 4F5FA 1C0NA 1B9IA 3A2BA 4ADDA 3N4XA 4WYCA 3VOMA 1UU0A 3NU8A 5F8VA 3BC8A 1LC5A 1DKAA 3W1IA 2W7JA 5C6UA 2X3LA 1WYTB 5AX8A 1M4NA 1TOEA 4GRXA 2W7HA 2VMXA 1PG8A 3FQ8A 5E5IA 1M0QA 4W1XA 3LG0A 3FZ8A 3LY1A 1C9CA 2D64A 3FSLA 2AY3A 1DJUA 3QHXA 5FT6A 1YAAA 1B5PA 3DXVA 1AICA 1SFFA 1CZCA 2ZP7A 2AY1A 1I41A 4H51A 1D7VA 1SVVA 2XBNA 3FZ6A 2X5FA 1AIBA 1KL1A 4UQVA 1QGNA 4AH3A 1IUGA 1AHGA 1M7YA 2W8WA 2CJDA 4J5UA 3FKDA 3FD0A 2JG2A 4Y0DA 3L8AA 1W7NA 4MSOA 1GEXA 3EI9A 4Q76A 1QJ3A 1YNUA 5M46A 3IF2A 1IBJA 1MDOA 4MKJA 1N31A 2C7TA 4RAEA 4AOAA 2HOYA 2AEUA 2RFVA 3A9ZA 1WYUB 1BJWA 1X2AA 4MQQA 1B5OA 2VMZA 3CBFA 5M49A 2VGVA 2O7CA 3I16A 3FFRA 5E4ZA 4E3QA 2TPLA 1ZOBA 2CY8A 2AY2A 4RJ0A 1ASGA 3E2ZB 1Y4IA 1H1CA 4IW7A 3FVSA 2FM1A 3PDBA 1AMSA 1CL1A 1I48A 2AY9A 3UAKA 2ZY5A 3MC6A 3ASBA 4WXBA 5EFSA 1KMKA 2ZYJA 3FCRA 2YKUA 3AELA 1YJSA 1IX6A 1OHWA 3HMUA 1WYUA 2BIEA 3ZRPA 2AY4A 1TASA 3MC6C 1EQBA 1BS0A 3N4SA 2JISA 2Z67A 3H9XA 1ARTA 4A6UA 2CTZA 2YKXA 2VGSA 4CVQA 4WD2A 4EU1A 3E2ZA 3DYDA 3P6KA 1SF2A 1D7SA 1OHYA 2AY8A 1I43A 2W7DA 4F4EA 3H14A 3EI6A 3E9KA 3N75A 1AY8A 1TOIA 4XQ2A 1QZ9A 4ITXA 3RI6A 4Q31A 4GSAA 4JF0A 3LV2A 3AENA 4HVKA 1S07A 3N5MA 4F5IA 4K05A 5EAAA 4IXZA 4JEWA 5F9SA 2Z1ZA 3USFA 2YRRA 2VGUA 5D95A 4R8DA 1TOKA 1TATA 1V2DA 1DGEA 4K2IA 1D7RA 3DODA 3RBFA 3PA9A 1EG5A 1YOOA 3A8UX 1W7MA 2FNIA 3FVXA 3NYSA 3QBOA 4RIZA 2XH1A 4MGRA 1ECXA 3RUYA 4EB5A 4F5KA 3GZCA 3OP7A 4A00A 4GDYA 1ASEA 4MQRA 1ARGA 2Z9XA 1SPAA 2BYJA 4IXOA 3HL2A 3NYUA 3B46A 4NOGA 4OBUA 4PFFA 1DGDA 2VI9A 3G8MA 3MBBA 4WYFA 5FT5A 2ZJGA 2E54A 2EPJA 3N4RA 5EUDA 3EIBA 3ECDA 1GCKA 4XAUA 3OKSA 3TQXA 3GR9A 2D63A 1OXPA 1WSTA 3BV0A 4K2MA 1ASAA 4XK1A 3L44A 2OATA 1KMJA 4LC3A 2WK8A 2EGYA 4RKDA 5FT4A 3WCOA 3NX3A 4BHDA 3TCMA 3FZ7A 4XJPA 3FDBA 3VK4A 4PFNA 2R2NA 1ASDA 3PD6B 2CFBA 5DX5A 4WP0A 5JAYA 1M6SA 1YIZA 2GMUA 1AMQA 2FYFA 4W91A 2BWPA 2VMTA 1GC0A 1P3WA 2WK7A 3BWNA 3WY7A 5EUEA 2ZUKA 3BB8A 3NNKA 3VK2A 1SZUA 3E6GA 1RV3A 2GSAA 2O0RA 1GD9A 4B9BA 2VMYA 1CQ8A 2OKKA 3BWNC 2W7EA 4XJMA 2O1BA 2Z1YA 4H63Q 2VMNA 2DOUA 4JF1A 9AATA 2EH6A 1RV4A 2G7JA 3DC1A 3PD6A 1ASFA 2YOBA 1GBNA 4XJLA 5M4DA 3TFTA 1OATA 1J04A 1YIYA 3MEBA 4ISYA 1O62A 1VEFA 2DKJA 2E7JA 3F6TA 4Y0HA 3BCBA 3F9TA 2BWNA 3ACZA 4ZDOA 1X28A 1AJRA 1C7NA 4J8LA 3EZSA 4RKCA 3DZZA 1SZSA 1CJ0A 3AEPA 2QA3A 3ELPA 1RVYA 3E77A 4HF8A 4R5FA 3K40A 1FC4A 1CL2A 2D61A 3K7YA 1G7XA 5EIGB 1QITA 1PFFA 1MAPA 1AJSB 4N0BA 2DGKA 2BKWA 1OHVA 4RM1A 2NMPA 3PDBB 1CZEA 4QGRA 1IX7A 3HBXA 4B98A 2Z61A 3BCXA 5LHAA 2W7MA 2C0RA 3JWBA 1G7WA 3LVMA 1IJIA 3NDNA 2R0TA 2D65A 2YCPA 1DFOA 3HDOA 1WYVA 4ZWMA 4F5GA 3ASAA 3N0LA 2C81A 3R4TA 4F5LA 4RLGA 4WXFA 5EIGA 1MGVA 4PVFA 1LC7A 1BJNA 2AY7A 1D2FA 3VP6A 4FFCA 2EO5A 4OT8A 1LW4A 1AJSA 4ZLVA 2VMUA 2Z9VA 1E5FA 3JTXA 3EUCA 3LVLB 3VAXA 4BQ0A 2VMRA 1W7LA 3AENB 1O61A 2FNUA 2YCNA 2W7IA 3PPLA 1MAQA 1M0OA 1ASCA 1V2FA 3UWCA 2HORA 1V72A 3CQ6A 2BHXA 3M5UA 1AAMA 2DGLA 3B1EA 2D5YA 2VIAA 3I4JA 5I92A 2GQNA 4RITA 3HVYA 1M32A 2WK9A 3MKJA 4XJOA 2V1PA 5HDMA 4EMYA 4CBRA 1TARA 1O4SA 5BJ4A 3PGYA 4F5MA 4I8AA 1ASNA 1OXOA 2YKVA 1BT4A 4CBSA 3RQ1A 4OBVA 4EB7A 1ARIA 4CXRA 5G0AA 4ZDPA 2BWOA 3EI7A 5G4JA 4ITGA 1ASBA 4JE5D 1X29A 3EZ1A 3DR7A 1JF9A 1MDXA 2W8VA 3B8XA 3Q8NA 1TOGA 7AATA 2D7ZA 3WGBA 1AHXA 3WGCA 4AZKA 1UKJA 2PO3A 3GBXA 1TOJA 2JJGA 1I29A 2X5DA 3ATHA 2W8UA 3JU7A 3B1CA 2ZSLA 1VP4A 2CB1A 1B9HA 4UHOA 2CANA 3KGXA 2VMWA 4LNMA 3FFHA 1C4KA 3AEOA 2HOZA 2W7FA 4JE5A 3IHJA 4DQ6A 1ELUA 3CQ5A 2VI8A
chains in the Genus database with same CATH topology
4LW4A 3WZFA 1MLYA 3WKSA 2OGAA 4WYDA 1DJEA 3JWAA 5KTBA 1KKPA 2PB0A 2VMQA 1LS3A 2VYCA 3PIUA 1BQAA 5TF5A 2CSTA 3A9XA 2E7UA 4A0FA 2KFPA 1JG8A 4W1VA 3T32A 1BKGA 2ORDA 3GETA 4A0GA 5J8QA 2Z9WA 2WKAA 2VMSA 5HHYA 1C7OA 1ARHA 4E77A 2Z9UA 2VGTA 1ZC9A 4WYEA 2FKIA 4WB0B 1UU1A 1Z3ZA 1BJOB 1PMOA 2F8JA 4KYOA 3N7NA 2W7GA 2VMOA 3COGA 3D6KA 4OTLA 3W1JA 1KKJA 2VGWA 3NUIA 3NRAA 3AOWA 4TN4A 1ARSA 1B8GA 1IAXA 1UU2A 2YKYA 1M0NA 1S0AA 2ZC0A 3E2FA 2BI1A 4WYAA 3NUBA 4IX8A 2G6WA 4F5JA 1AAWA 3QI6A 2QB2A 4ZASA 1D7UA 1WKGA 3FQAA 2EZ2A 3KGWA 4KXKA 5DB5A 2QBTA 4ZM3A 2HP2A 3FDDA 2ZY3A 3A9YA 3MADA 3PAAA 5EAVA 3G7QA 1FG7A 3RCHA 4A0HA 2DR1A 2CH1A 3DRDA 3EI8A 1J32A 4WBTA 2YHKA 1WKHA 1BJOA 1WYVB 4LNJA 4N0WA 1GEYA 4F5HA 3LWSA 3PDXA 1C7GA 3AEMA 4WLHA 4BA5A 4JEYA 1DJ9A 4LNLA 1S06A 1H0CA 1AY5A 3LVKA 3K28A 3LVJA 1QISA 2CJHA 3BN1A 5G09A 1JS3A 2DGMA 2JGTA 4K2BA 1S09A 4A72A 1Z7DA 5LH9A 3AEMC 4TMRA 1N8PA 2BIAA 3DR4A 5EQCA 3ZRRA 2HZPA 4FL0A 3B1DA 2WB6A 4GE4A 1TPLA 3MAUA 4TV7A 4DBCA 2W8JA 5G4IA 4ADCA 3GJUA 4ATQA 5M4BA 1EJIA 4A6TA 3MAFB 4Y0IA 2JJEA 2HP1A 3AV7A 1BQDA 4ADBA 1IVRA 1T3IA 4IYOB 4U1TA 4W1WA 1AKCA 4AO4A 3KE3A 4E1OA 1CS1A 5FT8A 3TATA 2AATA 4IXSA 1GC3A 2FQ6A 2QMAA 1WYTA 3QGUA 1AKAA 3ZRQA 4ZWVA 2VLFA 3NTJA 3EIAA 2HUUA 4W8IA 3QM2A 2D7YA 4P3MA 4GE9A 4ZDLA 1GC4A 1O69A 2YCTA 4P7YA 4MQPA 1W3UA 2VMPA 4OC9A 4KAMA 2OKJA 3ZZKA 4EFFA 3II0A 1YJZA 2ZY2A 3AATA 5G2PA 2HUFA 4GE7A 3MAFA 1QIRA 2V0YA 2ZSMA 1AMRA 1B4XA 2OQXA 3CQ4A 4IYOA 2QLRA 2HUIA 3CAIA 2X8UA 1XI9A 3W1HA 5BJ3A 1KL2A 1RVUA 2R5EA 1LW5A 3AOVA 1SZKA 4L0OA 2EYQA 2AY6A 3FQ7A 1N2TA 3VK3A 2C44A 4R2NA 3QPGA 1DTYA 5DJ9A 1M0PA 1QJ5A 5HXXA 1X0MA 1U08A 2GB3A 2VGZA 4ADEA 4JEVA 2QB3A 3HLMA 3GWPA 2R5CB 1LK9A 4A6RA 4CXQA 3HT4A 1ELQA 2EZ1A 1JS6A 2OGEA 4WB0A 3FVUA 1AIAA 3NYTA 4ZM4A 3NU7A 2GMSA 4M2JA 1V2EA 4OMAA 4ZSWA 1ASLA 1AMAA 3WX9A 4AO9A 3R9AA 1S08A 3AEJA 1ZODA 1LC8A 4ATPA 4M2MA 1AHEA 3WKRA 4BA4A 5K8BA 2BI2A 1YJYA 4MKKA 1MLZA 2BI5A 4RJYA 4PIWA 2W7LA 1G4XA 1ORDA 2BI3A 3FRKA 3ISLA 3KKIA 1AHYA 2VLHA 3TFUA 2BYLA 2D66A 4U2HA 4ZSYA 2Z20A 4JEZA 3BS8A 3AEJC 3UE8A 4BMKA 2QSRA 1XEYA 3EI5A 3GSBA 4UHMA 1IX8A 4XEWA 1BJ4A 4O6ZA 2R5CA 2CJGA 1AKBA 1AY4A 4WXGA 3E2YA 1W23A 2FN6A 3RBLA 3WCNA 1BW0A 2BI9A 3ELEA 1MDZA 4OCAA 2E7IA 2HOXA 3QN6A 4IY7A 2Q7WA 3HQTA 3PJ0A 2CINA 2A1VA 1VJOA 4M2KA 4JEXA 4R5ZA 4WYGA 3RCHB 4ZAHA 1G4VA 3BWOA 2PB2A 3H7FA 8AATA 4OYTA 4E3RA 2AEVA 4DGTA 2JJHA 3P1TA 4AZJA 3DU4A 1FG3A 3JW9A 1AX4A 2AY5A 1E5EA 3I5TA 2ZY4A 2CH2A 4UHNA 4WLJA 5IWQA 1GEWA 5G2QA 2DKBA 1ASMA 2W7KA 3G0TA 4Q6RA 4MY5A 3ZZJA 4Q75A 3GZDA 1PMMA 3JZLA 3FTBA 5DJ1A 3WLXA 3F0HA 1GC2A 1GDEA 1CQ7A 5D5SA 2VIBA 2YRIA 4LW2A 1IAYA 4UOYA 1CQ6A 1LKCA 2JJFA 3BCAA 2W8TA 5EUNA 2BIGA 3GZDC 1AHFA 4GEBA 4W5KA 2VMVA 5E3KA 3DXWA 4A0RA 4F5FA 1C0NA 1B9IA 3A2BA 4ADDA 3N4XA 4WYCA 3VOMA 1UU0A 3NU8A 5F8VA 3BC8A 1LC5A 1DKAA 3W1IA 2W7JA 5C6UA 2X3LA 1WYTB 5AX8A 1M4NA 1TOEA 4GRXA 2W7HA 2VMXA 1PG8A 3FQ8A 5E5IA 1M0QA 4W1XA 3LG0A 3FZ8A 3LY1A 1C9CA 2D64A 3FSLA 2AY3A 1DJUA 3QHXA 5FT6A 1YAAA 1B5PA 3DXVA 1AICA 1SFFA 1CZCA 2ZP7A 2AY1A 1I41A 4H51A 1D7VA 1SVVA 2XBNA 3FZ6A 2X5FA 1AIBA 1KL1A 4UQVA 1QGNA 4AH3A 1IUGA 1AHGA 1M7YA 2W8WA 2CJDA 4J5UA 3FKDA 3FD0A 2JG2A 4Y0DA 3L8AA 1W7NA 4MSOA 1GEXA 3EI9A 4Q76A 1QJ3A 1YNUA 5M46A 3IF2A 1IBJA 1MDOA 4MKJA 1N31A 2C7TA 4RAEA 4AOAA 2HOYA 2AEUA 2RFVA 3A9ZA 1WYUB 1BJWA 1X2AA 4MQQA 1B5OA 2VMZA 3CBFA 5M49A 2VGVA 2O7CA 3I16A 3FFRA 5E4ZA 4E3QA 2TPLA 1ZOBA 2CY8A 2AY2A 4RJ0A 1ASGA 3E2ZB 1Y4IA 1H1CA 4IW7A 3FVSA 2FM1A 3PDBA 1AMSA 1CL1A 1I48A 2AY9A 3UAKA 2ZY5A 3MC6A 3ASBA 4WXBA 5EFSA 1KMKA 2ZYJA 3FCRA 2YKUA 3AELA 1YJSA 1IX6A 1OHWA 3HMUA 1WYUA 2BIEA 3ZRPA 2AY4A 1TASA 3MC6C 1EQBA 1BS0A 3N4SA 2JISA 2Z67A 3H9XA 1ARTA 4A6UA 2CTZA 2YKXA 2VGSA 4CVQA 4WD2A 4EU1A 3E2ZA 3DYDA 3P6KA 1SF2A 1D7SA 1OHYA 2AY8A 1I43A 2W7DA 4F4EA 3H14A 3EI6A 3E9KA 3N75A 1AY8A 1TOIA 4XQ2A 1QZ9A 4ITXA 3RI6A 4Q31A 4GSAA 4JF0A 3LV2A 3AENA 4HVKA 1S07A 3N5MA 4F5IA 4K05A 5EAAA 4IXZA 4JEWA 5F9SA 2Z1ZA 3USFA 2YRRA 2VGUA 5D95A 4R8DA 1TOKA 1TATA 1V2DA 1DGEA 4K2IA 1D7RA 3DODA 3RBFA 3PA9A 1EG5A 1YOOA 3A8UX 1W7MA 2FNIA 3FVXA 3NYSA 3QBOA 4RIZA 2XH1A 4MGRA 1ECXA 3RUYA 4EB5A 4F5KA 3GZCA 3OP7A 4A00A 4GDYA 1ASEA 4MQRA 1ARGA 2Z9XA 1SPAA 2BYJA 4IXOA 3HL2A 3NYUA 3B46A 4NOGA 4OBUA 4PFFA 1DGDA 2VI9A 3G8MA 3MBBA 4WYFA 5FT5A 2ZJGA 2E54A 2EPJA 3N4RA 5EUDA 3EIBA 3ECDA 1GCKA 4XAUA 3OKSA 3TQXA 3GR9A 2D63A 1OXPA 1WSTA 3BV0A 4K2MA 1ASAA 4XK1A 3L44A 2OATA 1KMJA 4LC3A 2WK8A 2EGYA 4RKDA 5FT4A 3WCOA 3NX3A 4BHDA 3TCMA 3FZ7A 4XJPA 3FDBA 3VK4A 4PFNA 2R2NA 1ASDA 3PD6B 2CFBA 5DX5A 4WP0A 5JAYA 1M6SA 1YIZA 2GMUA 1AMQA 2FYFA 4W91A 2BWPA 2VMTA 1GC0A 1P3WA 2WK7A 3BWNA 3WY7A 5EUEA 2ZUKA 3BB8A 3NNKA 3VK2A 1SZUA 3E6GA 1RV3A 2GSAA 2O0RA 1GD9A 4B9BA 2VMYA 1CQ8A 2OKKA 3BWNC 2W7EA 4XJMA 2O1BA 2Z1YA 4H63Q 2VMNA 2DOUA 4JF1A 9AATA 2EH6A 1RV4A 2G7JA 3DC1A 3PD6A 1ASFA 2YOBA 1GBNA 4XJLA 5M4DA 3TFTA 1OATA 1J04A 1YIYA 3MEBA 4ISYA 1O62A 1VEFA 2DKJA 2E7JA 3F6TA 4Y0HA 3BCBA 3F9TA 2BWNA 3ACZA 4ZDOA 1X28A 1AJRA 1C7NA 4J8LA 3EZSA 4RKCA 3DZZA 1SZSA 1CJ0A 3AEPA 2QA3A 3ELPA 1RVYA 3E77A 4HF8A 4R5FA 3K40A 1FC4A 1CL2A 2D61A 3K7YA 1G7XA 5EIGB 1QITA 1PFFA 1MAPA 1AJSB 4N0BA 2DGKA 2BKWA 1OHVA 4RM1A 2NMPA 3PDBB 1CZEA 4QGRA 1IX7A 3HBXA 4B98A 2Z61A 3BCXA 5LHAA 2W7MA 2C0RA 3JWBA 1G7WA 3LVMA 1IJIA 3NDNA 2R0TA 2D65A 2YCPA 1DFOA 3HDOA 1WYVA 4ZWMA 4F5GA 3ASAA 3N0LA 2C81A 3R4TA 4F5LA 4RLGA 4WXFA 5EIGA 1MGVA 4PVFA 1LC7A 1BJNA 2AY7A 1D2FA 3VP6A 4FFCA 2EO5A 4OT8A 1LW4A 1AJSA 4ZLVA 2VMUA 2Z9VA 1E5FA 3JTXA 3EUCA 3LVLB 3VAXA 4BQ0A 2VMRA 1W7LA 3AENB 1O61A 2FNUA 2YCNA 2W7IA 3PPLA 1MAQA 1M0OA 1ASCA 1V2FA 3UWCA 2HORA 1V72A 3CQ6A 2BHXA 3M5UA 1AAMA 2DGLA 3B1EA 2D5YA 2VIAA 3I4JA 5I92A 2GQNA 4RITA 3HVYA 1M32A 2WK9A 3MKJA 4XJOA 2V1PA 5HDMA 4EMYA 4CBRA 1TARA 1O4SA 5BJ4A 3PGYA 4F5MA 4I8AA 1ASNA 1OXOA 2YKVA 1BT4A 4CBSA 3RQ1A 4OBVA 4EB7A 1ARIA 4CXRA 5G0AA 4ZDPA 2BWOA 3EI7A 5G4JA 4ITGA 1ASBA 4JE5D 1X29A 3EZ1A 3DR7A 1JF9A 1MDXA 2W8VA 3B8XA 3Q8NA 1TOGA 7AATA 2D7ZA 3WGBA 1AHXA 3WGCA 4AZKA 1UKJA 2PO3A 3GBXA 1TOJA 2JJGA 1I29A 2X5DA 3ATHA 2W8UA 3JU7A 3B1CA 2ZSLA 1VP4A 2CB1A 1B9HA 4UHOA 2CANA 3KGXA 2VMWA 4LNMA 3FFHA 1C4KA 3AEOA 2HOZA 2W7FA 4JE5A 3IHJA 4DQ6A 1ELUA 3CQ5A 2VI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LW4 A;  3WZF A;  1MLY A;  3WKS A;  2OGA A;  4WYD A;  1DJE A;  3JWA A;  1KKP A;  2PB0 A;  2VMQ A;  1LS3 A;  2VYC A;  3PIU A;  1BQA A;  5TF5 A;  2CST A;  3A9X A;  2E7U A;  4A0F A;  1JG8 A;  4W1V A;  3T32 A;  1BKG A;  2ORD A;  3GET A;  4A0G A;  5J8Q A;  2Z9W A;  2WKA A;  2VMS A;  5HHY A;  1C7O A;  1ARH A;  4E77 A;  2Z9U A;  2VGT A;  1ZC9 A;  4WYE A;  4WB0 B;  1UU1 A;  1Z3Z A;  1BJO B;  1PMO A;  2F8J A;  4KYO A;  2W7G A;  2VMO A;  3COG A;  3D6K A;  4OTL A;  3W1J A;  1KKJ A;  2VGW A;  3NUI A;  3NRA A;  3AOW A;  4TN4 A;  1ARS A;  1B8G A;  1IAX A;  1UU2 A;  2YKY A;  1M0N A;  1S0A A;  2ZC0 A;  3E2F A;  2BI1 A;  4WYA A;  3NUB A;  4IX8 A;  2G6W A;  4F5J A;  1AAW A;  3QI6 A;  2QB2 A;  4ZAS A;  1D7U A;  1WKG A;  3FQA A;  2EZ2 A;  3KGW A;  4KXK A;  5DB5 A;  2QBT A;  4ZM3 A;  2HP2 A;  3FDD A;  2ZY3 A;  3A9Y A;  3MAD A;  3PAA A;  5EAV A;  3G7Q A;  1FG7 A;  3RCH A;  4A0H A;  2DR1 A;  2CH1 A;  3DRD A;  3EI8 A;  1J32 A;  4WBT A;  2YHK A;  1WKH A;  1BJO A;  1WYV B;  4LNJ A;  4N0W A;  1GEY A;  4F5H A;  3LWS A;  3PDX A;  1C7G A;  3AEM A;  4WLH A;  4BA5 A;  4JEY A;  1DJ9 A;  4LNL A;  1S06 A;  1H0C A;  1AY5 A;  3LVK A;  3K28 A;  3LVJ A;  1QIS A;  2CJH A;  3BN1 A;  5G09 A;  1JS3 A;  2DGM A;  2JGT A;  4K2B A;  1S09 A;  4A72 A;  1Z7D A;  5LH9 A;  3AEM C;  4TMR A;  1N8P A;  2BIA A;  3DR4 A;  5EQC A;  3ZRR A;  2HZP A;  4FL0 A;  3B1D A;  4GE4 A;  1TPL A;  3MAU A;  4TV7 A;  4DBC A;  2W8J A;  5G4I A;  4ADC A;  3GJU A;  4ATQ A;  5M4B A;  1EJI A;  4A6T A;  3MAF B;  4Y0I A;  2JJE A;  2HP1 A;  3AV7 A;  1BQD A;  4ADB A;  1IVR A;  1T3I A;  4IYO B;  4U1T A;  4W1W A;  1AKC A;  4AO4 A;  3KE3 A;  4E1O A;  1CS1 A;  5FT8 A;  3TAT A;  2AAT A;  4IXS A;  1GC3 A;  2FQ6 A;  2QMA A;  1WYT A;  3QGU A;  1AKA A;  3ZRQ A;  4ZWV A;  2VLF A;  3NTJ A;  3EIA A;  2HUU A;  4W8I A;  3QM2 A;  2D7Y A;  4P3M A;  4GE9 A;  4ZDL A;  1GC4 A;  1O69 A;  2YCT A;  4P7Y A;  4MQP A;  1W3U A;  2VMP A;  4OC9 A;  4KAM A;  2OKJ A;  3ZZK A;  4EFF A;  3II0 A;  1YJZ A;  2ZY2 A;  3AAT A;  5G2P A;  2HUF A;  4GE7 A;  3MAF A;  1QIR A;  2V0Y A;  2ZSM A;  1AMR A;  1B4X A;  2OQX A;  3CQ4 A;  4IYO A;  2QLR A;  2HUI A;  3CAI A;  2X8U A;  1XI9 A;  3W1H A;  5BJ3 A;  1KL2 A;  1RVU A;  2R5E A;  1LW5 A;  3AOV A;  1SZK A;  4L0O A;  2AY6 A;  3FQ7 A;  1N2T A;  3VK3 A;  2C44 A;  4R2N A;  3QPG A;  1DTY A;  5DJ9 A;  1M0P A;  1QJ5 A;  5HXX A;  1X0M A;  1U08 A;  2GB3 A;  2VGZ A;  4ADE A;  4JEV A;  2QB3 A;  3HLM A;  3GWP A;  2R5C B;  1LK9 A;  4A6R A;  4CXQ A;  3HT4 A;  1ELQ A;  2EZ1 A;  1JS6 A;  2OGE A;  4WB0 A;  3FVU A;  1AIA A;  3NYT A;  4ZM4 A;  3NU7 A;  2GMS A;  4M2J A;  1V2E A;  4OMA A;  4ZSW A;  1ASL A;  1AMA A;  3WX9 A;  4AO9 A;  3R9A A;  1S08 A;  3AEJ A;  1ZOD A;  1LC8 A;  4ATP A;  4M2M A;  1AHE A;  3WKR A;  4BA4 A;  5K8B A;  2BI2 A;  1YJY A;  4MKK A;  1MLZ A;  2BI5 A;  4RJY A;  4PIW A;  2W7L A;  1G4X A;  1ORD A;  2BI3 A;  3FRK A;  3ISL A;  3KKI A;  1AHY A;  2VLH A;  3TFU A;  2BYL A;  2D66 A;  4U2H A;  4ZSY A;  2Z20 A;  4JEZ A;  3BS8 A;  3AEJ C;  3UE8 A;  4BMK A;  1XEY A;  3EI5 A;  3GSB A;  4UHM A;  1IX8 A;  4XEW A;  1BJ4 A;  4O6Z A;  2R5C A;  2CJG A;  1AKB A;  1AY4 A;  4WXG A;  3E2Y A;  1W23 A;  2FN6 A;  3RBL A;  3WCN A;  1BW0 A;  2BI9 A;  3ELE A;  1MDZ A;  4OCA A;  2E7I A;  2HOX A;  3QN6 A;  4IY7 A;  2Q7W A;  3HQT A;  3PJ0 A;  2CIN A;  1VJO A;  4M2K A;  4JEX A;  4R5Z A;  4WYG A;  3RCH B;  4ZAH A;  1G4V A;  3BWO A;  2PB2 A;  3H7F A;  8AAT A;  4OYT A;  4E3R A;  2AEV A;  4DGT A;  2JJH A;  3P1T A;  4AZJ A;  3DU4 A;  1FG3 A;  3JW9 A;  1AX4 A;  2AY5 A;  1E5E A;  3I5T A;  2ZY4 A;  2CH2 A;  4UHN A;  4WLJ A;  5IWQ A;  1GEW A;  5G2Q A;  2DKB A;  1ASM A;  2W7K A;  3G0T A;  4Q6R A;  4MY5 A;  3ZZJ A;  4Q75 A;  3GZD A;  1PMM A;  3JZL A;  3FTB A;  5DJ1 A;  3WLX A;  3F0H A;  1GC2 A;  1GDE A;  1CQ7 A;  5D5S A;  2VIB A;  2YRI A;  4LW2 A;  1IAY A;  4UOY A;  1CQ6 A;  1LKC A;  2JJF A;  3BCA A;  2W8T A;  5EUN A;  2BIG A;  3GZD C;  1AHF A;  4GEB A;  4W5K A;  2VMV A;  5E3K A;  3DXW A;  4A0R A;  4F5F A;  1C0N A;  1B9I A;  3A2B A;  4ADD A;  4WYC A;  3VOM A;  1UU0 A;  3NU8 A;  5F8V A;  3BC8 A;  1LC5 A;  1DKA A;  3W1I A;  2W7J A;  5C6U A;  2X3L A;  1WYT B;  5AX8 A;  1M4N A;  1TOE A;  4GRX A;  2W7H A;  2VMX A;  1PG8 A;  3FQ8 A;  5E5I A;  1M0Q A;  4W1X A;  3LG0 A;  3FZ8 A;  3LY1 A;  1C9C A;  2D64 A;  3FSL A;  2AY3 A;  1DJU A;  3QHX A;  5FT6 A;  1YAA A;  1B5P A;  3DXV A;  1AIC A;  1SFF A;  1CZC A;  2ZP7 A;  2AY1 A;  1I41 A;  4H51 A;  1D7V A;  1SVV A;  2XBN A;  3FZ6 A;  2X5F A;  1AIB A;  1KL1 A;  4UQV A;  1QGN A;  4AH3 A;  1IUG A;  1AHG A;  1M7Y A;  2W8W A;  2CJD A;  4J5U A;  3FKD A;  3FD0 A;  2JG2 A;  4Y0D A;  3L8A A;  1W7N A;  4MSO A;  1GEX A;  3EI9 A;  4Q76 A;  1QJ3 A;  1YNU A;  5M46 A;  3IF2 A;  1IBJ A;  1MDO A;  4MKJ A;  1N31 A;  2C7T A;  4RAE A;  4AOA A;  2HOY A;  2AEU A;  2RFV A;  3A9Z A;  1WYU B;  1BJW A;  1X2A A;  4MQQ A;  1B5O A;  2VMZ A;  3CBF A;  5M49 A;  2VGV A;  2O7C A;  3I16 A;  3FFR A;  5E4Z A;  4E3Q A;  2TPL A;  1ZOB A;  2CY8 A;  2AY2 A;  4RJ0 A;  1ASG A;  3E2Z B;  1Y4I A;  1H1C A;  4IW7 A;  3FVS A;  2FM1 A;  3PDB A;  1AMS A;  1CL1 A;  1I48 A;  2AY9 A;  3UAK A;  2ZY5 A;  3MC6 A;  3ASB A;  4WXB A;  5EFS A;  1KMK A;  2ZYJ A;  3FCR A;  2YKU A;  3AEL A;  1YJS A;  1IX6 A;  1OHW A;  3HMU A;  1WYU A;  2BIE A;  3ZRP A;  2AY4 A;  1TAS A;  3MC6 C;  1EQB A;  1BS0 A;  2JIS A;  2Z67 A;  1ART A;  4A6U A;  2CTZ A;  2YKX A;  2VGS A;  4CVQ A;  4WD2 A;  4EU1 A;  3E2Z A;  3DYD A;  3P6K A;  1SF2 A;  1D7S A;  1OHY A;  2AY8 A;  1I43 A;  2W7D A;  4F4E A;  3H14 A;  3EI6 A;  3E9K A;  3N75 A;  1AY8 A;  1TOI A;  4XQ2 A;  1QZ9 A;  4ITX A;  3RI6 A;  4Q31 A;  4GSA A;  4JF0 A;  3LV2 A;  3AEN A;  4HVK A;  1S07 A;  3N5M A;  4F5I A;  5EAA A;  4IXZ A;  4JEW A;  5F9S A;  2Z1Z A;  3USF A;  2YRR A;  2VGU A;  5D95 A;  4R8D A;  1TOK A;  1TAT A;  1V2D A;  1DGE A;  4K2I A;  1D7R A;  3DOD A;  3RBF A;  3PA9 A;  1EG5 A;  1YOO A;  3A8U X;  1W7M A;  2FNI A;  3FVX A;  3NYS A;  3QBO A;  4RIZ A;  2XH1 A;  4MGR A;  1ECX A;  3RUY A;  4EB5 A;  4F5K A;  3GZC A;  3OP7 A;  4A00 A;  4GDY A;  1ASE A;  4MQR A;  1ARG A;  2Z9X A;  1SPA A;  2BYJ A;  4IXO A;  3HL2 A;  3NYU A;  3B46 A;  4NOG A;  4OBU A;  4PFF A;  1DGD A;  2VI9 A;  3G8M A;  3MBB A;  4WYF A;  5FT5 A;  2ZJG A;  2E54 A;  2EPJ A;  5EUD A;  3EIB A;  3ECD A;  1GCK A;  4XAU A;  3OKS A;  3TQX A;  3GR9 A;  2D63 A;  1OXP A;  1WST A;  3BV0 A;  4K2M A;  1ASA A;  4XK1 A;  3L44 A;  2OAT A;  1KMJ A;  4LC3 A;  2WK8 A;  2EGY A;  4RKD A;  5FT4 A;  3WCO A;  3NX3 A;  4BHD A;  3TCM A;  3FZ7 A;  4XJP A;  3FDB A;  3VK4 A;  4PFN A;  2R2N A;  1ASD A;  3PD6 B;  2CFB A;  5DX5 A;  4WP0 A;  5JAY A;  1M6S A;  1YIZ A;  2GMU A;  1AMQ A;  2FYF A;  4W91 A;  2BWP A;  2VMT A;  1GC0 A;  1P3W A;  2WK7 A;  3BWN A;  3WY7 A;  5EUE A;  2ZUK A;  3BB8 A;  3NNK A;  3VK2 A;  1SZU A;  3E6G A;  1RV3 A;  2GSA A;  2O0R A;  1GD9 A;  4B9B A;  2VMY A;  1CQ8 A;  2OKK A;  3BWN C;  2W7E A;  4XJM A;  2O1B A;  2Z1Y A;  2VMN A;  2DOU A;  4JF1 A;  9AAT A;  2EH6 A;  1RV4 A;  3DC1 A;  3PD6 A;  1ASF A;  2YOB A;  1GBN A;  4XJL A;  5M4D A;  3TFT A;  1OAT A;  1J04 A;  1YIY A;  3MEB A;  4ISY A;  1O62 A;  1VEF A;  2DKJ A;  2E7J A;  3F6T A;  4Y0H A;  3BCB A;  3F9T A;  2BWN A;  3ACZ A;  4ZDO A;  1X28 A;  1AJR A;  1C7N A;  4J8L A;  3EZS A;  4RKC A;  3DZZ A;  1SZS A;  1CJ0 A;  3AEP A;  2QA3 A;  3ELP A;  1RVY A;  3E77 A;  4HF8 A;  4R5F A;  3K40 A;  1FC4 A;  1CL2 A;  2D61 A;  3K7Y A;  1G7X A;  5EIG B;  1QIT A;  1PFF A;  1MAP A;  1AJS B;  4N0B A;  2DGK A;  2BKW A;  1OHV A;  4RM1 A;  2NMP A;  3PDB B;  1CZE A;  4QGR A;  1IX7 A;  3HBX A;  4B98 A;  2Z61 A;  3BCX A;  5LHA A;  2W7M A;  2C0R A;  3JWB A;  1G7W A;  3LVM A;  1IJI A;  3NDN A;  2R0T A;  2D65 A;  2YCP A;  1DFO A;  3HDO A;  1WYV A;  4ZWM A;  4F5G A;  3ASA A;  3N0L A;  2C81 A;  3R4T A;  4F5L A;  4RLG A;  4WXF A;  5EIG A;  1MGV A;  4PVF A;  1LC7 A;  1BJN A;  2AY7 A;  1D2F A;  3VP6 A;  4FFC A;  2EO5 A;  4OT8 A;  1LW4 A;  1AJS A;  4ZLV A;  2VMU A;  2Z9V A;  1E5F A;  3JTX A;  3EUC A;  3LVL B;  3VAX A;  4BQ0 A;  2VMR A;  1W7L A;  3AEN B;  1O61 A;  2FNU A;  2YCN A;  2W7I A;  3PPL A;  1MAQ A;  1M0O A;  1ASC A;  1V2F A;  3UWC A;  2HOR A;  1V72 A;  3CQ6 A;  2BHX A;  3M5U A;  1AAM A;  2DGL A;  3B1E A;  2D5Y A;  2VIA A;  3I4J A;  5I92 A;  2GQN A;  4RIT A;  3HVY A;  1M32 A;  2WK9 A;  3MKJ A;  4XJO A;  2V1P A;  5HDM A;  4EMY A;  4CBR A;  1TAR A;  1O4S A;  5BJ4 A;  3PGY A;  4F5M A;  4I8A A;  1ASN A;  1OXO A;  2YKV A;  1BT4 A;  4CBS A;  3RQ1 A;  4OBV A;  4EB7 A;  1ARI A;  4CXR A;  5G0A A;  4ZDP A;  2BWO A;  3EI7 A;  5G4J A;  4ITG A;  1ASB A;  4JE5 D;  1X29 A;  3EZ1 A;  3DR7 A;  1JF9 A;  1MDX A;  2W8V A;  3B8X A;  3Q8N A;  1TOG A;  7AAT A;  2D7Z A;  3WGB A;  1AHX A;  3WGC A;  4AZK A;  1UKJ A;  2PO3 A;  3GBX A;  1TOJ A;  2JJG A;  1I29 A;  2X5D A;  3ATH A;  2W8U A;  3JU7 A;  3B1C A;  2ZSL A;  1VP4 A;  2CB1 A;  1B9H A;  4UHO A;  2CAN A;  3KGX A;  2VMW A;  4LNM A;  3FFH A;  1C4K A;  3AEO A;  2HOZ A;  2W7F A;  4JE5 A;  3IHJ A;  4DQ6 A;  1ELU A;  3CQ5 A;  2VI8 A; 
#chains in the Genus database with same CATH topology
 4LW4 A;  3WZF A;  1MLY A;  3WKS A;  2OGA A;  4WYD A;  1DJE A;  3JWA A;  5KTB A;  1KKP A;  2PB0 A;  2VMQ A;  1LS3 A;  2VYC A;  3PIU A;  1BQA A;  5TF5 A;  2CST A;  3A9X A;  2E7U A;  4A0F A;  2KFP A;  1JG8 A;  4W1V A;  3T32 A;  1BKG A;  2ORD A;  3GET A;  4A0G A;  5J8Q A;  2Z9W A;  2WKA A;  2VMS A;  5HHY A;  1C7O A;  1ARH A;  4E77 A;  2Z9U A;  2VGT A;  1ZC9 A;  4WYE A;  2FKI A;  4WB0 B;  1UU1 A;  1Z3Z A;  1BJO B;  1PMO A;  2F8J A;  4KYO A;  3N7N A;  2W7G A;  2VMO A;  3COG A;  3D6K A;  4OTL A;  3W1J A;  1KKJ A;  2VGW A;  3NUI A;  3NRA A;  3AOW A;  4TN4 A;  1ARS A;  1B8G A;  1IAX A;  1UU2 A;  2YKY A;  1M0N A;  1S0A A;  2ZC0 A;  3E2F A;  2BI1 A;  4WYA A;  3NUB A;  4IX8 A;  2G6W A;  4F5J A;  1AAW A;  3QI6 A;  2QB2 A;  4ZAS A;  1D7U A;  1WKG A;  3FQA A;  2EZ2 A;  3KGW A;  4KXK A;  5DB5 A;  2QBT A;  4ZM3 A;  2HP2 A;  3FDD A;  2ZY3 A;  3A9Y A;  3MAD A;  3PAA A;  5EAV A;  3G7Q A;  1FG7 A;  3RCH A;  4A0H A;  2DR1 A;  2CH1 A;  3DRD A;  3EI8 A;  1J32 A;  4WBT A;  2YHK A;  1WKH A;  1BJO A;  1WYV B;  4LNJ A;  4N0W A;  1GEY A;  4F5H A;  3LWS A;  3PDX A;  1C7G A;  3AEM A;  4WLH A;  4BA5 A;  4JEY A;  1DJ9 A;  4LNL A;  1S06 A;  1H0C A;  1AY5 A;  3LVK A;  3K28 A;  3LVJ A;  1QIS A;  2CJH A;  3BN1 A;  5G09 A;  1JS3 A;  2DGM A;  2JGT A;  4K2B A;  1S09 A;  4A72 A;  1Z7D A;  5LH9 A;  3AEM C;  4TMR A;  1N8P A;  2BIA A;  3DR4 A;  5EQC A;  3ZRR A;  2HZP A;  4FL0 A;  3B1D A;  2WB6 A;  4GE4 A;  1TPL A;  3MAU A;  4TV7 A;  4DBC A;  2W8J A;  5G4I A;  4ADC A;  3GJU A;  4ATQ A;  5M4B A;  1EJI A;  4A6T A;  3MAF B;  4Y0I A;  2JJE A;  2HP1 A;  3AV7 A;  1BQD A;  4ADB A;  1IVR A;  1T3I A;  4IYO B;  4U1T A;  4W1W A;  1AKC A;  4AO4 A;  3KE3 A;  4E1O A;  1CS1 A;  5FT8 A;  3TAT A;  2AAT A;  4IXS A;  1GC3 A;  2FQ6 A;  2QMA A;  1WYT A;  3QGU A;  1AKA A;  3ZRQ A;  4ZWV A;  2VLF A;  3NTJ A;  3EIA A;  2HUU A;  4W8I A;  3QM2 A;  2D7Y A;  4P3M A;  4GE9 A;  4ZDL A;  1GC4 A;  1O69 A;  2YCT A;  4P7Y A;  4MQP A;  1W3U A;  2VMP A;  4OC9 A;  4KAM A;  2OKJ A;  3ZZK A;  4EFF A;  3II0 A;  1YJZ A;  2ZY2 A;  3AAT A;  5G2P A;  2HUF A;  4GE7 A;  3MAF A;  1QIR A;  2V0Y A;  2ZSM A;  1AMR A;  1B4X A;  2OQX A;  3CQ4 A;  4IYO A;  2QLR A;  2HUI A;  3CAI A;  2X8U A;  1XI9 A;  3W1H A;  5BJ3 A;  1KL2 A;  1RVU A;  2R5E A;  1LW5 A;  3AOV A;  1SZK A;  4L0O A;  2EYQ A;  2AY6 A;  3FQ7 A;  1N2T A;  3VK3 A;  2C44 A;  4R2N A;  3QPG A;  1DTY A;  5DJ9 A;  1M0P A;  1QJ5 A;  5HXX A;  1X0M A;  1U08 A;  2GB3 A;  2VGZ A;  4ADE A;  4JEV A;  2QB3 A;  3HLM A;  3GWP A;  2R5C B;  1LK9 A;  4A6R A;  4CXQ A;  3HT4 A;  1ELQ A;  2EZ1 A;  1JS6 A;  2OGE A;  4WB0 A;  3FVU A;  1AIA A;  3NYT A;  4ZM4 A;  3NU7 A;  2GMS A;  4M2J A;  1V2E A;  4OMA A;  4ZSW A;  1ASL A;  1AMA A;  3WX9 A;  4AO9 A;  3R9A A;  1S08 A;  3AEJ A;  1ZOD A;  1LC8 A;  4ATP A;  4M2M A;  1AHE A;  3WKR A;  4BA4 A;  5K8B A;  2BI2 A;  1YJY A;  4MKK A;  1MLZ A;  2BI5 A;  4RJY A;  4PIW A;  2W7L A;  1G4X A;  1ORD A;  2BI3 A;  3FRK A;  3ISL A;  3KKI A;  1AHY A;  2VLH A;  3TFU A;  2BYL A;  2D66 A;  4U2H A;  4ZSY A;  2Z20 A;  4JEZ A;  3BS8 A;  3AEJ C;  3UE8 A;  4BMK A;  2QSR A;  1XEY A;  3EI5 A;  3GSB A;  4UHM A;  1IX8 A;  4XEW A;  1BJ4 A;  4O6Z A;  2R5C A;  2CJG A;  1AKB A;  1AY4 A;  4WXG A;  3E2Y A;  1W23 A;  2FN6 A;  3RBL A;  3WCN A;  1BW0 A;  2BI9 A;  3ELE A;  1MDZ A;  4OCA A;  2E7I A;  2HOX A;  3QN6 A;  1KAF A;  4IY7 A;  2Q7W A;  3HQT A;  3PJ0 A;  2CIN A;  2A1V A;  1VJO A;  4M2K A;  4JEX A;  4R5Z A;  4WYG A;  3RCH B;  4ZAH A;  1G4V A;  3BWO A;  2PB2 A;  3H7F A;  8AAT A;  4OYT A;  4E3R A;  2AEV A;  4DGT A;  2JJH A;  3P1T A;  4AZJ A;  3DU4 A;  1FG3 A;  3JW9 A;  1AX4 A;  2AY5 A;  1E5E A;  3I5T A;  2ZY4 A;  2CH2 A;  4UHN A;  4WLJ A;  5IWQ A;  1GEW A;  5G2Q A;  2DKB A;  1ASM A;  2W7K A;  3G0T A;  4Q6R A;  4MY5 A;  3ZZJ A;  4Q75 A;  3GZD A;  1PMM A;  3JZL A;  3FTB A;  5DJ1 A;  3WLX A;  3F0H A;  1GC2 A;  1GDE A;  1CQ7 A;  5D5S A;  2VIB A;  2YRI A;  4LW2 A;  1IAY A;  4UOY A;  1CQ6 A;  1LKC A;  2JJF A;  3BCA A;  2W8T A;  5EUN A;  2BIG A;  3GZD C;  1AHF A;  4GEB A;  4W5K A;  2VMV A;  5E3K A;  3DXW A;  4A0R A;  4F5F A;  1C0N A;  1B9I A;  3A2B A;  4ADD A;  3N4X A;  4WYC A;  3VOM A;  1UU0 A;  3NU8 A;  5F8V A;  3BC8 A;  1LC5 A;  1DKA A;  3W1I A;  2W7J A;  5C6U A;  2X3L A;  1WYT B;  5AX8 A;  1M4N A;  1TOE A;  4GRX A;  2W7H A;  2VMX A;  1PG8 A;  3FQ8 A;  5E5I A;  1M0Q A;  4W1X A;  3LG0 A;  3FZ8 A;  3LY1 A;  1C9C A;  2D64 A;  3FSL A;  2AY3 A;  1DJU A;  3QHX A;  5FT6 A;  1YAA A;  1B5P A;  3DXV A;  1AIC A;  1SFF A;  1CZC A;  2ZP7 A;  2AY1 A;  1I41 A;  4H51 A;  1D7V A;  1SVV A;  2XBN A;  3FZ6 A;  2X5F A;  1AIB A;  1KL1 A;  4UQV A;  1QGN A;  4AH3 A;  1IUG A;  1AHG A;  1M7Y A;  2W8W A;  2CJD A;  4J5U A;  3FKD A;  3FD0 A;  2JG2 A;  4Y0D A;  3L8A A;  1W7N A;  4MSO A;  1GEX A;  3EI9 A;  4Q76 A;  1QJ3 A;  1YNU A;  5M46 A;  3IF2 A;  1IBJ A;  1MDO A;  4MKJ A;  1N31 A;  2C7T A;  4RAE A;  4AOA A;  2HOY A;  2AEU A;  2RFV A;  3A9Z A;  1WYU B;  1BJW A;  1X2A A;  4MQQ A;  1B5O A;  2VMZ A;  3CBF A;  5M49 A;  2VGV A;  2O7C A;  3I16 A;  3FFR A;  5E4Z A;  4E3Q A;  2TPL A;  1ZOB A;  2CY8 A;  2AY2 A;  4RJ0 A;  1ASG A;  3E2Z B;  1Y4I A;  1H1C A;  4IW7 A;  3FVS A;  2FM1 A;  3PDB A;  1AMS A;  1CL1 A;  1I48 A;  2AY9 A;  3UAK A;  2ZY5 A;  3MC6 A;  3ASB A;  4WXB A;  5EFS A;  1KMK A;  2ZYJ A;  3FCR A;  2YKU A;  3AEL A;  1YJS A;  1IX6 A;  1OHW A;  3HMU A;  1WYU A;  2BIE A;  3ZRP A;  2AY4 A;  1TAS A;  3MC6 C;  1EQB A;  1BS0 A;  3N4S A;  2JIS A;  2Z67 A;  3H9X A;  1ART A;  4A6U A;  2CTZ A;  2YKX A;  2VGS A;  4CVQ A;  4WD2 A;  4EU1 A;  3E2Z A;  3DYD A;  3P6K A;  1SF2 A;  1D7S A;  1OHY A;  2AY8 A;  1I43 A;  2W7D A;  4F4E A;  3H14 A;  3EI6 A;  3E9K A;  3N75 A;  1AY8 A;  1TOI A;  4XQ2 A;  1QZ9 A;  4ITX A;  3RI6 A;  4Q31 A;  4GSA A;  4JF0 A;  3LV2 A;  3AEN A;  4HVK A;  1S07 A;  3N5M A;  4F5I A;  4K05 A;  5EAA A;  4IXZ A;  4JEW A;  5F9S A;  2Z1Z A;  3USF A;  2YRR A;  2VGU A;  5D95 A;  4R8D A;  1TOK A;  1TAT A;  1V2D A;  1DGE A;  4K2I A;  1D7R A;  3DOD A;  3RBF A;  3PA9 A;  1EG5 A;  1YOO A;  3A8U X;  1W7M A;  2FNI A;  3FVX A;  3NYS A;  3QBO A;  4RIZ A;  2XH1 A;  4MGR A;  1ECX A;  3RUY A;  4EB5 A;  4F5K A;  3GZC A;  3OP7 A;  4A00 A;  4GDY A;  1ASE A;  4MQR A;  1ARG A;  2Z9X A;  1SPA A;  2BYJ A;  4IXO A;  3HL2 A;  3NYU A;  3B46 A;  4NOG A;  4OBU A;  4PFF A;  1DGD A;  2VI9 A;  3G8M A;  3MBB A;  4WYF A;  5FT5 A;  2ZJG A;  2E54 A;  2EPJ A;  3N4R A;  5EUD A;  3EIB A;  3ECD A;  1GCK A;  4XAU A;  3OKS A;  3TQX A;  3GR9 A;  2D63 A;  1OXP A;  1WST A;  3BV0 A;  4K2M A;  1ASA A;  4XK1 A;  3L44 A;  2OAT A;  1KMJ A;  4LC3 A;  2WK8 A;  2EGY A;  4RKD A;  5FT4 A;  3WCO A;  3NX3 A;  4BHD A;  3TCM A;  3FZ7 A;  4XJP A;  3FDB A;  3VK4 A;  4PFN A;  2R2N A;  1ASD A;  3PD6 B;  2CFB A;  5DX5 A;  4WP0 A;  5JAY A;  1M6S A;  1YIZ A;  2GMU A;  1AMQ A;  2FYF A;  4W91 A;  2BWP A;  2VMT A;  1GC0 A;  1P3W A;  2WK7 A;  3BWN A;  3WY7 A;  5EUE A;  2ZUK A;  3BB8 A;  3NNK A;  3VK2 A;  1SZU A;  3E6G A;  1RV3 A;  2GSA A;  2O0R A;  1GD9 A;  4B9B A;  2VMY A;  1CQ8 A;  2OKK A;  3BWN C;  2W7E A;  4XJM A;  2O1B A;  2Z1Y A;  4H63 Q;  2VMN A;  2DOU A;  4JF1 A;  9AAT A;  2EH6 A;  1RV4 A;  2G7J A;  3DC1 A;  3PD6 A;  1ASF A;  2YOB A;  1GBN A;  4XJL A;  5M4D A;  3TFT A;  1OAT A;  1J04 A;  1YIY A;  3MEB A;  4ISY A;  1O62 A;  1VEF A;  2DKJ A;  2E7J A;  3F6T A;  4Y0H A;  3BCB A;  3F9T A;  2BWN A;  3ACZ A;  4ZDO A;  1X28 A;  1AJR A;  1C7N A;  4J8L A;  3EZS A;  4RKC A;  3DZZ A;  1SZS A;  1CJ0 A;  3AEP A;  2QA3 A;  3ELP A;  1RVY A;  3E77 A;  4HF8 A;  4R5F A;  3K40 A;  1FC4 A;  1CL2 A;  2D61 A;  3K7Y A;  1G7X A;  5EIG B;  1QIT A;  1PFF A;  1MAP A;  1AJS B;  4N0B A;  2DGK A;  2BKW A;  1OHV A;  4RM1 A;  2NMP A;  3PDB B;  1CZE A;  4QGR A;  1IX7 A;  3HBX A;  4B98 A;  2Z61 A;  3BCX A;  5LHA A;  2W7M A;  2C0R A;  3JWB A;  1G7W A;  3LVM A;  1IJI A;  3NDN A;  2R0T A;  2D65 A;  2YCP A;  1DFO A;  3HDO A;  1WYV A;  4ZWM A;  4F5G A;  3ASA A;  3N0L A;  2C81 A;  3R4T A;  4F5L A;  4RLG A;  4WXF A;  5EIG A;  1MGV A;  4PVF A;  1LC7 A;  1BJN A;  2AY7 A;  1D2F A;  3VP6 A;  4FFC A;  2EO5 A;  4OT8 A;  1LW4 A;  1AJS A;  4ZLV A;  2VMU A;  2Z9V A;  1E5F A;  3JTX A;  3EUC A;  3LVL B;  3VAX A;  4BQ0 A;  2VMR A;  1W7L A;  3AEN B;  1O61 A;  2FNU A;  2YCN A;  2W7I A;  3PPL A;  1MAQ A;  1M0O A;  1ASC A;  1V2F A;  3UWC A;  2HOR A;  1V72 A;  3CQ6 A;  2BHX A;  3M5U A;  1AAM A;  2DGL A;  3B1E A;  2D5Y A;  2VIA A;  3I4J A;  5I92 A;  2GQN A;  4RIT A;  3HVY A;  1M32 A;  2WK9 A;  3MKJ A;  4XJO A;  2V1P A;  5HDM A;  4EMY A;  4CBR A;  1TAR A;  1O4S A;  5BJ4 A;  3PGY A;  4F5M A;  4I8A A;  1ASN A;  1OXO A;  2YKV A;  1BT4 A;  4CBS A;  3RQ1 A;  4OBV A;  4EB7 A;  1ARI A;  4CXR A;  5G0A A;  4ZDP A;  2BWO A;  3EI7 A;  5G4J A;  4ITG A;  1ASB A;  4JE5 D;  1X29 A;  3EZ1 A;  3DR7 A;  1JF9 A;  1MDX A;  2W8V A;  3B8X A;  3Q8N A;  1TOG A;  7AAT A;  2D7Z A;  3WGB A;  1AHX A;  3WGC A;  4AZK A;  1UKJ A;  2PO3 A;  3GBX A;  1TOJ A;  2JJG A;  1I29 A;  2X5D A;  3ATH A;  2W8U A;  3JU7 A;  3B1C A;  2ZSL A;  1VP4 A;  2CB1 A;  1B9H A;  4UHO A;  2CAN A;  3KGX A;  2VMW A;  4LNM A;  3FFH A;  1C4K A;  3AEO A;  2HOZ A;  2W7F A;  4JE5 A;  3IHJ A;  4DQ6 A;  1ELU A;  3CQ5 A;  2VI8 A; 
#chains in the Genus database with same CATH homology
 4LW4 A;  3WZF A;  1MLY A;  3WKS A;  2OGA A;  4WYD A;  1DJE A;  3JWA A;  5KTB A;  1KKP A;  2PB0 A;  2VMQ A;  1LS3 A;  2VYC A;  3PIU A;  1BQA A;  5TF5 A;  2CST A;  3A9X A;  2E7U A;  4A0F A;  2KFP A;  1JG8 A;  4W1V A;  3T32 A;  1BKG A;  2ORD A;  3GET A;  4A0G A;  5J8Q A;  2Z9W A;  2WKA A;  2VMS A;  5HHY A;  1C7O A;  1ARH A;  4E77 A;  2Z9U A;  2VGT A;  1ZC9 A;  4WYE A;  2FKI A;  4WB0 B;  1UU1 A;  1Z3Z A;  1BJO B;  1PMO A;  2F8J A;  4KYO A;  3N7N A;  2W7G A;  2VMO A;  3COG A;  3D6K A;  4OTL A;  3W1J A;  1KKJ A;  2VGW A;  3NUI A;  3NRA A;  3AOW A;  4TN4 A;  1ARS A;  1B8G A;  1IAX A;  1UU2 A;  2YKY A;  1M0N A;  1S0A A;  2ZC0 A;  3E2F A;  2BI1 A;  4WYA A;  3NUB A;  4IX8 A;  2G6W A;  4F5J A;  1AAW A;  3QI6 A;  2QB2 A;  4ZAS A;  1D7U A;  1WKG A;  3FQA A;  2EZ2 A;  3KGW A;  4KXK A;  5DB5 A;  2QBT A;  4ZM3 A;  2HP2 A;  3FDD A;  2ZY3 A;  3A9Y A;  3MAD A;  3PAA A;  5EAV A;  3G7Q A;  1FG7 A;  3RCH A;  4A0H A;  2DR1 A;  2CH1 A;  3DRD A;  3EI8 A;  1J32 A;  4WBT A;  2YHK A;  1WKH A;  1BJO A;  1WYV B;  4LNJ A;  4N0W A;  1GEY A;  4F5H A;  3LWS A;  3PDX A;  1C7G A;  3AEM A;  4WLH A;  4BA5 A;  4JEY A;  1DJ9 A;  4LNL A;  1S06 A;  1H0C A;  1AY5 A;  3LVK A;  3K28 A;  3LVJ A;  1QIS A;  2CJH A;  3BN1 A;  5G09 A;  1JS3 A;  2DGM A;  2JGT A;  4K2B A;  1S09 A;  4A72 A;  1Z7D A;  5LH9 A;  3AEM C;  4TMR A;  1N8P A;  2BIA A;  3DR4 A;  5EQC A;  3ZRR A;  2HZP A;  4FL0 A;  3B1D A;  2WB6 A;  4GE4 A;  1TPL A;  3MAU A;  4TV7 A;  4DBC A;  2W8J A;  5G4I A;  4ADC A;  3GJU A;  4ATQ A;  5M4B A;  1EJI A;  4A6T A;  3MAF B;  4Y0I A;  2JJE A;  2HP1 A;  3AV7 A;  1BQD A;  4ADB A;  1IVR A;  1T3I A;  4IYO B;  4U1T A;  4W1W A;  1AKC A;  4AO4 A;  3KE3 A;  4E1O A;  1CS1 A;  5FT8 A;  3TAT A;  2AAT A;  4IXS A;  1GC3 A;  2FQ6 A;  2QMA A;  1WYT A;  3QGU A;  1AKA A;  3ZRQ A;  4ZWV A;  2VLF A;  3NTJ A;  3EIA A;  2HUU A;  4W8I A;  3QM2 A;  2D7Y A;  4P3M A;  4GE9 A;  4ZDL A;  1GC4 A;  1O69 A;  2YCT A;  4P7Y A;  4MQP A;  1W3U A;  2VMP A;  4OC9 A;  4KAM A;  2OKJ A;  3ZZK A;  4EFF A;  3II0 A;  1YJZ A;  2ZY2 A;  3AAT A;  5G2P A;  2HUF A;  4GE7 A;  3MAF A;  1QIR A;  2V0Y A;  2ZSM A;  1AMR A;  1B4X A;  2OQX A;  3CQ4 A;  4IYO A;  2QLR A;  2HUI A;  3CAI A;  2X8U A;  1XI9 A;  3W1H A;  5BJ3 A;  1KL2 A;  1RVU A;  2R5E A;  1LW5 A;  3AOV A;  1SZK A;  4L0O A;  2EYQ A;  2AY6 A;  3FQ7 A;  1N2T A;  3VK3 A;  2C44 A;  4R2N A;  3QPG A;  1DTY A;  5DJ9 A;  1M0P A;  1QJ5 A;  5HXX A;  1X0M A;  1U08 A;  2GB3 A;  2VGZ A;  4ADE A;  4JEV A;  2QB3 A;  3HLM A;  3GWP A;  2R5C B;  1LK9 A;  4A6R A;  4CXQ A;  3HT4 A;  1ELQ A;  2EZ1 A;  1JS6 A;  2OGE A;  4WB0 A;  3FVU A;  1AIA A;  3NYT A;  4ZM4 A;  3NU7 A;  2GMS A;  4M2J A;  1V2E A;  4OMA A;  4ZSW A;  1ASL A;  1AMA A;  3WX9 A;  4AO9 A;  3R9A A;  1S08 A;  3AEJ A;  1ZOD A;  1LC8 A;  4ATP A;  4M2M A;  1AHE A;  3WKR A;  4BA4 A;  5K8B A;  2BI2 A;  1YJY A;  4MKK A;  1MLZ A;  2BI5 A;  4RJY A;  4PIW A;  2W7L A;  1G4X A;  1ORD A;  2BI3 A;  3FRK A;  3ISL A;  3KKI A;  1AHY A;  2VLH A;  3TFU A;  2BYL A;  2D66 A;  4U2H A;  4ZSY A;  2Z20 A;  4JEZ A;  3BS8 A;  3AEJ C;  3UE8 A;  4BMK A;  2QSR A;  1XEY A;  3EI5 A;  3GSB A;  4UHM A;  1IX8 A;  4XEW A;  1BJ4 A;  4O6Z A;  2R5C A;  2CJG A;  1AKB A;  1AY4 A;  4WXG A;  3E2Y A;  1W23 A;  2FN6 A;  3RBL A;  3WCN A;  1BW0 A;  2BI9 A;  3ELE A;  1MDZ A;  4OCA A;  2E7I A;  2HOX A;  3QN6 A;  4IY7 A;  2Q7W A;  3HQT A;  3PJ0 A;  2CIN A;  2A1V A;  1VJO A;  4M2K A;  4JEX A;  4R5Z A;  4WYG A;  3RCH B;  4ZAH A;  1G4V A;  3BWO A;  2PB2 A;  3H7F A;  8AAT A;  4OYT A;  4E3R A;  2AEV A;  4DGT A;  2JJH A;  3P1T A;  4AZJ A;  3DU4 A;  1FG3 A;  3JW9 A;  1AX4 A;  2AY5 A;  1E5E A;  3I5T A;  2ZY4 A;  2CH2 A;  4UHN A;  4WLJ A;  5IWQ A;  1GEW A;  5G2Q A;  2DKB A;  1ASM A;  2W7K A;  3G0T A;  4Q6R A;  4MY5 A;  3ZZJ A;  4Q75 A;  3GZD A;  1PMM A;  3JZL A;  3FTB A;  5DJ1 A;  3WLX A;  3F0H A;  1GC2 A;  1GDE A;  1CQ7 A;  5D5S A;  2VIB A;  2YRI A;  4LW2 A;  1IAY A;  4UOY A;  1CQ6 A;  1LKC A;  2JJF A;  3BCA A;  2W8T A;  5EUN A;  2BIG A;  3GZD C;  1AHF A;  4GEB A;  4W5K A;  2VMV A;  5E3K A;  3DXW A;  4A0R A;  4F5F A;  1C0N A;  1B9I A;  3A2B A;  4ADD A;  3N4X A;  4WYC A;  3VOM A;  1UU0 A;  3NU8 A;  5F8V A;  3BC8 A;  1LC5 A;  1DKA A;  3W1I A;  2W7J A;  5C6U A;  2X3L A;  1WYT B;  5AX8 A;  1M4N A;  1TOE A;  4GRX A;  2W7H A;  2VMX A;  1PG8 A;  3FQ8 A;  5E5I A;  1M0Q A;  4W1X A;  3LG0 A;  3FZ8 A;  3LY1 A;  1C9C A;  2D64 A;  3FSL A;  2AY3 A;  1DJU A;  3QHX A;  5FT6 A;  1YAA A;  1B5P A;  3DXV A;  1AIC A;  1SFF A;  1CZC A;  2ZP7 A;  2AY1 A;  1I41 A;  4H51 A;  1D7V A;  1SVV A;  2XBN A;  3FZ6 A;  2X5F A;  1AIB A;  1KL1 A;  4UQV A;  1QGN A;  4AH3 A;  1IUG A;  1AHG A;  1M7Y A;  2W8W A;  2CJD A;  4J5U A;  3FKD A;  3FD0 A;  2JG2 A;  4Y0D A;  3L8A A;  1W7N A;  4MSO A;  1GEX A;  3EI9 A;  4Q76 A;  1QJ3 A;  1YNU A;  5M46 A;  3IF2 A;  1IBJ A;  1MDO A;  4MKJ A;  1N31 A;  2C7T A;  4RAE A;  4AOA A;  2HOY A;  2AEU A;  2RFV A;  3A9Z A;  1WYU B;  1BJW A;  1X2A A;  4MQQ A;  1B5O A;  2VMZ A;  3CBF A;  5M49 A;  2VGV A;  2O7C A;  3I16 A;  3FFR A;  5E4Z A;  4E3Q A;  2TPL A;  1ZOB A;  2CY8 A;  2AY2 A;  4RJ0 A;  1ASG A;  3E2Z B;  1Y4I A;  1H1C A;  4IW7 A;  3FVS A;  2FM1 A;  3PDB A;  1AMS A;  1CL1 A;  1I48 A;  2AY9 A;  3UAK A;  2ZY5 A;  3MC6 A;  3ASB A;  4WXB A;  5EFS A;  1KMK A;  2ZYJ A;  3FCR A;  2YKU A;  3AEL A;  1YJS A;  1IX6 A;  1OHW A;  3HMU A;  1WYU A;  2BIE A;  3ZRP A;  2AY4 A;  1TAS A;  3MC6 C;  1EQB A;  1BS0 A;  3N4S A;  2JIS A;  2Z67 A;  3H9X A;  1ART A;  4A6U A;  2CTZ A;  2YKX A;  2VGS A;  4CVQ A;  4WD2 A;  4EU1 A;  3E2Z A;  3DYD A;  3P6K A;  1SF2 A;  1D7S A;  1OHY A;  2AY8 A;  1I43 A;  2W7D A;  4F4E A;  3H14 A;  3EI6 A;  3E9K A;  3N75 A;  1AY8 A;  1TOI A;  4XQ2 A;  1QZ9 A;  4ITX A;  3RI6 A;  4Q31 A;  4GSA A;  4JF0 A;  3LV2 A;  3AEN A;  4HVK A;  1S07 A;  3N5M A;  4F5I A;  4K05 A;  5EAA A;  4IXZ A;  4JEW A;  5F9S A;  2Z1Z A;  3USF A;  2YRR A;  2VGU A;  5D95 A;  4R8D A;  1TOK A;  1TAT A;  1V2D A;  1DGE A;  4K2I A;  1D7R A;  3DOD A;  3RBF A;  3PA9 A;  1EG5 A;  1YOO A;  3A8U X;  1W7M A;  2FNI A;  3FVX A;  3NYS A;  3QBO A;  4RIZ A;  2XH1 A;  4MGR A;  1ECX A;  3RUY A;  4EB5 A;  4F5K A;  3GZC A;  3OP7 A;  4A00 A;  4GDY A;  1ASE A;  4MQR A;  1ARG A;  2Z9X A;  1SPA A;  2BYJ A;  4IXO A;  3HL2 A;  3NYU A;  3B46 A;  4NOG A;  4OBU A;  4PFF A;  1DGD A;  2VI9 A;  3G8M A;  3MBB A;  4WYF A;  5FT5 A;  2ZJG A;  2E54 A;  2EPJ A;  3N4R A;  5EUD A;  3EIB A;  3ECD A;  1GCK A;  4XAU A;  3OKS A;  3TQX A;  3GR9 A;  2D63 A;  1OXP A;  1WST A;  3BV0 A;  4K2M A;  1ASA A;  4XK1 A;  3L44 A;  2OAT A;  1KMJ A;  4LC3 A;  2WK8 A;  2EGY A;  4RKD A;  5FT4 A;  3WCO A;  3NX3 A;  4BHD A;  3TCM A;  3FZ7 A;  4XJP A;  3FDB A;  3VK4 A;  4PFN A;  2R2N A;  1ASD A;  3PD6 B;  2CFB A;  5DX5 A;  4WP0 A;  5JAY A;  1M6S A;  1YIZ A;  2GMU A;  1AMQ A;  2FYF A;  4W91 A;  2BWP A;  2VMT A;  1GC0 A;  1P3W A;  2WK7 A;  3BWN A;  3WY7 A;  5EUE A;  2ZUK A;  3BB8 A;  3NNK A;  3VK2 A;  1SZU A;  3E6G A;  1RV3 A;  2GSA A;  2O0R A;  1GD9 A;  4B9B A;  2VMY A;  1CQ8 A;  2OKK A;  3BWN C;  2W7E A;  4XJM A;  2O1B A;  2Z1Y A;  4H63 Q;  2VMN A;  2DOU A;  4JF1 A;  9AAT A;  2EH6 A;  1RV4 A;  2G7J A;  3DC1 A;  3PD6 A;  1ASF A;  2YOB A;  1GBN A;  4XJL A;  5M4D A;  3TFT A;  1OAT A;  1J04 A;  1YIY A;  3MEB A;  4ISY A;  1O62 A;  1VEF A;  2DKJ A;  2E7J A;  3F6T A;  4Y0H A;  3BCB A;  3F9T A;  2BWN A;  3ACZ A;  4ZDO A;  1X28 A;  1AJR A;  1C7N A;  4J8L A;  3EZS A;  4RKC A;  3DZZ A;  1SZS A;  1CJ0 A;  3AEP A;  2QA3 A;  3ELP A;  1RVY A;  3E77 A;  4HF8 A;  4R5F A;  3K40 A;  1FC4 A;  1CL2 A;  2D61 A;  3K7Y A;  1G7X A;  5EIG B;  1QIT A;  1PFF A;  1MAP A;  1AJS B;  4N0B A;  2DGK A;  2BKW A;  1OHV A;  4RM1 A;  2NMP A;  3PDB B;  1CZE A;  4QGR A;  1IX7 A;  3HBX A;  4B98 A;  2Z61 A;  3BCX A;  5LHA A;  2W7M A;  2C0R A;  3JWB A;  1G7W A;  3LVM A;  1IJI A;  3NDN A;  2R0T A;  2D65 A;  2YCP A;  1DFO A;  3HDO A;  1WYV A;  4ZWM A;  4F5G A;  3ASA A;  3N0L A;  2C81 A;  3R4T A;  4F5L A;  4RLG A;  4WXF A;  5EIG A;  1MGV A;  4PVF A;  1LC7 A;  1BJN A;  2AY7 A;  1D2F A;  3VP6 A;  4FFC A;  2EO5 A;  4OT8 A;  1LW4 A;  1AJS A;  4ZLV A;  2VMU A;  2Z9V A;  1E5F A;  3JTX A;  3EUC A;  3LVL B;  3VAX A;  4BQ0 A;  2VMR A;  1W7L A;  3AEN B;  1O61 A;  2FNU A;  2YCN A;  2W7I A;  3PPL A;  1MAQ A;  1M0O A;  1ASC A;  1V2F A;  3UWC A;  2HOR A;  1V72 A;  3CQ6 A;  2BHX A;  3M5U A;  1AAM A;  2DGL A;  3B1E A;  2D5Y A;  2VIA A;  3I4J A;  5I92 A;  2GQN A;  4RIT A;  3HVY A;  1M32 A;  2WK9 A;  3MKJ A;  4XJO A;  2V1P A;  5HDM A;  4EMY A;  4CBR A;  1TAR A;  1O4S A;  5BJ4 A;  3PGY A;  4F5M A;  4I8A A;  1ASN A;  1OXO A;  2YKV A;  1BT4 A;  4CBS A;  3RQ1 A;  4OBV A;  4EB7 A;  1ARI A;  4CXR A;  5G0A A;  4ZDP A;  2BWO A;  3EI7 A;  5G4J A;  4ITG A;  1ASB A;  4JE5 D;  1X29 A;  3EZ1 A;  3DR7 A;  1JF9 A;  1MDX A;  2W8V A;  3B8X A;  3Q8N A;  1TOG A;  7AAT A;  2D7Z A;  3WGB A;  1AHX A;  3WGC A;  4AZK A;  1UKJ A;  2PO3 A;  3GBX A;  1TOJ A;  2JJG A;  1I29 A;  2X5D A;  3ATH A;  2W8U A;  3JU7 A;  3B1C A;  2ZSL A;  1VP4 A;  2CB1 A;  1B9H A;  4UHO A;  2CAN A;  3KGX A;  2VMW A;  4LNM A;  3FFH A;  1C4K A;  3AEO A;  2HOZ A;  2W7F A;  4JE5 A;  3IHJ A;  4DQ6 A;  1ELU A;  3CQ5 A;  2VI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...