2R2OA

Crystal structure of the effector domain of human plexin b1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
100
Chain Sequence
YRPLTLNALLAAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plexin-B1
publication title Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 26
structure length 100
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2r2oA00
2NCNA 2M17A 3CF6E 4MJSB 2CHZA 2KXJA 2VRRB 5JHBA 1E8ZA 3GZNI 3W1YA 2FUHB 1J19A 4E74A 4MELA 3PRPB 2M1MA 4DXAB 2GBKA 5LLIA 2L0FA 2LGYA 1WJNA 1YJ1A 4GXBA 3L54A 3K9PB 4TQ1A 1UBQA 1WM2A 2BWFA 4HXDA 4K81A 1X1MA 5DCNA 1V81A 5BO4B 2K1FA 3JSVB 2ZNVB 4W9KA 4DDID 3R7QA 2ZEQA 3PHWB 3QJZA 4ANXA 3UQAA 4K7WA 4BKSA 2CS4A 2JZZA 4FA6A 1IYFA 2JPHA 3N3KB 2IO1B 4RM9A 1WXAA 1GC7A 3RCZA 2WDTB 4IM3A 2WX1A 1RLFA 3DDCB 1Y8RC 2FCQA 2L76A 2UYZB 4LCDE 2JT4B 2WYQA 4ANWA 1WJ6A 1SGHA 2XK5A 3B08A 3OAWA 2K6DB 4XX5A 3TMPB 3WIMA 4FJZA 1WY8A 1BT0A 4G50A 2YVCA 2D2QA 2PEAA 3ZUNA 2KZRA 2L00B 1D3ZA 1WMHA 3RZWC 2G4SA 3VUXA 2JVCA 3OLMD 3QK0A 2B3AA 4W9IA 3NOBA 2FCSA 3DVGX 4IC7B 2CKHB 3DVNU 5G2NA 3QAQA 2KC1A 4XC2A 5J17A 2JZ3B 4WJQA 2PE9A 4NAWA 3TL5A 4WAAA 2RSUA 4FADA 4G0NB 4MH0E 2N1WA 1M94A 4GDKB 1JRUA 3V62A 1PQSA 5C1ZA 2IO3B 2EMSA 2G4DB 2W9NA 3L16A 2HJ8A 3V61A 2NPTA 4DHZE 2DENB 5AEKB 2DYBA 3UIOB 3PHXB 2LGDA 1UD7A 2FCNA 3R7RA 2GOWA 2LI5A 3BINA 3ZNID 3IBEA 1A5RA 1C3TA 5CTRC 4WJPA 1GNUA 1R4MI 4ICVA 3ZDMC 3B1LX 2KC2A 2KK8A 2KOXA 2LJ5A 2MBHA 4FN2A 4MDKE 4EUTA 2KQSA 4BOSC 4IM0A 2KJHB 4NJ6A 3WA0A 2I1JA 3PVLA 1P1AA 1P98A 2MBBB 1WGRA 4KDLB 4WWPA 5C23A 4HK2A 4F8CB 2LXAA 3A1QB 1ZGUB 3SD5A 3VTVA 3ZTDA 4BKSD 3HIZA 2ZNVC 3VHTC 5IA7A 2BPSA 4GIVA 2KFKB 4PYZA 3H7SA 4M8MA 1V49A 4OVVA 1RAXA 4AOFA 1WX9A 4MEMA 4MGKE 2KTRA 1NBFC 1E8WA 2KFJA 4J6IA 5D6JB 3ZNZB 1ZKHA 1R4NI 3PLVA 2LVQA 1E8XA 2KWUB 2M0XA 4W9HA 1I42A 1KLVA 1XD3B 3P2BA 4G3XB 4AUQC 4BOZB 2KNBA 4KDIC 2IO0B 3APFA 5CX3A 2Z0DB 2HD5B 2RD0A 2ASQA 4DBGA 4EKUA 2MLBA 2J7QB 3DBSA 2MBEA 4TQ0A 5LXIB 2MP2A 3NHEB 3T9LA 5HKHA 1P3QU 3TBLD 4OVUA 2K8BA 1V2YA 1WYWB 3TCAA 3M63B 4NJ7A 1QZEA 2MRPA 2N4FA 3EECA 3H6NA 4M8NA 1WM3A 2AYOB 2MW5A 3T8MA 4KSKC 3ZVVA 5KHQA 2GMIC 1KOTA 2Z59B 2IZVB 3W1SA 1WGGA 1OQYA 2AWTA 4M0WB 1WXVA 2L0TA 4HLEA 2PJHA 4MM3A 2K8CA 2KX0A 4GU2A 2RR9A 3RD2A 4K1RB 1V5OA 2I1KA 4KIKA 5L83A 4X57B 3S2AA 3PTFC 1WZ3A 3R66C 3DQVA 3APCA 2O6VA 4JQWC 2C5LC 5J18A 4FULA 3RYTA 3Q3FA 4LDTB 2BGFA 1EUVB 3QHTA 1E5WA 2BF8B 2MCNB 4B6WA 2C7NB 1YD8U 2G45B 1GUAB 3VH3B 2R2QA 4W9JA 1CMXB 1J8CA 2DYMA 3VTWA 2KX3A 2GBNA 2N7DA 4W9FA 3ZRCA 1EO6A 2MBQA 4XZ4A 3M95A 4TV3A 2REXA 2FNJB 2LD9A 5G55A 1LXDA 3AU5A 4IG7B 4EEWA 3L0WB 5DPWA 4DDGD 3ML9A 2LWPA 2NBUA 2KMAA 4KVGB 2MSED 1P9DU 3UQBA 4URKA 3L10B 1E7VA 3SDLC 3ZTCA 3ZIMA 2LASA 4ZRIA 4HCNB 3U8ZA 1I35A 2YLMA 3AULA 1YIWA 4BKGA 3H7PA 5CHFA 3IG3A 4YL8A 2J0JA 3N32A 5DPSA 1LM8B 2A5UA 4GSWA 3KYDD 5E6OA 5GMVA 1V6EA 3VVWB 2LGXA 4DHJD 2M4NA 4ASWC 5JHAA 4PS8A 4WJNA 3PZDA 2L3ZA 4HPLB 2ZVOA 4ZYNA 2KTFA 4EZJA 2Z0EB 4I6LB 4BKTA 4B95A 3OJ4B 1UELA 2IYDB 4CYEA 1TGZB 4DHZB 1GG3A 4P7IA 3L13A 3VUWA 3ML8A 2JWZA 4HDQA 4BFRA 2JUOA 3JVZX 5J2RA 2WWZA 1UZXB 3WANA 2KN5A 3A4RA 4BBNC 4HWIB 3PLUA 3ZKJC 2BKFA 5CHVC 3ALBA 3MHSD 4A3OA 2JXXA 5CHWA 4RMAA 1ZW7A 2KDIA 2IY1B 4MSMB 1WGDA 3A9KB 3PRZA 4NQKE 4AJYB 3VDZA 1H4RA 2ZCBA 4GDLB 5TR5A 3VH4B 2O6VD 3WAPA 3DBRI 4F7ZA 2O2VB 2R2OA 3EC8A 4NPNA 4HVBA 4NY0A 3UGBB 4MGYE 3UIPB 4B9KA 3A9JA 3V6CB 2RGFA 4AWJA 5LXHA 4MGIE 4WQOB 1V5TA 1J0GA 3QIJA 2K25A 3QWZB 2CHWA 2KTRB 2NR2A 1E90A 2OJRA 4FHJA 4GDKA 2ZPYA 1TTNA 4G11A 2FIFA 4DK5A 3A33B 4IWOA 1WF9A 3ZDTA 3KW5B 3X23A 1OTRB 1WR1A 2KVRA 1S1QB 4I6NB 3D32A 4BVUC 2PPHA 3ENEA 3KUDB 2NBVB 2ZVNA 3H1UA 2JY6A 3MTNB 2J0MA 2MP2B 4IM2A 4LJOB 2N7EA 1UH6A 4WWOA 4HDOA 2GBJA 3QARA 4LDTD 4K7UA 2Y5BB 3K9OB 4KZ0A 2KHWB 2DAJA 4MGZE 1OEYA 3LJ3A 3AU4A 4II2B 4W9DA 2CU1A 4HJKA 3WALA 2DYOA 3L08A 3RZFA 3VUYA 3NZUA 3QX1A 4FHKA 4E71A 1OGWA 5DPRA 5JZEB 2BKRB 4W9LA 2KWCA 1E7UA 2AEHA 3JYUA 4GMVA 3CSFA 2BWES 1FXTB 4PS7A 2EMTA 3GOEA 1VCBA 3A1QA 3BY4B 5IAAC 3NZSA 3DVGY 1Q5WB 5E6NA 3L17A 3QCAA 4K7SA 1LFDA 4FLHA 3DBHI 3DVNV 2MX2A 1WE7A 3PGEA 1WIAA 1RFAA 2K8HA 2GBRA 3R3MA 1K8RB 2KJ6A 2D3GA 2LVPA 3PSEB 3HM3A 2ZJDA 3VXWA 4A20A 4FJVB 3O65B 4ZRKA 2RPQA 4W9EA 3ZRFA 3PRMB 3A4SC 2NBWB 3UF8A 5E6PA 3PPAA 3TIXA 2IY0B 4IW0A 4AJWA 2JRIB 1Q1OA 5DPTA 2MBOA 3ZW3A 2OOBB 1TBEA 1EF5A 4EZLA 1VD2A 5AZFA 3NS8A 2KJRA 1WX7A 4KSLC 1S3SG 3Q3JA 2NVUI 3HK0A 3ZLZA 4ANVA 2XEWA 4II3B 2XK5B 2FAZA 2IBIB 2L8JA 3CSTA 3MJWA 4JLCA 3LDZE 2C7MB 4WJOA 3H7PB 3ZO5B 1G6JA 4MJSA 1WZ0A 1LQBA 2DAFA 4IWQA 4GOCA 2C60A 1H8CA 1NDDA 4DWFA 2N1VA 4AP4C 1WRDB 4MSQB 4ZRJA 1WMHB 3IFWB 4EFOA 1XT9B 1YX5B 2PE6B 3RULA 3V6EB 1L7YA 3OJ3A 2FCMA 1WXSA 2K6QA 2BYEA 4NAWB 2V3SA 2KDEB 2V1YA 3VTUA 3PS6A 2KD0A 3HHMA 1MG8A 3DPDA 3WAMA 1UGMA 1Z2MA 1SIFA 1GC6A 2HTHA 2LVOA 3UINB 2LUEA 3JSVA 3WAOA 3X0WA 4FBJB 3EHVA 3PT2B 2L05A 2QHOA 3ZNGC 2NPTB 2ZZPB 3W1SC 4JGHB 4RM8A 2N9XA 3ZNHB 3C0RB 5D2MB 1F9JA 1WXMA 1WI0A 2XBBC 1WX8A 3VFKA 1KM7A 1WFYA 3EFUA 3KUCB 4JL9A 1C1YB 2IO2B 2J0KA 2D10A 2HE7A 2N9EB 3ONSA 4HCPB 4A3PA 1WGYA 2C9WB 1T0YA 1WJ4A 3DOWA 4EOYA 1XQQA 3AXCA 2CR5A 3QC8B 3A9JB 4CHKA 2EKEC 3I3TB 4NNJB 2LRWA 3QA8A 5AZHA 3AI5A 1WGHA 1YX6B 1WR6E 4TUUA 2DHZA 2DZKA 1E8YA 2N9PC 4GB9A 1V9JA 5L95C 2K39A 2KWVB 3M3JA 4BBNF 1GJZA 2KO3A 3VAWA 2BYVE 1WJUA 1ISNA 2MA9B 4W9CA 3RUIB 3KVFB 2MQJA 2KLCA 1OEYJ 3H9DA 2DX5B 1AARA 2D11A 1WE6A 3PREA 4GN1A 3KH0A 5D94A 4JIOU 4IUMB 4PYUA 2BYFA 3TJPA 4LJPB 2KQ7A 4DHJB 2KLGA 1U4AA 4EZKA 4I6PA 3U7DA 3PV1A 3A9KA 2MWSB 1YQBA 1KJTA 1UBIA 2L7RA 3JW0X 5AZGA 3SHQA 4GDLA 1L2NA 3KYCD 3N30A 4N9F4 2KDFB 4PS3A 1HE8A 5FR6A 3DBLI 4F1SA 2O2VA 4CO7A 3HM6X 3RT3B 3SU8X 3U30A 2KDBA 2LZ6A 4WWNA 1RRBA 1Q0WB 4KV2A 3DCGA 2C7HA 3IHPC 3NY5A 4FJYA 3APDA 2LXCA 3CMMB 2ZPNA 2LRUA 2UWQA 1P0RA 2GBMA 3V60A 3IVFA 2D07B 5D7GA 2WX0A 4ICUA 1WH3A 1NI2A 2CHXA 2AL6A 2KANA 2V4LA 4ANUA 3B0AA 4HPMB 5KHOA 2JRHA 5EDSA 2KFKA 4KIKB 4ZDVA 1EF1A 5JH5C 2O6VB 3VQIA 4KZCA 2JF5A 3M62B 2DZJA 2M8SA 4NQLB 1V80A 4E3CA 4W9GA 2G3QB 1IP9A 1IPGA 2KKCA 3QQ8B 2A4ZA 2KMCA 4IWPA 2FIDA 4GGQA 1SE9A 4TKNA 2DZIA 2DZMA 1TZ1A 1Z5SB 2NS5A 2ZCCA 3KUZA 3ECIA 1V86A 2AL3A
chains in the Genus database with same CATH superfamily
2ICIA 3NJTA 4MJSB 4C56C 4M01A 3RNCC 3W5VB 3ZGZA 2FUHB 4RF0A 2FE8A 2L0FA 2GLSA 1WJNA 4TQ1A 1WM2A 4HXDA 3DWMA 2K1FA 4MACA 4W9KA 4DDID 1TKEA 2JZZA 4FA6A 1IGCA 3AECB 2MHJA 2HDEA 3RCZA 1KRHA 2WX1A 1MPEA 1DYQA 3DDCB 1JQ4A 5H8YE 3TEYA 3E9SA 2JT4B 1SGHA 2XK5A 4XX5A 3NG0A 2YVCA 1I4GA 2G4SA 3VUXA 2G9HD 3DVGX 4IC7B 5G2NA 3B2GA 4MH8A 3MJ5A 3R2TA 3UI3A 4WAAA 4MH0E 1ZUD2 5BMIA 3V61A 4DHZE 5AEKB 3UIOB 1OFFA 3R7RA 1YN4A 2LI5A 3ZNID 1UGJA 3ZDMC 3B1LX 2LJ5A 2MBHA 4FN2A 2KJHB 3PVLA 1F52A 5C23A 4OZAA 2LXAA 3A1QB 2FUG1 3ZTDA 1F0ZA 3VHTC 2WLBA 3H7SA 1RAXA 2KFJA 2KTRA 3ZNZB 3PLVA 1E8XA 2KWUB 2M0XA 2W54A 1I42A 1KLVA 3U2SC 1SE2A 4DQOC 2IO0B 5CX3A 1V97A 2ASQA 3GE3C 4EKUA 2MLBA 2MBEA 2K8BA 1WYWB 3TCAA 1WXQA 3EECA 3H6NA 1OQQA 1WM3A 4A8XC 5KHQA 1HZ6A 1KOTA 2Z59B 3W1SA 4M0WB 1WXVA 2L0TA 2KX0A 2WXRA 2PKOA 3ZJTA 4K1RB 4KIKA 4X57B 2QMTA 2BBCA 5J18A 4LDTB 3B9JA 1MFWA 4RGTA 4B0EA 3VH3B 4W9JA 1CMXB 2AQ1B 1J8CA 2AQ2B 3M95A 2REXA 4YXDB 2LD9A 1LXDA 4EEWA 3IAS1 4LNIA 3RI7C 4N58A 3ML9A 2LWPA 2AQ3B 1P9DU 2LASA 1M4VA 3GP7A 2B76B 2YLMA 3AULA 3H7PA 4YL8A 4LTUA 3BVZA 1LM8B 4GSWA 1XCQL 3KYDD 2LGIA 2LGXA 2JXTA 1MHXA 4EZJA 4BKTA 1UELA 5HI1A 2IYDB 4CYEA 5G5GA 4N6EB 4HDQA 4BFRA 2JUOA 3JVZX 1XLOA 1TKYA 1HTQA 1UZXB 1V1PB 2BKFA 2V9HA 2JX5A 2IY1B 3DWGC 4AJYB 1PYWD 3NZ3A 3B2FA 3N1ZC 2RDGA 5TR5A 2O6VD 1OQRA 1FNVA 2R2OA 3EC8A 3UGBB 3HVZA 2FBWB 1AN8A 4MGIE 4KKIA 4NZLB 1JWBD 1E90A 2OJRA 3NVYA 1IUEA 4GDKA 4B0MA 1T0RC 4G11A 1ZDXA 4KGSA 1VZ7A 3A33B 3ZDTA 3KW5B 3E56A 1BMLC 1L6VA 1OTRB 1DGJA 2KVRA 1S1QB 2WXOA 1ENFA 1SJED 2MP2B 1N6ZA 4WWOA 2GBJA 2X38A 3QARA 4ANWA 2Y5BB 3Q8FA 2KHWB 1OEYA 4W9DA 3VUYA 1NYQA 3QX1A 4FHKA 1OGWA 5E6JA 4W9LA 2BYTA 3O13A 2BWES 1FXTB 1R4MB 3GOEA 1ET9A 1SSNA 2V3NA 3V3XA 3DVGY 4IKGA 4K3BA 4REZA 1I4XA 1SBBB 2K8HA 1N62A 2IGHA 2D3GA 2LVPA 3PSEB 3HM3A 4YWGG 3VXWA 2BS2B 3A4SC 2IY0B 1CJEA 2N0SB 4IW0A 3P42A 2MBOA 4EZLA 5AZFA 2W55A 3N1XC 1S3SG 3Q3JA 4ANVA 3AEFB 4II3B 2XK5B 3X23A 3P4RB 4JLCA 1RFKA 2C7MB 3LDZE 4MJSA 4ZRJA 1C77A 1N60A 2PE6B 3RULA 2RDBC 3OJ3A 1UF0A 2WHIA 1VDVA 2BYEA 3KLSX 5IKCM 4L23A 3AE5B 1MG8A 4WQMA 3DPDA 3WAMA 1UGMA 4XDDA 4H2AA 2LUEA 2L83A 2D5GA 2L05A 2QHOA 2K22A 4JGHB 1F77A 2WS3B 4RM8A 1K50A 3C0RB 1JWSD 1F9JA 1WXMA 1WI0A 5I4DA 1WX8A 2IGGA 3ABVB 1PDXA 4JL9A 2IO2B 2D10A 2DBYA 2ACZB 1WGYA 3AE9B 1T0YA 4CHKA 2D3BA 1UWMA 4NNJB 4WH4A 3QA8A 5AZHA 3AI5A 1ROEA 1YX6B 5L95C 2KT7A 5HHDG 1PGBA 2KWVB 1GJZA 1FD6A 4USAA 2BYVE 3AV8A 3ZQ4A 3SR6A 1AARA 2OEDA 5D94A 2NTTA 3CWIA 4PYUA 2BYFA 4LJPB 2KLGA 3U7DA 3AH7A 1KF6B 2MWSB 1FIQA 2L7RA 2WXMA 1CZPA 3SHQA 4OZCA 3KYCD 4N9F4 2KDFB 1KLUD 1HE8A 1XLPA 2TSSA 5FR6A 3R2IA 3HM6X 1AWDA 3Q3OC 3SU8X 3Q8CA 3IHPC 4ZOHC 1E6EB 2LXCA 2ZPNA 1SJHD 3V60A 2WXJA 1WH3A 2KANA 2JRHA 2G1EA 5EDSA 4KIKB 3AE6B 3Q6BA 5JH5C 1L0YB 1BXTA 3M62B 1V80A 5C3JB 4W9GA 2G3QB 1IPGA 4A55A 5EE3A 4GGQA 2NMQA 3GE8C 3KUZA 1V86A 2RMMA 1K51A 3CF6E 1D5ZC 2PTLA 3AE4B 1J19A 4MELA 1JW9D 2BT6A 4DXAB 3Q8EA 2GBKA 2E6XA 2LGYA 2INNE 2EELA 2BWFA 5DCNA 3JSVB 3R7QA 2LUMA 3ETRA 3UQAA 1IYFA 2JPHA 4RH6A 3N3KB 2WDTB 3AE2B 4IM3A 1RLFA 5TSSA 2Y3AA 1Y8RC 4LCDE 1WJ6A 3TMPB 1NVID 1TZOA 4ZHPA 1BT0A 2D2QA 2PEAA 2KZRA 5BYRA 1GB4A 2JVCA 4WWMA 3AMZA 3QAQA 2KC1A 2JZ3B 4WJQA 3MFGA 3P63A 3GS2A 1FXIA 4G0NB 4GDKB 4S0RA 3V62A 1HXYD 2I38A 1C79A 2SAKA 2IO3B 3IAM1 2G4DB 4LLGM 2W9NA 2HJ8A 2DENB 2K5PA 4US8A 2FCNA 1V1PA 3BINA 1C3TA 3L4PA 1R4MI 2KACA 2KK8A 2KOXA 4MDKE 1I4RA 1P1AA 2MBBB 4KDLB 5AUIA 1L0XB 3SD5A 3VTVA 2OJWA 3HIZA 2KFKB 2J53A 4OVVA 4AOFA 4J6IA 2PIAA 1E9MA 1ZKHA 2W82A 1C9FA 2PLPA 1TS4A 4NJCA 2WNMA 4OHJA 4G3XB 4AUQC 4A9AA 4P16A 1KTKA 3APFA 2Z0DB 1F2RI 2RD0A 4M02A 4DBGA 1T3QA 3DBSA 4TQ0A 2MP2A 3NHEB 3T9LA 4XYCA 1QZEA 2WU2B 2AYOB 4KSKC 4LNFA 3ZVVA 2GMIC 2YEPB 2IZVB 1OQYA 2AWTA 1TKGA 1GPXA 1LGRA 3NVVA 4MM3A 1VJKA 4GU2A 2UU7A 1FFUA 2WDQB 3DQVA 3RNFC 2C5LC 3C19A 4FULA 2DWQA 2Q5WD 1YD8U 3MC9A 2R2QA 4Q2JA 2DYMA 3VTWA 1EO6A 2IDYA 5G55A 3AU5A 4IG7B 3AEDB 2ZW0A 4R3DA 4RGNA 2LHEA 2KMAA 2MSED 3UQBA 4URKA 3L10B 1E7VA 3SDLC 4ZRIA 4PT5A 4HCNB 1I35A 3IG3A 3N32A 1MI0A 1V6EA 2M4NA 1JROA 2BVCA 3GZNB 3PZDA 4ZYNA 2MJEA 4LNKA 1TGZB 3ML8A 3A4RA 3ZKJC 3T3NA 4A3OA 1ZW7A 2KDIA 4C7ZA 1YMHE 1Y56A 4A90A 2QIEB 3TUOA 1F1HA 1K53A 4HVBA 4NY0A 3VRAB 3UIPB 3V6CB 3NVWA 4AWJA 1GB1A 1RWSA 1QLBB 2I2YA 4O1NA 2NR2A 3EA6A 3PZ8A 2LJIA 1TTNA 3FILB 4P1BC 2FIFA 4DK5A 2N9KA 2L1AA 4IWOA 2LGSA 1WF9A 3KQ4A 1L5PA 1WR1A 1PGAA 1SE4A 4I6NB 5FK9C 3ENEA 3KUDB 3AEEB 3H1UA 2J0MA 1JWAD 4HDOA 4KZ0A 1WGKA 2DAJA 4ARIA 2BS4B 4HJKA 3WALA 4RGMA 4E71A 2KDMA 2BKRB 3TEWA 3JYUA 1B9RA 3I57A 3RNEC 4ZRPA 3CIRB 2D3CA 3I63C 2KAJA 4K7SA 1LFDA 3DBHI 3PGEA 1MHHE 2GBRA 3R3MA 2EKIA 2KJ6A 3J9CA 3IT6B 4FJVB 3O65B 4ZRKA 2RPQA 1TYGB 1JRPA 3UF8A 5E6PA 3PPAA 3KWVA 1R4NB 4YSYB 1VD2A 3NS8A 2KJRA 1D5XC 2XEWA 3MJWA 3ZO5B 4WJOA 3C8YA 1WZ0A 2DAFA 1QT9A 3DHHC 2MH7A 4MSQB 4AP4C 3TSSA 1TY2A 2K6QA 1CK1A 2BW2A 1HA5A 1SF0A 3VTUA 3PS6A 4NAMA 1ZE3D 1Z2MA 4JE3B 3UINB 3JSVA 3WAOA 3X0WA 2CJOA 2SEBD 2N9XA 2XBBC 1WFYA 2LMCA 2N9EB 2J0KA 2HE7A 2JSVX 4HCPB 4YT0B 1QOFA 2CR5A 3QC8B 1XLNA 4XWWA 2LRWA 3BWUD 3Q3NC 1ZXIA 5BMHA 2QJLA 1XXGA 4TUUA 2VH2A 2DHZA 2K39A 1ZP0B 3M3JA 3VAWA 2INPE 2YEPF 3RUIB 3KVFB 1NI3A 2DX5B 3SFEB 4JIOU 3FAHA 4IUMB 1TY0A 2V3PA 3TJPA 1FCLA 1SE3A 4EZKA 2KYWA 3A9KA 1KJTA 2KMMA 4GDLA 2GB1A 3N30A 1HEZE 4PS3A 1EU3A 2VH1A 4F1SA 2O2VA 5JXVA 4HRSA 4ZRQA 3DCGA 4FJYA 2WXGA 1T0SC 3NS1A 2UWQA 1FM0D 1P0RA 3DBRB 4MM3B 4ICUA 3U7ZA 2KFKA 4ZDVA 4RF1A 2Z8LA 3VQIA 4KZCA 5G5HA 3N20C 2JF5A 3MC8A 3RN9C 2ZW1A 4NQLB 4E3CA 2KKCA 1ZDVA 2KMCA 3OWEB 1FXAA 3W2DA 3K9PB 3LXFA 2AL3A 2M17A 1HZ5A 3AE8B 2CHZA 2VRRB 1E8ZA 3GZNI 2Y5CA 1TT5B 4E74A 3PRPB 3Q3MC 1DOIA 5LLIA 1R7SA 4GXBA 1TS5A 3L54A 1T0QC 1UBQA 1XO3A 1X1MA 1V81A 2J52A 1E10A 4ACFA 2ZEQA 4ANXA 1QQRA 4BKSA 2IO1B 1WXAA 3AN1A 2L76A 2UYZB 2WYQA 4HKQA 4YTNB 2K6DB 1I7HA 3HVDA 1WRIA 1SB3C 1FCCC 1PFDA 2JWUA 1D3ZA 4LNNA 3RZWC 4W9IA 5LNK1 2FCSA 5EE1A 1DOYA 2PE9A 2N1WA 5C1ZA 4OVZA 3N1YC 2EMSA 3KWLA 3V05A 2WGSA 2DYBA 2LGDA 1UD7A 2WXLA 4FXCA 1PUTA 3IT4B 3Q2AC 3IBEA 2J42A 4WJPA 1GNUA 4AQ7A 4RFBA 2KC2A 4RNAA 1B1ZA 2KQSA 4IM0A 2I1JA 1NENB 1P98A 4J3OD 1WGRA 4WWPA 1FNWA 2H89B 4F8CB 4N59A 3ZYYX 3NVZA 2E3TA 2BQQA 5IA7A 3AB5A 2BPSA 3PZ7A 4PYZA 3LYYA 1J7BA 2PVOD 1V49A 4LK0M 1YN3A 1WX9A 1NBFC 1E8WA 5D6JB 1R4NI 2LVQA 3BYTB 4W9HA 3FILA 3P2BA 4BOZB 1I4HA 4P6VF 4KDIC 2HD5B 3AE7B 4D2KA 2MJ3A 5HG2A 5LXIB 1P3QU 3M63B 2MRPA 2N4FA 4M8NA 2MW5A 4JPSA 1WGGA 4C7YA 5IP4D 4HLEA 1KH0A 2PJHA 2K8CA 2K9XA 2I1KA 3S2AA 1YN5A 3PTFC 3R66C 1QF6A 3APCA 2BGFA 1FFVA 1EUVB 2BF8B 2PVGC 2MCNB 2DNFA 4B6WA 4EE2A 1RYJA 2C7NB 1MVKA 4AS1A 1TJEA 1C4CA 3VR9B 3LB8C 2V0GA 2KX3A 5D3DA 3P4QB 1TIFA 1QOGA 2QDFA 3Q8AA 4RCOA 4TV3A 3AEGB 3L0WB 5DPWA 4DDGD 2NBUA 4KVGB 4C80A 1FO4A 3ZTCA 2J4XA 4BAXA 1SXTA 3U8ZA 1YIWA 5CHFA 1N63A 5DPSA 2A5UA 2BS3B 2H88B 5JHAA 4ASWC 1JALA 2KTFA 3NRZA 2Z0EB 4I6LB 1QOAA 4IDIA 4B95A 2N7JA 1GG3A 4P7IA 3EFCA 1JWUD 2JWZA 4TMAB 4HROA 1E7PB 5J2RA 2KN5A 2LEKA 3BVMA 3ALBA 1D5MC 4RMAA 4IOIE 2KN4A 1VR9A 2HTME 4MSMB 4YTPB 2QEJC 1WGDA 3A9KB 3P4SB 3VDZA 1YQ3B 2ZCBA 4GDLB 3P4PB 3I9V1 1FEHA 4HEA1 3WAPA 3DBRI 2O2VB 2VZKB 4B9KA 2RGFA 1I4QA 3MC0B 3R8BA 1HTOA 4WQOB 1V5TA 1J0GA 2M56B 2K25A 3QWZB 1P7EA 2WXHA 2JU6X 4FHJA 2ZPYA 1XEEA 4WIPA 1VZ6A 3U4EG 4K3CA 4US9A 1ZOYB 3D32A 2ZVNA 2JY6A 5EE0A 4LJOB 2N7EA 4XWTA 1UH6A 2M19A 3K9OB 3LJ3A 4II2B 3RFZB 2DYOA 3RZFA 3NZUA 3PO0A 5DPRA 5JZEB 3U52E 3VR8B 1VCBA 5IAAC 3NZSA 1E0ZA 5E6NA 3QCAA 5MPOA 1KLGD 4JWUC 3Q8BA 4XDCA 1K8RB 4A20A 3URYA 4W9EA 3ZRFA 1VZ8A 5IO9A 2N9LA 1GOZA 2WDRB 2JRIB 5DPTA 1EF5A 1WX7A 4KSLC 3ZLZA 1JWMD 3CSTA 1G6JA 2JZPA 1H8CA 2BB6A 1QILA 3IFWB 1JMLA 1XT9B 3VRBB 3SFDB 1N5XA 2V3SA 1BUIC 1ESFA 2V1YA 1C78A 5BYQA 1SIFA 1GC6A 2LVOA 4FBJB 3PT2B 3P1MA 4HPPA 3VFKA 3EFUA 1YOVB 3BYYB 4A3PA 1MJDA 2C9WB 1WJ4A 4EOYA 4LNOA 1XQQA 2WXKA 3EUB2 3A9JB 2GRIA 2N9PC 1MG4A 1V9JA 4ZYSA 2KO3A 1WJUA 1ISNA 2MA9B 3N9YC 4W9CA 1OEYJ 3H9DA 2D11A 4GN1A 1WE6A 2NTSA 4YTMB 1WSPA 4DHJB 1U4AA 2JYEA 4I6PA 4KX6B 3PV1A 1UBIA 3JW0X 5AZGA 4CO7A 3RT3B 4XGAB 4ZHOA 1XF5L 2KDBA 1Q0WB 1TS2A 3HUIA 3DHIC 3AEAB 3APDA 3FKYA 3CMMB 2LRUA 2QC8A 3IVFA 2D07B 2WX0A 2V4LA 2CHXA 1FNUA 4HPMB 5KHOA 3Q14C 3BK1A 1IBXA 1FRDA 2DZJA 2R61A 2M0AA 1N61A 1EU4A 1IP9A 1UNSA 4IWPA 1SE9A 2DZIA 2X8XX 2KWDA 2ZCCA 4BVUC 1E8YA 2NCNA 3ZXRA 4XE0A 2KXJA 5JHBA 4WURA 1RM6C 1KFYB 3W1YA 2WDVB 1LO5D 1WWTA 2M1MA 1ACCA 2JQRB 1HQRD 2RPVA 1YJ1A 2BB5A 4K81A 5BO4B 3WCQA 2ZNVB 2VZKD 5IOIA 3PHWB 3QJZA 4C4VB 4K7WA 1D6EC 2CS4A 4RM9A 1GC7A 5T8IA 1D4BA 2FCQA 1T5XD 2CJNA 1T6BX 3B08A 3OAWA 3WIMA 1IGDA 4FJZA 1WY8A 2JYTA 3BIID 4G50A 2DLBA 3ZUNA 4TSSA 2L00B 1WMHA 4CQNA 3OLMD 1N5WA 2B3AA 2K3UA 3NOBA 3QK0A 2CKHB 3DVNU 3GB1A 4XC2A 5J17A 4NAWA 1SIJA 3ZJUA 3TL5A 4A6QA 2RSUA 4FADA 1M94A 1JRUA 4HJGE 5FKAC 1PQSA 1ET6A 2HJ1A 2XN9C 3L16A 2NPTA 3RNBC 1C4PA 3PHXB 5EE9A 2GOWA 4L2YA 1A5RA 5CTRC 4ICVA 4WAFA 1V1OA 2WP9B 4EUTA 1STEA 4BOSC 4QAYA 4NJ6A 3WA0A 5IN7A 4KKJA 4HK2A 1ZGUB 4BKSD 5D3IB 3W9CB 2ZNVC 4GIVA 2Y5PA 4M8MA 4MEMA 4MGKE 4C00A 1YNTE 1XD3B 2KNBA 5BYSA 1J7AA 1A70A 2J7QB 4YSZB 5HKHA 2IPKD 1YQ4B 3TBLD 4OVUA 1V2YA 4NJ7A 1QOBA 3T8MA 4DXFA 1WYGA 2MEKA 3DBLB 4P1CC 2RR9A 3RD2A 1V5OA 2WXFA 3AE1B 4MT5A 5L83A 1WZ3A 4S17A 4JQWC 2O6VA 3RYTA 1ZXHA 3Q3FA 3QHTA 1E5WA 2G45B 1GUAB 2GBNA 2N7DA 4W9FA 3ZRCA 2MBQA 4XZ4A 2FNJB 4DXGA 1PGXA 2IGDA 4PK1A 3ZJVA 2L52A 3AM9A 3ZIMA 4BKGA 1QKZA 2J0JA 4KGRA 5GMVA 4DHJD 5E6OA 3VVWB 2WXNA 4PS8A 4WJNA 1XLQA 2L3ZA 4HPLB 2ZVOA 1ZPSA 4KGTA 3OJ4B 4DHZB 3VUWA 3L13A 5C2TB 2WWZA 2XNAC 1VLBA 3WANA 4BBNC 4HWIB 3PLUA 1FRRA 5CHVC 3MHSD 2JXXA 5CHWA 3PRZA 4NQKE 1H4RA 3VH4B 4ARCA 3DHGC 4F7ZA 4NPNA 2W3RA 4MGYE 3A9JA 1EWCA 1AW7A 5LXHA 1SEBD 2KVZA 3BK2A 2WXQA 3QIJA 2IJ0A 2CHWA 2KTRB 3H8HA 3HRDD 5H92C 2LHDA 4OZBA 1F2RC 4GLSC 4ITKA 1IBXB 1C4AA 1YJJA 2PPHA 4RGOS 2NBVB 1XCTL 3MTNB 2LFIA 4IM2A 2CU3A 4LDTD 4K7UA 4MGZE 3AU4A 2CU1A 4JX1C 3L08A 1JCKB 2MJDA 2KQ4X 2KWCA 1E7UA 2AEHA 3Q69A 4GMVA 3CSFA 4YSXB 4PS7A 2EMTA 1EM7A 3A1QA 3BY4B 1NEKB 2INCC 1Q5WB 5HFYA 3L17A 1FMAD 4FLHA 3DVNV 2MX2A 1WE7A 1Q10A 1WIAA 1RFAA 1VRAB 4BZAA 3NUHB 1DOXA 2ZJDA 3PRMB 2INDC 2NBWB 2AX5A 3TIXA 1TS3A 3T3OA 4AJWA 1Q1OA 3ZW3A 2OOBB 2QILA 1TBEA 1L6UA 3IXSA 2NVUI 3HK0A 2FAZA 2IBIB 2L8JA 3AEBB 3H7PB 4M0WA 4UDUC 1LQBA 1YJIA 4IWQA 4GOCA 2C60A 1EWYC 2BTEA 1NDDA 4DWFA 2N1VA 1WRDB 1WMHB 4EFOA 1YX5B 3V6EB 1L7YA 2FCMA 1WXSA 3AE3B 4NAWB 2KDEB 2WXPA 3DBHB 1J7CA 2KD0A 3HHMA 3SEBA 2HTHA 3W5UB 3EHVA 3ZNGC 4L1BA 2NPTB 2ZZPB 3W1SC 4C4VA 3BZDB 3ZNHB 2RDHA 5D2MB 1KM7A 2WU5B 3KUCB 1C1YB 3ONSA 2L32A 1V8CA 3DOWA 3AXCA 2EKEC 3I3TB 3I5JC 2V4IB 1WGHA 3BVGA 1WR6E 4GB9A 2DZKA 2ONQA 1P7FA 3MP9A 4BBNF 1K52A 1FPYA 1NYRA 1GAQB 5BMGA 2MQJA 2OHFA 2KLCA 5AUKA 1L4ZB 4M00A 3PREA 3KH0A 3TEXA 5FR3A 3OG5A 3RNAC 3MHZA 2D3AA 2KQ7A 2QCZA 2WQYB 2WXIA 1YQBA 2W3SA 2K0PA 1UWXA 1L2NA 1L0VB 1UUPA 3DBLI 3RPFC 2PMVA 1L4DB 3U30A 2LZ6A 4WWNA 1RRBA 4KV2A 2C7HA 3NY5A 3RNGC 5GXGB 2GI9A 2GBMA 4HKZE 5D7GA 3TEZA 1NI2A 2AL6A 4ANUA 3ZXVA 3B0AA 4JWSC 2PW9A 2QSDA 3FC4A 3RMKC 1I4PA 1EF1A 2O6VB 1C76A 2M8SA 2ON8A 1AYFA 3QQ8B 2A4ZA 2FIDA 2DZMA 3EGRA 1TZ1A 1Z5SB 1CQVA 2NS5A 3ECIA 4TKNA 4OW0A
chains in the Genus database with same CATH topology
2NCNA 2M17A 3CF6E 4MJSB 2CHZA 2KXJA 2VRRB 5JHBA 1E8ZA 3GZNI 3W1YA 2FUHB 1J19A 4E74A 4MELA 3PRPB 2M1MA 4DXAB 2GBKA 5LLIA 2L0FA 2LGYA 1WJNA 1YJ1A 4GXBA 3L54A 3K9PB 4TQ1A 1UBQA 1WM2A 2BWFA 4HXDA 4K81A 1X1MA 5DCNA 1V81A 5BO4B 2K1FA 3JSVB 2ZNVB 4W9KA 4DDID 3R7QA 2ZEQA 3PHWB 3QJZA 4ANXA 3UQAA 4K7WA 4BKSA 2CS4A 2JZZA 4FA6A 1IYFA 2JPHA 3N3KB 2IO1B 4RM9A 1WXAA 1GC7A 3RCZA 2WDTB 4IM3A 2WX1A 1RLFA 3DDCB 1Y8RC 2FCQA 2L76A 2UYZB 4LCDE 2JT4B 2WYQA 4ANWA 1WJ6A 1SGHA 2XK5A 3B08A 3OAWA 2K6DB 4XX5A 3TMPB 3WIMA 4FJZA 1WY8A 1BT0A 4G50A 2YVCA 2D2QA 2PEAA 3ZUNA 2KZRA 2L00B 1D3ZA 1WMHA 3RZWC 2G4SA 3VUXA 2JVCA 3OLMD 3QK0A 2B3AA 4W9IA 3NOBA 2FCSA 3DVGX 4IC7B 2CKHB 3DVNU 5G2NA 3QAQA 2KC1A 4XC2A 5J17A 2JZ3B 4WJQA 2PE9A 4NAWA 3TL5A 4WAAA 2RSUA 4FADA 4G0NB 4MH0E 2N1WA 1M94A 4GDKB 1JRUA 3V62A 1PQSA 5C1ZA 2IO3B 2EMSA 2G4DB 2W9NA 3L16A 2HJ8A 3V61A 2NPTA 4DHZE 2DENB 5AEKB 2DYBA 3UIOB 3PHXB 2LGDA 1UD7A 2FCNA 3R7RA 2GOWA 2LI5A 3BINA 3ZNID 3IBEA 1A5RA 1C3TA 5CTRC 4WJPA 1GNUA 1R4MI 4ICVA 3ZDMC 3B1LX 2KC2A 2KK8A 2KOXA 2LJ5A 2MBHA 4FN2A 4MDKE 4EUTA 2KQSA 4BOSC 4IM0A 2KJHB 4NJ6A 3WA0A 2I1JA 3PVLA 1P1AA 1P98A 2MBBB 1WGRA 4KDLB 4WWPA 5C23A 4HK2A 4F8CB 2LXAA 3A1QB 1ZGUB 3SD5A 3VTVA 3ZTDA 4BKSD 3HIZA 2ZNVC 3VHTC 5IA7A 2BPSA 4GIVA 2KFKB 4PYZA 3H7SA 4M8MA 1V49A 4OVVA 1RAXA 4AOFA 1WX9A 4MEMA 4MGKE 2KTRA 1NBFC 1E8WA 2KFJA 4J6IA 5D6JB 3ZNZB 1ZKHA 1R4NI 3PLVA 2LVQA 1E8XA 2KWUB 2M0XA 4W9HA 1I42A 1KLVA 1XD3B 3P2BA 4G3XB 4AUQC 4BOZB 2KNBA 4KDIC 2IO0B 3APFA 5CX3A 2Z0DB 2HD5B 2RD0A 2ASQA 4DBGA 4EKUA 2MLBA 2J7QB 3DBSA 2MBEA 4TQ0A 5LXIB 2MP2A 3NHEB 3T9LA 5HKHA 1P3QU 3TBLD 4OVUA 2K8BA 1V2YA 1WYWB 3TCAA 3M63B 4NJ7A 1QZEA 2MRPA 2N4FA 3EECA 3H6NA 4M8NA 1WM3A 2AYOB 2MW5A 3T8MA 4KSKC 3ZVVA 5KHQA 2GMIC 1KOTA 2Z59B 2IZVB 3W1SA 1WGGA 1OQYA 2AWTA 4M0WB 1WXVA 2L0TA 4HLEA 2PJHA 4MM3A 2K8CA 2KX0A 4GU2A 2RR9A 3RD2A 4K1RB 1V5OA 2I1KA 4KIKA 5L83A 4X57B 3S2AA 3PTFC 1WZ3A 3R66C 3DQVA 3APCA 2O6VA 4JQWC 2C5LC 5J18A 4FULA 3RYTA 3Q3FA 4LDTB 2BGFA 1EUVB 3QHTA 1E5WA 2BF8B 2MCNB 4B6WA 2C7NB 1YD8U 2G45B 1GUAB 3VH3B 2R2QA 4W9JA 1CMXB 1J8CA 2DYMA 3VTWA 2KX3A 2GBNA 2N7DA 4W9FA 3ZRCA 1EO6A 2MBQA 4XZ4A 3M95A 4TV3A 2REXA 2FNJB 2LD9A 5G55A 1LXDA 3AU5A 4IG7B 4EEWA 3L0WB 5DPWA 4DDGD 3ML9A 2LWPA 2NBUA 2KMAA 4KVGB 2MSED 1P9DU 3UQBA 4URKA 3L10B 1E7VA 3SDLC 3ZTCA 3ZIMA 2LASA 4ZRIA 4HCNB 3U8ZA 1I35A 2YLMA 3AULA 1YIWA 4BKGA 3H7PA 5CHFA 3IG3A 4YL8A 2J0JA 3N32A 5DPSA 1LM8B 2A5UA 4GSWA 3KYDD 5E6OA 5GMVA 1V6EA 3VVWB 2LGXA 4DHJD 2M4NA 4ASWC 5JHAA 4PS8A 4WJNA 3PZDA 2L3ZA 4HPLB 2ZVOA 4ZYNA 2KTFA 4EZJA 2Z0EB 4I6LB 4BKTA 4B95A 3OJ4B 1UELA 2IYDB 4CYEA 1TGZB 4DHZB 1GG3A 4P7IA 3L13A 3VUWA 3ML8A 2JWZA 4HDQA 4BFRA 2JUOA 3JVZX 5J2RA 2WWZA 1UZXB 3WANA 2KN5A 3A4RA 4BBNC 4HWIB 3PLUA 3ZKJC 2BKFA 5CHVC 3ALBA 3MHSD 4A3OA 2JXXA 5CHWA 4RMAA 1ZW7A 2KDIA 2IY1B 4MSMB 1WGDA 3A9KB 3PRZA 4NQKE 4AJYB 3VDZA 1H4RA 2ZCBA 4GDLB 5TR5A 3VH4B 2O6VD 3WAPA 3DBRI 4F7ZA 2O2VB 2R2OA 3EC8A 4NPNA 4HVBA 4NY0A 3UGBB 4MGYE 3UIPB 4B9KA 3A9JA 3V6CB 2RGFA 4AWJA 5LXHA 4MGIE 4WQOB 1V5TA 1J0GA 3QIJA 2K25A 3QWZB 2CHWA 2KTRB 2NR2A 1E90A 2OJRA 4FHJA 4GDKA 2ZPYA 1TTNA 4G11A 2FIFA 4DK5A 3A33B 4IWOA 1WF9A 3ZDTA 3KW5B 3X23A 1OTRB 1WR1A 2KVRA 1S1QB 4I6NB 3D32A 4BVUC 2PPHA 3ENEA 3KUDB 2NBVB 2ZVNA 3H1UA 2JY6A 3MTNB 2J0MA 2MP2B 4IM2A 4LJOB 2N7EA 1UH6A 4WWOA 4HDOA 2GBJA 3QARA 4LDTD 4K7UA 2Y5BB 3K9OB 4KZ0A 2KHWB 2DAJA 4MGZE 1OEYA 3LJ3A 3AU4A 4II2B 4W9DA 2CU1A 4HJKA 3WALA 2DYOA 3L08A 3RZFA 3VUYA 3NZUA 3QX1A 4FHKA 4E71A 1OGWA 5DPRA 5JZEB 2BKRB 4W9LA 2KWCA 1E7UA 2AEHA 3JYUA 4GMVA 3CSFA 2BWES 1FXTB 4PS7A 2EMTA 3GOEA 1VCBA 3A1QA 3BY4B 5IAAC 3NZSA 3DVGY 1Q5WB 5E6NA 3L17A 3QCAA 4K7SA 1LFDA 4FLHA 3DBHI 3DVNV 2MX2A 1WE7A 3PGEA 1WIAA 1RFAA 2K8HA 2GBRA 3R3MA 1K8RB 2KJ6A 2D3GA 2LVPA 3PSEB 3HM3A 2ZJDA 3VXWA 4A20A 4FJVB 3O65B 4ZRKA 2RPQA 4W9EA 3ZRFA 3PRMB 3A4SC 2NBWB 3UF8A 5E6PA 3PPAA 3TIXA 2IY0B 4IW0A 4AJWA 2JRIB 1Q1OA 5DPTA 2MBOA 3ZW3A 2OOBB 1TBEA 1EF5A 4EZLA 1VD2A 5AZFA 3NS8A 2KJRA 1WX7A 4KSLC 1S3SG 3Q3JA 2NVUI 3HK0A 3ZLZA 4ANVA 2XEWA 4II3B 2XK5B 2FAZA 2IBIB 2L8JA 3CSTA 3MJWA 4JLCA 3LDZE 2C7MB 4WJOA 3H7PB 3ZO5B 1G6JA 4MJSA 1WZ0A 1LQBA 2DAFA 4IWQA 4GOCA 2C60A 1H8CA 1NDDA 4DWFA 2N1VA 4AP4C 1WRDB 4MSQB 4ZRJA 1WMHB 3IFWB 4EFOA 1XT9B 1YX5B 2PE6B 3RULA 3V6EB 1L7YA 3OJ3A 2FCMA 1WXSA 2K6QA 2BYEA 4NAWB 2V3SA 2KDEB 2V1YA 3VTUA 3PS6A 2KD0A 3HHMA 1MG8A 3DPDA 3WAMA 1UGMA 1Z2MA 1SIFA 1GC6A 2HTHA 2LVOA 3UINB 2LUEA 3JSVA 3WAOA 3X0WA 4FBJB 3EHVA 3PT2B 2L05A 2QHOA 3ZNGC 2NPTB 2ZZPB 3W1SC 4JGHB 4RM8A 2N9XA 3ZNHB 3C0RB 5D2MB 1F9JA 1WXMA 1WI0A 2XBBC 1WX8A 3VFKA 1KM7A 1WFYA 3EFUA 3KUCB 4JL9A 1C1YB 2IO2B 2J0KA 2D10A 2HE7A 2N9EB 3ONSA 4HCPB 4A3PA 1WGYA 2C9WB 1T0YA 1WJ4A 3DOWA 4EOYA 1XQQA 3AXCA 2CR5A 3QC8B 3A9JB 4CHKA 2EKEC 3I3TB 4NNJB 2LRWA 3QA8A 5AZHA 3AI5A 1WGHA 1YX6B 1WR6E 4TUUA 2DHZA 2DZKA 1E8YA 2N9PC 4GB9A 1V9JA 5L95C 2K39A 2KWVB 3M3JA 4BBNF 1GJZA 2KO3A 3VAWA 2BYVE 1WJUA 1ISNA 2MA9B 4W9CA 3RUIB 3KVFB 2MQJA 2KLCA 1OEYJ 3H9DA 2DX5B 1AARA 2D11A 1WE6A 3PREA 4GN1A 3KH0A 5D94A 4JIOU 4IUMB 4PYUA 2BYFA 3TJPA 4LJPB 2KQ7A 4DHJB 2KLGA 1U4AA 4EZKA 4I6PA 3U7DA 3PV1A 3A9KA 2MWSB 1YQBA 1KJTA 1UBIA 2L7RA 3JW0X 5AZGA 3SHQA 4GDLA 1L2NA 3KYCD 3N30A 4N9F4 2KDFB 4PS3A 1HE8A 5FR6A 3DBLI 4F1SA 2O2VA 4CO7A 3HM6X 3RT3B 3SU8X 3U30A 2KDBA 2LZ6A 4WWNA 1RRBA 1Q0WB 4KV2A 3DCGA 2C7HA 3IHPC 3NY5A 4FJYA 3APDA 2LXCA 3CMMB 2ZPNA 2LRUA 2UWQA 1P0RA 2GBMA 3V60A 3IVFA 2D07B 5D7GA 2WX0A 4ICUA 1WH3A 1NI2A 2CHXA 2AL6A 2KANA 2V4LA 4ANUA 3B0AA 4HPMB 5KHOA 2JRHA 5EDSA 2KFKA 4KIKB 4ZDVA 1EF1A 5JH5C 2O6VB 3VQIA 4KZCA 2JF5A 3M62B 2DZJA 2M8SA 4NQLB 1V80A 4E3CA 4W9GA 2G3QB 1IP9A 1IPGA 2KKCA 3QQ8B 2A4ZA 2KMCA 4IWPA 2FIDA 4GGQA 1SE9A 4TKNA 2DZIA 2DZMA 1TZ1A 1Z5SB 2NS5A 2ZCCA 3KUZA 3ECIA 1V86A 2AL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCN A;  2M17 A;  3CF6 E;  4MJS B;  2CHZ A;  2KXJ A;  2VRR B;  5JHB A;  1E8Z A;  3GZN I;  3W1Y A;  2FUH B;  1J19 A;  4E74 A;  4MEL A;  3PRP B;  2M1M A;  4DXA B;  2GBK A;  5LLI A;  2L0F A;  2LGY A;  1WJN A;  1YJ1 A;  4GXB A;  3L54 A;  3K9P B;  4TQ1 A;  1UBQ A;  1WM2 A;  2BWF A;  4HXD A;  4K81 A;  1X1M A;  5DCN A;  1V81 A;  5BO4 B;  2K1F A;  3JSV B;  2ZNV B;  4W9K A;  4DDI D;  3R7Q A;  2ZEQ A;  3PHW B;  3QJZ A;  4ANX A;  3UQA A;  4K7W A;  4BKS A;  2CS4 A;  2JZZ A;  4FA6 A;  1IYF A;  2JPH A;  3N3K B;  2IO1 B;  4RM9 A;  1WXA A;  1GC7 A;  3RCZ A;  2WDT B;  4IM3 A;  2WX1 A;  1RLF A;  3DDC B;  1Y8R C;  2FCQ A;  2L76 A;  2UYZ B;  4LCD E;  2JT4 B;  2WYQ A;  4ANW A;  1WJ6 A;  1SGH A;  2XK5 A;  3B08 A;  3OAW A;  2K6D B;  4XX5 A;  3TMP B;  3WIM A;  4FJZ A;  1WY8 A;  1BT0 A;  4G50 A;  2YVC A;  2D2Q A;  2PEA A;  3ZUN A;  2KZR A;  2L00 B;  1D3Z A;  1WMH A;  3RZW C;  2G4S A;  3VUX A;  2JVC A;  3OLM D;  3QK0 A;  2B3A A;  4W9I A;  3NOB A;  2FCS A;  3DVG X;  4IC7 B;  2CKH B;  3DVN U;  5G2N A;  3QAQ A;  2KC1 A;  4XC2 A;  5J17 A;  2JZ3 B;  4WJQ A;  2PE9 A;  4NAW A;  3TL5 A;  4WAA A;  2RSU A;  4FAD A;  4G0N B;  4MH0 E;  2N1W A;  1M94 A;  4GDK B;  1JRU A;  3V62 A;  1PQS A;  5C1Z A;  2IO3 B;  2EMS A;  2G4D B;  2W9N A;  3L16 A;  2HJ8 A;  3V61 A;  2NPT A;  4DHZ E;  2DEN B;  5AEK B;  2DYB A;  3UIO B;  3PHX B;  2LGD A;  1UD7 A;  2FCN A;  3R7R A;  2GOW A;  2LI5 A;  3BIN A;  3ZNI D;  3IBE A;  1A5R A;  1C3T A;  5CTR C;  4WJP A;  1GNU A;  1R4M I;  4ICV A;  3ZDM C;  3B1L X;  2KC2 A;  2KK8 A;  2KOX A;  2LJ5 A;  2MBH A;  4FN2 A;  4MDK E;  4EUT A;  2KQS A;  4BOS C;  4IM0 A;  2KJH B;  4NJ6 A;  3WA0 A;  2I1J A;  3PVL A;  1P1A A;  1P98 A;  2MBB B;  1WGR A;  4KDL B;  4WWP A;  5C23 A;  4HK2 A;  4F8C B;  2LXA A;  3A1Q B;  1ZGU B;  3SD5 A;  3VTV A;  3ZTD A;  4BKS D;  3HIZ A;  2ZNV C;  3VHT C;  5IA7 A;  2BPS A;  4GIV A;  2KFK B;  4PYZ A;  3H7S A;  4M8M A;  1V49 A;  4OVV A;  1RAX A;  4AOF A;  1WX9 A;  4MEM A;  4MGK E;  2KTR A;  1NBF C;  1E8W A;  2KFJ A;  4J6I A;  5D6J B;  3ZNZ B;  1ZKH A;  1R4N I;  3PLV A;  2LVQ A;  1E8X A;  2KWU B;  2M0X A;  4W9H A;  1I42 A;  1KLV A;  1XD3 B;  3P2B A;  4G3X B;  4AUQ C;  4BOZ B;  2KNB A;  4KDI C;  2IO0 B;  3APF A;  5CX3 A;  2Z0D B;  2HD5 B;  2RD0 A;  2ASQ A;  4DBG A;  4EKU A;  2MLB A;  2J7Q B;  3DBS A;  2MBE A;  4TQ0 A;  5LXI B;  2MP2 A;  3NHE B;  3T9L A;  5HKH A;  1P3Q U;  3TBL D;  4OVU A;  2K8B A;  1V2Y A;  1WYW B;  3TCA A;  3M63 B;  4NJ7 A;  1QZE A;  2MRP A;  2N4F A;  3EEC A;  3H6N A;  4M8N A;  1WM3 A;  2AYO B;  2MW5 A;  3T8M A;  4KSK C;  3ZVV A;  5KHQ A;  2GMI C;  1KOT A;  2Z59 B;  2IZV B;  3W1S A;  1WGG A;  1OQY A;  2AWT A;  4M0W B;  1WXV A;  2L0T A;  4HLE A;  2PJH A;  4MM3 A;  2K8C A;  2KX0 A;  4GU2 A;  2RR9 A;  3RD2 A;  4K1R B;  1V5O A;  2I1K A;  4KIK A;  5L83 A;  4X57 B;  3S2A A;  3PTF C;  1WZ3 A;  3R66 C;  3DQV A;  3APC A;  2O6V A;  4JQW C;  2C5L C;  5J18 A;  4FUL A;  3RYT A;  3Q3F A;  4LDT B;  2BGF A;  1EUV B;  3QHT A;  1E5W A;  2BF8 B;  2MCN B;  4B6W A;  2C7N B;  1YD8 U;  2G45 B;  1GUA B;  3VH3 B;  2R2Q A;  4W9J A;  1CMX B;  1J8C A;  2DYM A;  3VTW A;  2KX3 A;  2GBN A;  2N7D A;  4W9F A;  3ZRC A;  1EO6 A;  2MBQ A;  4XZ4 A;  3M95 A;  4TV3 A;  2REX A;  2FNJ B;  2LD9 A;  5G55 A;  1LXD A;  3AU5 A;  4IG7 B;  4EEW A;  3L0W B;  5DPW A;  4DDG D;  3ML9 A;  2LWP A;  2NBU A;  2KMA A;  4KVG B;  2MSE D;  1P9D U;  3UQB A;  4URK A;  3L10 B;  1E7V A;  3SDL C;  3ZTC A;  3ZIM A;  2LAS A;  4ZRI A;  4HCN B;  3U8Z A;  1I35 A;  2YLM A;  3AUL A;  1YIW A;  4BKG A;  3H7P A;  5CHF A;  3IG3 A;  4YL8 A;  2J0J A;  3N32 A;  5DPS A;  1LM8 B;  2A5U A;  4GSW A;  3KYD D;  5E6O A;  5GMV A;  1V6E A;  3VVW B;  2LGX A;  4DHJ D;  2M4N A;  4ASW C;  5JHA A;  4PS8 A;  4WJN A;  3PZD A;  2L3Z A;  4HPL B;  2ZVO A;  4ZYN A;  2KTF A;  4EZJ A;  2Z0E B;  4I6L B;  4BKT A;  4B95 A;  3OJ4 B;  1UEL A;  2IYD B;  4CYE A;  1TGZ B;  4DHZ B;  1GG3 A;  4P7I A;  3L13 A;  3VUW A;  3ML8 A;  2JWZ A;  4HDQ A;  4BFR A;  2JUO A;  3JVZ X;  5J2R A;  2WWZ A;  1UZX B;  3WAN A;  2KN5 A;  3A4R A;  4BBN C;  4HWI B;  3PLU A;  3ZKJ C;  2BKF A;  5CHV C;  3ALB A;  3MHS D;  4A3O A;  2JXX A;  5CHW A;  4RMA A;  1ZW7 A;  2KDI A;  2IY1 B;  4MSM B;  1WGD A;  3A9K B;  3PRZ A;  4NQK E;  4AJY B;  3VDZ A;  1H4R A;  2ZCB A;  4GDL B;  5TR5 A;  3VH4 B;  2O6V D;  3WAP A;  3DBR I;  4F7Z A;  2O2V B;  2R2O A;  3EC8 A;  4NPN A;  4HVB A;  4NY0 A;  3UGB B;  4MGY E;  3UIP B;  4B9K A;  3A9J A;  3V6C B;  2RGF A;  4AWJ A;  5LXH A;  4MGI E;  4WQO B;  1V5T A;  1J0G A;  3QIJ A;  2K25 A;  3QWZ B;  2CHW A;  2KTR B;  2NR2 A;  1E90 A;  2OJR A;  4FHJ A;  4GDK A;  2ZPY A;  1TTN A;  4G11 A;  2FIF A;  4DK5 A;  3A33 B;  4IWO A;  1WF9 A;  3ZDT A;  3KW5 B;  3X23 A;  1OTR B;  1WR1 A;  2KVR A;  1S1Q B;  4I6N B;  3D32 A;  4BVU C;  2PPH A;  3ENE A;  3KUD B;  2NBV B;  2ZVN A;  3H1U A;  2JY6 A;  3MTN B;  2J0M A;  2MP2 B;  4IM2 A;  4LJO B;  2N7E A;  1UH6 A;  4WWO A;  4HDO A;  2GBJ A;  3QAR A;  4LDT D;  4K7U A;  2Y5B B;  3K9O B;  4KZ0 A;  2KHW B;  2DAJ A;  4MGZ E;  1OEY A;  3LJ3 A;  3AU4 A;  4II2 B;  4W9D A;  2CU1 A;  4HJK A;  3WAL A;  2DYO A;  3L08 A;  3RZF A;  3VUY A;  3NZU A;  3QX1 A;  4FHK A;  4E71 A;  1OGW A;  5DPR A;  5JZE B;  2BKR B;  4W9L A;  2KWC A;  1E7U A;  2AEH A;  3JYU A;  4GMV A;  3CSF A;  2BWE S;  1FXT B;  4PS7 A;  2EMT A;  3GOE A;  1VCB A;  3A1Q A;  3BY4 B;  5IAA C;  3NZS A;  3DVG Y;  1Q5W B;  5E6N A;  3L17 A;  3QCA A;  4K7S A;  1LFD A;  4FLH A;  3DBH I;  3DVN V;  2MX2 A;  1WE7 A;  3PGE A;  1WIA A;  1RFA A;  2K8H A;  2GBR A;  3R3M A;  1K8R B;  2KJ6 A;  2D3G A;  2LVP A;  3PSE B;  3HM3 A;  2ZJD A;  3VXW A;  4A20 A;  4FJV B;  3O65 B;  4ZRK A;  2RPQ A;  4W9E A;  3ZRF A;  3PRM B;  3A4S C;  2NBW B;  3UF8 A;  5E6P A;  3PPA A;  3TIX A;  2IY0 B;  4IW0 A;  4AJW A;  2JRI B;  1Q1O A;  5DPT A;  2MBO A;  3ZW3 A;  2OOB B;  1TBE A;  1EF5 A;  4EZL A;  1VD2 A;  5AZF A;  3NS8 A;  2KJR A;  1WX7 A;  4KSL C;  1S3S G;  3Q3J A;  2NVU I;  3HK0 A;  3ZLZ A;  4ANV A;  2XEW A;  4II3 B;  2XK5 B;  2FAZ A;  2IBI B;  2L8J A;  3CST A;  3MJW A;  4JLC A;  3LDZ E;  2C7M B;  4WJO A;  3H7P B;  3ZO5 B;  1G6J A;  4MJS A;  1WZ0 A;  1LQB A;  2DAF A;  4IWQ A;  4GOC A;  2C60 A;  1H8C A;  1NDD A;  4DWF A;  2N1V A;  4AP4 C;  1WRD B;  4MSQ B;  4ZRJ A;  1WMH B;  3IFW B;  4EFO A;  1XT9 B;  1YX5 B;  2PE6 B;  3RUL A;  3V6E B;  1L7Y A;  3OJ3 A;  2FCM A;  1WXS A;  2K6Q A;  2BYE A;  4NAW B;  2V3S A;  2KDE B;  2V1Y A;  3VTU A;  3PS6 A;  2KD0 A;  3HHM A;  1MG8 A;  3DPD A;  3WAM A;  1UGM A;  1Z2M A;  1SIF A;  1GC6 A;  2HTH A;  2LVO A;  3UIN B;  2LUE A;  3JSV A;  3WAO A;  3X0W A;  4FBJ B;  3EHV A;  3PT2 B;  2L05 A;  2QHO A;  3ZNG C;  2NPT B;  2ZZP B;  3W1S C;  4JGH B;  4RM8 A;  2N9X A;  3ZNH B;  3C0R B;  5D2M B;  1F9J A;  1WXM A;  1WI0 A;  2XBB C;  1WX8 A;  3VFK A;  1KM7 A;  1WFY A;  3EFU A;  3KUC B;  4JL9 A;  1C1Y B;  2IO2 B;  2J0K A;  2D10 A;  2HE7 A;  2N9E B;  3ONS A;  4HCP B;  4A3P A;  1WGY A;  2C9W B;  1T0Y A;  1WJ4 A;  3DOW A;  4EOY A;  1XQQ A;  3AXC A;  2CR5 A;  3QC8 B;  3A9J B;  4CHK A;  2EKE C;  3I3T B;  4NNJ B;  2LRW A;  3QA8 A;  5AZH A;  3AI5 A;  1WGH A;  1YX6 B;  1WR6 E;  4TUU A;  2DHZ A;  2DZK A;  1E8Y A;  2N9P C;  4GB9 A;  1V9J A;  5L95 C;  2K39 A;  2KWV B;  3M3J A;  4BBN F;  1GJZ A;  2KO3 A;  3VAW A;  2BYV E;  1WJU A;  1ISN A;  2MA9 B;  4W9C A;  3RUI B;  3KVF B;  2MQJ A;  2KLC A;  1OEY J;  3H9D A;  2DX5 B;  1AAR A;  2D11 A;  1WE6 A;  3PRE A;  4GN1 A;  3KH0 A;  5D94 A;  4JIO U;  4IUM B;  4PYU A;  2BYF A;  3TJP A;  4LJP B;  2KQ7 A;  4DHJ B;  2KLG A;  1U4A A;  4EZK A;  4I6P A;  3U7D A;  3PV1 A;  3A9K A;  2MWS B;  1YQB A;  1KJT A;  1UBI A;  2L7R A;  3JW0 X;  5AZG A;  3SHQ A;  4GDL A;  1L2N A;  3KYC D;  3N30 A;  4N9F 4;  2KDF B;  4PS3 A;  1HE8 A;  5FR6 A;  3DBL I;  4F1S A;  2O2V A;  4CO7 A;  3HM6 X;  3RT3 B;  3SU8 X;  3U30 A;  2KDB A;  2LZ6 A;  4WWN A;  1RRB A;  1Q0W B;  4KV2 A;  3DCG A;  2C7H A;  3IHP C;  3NY5 A;  4FJY A;  3APD A;  2LXC A;  3CMM B;  2ZPN A;  2LRU A;  2UWQ A;  1P0R A;  2GBM A;  3V60 A;  3IVF A;  2D07 B;  5D7G A;  2WX0 A;  4ICU A;  1WH3 A;  1NI2 A;  2CHX A;  2AL6 A;  2KAN A;  2V4L A;  4ANU A;  3B0A A;  4HPM B;  5KHO A;  2JRH A;  5EDS A;  2KFK A;  4KIK B;  4ZDV A;  1EF1 A;  5JH5 C;  2O6V B;  3VQI A;  4KZC A;  2JF5 A;  3M62 B;  2DZJ A;  2M8S A;  4NQL B;  1V80 A;  4E3C A;  4W9G A;  2G3Q B;  1IP9 A;  1IPG A;  2KKC A;  3QQ8 B;  2A4Z A;  2KMC A;  4IWP A;  2FID A;  4GGQ A;  1SE9 A;  4TKN A;  2DZI A;  2DZM A;  1TZ1 A;  1Z5S B;  2NS5 A;  2ZCC A;  3KUZ A;  3ECI A;  1V86 A;  2AL3 A; 
#chains in the Genus database with same CATH topology
 2ICI A;  3NJT A;  4MJS B;  4C56 C;  4M01 A;  3RNC C;  3W5V B;  3ZGZ A;  2FUH B;  4RF0 A;  2FE8 A;  2L0F A;  2GLS A;  1WJN A;  4TQ1 A;  1WM2 A;  4HXD A;  3DWM A;  2K1F A;  4MAC A;  4W9K A;  4DDI D;  1TKE A;  2JZZ A;  4FA6 A;  1IGC A;  3AEC B;  2MHJ A;  2HDE A;  3RCZ A;  1KRH A;  2WX1 A;  1MPE A;  1DYQ A;  3DDC B;  1JQ4 A;  5H8Y E;  3TEY A;  3E9S A;  2JT4 B;  1SGH A;  2XK5 A;  4XX5 A;  3NG0 A;  2YVC A;  1I4G A;  2G4S A;  3VUX A;  2G9H D;  3DVG X;  4IC7 B;  5G2N A;  3B2G A;  4MH8 A;  3MJ5 A;  3R2T A;  3UI3 A;  4WAA A;  4MH0 E;  1ZUD 2;  5BMI A;  3V61 A;  4DHZ E;  5AEK B;  3UIO B;  1OFF A;  3R7R A;  1YN4 A;  2LI5 A;  3ZNI D;  1UGJ A;  3ZDM C;  3B1L X;  2LJ5 A;  2MBH A;  4FN2 A;  2KJH B;  3PVL A;  1F52 A;  5C23 A;  4OZA A;  2LXA A;  3A1Q B;  2FUG 1;  3ZTD A;  1F0Z A;  3VHT C;  2WLB A;  3H7S A;  1RAX A;  2KFJ A;  2KTR A;  3ZNZ B;  3PLV A;  1E8X A;  2KWU B;  2M0X A;  2W54 A;  1I42 A;  1KLV A;  3U2S C;  1SE2 A;  4DQO C;  2IO0 B;  5CX3 A;  1V97 A;  2ASQ A;  3GE3 C;  4EKU A;  2MLB A;  2MBE A;  2K8B A;  1WYW B;  3TCA A;  1WXQ A;  3EEC A;  3H6N A;  1OQQ A;  1WM3 A;  4A8X C;  5KHQ A;  1HZ6 A;  1KOT A;  2Z59 B;  3W1S A;  4M0W B;  1WXV A;  2L0T A;  2KX0 A;  2WXR A;  2PKO A;  3ZJT A;  4K1R B;  4KIK A;  4X57 B;  2QMT A;  2BBC A;  5J18 A;  4LDT B;  3B9J A;  1MFW A;  4RGT A;  4B0E A;  3VH3 B;  4W9J A;  1CMX B;  2AQ1 B;  1J8C A;  2AQ2 B;  3M95 A;  2REX A;  4YXD B;  2LD9 A;  1LXD A;  4EEW A;  3IAS 1;  4LNI A;  3RI7 C;  4N58 A;  3ML9 A;  2LWP A;  2AQ3 B;  1P9D U;  2LAS A;  1M4V A;  3GP7 A;  2B76 B;  2YLM A;  3AUL A;  3H7P A;  4YL8 A;  4LTU A;  3BVZ A;  1LM8 B;  4GSW A;  1XCQ L;  3KYD D;  2LGI A;  2LGX A;  2JXT A;  1MHX A;  4EZJ A;  4BKT A;  1UEL A;  5HI1 A;  2IYD B;  4CYE A;  5G5G A;  4N6E B;  4HDQ A;  4BFR A;  2JUO A;  3JVZ X;  1XLO A;  1TKY A;  1HTQ A;  1UZX B;  1V1P B;  2BKF A;  2V9H A;  2JX5 A;  2IY1 B;  3DWG C;  4AJY B;  1PYW D;  3NZ3 A;  3B2F A;  3N1Z C;  2RDG A;  5TR5 A;  2O6V D;  1OQR A;  1FNV A;  2R2O A;  3EC8 A;  3UGB B;  3HVZ A;  2FBW B;  1AN8 A;  4MGI E;  4KKI A;  4NZL B;  1JWB D;  1E90 A;  2OJR A;  3NVY A;  1IUE A;  4GDK A;  4B0M A;  1T0R C;  4G11 A;  1ZDX A;  4KGS A;  1VZ7 A;  3A33 B;  3ZDT A;  3KW5 B;  3E56 A;  1BML C;  1L6V A;  1OTR B;  1DGJ A;  2KVR A;  1S1Q B;  2WXO A;  1ENF A;  1SJE D;  2MP2 B;  1N6Z A;  4WWO A;  2GBJ A;  2X38 A;  3QAR A;  4ANW A;  2Y5B B;  3Q8F A;  2KHW B;  1OEY A;  4W9D A;  3VUY A;  1NYQ A;  3QX1 A;  4FHK A;  1OGW A;  5E6J A;  4W9L A;  2BYT A;  3O13 A;  2BWE S;  1FXT B;  1R4M B;  3GOE A;  1ET9 A;  1SSN A;  2V3N A;  3V3X A;  3DVG Y;  4IKG A;  4K3B A;  4REZ A;  1I4X A;  1SBB B;  2K8H A;  1N62 A;  2IGH A;  2D3G A;  2LVP A;  3PSE B;  3HM3 A;  4YWG G;  3VXW A;  2BS2 B;  3A4S C;  2IY0 B;  1CJE A;  2N0S B;  4IW0 A;  3P42 A;  2MBO A;  4EZL A;  5AZF A;  2W55 A;  3N1X C;  1S3S G;  3Q3J A;  4ANV A;  3AEF B;  4II3 B;  2XK5 B;  3X23 A;  3P4R B;  4JLC A;  1RFK A;  2C7M B;  3LDZ E;  4MJS A;  4ZRJ A;  1C77 A;  1N60 A;  2PE6 B;  3RUL A;  2RDB C;  3OJ3 A;  1UF0 A;  2WHI A;  1VDV A;  2BYE A;  3KLS X;  5IKC M;  4L23 A;  3AE5 B;  1MG8 A;  4WQM A;  3DPD A;  3WAM A;  1UGM A;  4XDD A;  4H2A A;  2LUE A;  2L83 A;  2D5G A;  2L05 A;  2QHO A;  2K22 A;  4JGH B;  1F77 A;  2WS3 B;  4RM8 A;  1K50 A;  3C0R B;  1JWS D;  1F9J A;  1WXM A;  1WI0 A;  5I4D A;  1WX8 A;  2IGG A;  3ABV B;  1PDX A;  4JL9 A;  2IO2 B;  2D10 A;  2DBY A;  2ACZ B;  1WGY A;  3AE9 B;  1T0Y A;  4CHK A;  2D3B A;  1UWM A;  4NNJ B;  4WH4 A;  3QA8 A;  5AZH A;  3AI5 A;  1ROE A;  1YX6 B;  5L95 C;  2KT7 A;  5HHD G;  1PGB A;  2KWV B;  1GJZ A;  1FD6 A;  4USA A;  2BYV E;  3AV8 A;  3ZQ4 A;  3SR6 A;  1AAR A;  2OED A;  5D94 A;  2NTT A;  3CWI A;  4PYU A;  2BYF A;  4LJP B;  2KLG A;  3U7D A;  3AH7 A;  1KF6 B;  2MWS B;  1FIQ A;  2L7R A;  2WXM A;  1CZP A;  3SHQ A;  4OZC A;  3KYC D;  4N9F 4;  2KDF B;  1KLU D;  1HE8 A;  1XLP A;  2TSS A;  5FR6 A;  3R2I A;  3HM6 X;  1AWD A;  3Q3O C;  3SU8 X;  3Q8C A;  3IHP C;  4ZOH C;  1E6E B;  2LXC A;  2ZPN A;  1SJH D;  3V60 A;  2WXJ A;  1WH3 A;  2KAN A;  2JRH A;  2G1E A;  5EDS A;  4KIK B;  3AE6 B;  3Q6B A;  5JH5 C;  1L0Y B;  1BXT A;  3M62 B;  1V80 A;  5C3J B;  4W9G A;  2G3Q B;  1IPG A;  4A55 A;  5EE3 A;  4GGQ A;  2NMQ A;  3GE8 C;  3KUZ A;  1V86 A;  2RMM A;  1K51 A;  3CF6 E;  1D5Z C;  2PTL A;  3AE4 B;  1J19 A;  4MEL A;  1JW9 D;  2BT6 A;  4DXA B;  3Q8E A;  2GBK A;  2E6X A;  2LGY A;  2INN E;  2EEL A;  2BWF A;  5DCN A;  3JSV B;  3R7Q A;  2LUM A;  3ETR A;  3UQA A;  1IYF A;  2JPH A;  4RH6 A;  3N3K B;  2WDT B;  3AE2 B;  4IM3 A;  1RLF A;  5TSS A;  2Y3A A;  1Y8R C;  4LCD E;  1WJ6 A;  3TMP B;  1NVI D;  1TZO A;  4ZHP A;  1BT0 A;  2D2Q A;  2PEA A;  2KZR A;  5BYR A;  1GB4 A;  2JVC A;  4WWM A;  3AMZ A;  3QAQ A;  2KC1 A;  2JZ3 B;  4WJQ A;  3MFG A;  3P63 A;  3GS2 A;  1FXI A;  4G0N B;  4GDK B;  4S0R A;  3V62 A;  1HXY D;  2I38 A;  1C79 A;  2SAK A;  2IO3 B;  3IAM 1;  2G4D B;  4LLG M;  2W9N A;  2HJ8 A;  2DEN B;  2K5P A;  4US8 A;  2FCN A;  1V1P A;  3BIN A;  1C3T A;  3L4P A;  1R4M I;  2KAC A;  2KK8 A;  2KOX A;  4MDK E;  1I4R A;  1P1A A;  2MBB B;  4KDL B;  5AUI A;  1L0X B;  3SD5 A;  3VTV A;  2OJW A;  3HIZ A;  2KFK B;  2J53 A;  4OVV A;  4AOF A;  4J6I A;  2PIA A;  1E9M A;  1ZKH A;  2W82 A;  1C9F A;  2PLP A;  1TS4 A;  4NJC A;  2WNM A;  4OHJ A;  4G3X B;  4AUQ C;  4A9A A;  4P16 A;  1KTK A;  3APF A;  2Z0D B;  1F2R I;  2RD0 A;  4M02 A;  4DBG A;  1T3Q A;  3DBS A;  4TQ0 A;  2MP2 A;  3NHE B;  3T9L A;  4XYC A;  1QZE A;  2WU2 B;  2AYO B;  4KSK C;  4LNF A;  3ZVV A;  2GMI C;  2YEP B;  2IZV B;  1OQY A;  2AWT A;  1TKG A;  1GPX A;  1LGR A;  3NVV A;  4MM3 A;  1VJK A;  4GU2 A;  2UU7 A;  1FFU A;  2WDQ B;  3DQV A;  3RNF C;  2C5L C;  3C19 A;  4FUL A;  2DWQ A;  2Q5W D;  1YD8 U;  3MC9 A;  2R2Q A;  4Q2J A;  2DYM A;  3VTW A;  1EO6 A;  2IDY A;  5G55 A;  3AU5 A;  4IG7 B;  3AED B;  2ZW0 A;  4R3D A;  4RGN A;  2LHE A;  2KMA A;  2MSE D;  3UQB A;  4URK A;  3L10 B;  1E7V A;  3SDL C;  4ZRI A;  4PT5 A;  4HCN B;  1I35 A;  3IG3 A;  3N32 A;  1MI0 A;  1V6E A;  2M4N A;  1JRO A;  2BVC A;  3GZN B;  3PZD A;  4ZYN A;  2MJE A;  4LNK A;  1TGZ B;  3ML8 A;  3A4R A;  3ZKJ C;  3T3N A;  4A3O A;  1ZW7 A;  2KDI A;  4C7Z A;  1YMH E;  1Y56 A;  4A90 A;  2QIE B;  3TUO A;  1F1H A;  1K53 A;  4HVB A;  4NY0 A;  3VRA B;  3UIP B;  3V6C B;  3NVW A;  4AWJ A;  1GB1 A;  1RWS A;  1QLB B;  2I2Y A;  4O1N A;  2NR2 A;  3EA6 A;  3PZ8 A;  2LJI A;  1TTN A;  3FIL B;  4P1B C;  2FIF A;  4DK5 A;  2N9K A;  2L1A A;  4IWO A;  2LGS A;  1WF9 A;  3KQ4 A;  1L5P A;  1WR1 A;  1PGA A;  1SE4 A;  4I6N B;  5FK9 C;  3ENE A;  3KUD B;  3AEE B;  3H1U A;  2J0M A;  1JWA D;  4HDO A;  4KZ0 A;  1WGK A;  2DAJ A;  4ARI A;  2BS4 B;  4HJK A;  3WAL A;  4RGM A;  4E71 A;  2KDM A;  2BKR B;  3TEW A;  3JYU A;  1B9R A;  3I57 A;  3RNE C;  4ZRP A;  3CIR B;  2D3C A;  3I63 C;  2KAJ A;  4K7S A;  1LFD A;  3DBH I;  3PGE A;  1MHH E;  2GBR A;  3R3M A;  2EKI A;  2KJ6 A;  3J9C A;  3IT6 B;  4FJV B;  3O65 B;  4ZRK A;  2RPQ A;  1TYG B;  1JRP A;  3UF8 A;  5E6P A;  3PPA A;  3KWV A;  1R4N B;  4YSY B;  1VD2 A;  3NS8 A;  2KJR A;  1D5X C;  2XEW A;  3MJW A;  3ZO5 B;  4WJO A;  3C8Y A;  1WZ0 A;  2DAF A;  1QT9 A;  3DHH C;  2MH7 A;  4MSQ B;  4AP4 C;  3TSS A;  1TY2 A;  2K6Q A;  1CK1 A;  2BW2 A;  1HA5 A;  1SF0 A;  3VTU A;  3PS6 A;  4NAM A;  1ZE3 D;  1Z2M A;  4JE3 B;  3UIN B;  3JSV A;  3WAO A;  3X0W A;  2CJO A;  2SEB D;  2N9X A;  2XBB C;  1WFY A;  2LMC A;  2N9E B;  2J0K A;  2HE7 A;  2JSV X;  4HCP B;  4YT0 B;  1QOF A;  2CR5 A;  3QC8 B;  1XLN A;  4XWW A;  2LRW A;  3BWU D;  3Q3N C;  1ZXI A;  5BMH A;  2QJL A;  1XXG A;  4TUU A;  2VH2 A;  2DHZ A;  2K39 A;  1ZP0 B;  3M3J A;  3VAW A;  2INP E;  2YEP F;  3RUI B;  3KVF B;  1NI3 A;  2DX5 B;  3SFE B;  4JIO U;  3FAH A;  4IUM B;  1TY0 A;  2V3P A;  3TJP A;  1FCL A;  1SE3 A;  4EZK A;  2KYW A;  3A9K A;  1KJT A;  2KMM A;  4GDL A;  2GB1 A;  3N30 A;  1HEZ E;  4PS3 A;  1EU3 A;  2VH1 A;  4F1S A;  2O2V A;  5JXV A;  4HRS A;  4ZRQ A;  3DCG A;  4FJY A;  2WXG A;  1T0S C;  3NS1 A;  2UWQ A;  1FM0 D;  1P0R A;  3DBR B;  4MM3 B;  4ICU A;  3U7Z A;  2KFK A;  4ZDV A;  4RF1 A;  2Z8L A;  3VQI A;  4KZC A;  5G5H A;  3N20 C;  2JF5 A;  3MC8 A;  3RN9 C;  2ZW1 A;  4NQL B;  4E3C A;  2KKC A;  1ZDV A;  2KMC A;  3OWE B;  1FXA A;  3W2D A;  3K9P B;  3LXF A;  2AL3 A;  2M17 A;  1HZ5 A;  3AE8 B;  2CHZ A;  2VRR B;  1E8Z A;  3GZN I;  2Y5C A;  1TT5 B;  4E74 A;  3PRP B;  3Q3M C;  1DOI A;  5LLI A;  1R7S A;  4GXB A;  1TS5 A;  3L54 A;  1T0Q C;  1UBQ A;  1XO3 A;  1X1M A;  1V81 A;  2J52 A;  1E10 A;  4ACF A;  2ZEQ A;  4ANX A;  1QQR A;  4BKS A;  2IO1 B;  1WXA A;  3AN1 A;  2L76 A;  2UYZ B;  2WYQ A;  4HKQ A;  4YTN B;  2K6D B;  1I7H A;  3HVD A;  1WRI A;  1SB3 C;  1FCC C;  1PFD A;  2JWU A;  1D3Z A;  4LNN A;  3RZW C;  4W9I A;  5LNK 1;  2FCS A;  5EE1 A;  1DOY A;  2PE9 A;  2N1W A;  5C1Z A;  4OVZ A;  3N1Y C;  2EMS A;  3KWL A;  3V05 A;  2WGS A;  2DYB A;  2LGD A;  1UD7 A;  2WXL A;  4FXC A;  1PUT A;  3IT4 B;  3Q2A C;  3IBE A;  2J42 A;  4WJP A;  1GNU A;  4AQ7 A;  4RFB A;  2KC2 A;  4RNA A;  1B1Z A;  2KQS A;  4IM0 A;  2I1J A;  1NEN B;  1P98 A;  4J3O D;  1WGR A;  4WWP A;  1FNW A;  2H89 B;  4F8C B;  4N59 A;  3ZYY X;  3NVZ A;  2E3T A;  2BQQ A;  5IA7 A;  3AB5 A;  2BPS A;  3PZ7 A;  4PYZ A;  3LYY A;  1J7B A;  2PVO D;  1V49 A;  4LK0 M;  1YN3 A;  1WX9 A;  1NBF C;  1E8W A;  5D6J B;  1R4N I;  2LVQ A;  3BYT B;  4W9H A;  3FIL A;  3P2B A;  4BOZ B;  1I4H A;  4P6V F;  4KDI C;  2HD5 B;  3AE7 B;  4D2K A;  2MJ3 A;  5HG2 A;  5LXI B;  1P3Q U;  3M63 B;  2MRP A;  2N4F A;  4M8N A;  2MW5 A;  4JPS A;  1WGG A;  4C7Y A;  5IP4 D;  4HLE A;  1KH0 A;  2PJH A;  2K8C A;  2K9X A;  2I1K A;  3S2A A;  1YN5 A;  3PTF C;  3R66 C;  1QF6 A;  3APC A;  2BGF A;  1FFV A;  1EUV B;  2BF8 B;  2PVG C;  2MCN B;  2DNF A;  4B6W A;  4EE2 A;  1RYJ A;  2C7N B;  1MVK A;  4AS1 A;  1TJE A;  1C4C A;  3VR9 B;  3LB8 C;  2V0G A;  2KX3 A;  5D3D A;  3P4Q B;  1TIF A;  1QOG A;  2QDF A;  3Q8A A;  4RCO A;  4TV3 A;  3AEG B;  3L0W B;  5DPW A;  4DDG D;  2NBU A;  4KVG B;  4C80 A;  1FO4 A;  3ZTC A;  2J4X A;  4BAX A;  1SXT A;  3U8Z A;  1YIW A;  5CHF A;  1N63 A;  5DPS A;  2A5U A;  2BS3 B;  2H88 B;  5JHA A;  4ASW C;  1JAL A;  2KTF A;  3NRZ A;  2Z0E B;  4I6L B;  1QOA A;  4IDI A;  4B95 A;  2N7J A;  1GG3 A;  4P7I A;  3EFC A;  1JWU D;  2JWZ A;  4TMA B;  4HRO A;  1E7P B;  5J2R A;  2KN5 A;  2LEK A;  3BVM A;  3ALB A;  1D5M C;  4RMA A;  4IOI E;  2KN4 A;  1VR9 A;  2HTM E;  4MSM B;  4YTP B;  2QEJ C;  1WGD A;  3A9K B;  3P4S B;  3VDZ A;  1YQ3 B;  2ZCB A;  4GDL B;  3P4P B;  3I9V 1;  1FEH A;  4HEA 1;  3WAP A;  3DBR I;  2O2V B;  2VZK B;  4B9K A;  2RGF A;  1I4Q A;  3MC0 B;  3R8B A;  1HTO A;  4WQO B;  1V5T A;  1J0G A;  2M56 B;  2K25 A;  3QWZ B;  1P7E A;  2WXH A;  2JU6 X;  4FHJ A;  2ZPY A;  1XEE A;  4WIP A;  1VZ6 A;  3U4E G;  4K3C A;  4US9 A;  1ZOY B;  3D32 A;  2ZVN A;  2JY6 A;  5EE0 A;  4LJO B;  2N7E A;  4XWT A;  1UH6 A;  2M19 A;  3K9O B;  3LJ3 A;  4II2 B;  3RFZ B;  2DYO A;  3RZF A;  3NZU A;  3PO0 A;  5DPR A;  5JZE B;  3U52 E;  3VR8 B;  1VCB A;  5IAA C;  3NZS A;  1E0Z A;  5E6N A;  3QCA A;  5MPO A;  1KLG D;  4JWU C;  3Q8B A;  4XDC A;  1K8R B;  4A20 A;  3URY A;  4W9E A;  3ZRF A;  1VZ8 A;  5IO9 A;  2N9L A;  1GOZ A;  2WDR B;  2JRI B;  5DPT A;  1EF5 A;  1WX7 A;  4KSL C;  3ZLZ A;  1JWM D;  3CST A;  1G6J A;  2JZP A;  1H8C A;  2BB6 A;  1QIL A;  3IFW B;  1JML A;  1XT9 B;  3VRB B;  3SFD B;  1N5X A;  2V3S A;  1BUI C;  1ESF A;  2V1Y A;  1C78 A;  5BYQ A;  1SIF A;  1GC6 A;  2LVO A;  4FBJ B;  3PT2 B;  3P1M A;  4HPP A;  3VFK A;  3EFU A;  1YOV B;  3BYY B;  4A3P A;  1MJD A;  2C9W B;  1WJ4 A;  4EOY A;  4LNO A;  1XQQ A;  2WXK A;  3EUB 2;  3A9J B;  2GRI A;  2N9P C;  1MG4 A;  1V9J A;  4ZYS A;  2KO3 A;  1WJU A;  1ISN A;  2MA9 B;  3N9Y C;  4W9C A;  1OEY J;  3H9D A;  2D11 A;  4GN1 A;  1WE6 A;  2NTS A;  4YTM B;  1WSP A;  4DHJ B;  1U4A A;  2JYE A;  4I6P A;  4KX6 B;  3PV1 A;  1UBI A;  3JW0 X;  5AZG A;  4CO7 A;  3RT3 B;  4XGA B;  4ZHO A;  1XF5 L;  2KDB A;  1Q0W B;  1TS2 A;  3HUI A;  3DHI C;  3AEA B;  3APD A;  3FKY A;  3CMM B;  2LRU A;  2QC8 A;  3IVF A;  2D07 B;  2WX0 A;  2V4L A;  2CHX A;  1FNU A;  4HPM B;  5KHO A;  3Q14 C;  3BK1 A;  1IBX A;  1FRD A;  2DZJ A;  2R61 A;  2M0A A;  1N61 A;  1EU4 A;  1IP9 A;  1UNS A;  4IWP A;  1SE9 A;  2DZI A;  2X8X X;  2KWD A;  2ZCC A;  4BVU C;  1E8Y A;  2NCN A;  3ZXR A;  4XE0 A;  2KXJ A;  5JHB A;  4WUR A;  1RM6 C;  1KFY B;  3W1Y A;  2WDV B;  1LO5 D;  1WWT A;  2M1M A;  1ACC A;  2JQR B;  1HQR D;  2RPV A;  1YJ1 A;  2BB5 A;  4K81 A;  5BO4 B;  3WCQ A;  2ZNV B;  2VZK D;  5IOI A;  3PHW B;  3QJZ A;  4C4V B;  4K7W A;  1D6E C;  2CS4 A;  4RM9 A;  1GC7 A;  5T8I A;  1D4B A;  2FCQ A;  1T5X D;  2CJN A;  1T6B X;  3B08 A;  3OAW A;  3WIM A;  1IGD A;  4FJZ A;  1WY8 A;  2JYT A;  3BII D;  4G50 A;  2DLB A;  3ZUN A;  4TSS A;  2L00 B;  1WMH A;  4CQN A;  3OLM D;  1N5W A;  2B3A A;  2K3U A;  3NOB A;  3QK0 A;  2CKH B;  3DVN U;  3GB1 A;  4XC2 A;  5J17 A;  4NAW A;  1SIJ A;  3ZJU A;  3TL5 A;  4A6Q A;  2RSU A;  4FAD A;  1M94 A;  1JRU A;  4HJG E;  5FKA C;  1PQS A;  1ET6 A;  2HJ1 A;  2XN9 C;  3L16 A;  2NPT A;  3RNB C;  1C4P A;  3PHX B;  5EE9 A;  2GOW A;  4L2Y A;  1A5R A;  5CTR C;  4ICV A;  4WAF A;  1V1O A;  2WP9 B;  4EUT A;  1STE A;  4BOS C;  4QAY A;  4NJ6 A;  3WA0 A;  5IN7 A;  4KKJ A;  4HK2 A;  1ZGU B;  4BKS D;  5D3I B;  3W9C B;  2ZNV C;  4GIV A;  2Y5P A;  4M8M A;  4MEM A;  4MGK E;  4C00 A;  1YNT E;  1XD3 B;  2KNB A;  5BYS A;  1J7A A;  1A70 A;  2J7Q B;  4YSZ B;  5HKH A;  2IPK D;  1YQ4 B;  3TBL D;  4OVU A;  1V2Y A;  4NJ7 A;  1QOB A;  3T8M A;  4DXF A;  1WYG A;  2MEK A;  3DBL B;  4P1C C;  2RR9 A;  3RD2 A;  1V5O A;  2WXF A;  3AE1 B;  4MT5 A;  5L83 A;  1WZ3 A;  4S17 A;  4JQW C;  2O6V A;  3RYT A;  1ZXH A;  3Q3F A;  3QHT A;  1E5W A;  2G45 B;  1GUA B;  2GBN A;  2N7D A;  4W9F A;  3ZRC A;  2MBQ A;  4XZ4 A;  2FNJ B;  4DXG A;  1PGX A;  2IGD A;  4PK1 A;  3ZJV A;  2L52 A;  3AM9 A;  3ZIM A;  4BKG A;  1QKZ A;  2J0J A;  4KGR A;  5GMV A;  4DHJ D;  5E6O A;  3VVW B;  2WXN A;  4PS8 A;  4WJN A;  1XLQ A;  2L3Z A;  4HPL B;  2ZVO A;  1ZPS A;  4KGT A;  3OJ4 B;  4DHZ B;  3VUW A;  3L13 A;  5C2T B;  2WWZ A;  2XNA C;  1VLB A;  3WAN A;  4BBN C;  4HWI B;  3PLU A;  1FRR A;  5CHV C;  3MHS D;  2JXX A;  5CHW A;  3PRZ A;  4NQK E;  1H4R A;  3VH4 B;  4ARC A;  3DHG C;  4F7Z A;  4NPN A;  2W3R A;  4MGY E;  3A9J A;  1EWC A;  1AW7 A;  5LXH A;  1SEB D;  2KVZ A;  3BK2 A;  2WXQ A;  3QIJ A;  2IJ0 A;  2CHW A;  2KTR B;  3H8H A;  3HRD D;  5H92 C;  2LHD A;  4OZB A;  1F2R C;  4GLS C;  4ITK A;  1IBX B;  1C4A A;  1YJJ A;  2PPH A;  4RGO S;  2NBV B;  1XCT L;  3MTN B;  2LFI A;  4IM2 A;  2CU3 A;  4LDT D;  4K7U A;  4MGZ E;  3AU4 A;  2CU1 A;  4JX1 C;  3L08 A;  1JCK B;  2MJD A;  2KQ4 X;  2KWC A;  1E7U A;  2AEH A;  3Q69 A;  4GMV A;  3CSF A;  4YSX B;  4PS7 A;  2EMT A;  1EM7 A;  3A1Q A;  3BY4 B;  1NEK B;  2INC C;  1Q5W B;  5HFY A;  3L17 A;  1FMA D;  4FLH A;  3DVN V;  2MX2 A;  1WE7 A;  1Q10 A;  1WIA A;  1RFA A;  1VRA B;  4BZA A;  3NUH B;  1DOX A;  2ZJD A;  3PRM B;  2IND C;  2NBW B;  2AX5 A;  3TIX A;  1TS3 A;  3T3O A;  4AJW A;  1Q1O A;  3ZW3 A;  2OOB B;  2QIL A;  1TBE A;  1L6U A;  3IXS A;  2NVU I;  3HK0 A;  2FAZ A;  2IBI B;  2L8J A;  3AEB B;  3H7P B;  4M0W A;  4UDU C;  1LQB A;  1YJI A;  4IWQ A;  4GOC A;  2C60 A;  1EWY C;  2BTE A;  1NDD A;  4DWF A;  2N1V A;  1WRD B;  1WMH B;  4EFO A;  1YX5 B;  3V6E B;  1L7Y A;  2FCM A;  1WXS A;  3AE3 B;  4NAW B;  2KDE B;  2WXP A;  3DBH B;  1J7C A;  2KD0 A;  3HHM A;  3SEB A;  2HTH A;  3W5U B;  3EHV A;  3ZNG C;  4L1B A;  2NPT B;  2ZZP B;  3W1S C;  4C4V A;  3BZD B;  3ZNH B;  2RDH A;  5D2M B;  1KM7 A;  2WU5 B;  3KUC B;  1C1Y B;  3ONS A;  2L32 A;  1V8C A;  3DOW A;  3AXC A;  2EKE C;  3I3T B;  3I5J C;  2V4I B;  1WGH A;  3BVG A;  1WR6 E;  4GB9 A;  2DZK A;  2ONQ A;  1P7F A;  3MP9 A;  4BBN F;  1K52 A;  1FPY A;  1NYR A;  1GAQ B;  5BMG A;  2MQJ A;  2OHF A;  2KLC A;  5AUK A;  1L4Z B;  4M00 A;  3PRE A;  3KH0 A;  3TEX A;  5FR3 A;  3OG5 A;  3RNA C;  3MHZ A;  2D3A A;  2KQ7 A;  2QCZ A;  2WQY B;  2WXI A;  1YQB A;  2W3S A;  2K0P A;  1UWX A;  1L2N A;  1L0V B;  1UUP A;  3DBL I;  3RPF C;  2PMV A;  1L4D B;  3U30 A;  2LZ6 A;  4WWN A;  1RRB A;  4KV2 A;  2C7H A;  3NY5 A;  3RNG C;  5GXG B;  2GI9 A;  2GBM A;  4HKZ E;  5D7G A;  3TEZ A;  1NI2 A;  2AL6 A;  4ANU A;  3ZXV A;  3B0A A;  4JWS C;  2PW9 A;  2QSD A;  3FC4 A;  3RMK C;  1I4P A;  1EF1 A;  2O6V B;  1C76 A;  2M8S A;  2ON8 A;  1AYF A;  3QQ8 B;  2A4Z A;  2FID A;  2DZM A;  3EGR A;  1TZ1 A;  1Z5S B;  1CQV A;  2NS5 A;  3ECI A;  4TKN A;  4OW0 A; 
#chains in the Genus database with same CATH homology
 2NCN A;  2M17 A;  3CF6 E;  4MJS B;  2CHZ A;  2KXJ A;  2VRR B;  5JHB A;  1E8Z A;  3GZN I;  3W1Y A;  2FUH B;  1J19 A;  4E74 A;  4MEL A;  3PRP B;  2M1M A;  4DXA B;  2GBK A;  5LLI A;  2L0F A;  2LGY A;  1WJN A;  1YJ1 A;  4GXB A;  3L54 A;  3K9P B;  4TQ1 A;  1UBQ A;  1WM2 A;  2BWF A;  4HXD A;  4K81 A;  1X1M A;  5DCN A;  1V81 A;  5BO4 B;  2K1F A;  3JSV B;  2ZNV B;  4W9K A;  4DDI D;  3R7Q A;  2ZEQ A;  3PHW B;  3QJZ A;  4ANX A;  3UQA A;  4K7W A;  4BKS A;  2CS4 A;  2JZZ A;  4FA6 A;  1IYF A;  2JPH A;  3N3K B;  2IO1 B;  4RM9 A;  1WXA A;  1GC7 A;  3RCZ A;  2WDT B;  4IM3 A;  2WX1 A;  1RLF A;  3DDC B;  1Y8R C;  2FCQ A;  2L76 A;  2UYZ B;  4LCD E;  2JT4 B;  2WYQ A;  4ANW A;  1WJ6 A;  1SGH A;  2XK5 A;  3B08 A;  3OAW A;  2K6D B;  4XX5 A;  3TMP B;  3WIM A;  4FJZ A;  1WY8 A;  1BT0 A;  4G50 A;  2YVC A;  2D2Q A;  2PEA A;  3ZUN A;  2KZR A;  2L00 B;  1D3Z A;  1WMH A;  3RZW C;  2G4S A;  3VUX A;  2JVC A;  3OLM D;  3QK0 A;  2B3A A;  4W9I A;  3NOB A;  2FCS A;  3DVG X;  4IC7 B;  2CKH B;  3DVN U;  5G2N A;  3QAQ A;  2KC1 A;  4XC2 A;  5J17 A;  2JZ3 B;  4WJQ A;  2PE9 A;  4NAW A;  3TL5 A;  4WAA A;  2RSU A;  4FAD A;  4G0N B;  4MH0 E;  2N1W A;  1M94 A;  4GDK B;  1JRU A;  3V62 A;  1PQS A;  5C1Z A;  2IO3 B;  2EMS A;  2G4D B;  2W9N A;  3L16 A;  2HJ8 A;  3V61 A;  2NPT A;  4DHZ E;  2DEN B;  5AEK B;  2DYB A;  3UIO B;  3PHX B;  2LGD A;  1UD7 A;  2FCN A;  3R7R A;  2GOW A;  2LI5 A;  3BIN A;  3ZNI D;  3IBE A;  1A5R A;  1C3T A;  5CTR C;  4WJP A;  1GNU A;  1R4M I;  4ICV A;  3ZDM C;  3B1L X;  2KC2 A;  2KK8 A;  2KOX A;  2LJ5 A;  2MBH A;  4FN2 A;  4MDK E;  4EUT A;  2KQS A;  4BOS C;  4IM0 A;  2KJH B;  4NJ6 A;  3WA0 A;  2I1J A;  3PVL A;  1P1A A;  1P98 A;  2MBB B;  1WGR A;  4KDL B;  4WWP A;  5C23 A;  4HK2 A;  4F8C B;  2LXA A;  3A1Q B;  1ZGU B;  3SD5 A;  3VTV A;  3ZTD A;  4BKS D;  3HIZ A;  2ZNV C;  3VHT C;  5IA7 A;  2BPS A;  4GIV A;  2KFK B;  4PYZ A;  3H7S A;  4M8M A;  1V49 A;  4OVV A;  1RAX A;  4AOF A;  1WX9 A;  4MEM A;  4MGK E;  2KTR A;  1NBF C;  1E8W A;  2KFJ A;  4J6I A;  5D6J B;  3ZNZ B;  1ZKH A;  1R4N I;  3PLV A;  2LVQ A;  1E8X A;  2KWU B;  2M0X A;  4W9H A;  1I42 A;  1KLV A;  1XD3 B;  3P2B A;  4G3X B;  4AUQ C;  4BOZ B;  2KNB A;  4KDI C;  2IO0 B;  3APF A;  5CX3 A;  2Z0D B;  2HD5 B;  2RD0 A;  2ASQ A;  4DBG A;  4EKU A;  2MLB A;  2J7Q B;  3DBS A;  2MBE A;  4TQ0 A;  5LXI B;  2MP2 A;  3NHE B;  3T9L A;  5HKH A;  1P3Q U;  3TBL D;  4OVU A;  2K8B A;  1V2Y A;  1WYW B;  3TCA A;  3M63 B;  4NJ7 A;  1QZE A;  2MRP A;  2N4F A;  3EEC A;  3H6N A;  4M8N A;  1WM3 A;  2AYO B;  2MW5 A;  3T8M A;  4KSK C;  3ZVV A;  5KHQ A;  2GMI C;  1KOT A;  2Z59 B;  2IZV B;  3W1S A;  1WGG A;  1OQY A;  2AWT A;  4M0W B;  1WXV A;  2L0T A;  4HLE A;  2PJH A;  4MM3 A;  2K8C A;  2KX0 A;  4GU2 A;  2RR9 A;  3RD2 A;  4K1R B;  1V5O A;  2I1K A;  4KIK A;  5L83 A;  4X57 B;  3S2A A;  3PTF C;  1WZ3 A;  3R66 C;  3DQV A;  3APC A;  2O6V A;  4JQW C;  2C5L C;  5J18 A;  4FUL A;  3RYT A;  3Q3F A;  4LDT B;  2BGF A;  1EUV B;  3QHT A;  1E5W A;  2BF8 B;  2MCN B;  4B6W A;  2C7N B;  1YD8 U;  2G45 B;  1GUA B;  3VH3 B;  2R2Q A;  4W9J A;  1CMX B;  1J8C A;  2DYM A;  3VTW A;  2KX3 A;  2GBN A;  2N7D A;  4W9F A;  3ZRC A;  1EO6 A;  2MBQ A;  4XZ4 A;  3M95 A;  4TV3 A;  2REX A;  2FNJ B;  2LD9 A;  5G55 A;  1LXD A;  3AU5 A;  4IG7 B;  4EEW A;  3L0W B;  5DPW A;  4DDG D;  3ML9 A;  2LWP A;  2NBU A;  2KMA A;  4KVG B;  2MSE D;  1P9D U;  3UQB A;  4URK A;  3L10 B;  1E7V A;  3SDL C;  3ZTC A;  3ZIM A;  2LAS A;  4ZRI A;  4HCN B;  3U8Z A;  1I35 A;  2YLM A;  3AUL A;  1YIW A;  4BKG A;  3H7P A;  5CHF A;  3IG3 A;  4YL8 A;  2J0J A;  3N32 A;  5DPS A;  1LM8 B;  2A5U A;  4GSW A;  3KYD D;  5E6O A;  5GMV A;  1V6E A;  3VVW B;  2LGX A;  4DHJ D;  2M4N A;  4ASW C;  5JHA A;  4PS8 A;  4WJN A;  3PZD A;  2L3Z A;  4HPL B;  2ZVO A;  4ZYN A;  2KTF A;  4EZJ A;  2Z0E B;  4I6L B;  4BKT A;  4B95 A;  3OJ4 B;  1UEL A;  2IYD B;  4CYE A;  1TGZ B;  4DHZ B;  1GG3 A;  4P7I A;  3L13 A;  3VUW A;  3ML8 A;  2JWZ A;  4HDQ A;  4BFR A;  2JUO A;  3JVZ X;  5J2R A;  2WWZ A;  1UZX B;  3WAN A;  2KN5 A;  3A4R A;  4BBN C;  4HWI B;  3PLU A;  3ZKJ C;  2BKF A;  5CHV C;  3ALB A;  3MHS D;  4A3O A;  2JXX A;  5CHW A;  4RMA A;  1ZW7 A;  2KDI A;  2IY1 B;  4MSM B;  1WGD A;  3A9K B;  3PRZ A;  4NQK E;  4AJY B;  3VDZ A;  1H4R A;  2ZCB A;  4GDL B;  5TR5 A;  3VH4 B;  2O6V D;  3WAP A;  3DBR I;  4F7Z A;  2O2V B;  2R2O A;  3EC8 A;  4NPN A;  4HVB A;  4NY0 A;  3UGB B;  4MGY E;  3UIP B;  4B9K A;  3A9J A;  3V6C B;  2RGF A;  4AWJ A;  5LXH A;  4MGI E;  4WQO B;  1V5T A;  1J0G A;  3QIJ A;  2K25 A;  3QWZ B;  2CHW A;  2KTR B;  2NR2 A;  1E90 A;  2OJR A;  4FHJ A;  4GDK A;  2ZPY A;  1TTN A;  4G11 A;  2FIF A;  4DK5 A;  3A33 B;  4IWO A;  1WF9 A;  3ZDT A;  3KW5 B;  3X23 A;  1OTR B;  1WR1 A;  2KVR A;  1S1Q B;  4I6N B;  3D32 A;  4BVU C;  2PPH A;  3ENE A;  3KUD B;  2NBV B;  2ZVN A;  3H1U A;  2JY6 A;  3MTN B;  2J0M A;  2MP2 B;  4IM2 A;  4LJO B;  2N7E A;  1UH6 A;  4WWO A;  4HDO A;  2GBJ A;  3QAR A;  4LDT D;  4K7U A;  2Y5B B;  3K9O B;  4KZ0 A;  2KHW B;  2DAJ A;  4MGZ E;  1OEY A;  3LJ3 A;  3AU4 A;  4II2 B;  4W9D A;  2CU1 A;  4HJK A;  3WAL A;  2DYO A;  3L08 A;  3RZF A;  3VUY A;  3NZU A;  3QX1 A;  4FHK A;  4E71 A;  1OGW A;  5DPR A;  5JZE B;  2BKR B;  4W9L A;  2KWC A;  1E7U A;  2AEH A;  3JYU A;  4GMV A;  3CSF A;  2BWE S;  1FXT B;  4PS7 A;  2EMT A;  3GOE A;  1VCB A;  3A1Q A;  3BY4 B;  5IAA C;  3NZS A;  3DVG Y;  1Q5W B;  5E6N A;  3L17 A;  3QCA A;  4K7S A;  1LFD A;  4FLH A;  3DBH I;  3DVN V;  2MX2 A;  1WE7 A;  3PGE A;  1WIA A;  1RFA A;  2K8H A;  2GBR A;  3R3M A;  1K8R B;  2KJ6 A;  2D3G A;  2LVP A;  3PSE B;  3HM3 A;  2ZJD A;  3VXW A;  4A20 A;  4FJV B;  3O65 B;  4ZRK A;  2RPQ A;  4W9E A;  3ZRF A;  3PRM B;  3A4S C;  2NBW B;  3UF8 A;  5E6P A;  3PPA A;  3TIX A;  2IY0 B;  4IW0 A;  4AJW A;  2JRI B;  1Q1O A;  5DPT A;  2MBO A;  3ZW3 A;  2OOB B;  1TBE A;  1EF5 A;  4EZL A;  1VD2 A;  5AZF A;  3NS8 A;  2KJR A;  1WX7 A;  4KSL C;  1S3S G;  3Q3J A;  2NVU I;  3HK0 A;  3ZLZ A;  4ANV A;  2XEW A;  4II3 B;  2XK5 B;  2FAZ A;  2IBI B;  2L8J A;  3CST A;  3MJW A;  4JLC A;  3LDZ E;  2C7M B;  4WJO A;  3H7P B;  3ZO5 B;  1G6J A;  4MJS A;  1WZ0 A;  1LQB A;  2DAF A;  4IWQ A;  4GOC A;  2C60 A;  1H8C A;  1NDD A;  4DWF A;  2N1V A;  4AP4 C;  1WRD B;  4MSQ B;  4ZRJ A;  1WMH B;  3IFW B;  4EFO A;  1XT9 B;  1YX5 B;  2PE6 B;  3RUL A;  3V6E B;  1L7Y A;  3OJ3 A;  2FCM A;  1WXS A;  2K6Q A;  2BYE A;  4NAW B;  2V3S A;  2KDE B;  2V1Y A;  3VTU A;  3PS6 A;  2KD0 A;  3HHM A;  1MG8 A;  3DPD A;  3WAM A;  1UGM A;  1Z2M A;  1SIF A;  1GC6 A;  2HTH A;  2LVO A;  3UIN B;  2LUE A;  3JSV A;  3WAO A;  3X0W A;  4FBJ B;  3EHV A;  3PT2 B;  2L05 A;  2QHO A;  3ZNG C;  2NPT B;  2ZZP B;  3W1S C;  4JGH B;  4RM8 A;  2N9X A;  3ZNH B;  3C0R B;  5D2M B;  1F9J A;  1WXM A;  1WI0 A;  2XBB C;  1WX8 A;  3VFK A;  1KM7 A;  1WFY A;  3EFU A;  3KUC B;  4JL9 A;  1C1Y B;  2IO2 B;  2J0K A;  2D10 A;  2HE7 A;  2N9E B;  3ONS A;  4HCP B;  4A3P A;  1WGY A;  2C9W B;  1T0Y A;  1WJ4 A;  3DOW A;  4EOY A;  1XQQ A;  3AXC A;  2CR5 A;  3QC8 B;  3A9J B;  4CHK A;  2EKE C;  3I3T B;  4NNJ B;  2LRW A;  3QA8 A;  5AZH A;  3AI5 A;  1WGH A;  1YX6 B;  1WR6 E;  4TUU A;  2DHZ A;  2DZK A;  1E8Y A;  2N9P C;  4GB9 A;  1V9J A;  5L95 C;  2K39 A;  2KWV B;  3M3J A;  4BBN F;  1GJZ A;  2KO3 A;  3VAW A;  2BYV E;  1WJU A;  1ISN A;  2MA9 B;  4W9C A;  3RUI B;  3KVF B;  2MQJ A;  2KLC A;  1OEY J;  3H9D A;  2DX5 B;  1AAR A;  2D11 A;  1WE6 A;  3PRE A;  4GN1 A;  3KH0 A;  5D94 A;  4JIO U;  4IUM B;  4PYU A;  2BYF A;  3TJP A;  4LJP B;  2KQ7 A;  4DHJ B;  2KLG A;  1U4A A;  4EZK A;  4I6P A;  3U7D A;  3PV1 A;  3A9K A;  2MWS B;  1YQB A;  1KJT A;  1UBI A;  2L7R A;  3JW0 X;  5AZG A;  3SHQ A;  4GDL A;  1L2N A;  3KYC D;  3N30 A;  4N9F 4;  2KDF B;  4PS3 A;  1HE8 A;  5FR6 A;  3DBL I;  4F1S A;  2O2V A;  4CO7 A;  3HM6 X;  3RT3 B;  3SU8 X;  3U30 A;  2KDB A;  2LZ6 A;  4WWN A;  1RRB A;  1Q0W B;  4KV2 A;  3DCG A;  2C7H A;  3IHP C;  3NY5 A;  4FJY A;  3APD A;  2LXC A;  3CMM B;  2ZPN A;  2LRU A;  2UWQ A;  1P0R A;  2GBM A;  3V60 A;  3IVF A;  2D07 B;  5D7G A;  2WX0 A;  4ICU A;  1WH3 A;  1NI2 A;  2CHX A;  2AL6 A;  2KAN A;  2V4L A;  4ANU A;  3B0A A;  4HPM B;  5KHO A;  2JRH A;  5EDS A;  2KFK A;  4KIK B;  4ZDV A;  1EF1 A;  5JH5 C;  2O6V B;  3VQI A;  4KZC A;  2JF5 A;  3M62 B;  2DZJ A;  2M8S A;  4NQL B;  1V80 A;  4E3C A;  4W9G A;  2G3Q B;  1IP9 A;  1IPG A;  2KKC A;  3QQ8 B;  2A4Z A;  2KMC A;  4IWP A;  2FID A;  4GGQ A;  1SE9 A;  4TKN A;  2DZI A;  2DZM A;  1TZ1 A;  1Z5S B;  2NS5 A;  2ZCC A;  3KUZ A;  3ECI A;  1V86 A;  2AL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...