2R3BA

Crystal structure of a ribokinase-like superfamily protein (ef1790) from enterococcus faecalis v583 at 1.80 a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
283
Chain Sequence
ENLYFQGMRYLSKDILEEVITQRPSDSYKSNFGRVVLIGGNRQYGGAIIMSTEACINSGAGLTTVITDVKNHGPLHARCPEAMVVGFEETVLLTNVVEQADVILIGPGLGLDATAQQILKMVLAQHQKQQWLIIDGSAITLFSQGNFSLTYPEKVVFTPHQMEWQRLSHLPIEQQTLANNQRQQAKLGSTIVLKSHRTTIFHAGEPFQNTGGNPGMATGGTGDTLAGIIAGFLAQFKPTIETIAGAVYLHSLIGDDLAKTDYVVLPTKISQALPTYMKKYAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative kinase in the ribokinase-like superfamily from Enterococcus faecalis V583 (NP_815490.1) at 1.80 A resolution
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords YjeF-related protein
total genus 99
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2r3bA01
3RU3A 2V78A 2F7KA 3GO6A 3RSQA 3H74A 3HPDA 4K8PA 3B1PA 4KANA 3RT7A 4C5JA 4E3AA 4E8WA 4LC4A 2HQQA 4B8SA 3RT9A 1DGMA 1U2XA 3CQDA 4KADA 1L2LA 3RQ6A 1LIJA 5BYDA 4K9CA 2A9YA 4S1IA 1YHJA 3PL2A 4E8ZA 1BX4A 5B6AA 1LIKA 4C5NA 1LHRA 3RRBA 1TD2A 4KALA 1GC5A 3NM1A 3RTEA 1EKQA 4YWRA 4DC3A 3GO7A 1YGKA 4E8YA 2FV7A 3NM3A 3UMOA 1RK2A 3ZS7A 2F02A 5BYCA 3N1CA 3NC2A 1UA4A 4LBGA 4K8KA 3RTBA 1JXHA 3IKHA 4XF6A 2AA0A 1GQTA 1TYYA 3IBQA 3Q92A 3KTNA 2PKKA 5CGAA 3NC9A 2R3EA 3VAQA 5C3ZA 3RQ5A 3KEUA 1RKDA 3FHYA 3UQDA 3NCAA 3K5WA 5CGEA 4EUMA 4E84A 1TZ6A 4PVVA 3LHXA 2AJRA 3HYOA 4C5LA 4XF7A 3FHXA 3IE7A 1VM7A 3RPZA 2DDOA 2RBCA 4JJPA 3UQ9A 2AJPA 2NWHA 1V1SA 4GM6A 5BYFA 2ABSA 2C4EA 3K9EA 3RQ8A 4EN4A 3RQHA 4E69A 3BF5A 5EYNA 4XCKA 3NL5A 2ABQA 3RTGA 2I5BA 4EBUA 3B1QA 3GBUA 1LIOA 2JG5A 1VI9A 3QA2A 3RS9A 3B1OA 3DRWA 3B1RA 3MBHA 2I6BA 3JULA 1V1AA 4U7XA 3RSGA 2PKFA 2YXTA 4B8RA 2JGVA 3RO4A 1RFVA 1RKSA 3DZVA 4YL5A 4C5MA 3I3YA 3RTAA 2QCVA 3EWMA 4N09A 4O1GA 4KAHA 5TQIA 3OTXA 3QAIA 3HICA 3VASA 4K8CA 1V19A 4C5KA 5C41A 4JKUA 3PZSA 3NL2A 3RSFA 1LIIA 4XDAA 3RU2A 4K9IA 3RRFA 4K8TA 5COJA 1RFUA 5F0ZA 2A9ZA 3RTCA 4DU5A 3LKIA 2QHPA 4N08A 4EOHA 3RPHA 3MBJA 5EY7A 3RQ2A 3UMPA 4S1IB 2R3BA 4UBEA 3UBOA 3IQ0A 1LHPA 2JG1A 2I6AA 2XTBA 4LCAA 3Q1YA 5BYEA 1ESQA 1JXIA 3RQQA 4X8FA 3RTDA 3RM5A 3B3LA 2Q5RA 5CM5A 1KYHA 3LOOA 2AFBA 4WJMA 4K93A 4O1LA 3NL6A 3B1NA 3RRJA 1VK4A 3RS8A 3RQXA 3KD6A 1WYEA 4S1MA 2AX3A 3NL3A 1UB0A 3H49A 2PKMA 3BGKA 4KBEA 1RKAA 3KZHA 4LBXA 2VARA 3RY7A 2PKNA 3RSSA 3UQ6A 2DCNA 1V1BA 1EKKA 4JKSA 3NBWA 2C49A 1RFTA 5TRWA 3LJSA 5C40A 1ESJA 2AWDA 3NBVA 2HW1A 2AB8A 2DDMA 3IN1A 4S1HA 5F11A 2DDWA 5C3YA 1C3QA 1TZ3A 3RREA 2YXUA 3UQEA 1YGJA 3IH0A 3W4SA 2HLZA
chains in the Genus database with same CATH superfamily
3RU3A 2V78A 2F7KA 3GO6A 3RSQA 3H74A 3HPDA 4K8PA 3B1PA 4KANA 4CVMA 3RT7A 4C5JA 2XPCA 5A5FA 4E3AA 4E8WA 4LC4A 2HQQA 4B8SA 3RT9A 1DGMA 1U2XA 3CQDA 4KADA 1L2LA 3RQ6A 1LIJA 2GCAA 4K9CA 5BYDA 4BUCA 2A9YA 4S1IA 1YHJA 3PL2A 4E8ZA 1BX4A 5B6AA 1LIKA 4C5NA 1LHRA 3RRBA 1TD2A 4KALA 1GC5A 4E8YA 2AM2A 3NM1A 3RTEA 1EKQA 1O5ZA 2GCBA 3GO7A 1YGKA 4YWRA 2FV7A 2Y67A 3NM3A 3UMOA 1RK2A 1GG4A 1EEHA 3ZS7A 1J6UA 2F02A 2JFFA 3N1CA 5BYCA 3NC2A 4BUBA 1UA4A 4LBGA 3UBOA 4K8KA 3RTBA 1JXHA 3IKHA 4XF6A 2AA0A 1GQTA 1TYYA 3IBQA 3Q92A 3KTNA 2PKKA 5CGAA 3NC9A 2R3EA 3VAQA 5C3ZA 3RQ5A 3KEUA 1RKDA 3FHYA 3UQDA 3NCAA 3K5WA 5CGEA 4EUMA 4E84A 1GQYA 1TZ6A 4PVVA 3LHXA 2AJRA 3HYOA 4QF5A 4C5LA 4XF7A 3FHXA 3LK7A 3IE7A 1VM7A 3RPZA 2DDOA 2RBCA 4JJPA 3UQ9A 4CVKA 2AJPA 4DC3A 2NWHA 1V1SA 4GM6A 3ZM5A 5BYFA 1P31A 2ABSA 2C4EA 3K9EA 3RQ8A 3RQHA 4E69A 4EN4A 3BF5A 5EYNA 4XCKA 3HJ6A 3NL5A 2ABQA 2UUPA 3RTGA 2I5BA 4EBUA 4HV4A 1JBVA 3B1QA 1LIOA 3GBUA 2JG5A 1VI9A 3QA2A 3RS9A 2XJAA 3EAGA 3B1OA 2WTZA 3B1RA 1E0DA 2I6BA 3DRWA 1V1AA 3JULA 3MBHA 4U7XA 3RSGA 1P3DA 1E8CA 2PKFA 2VORA 2YXTA 4C12A 4B8RA 2JGVA 3RO4A 1RFVA 1W7KA 1RKSA 3DZVA 4QDIA 2Y66A 4YL5A 4C5MA 3I3YA 3RTAA 2QCVA 4ZIYA 3EWMA 4N09A 5A5EA 3N2AA 4O1GA 2VTEA 4KAHA 5TQIA 2Y1OA 3OTXA 3QAIA 3HICA 3VASA 4K8CA 1V19A 4C5KA 4CVLA 1UAGA 4JKUA 4C13A 5C41A 3PZSA 3NL2A 3RSFA 1LIIA 3UAGA 4XDAA 3ZL8A 3RU2A 2VTDA 4K9IA 2F00A 3RRFA 4K8TA 5COJA 1RFUA 5F0ZA 2A9ZA 3RTCA 4DU5A 3LKIA 2QHPA 2UUOA 4N08A 4EOHA 2VOSA 3RPHA 3MBJA 5EY7A 3RQ2A 3UMPA 4S1IB 2R3BA 2UAGA 2JFGA 3IQ0A 1LHPA 4UBEA 2I6AA 2JG1A 2XTBA 3HN7A 4LCAA 3Q1YA 5BYEA 1ESQA 1JXIA 2Y68A 3RQQA 4X8FA 3RTDA 3RM5A 3B3LA 1W78A 2Q5RA 5CM5A 1KYHA 3LOOA 2AFBA 2GC6A 4K93A 3QCZA 2JFHA 3B1NA 3NL6A 4O1LA 3RRJA 1VK4A 3RS8A 3RQXA 3KD6A 1WYEA 4S1MA 2AX3A 3NL3A 1UB0A 3H49A 2PKMA 1JBWA 3NRSA 3BGKA 4KBEA 1RKAA 2WJPA 3KZHA 4LBXA 2VARA 3RY7A 2PKNA 2X5OA 3RSSA 3UQ6A 2DCNA 1V1BA 1EKKA 4JKSA 3NBWA 2C49A 1RFTA 3ZM6A 4UAGA 3PYZA 2AM1A 5TRWA 3LJSA 5C40A 1ESJA 2AWDA 2GC5A 2HW1A 1FGSA 2AB8A 2DDMA 3IN1A 3NBVA 4S1HA 5F11A 2DDWA 5C3YA 1C3QA 1GQQA 1TZ3A 2YXUA 4WJMA 1YGJA 3IH0A 3RREA 3UQEA 3W4SA 2HLZA
chains in the Genus database with same CATH topology
3RU3A 2V78A 2F7KA 3GO6A 3RSQA 3H74A 3HPDA 4K8PA 3B1PA 4KANA 3RT7A 4C5JA 4E3AA 4E8WA 4LC4A 2HQQA 4B8SA 3RT9A 1DGMA 1U2XA 3CQDA 4KADA 1L2LA 3RQ6A 1LIJA 5BYDA 4K9CA 2A9YA 4S1IA 1YHJA 3PL2A 4E8ZA 1BX4A 5B6AA 1LIKA 4C5NA 1LHRA 3RRBA 1TD2A 4KALA 1GC5A 3NM1A 3RTEA 1EKQA 4YWRA 4DC3A 3GO7A 1YGKA 4E8YA 2FV7A 3NM3A 3UMOA 1RK2A 3ZS7A 2F02A 5BYCA 3N1CA 3NC2A 1UA4A 4LBGA 4K8KA 3RTBA 1JXHA 3IKHA 4XF6A 2AA0A 1GQTA 1TYYA 3IBQA 3Q92A 3KTNA 2PKKA 5CGAA 3NC9A 2R3EA 3VAQA 5C3ZA 3RQ5A 3KEUA 1RKDA 3FHYA 3UQDA 3NCAA 3K5WA 5CGEA 4EUMA 4E84A 1TZ6A 4PVVA 3LHXA 2AJRA 3HYOA 4C5LA 4XF7A 3FHXA 3IE7A 1VM7A 3RPZA 2DDOA 2RBCA 4JJPA 3UQ9A 2AJPA 2NWHA 1V1SA 4GM6A 5BYFA 2ABSA 2C4EA 3K9EA 3RQ8A 4EN4A 3RQHA 4E69A 3BF5A 5EYNA 4XCKA 3HJ6A 3NL5A 2ABQA 3RTGA 2I5BA 4EBUA 3B1QA 3GBUA 1LIOA 2JG5A 1VI9A 3QA2A 3RS9A 3B1OA 3DRWA 3B1RA 3MBHA 2I6BA 3JULA 1V1AA 4U7XA 3RSGA 2PKFA 2YXTA 4B8RA 2JGVA 3RO4A 1RFVA 1RKSA 3DZVA 4YL5A 4C5MA 3I3YA 3RTAA 2QCVA 3EWMA 4N09A 4O1GA 4KAHA 5TQIA 3OTXA 3QAIA 3HICA 3VASA 4K8CA 1V19A 4C5KA 5C41A 4JKUA 3PZSA 3NL2A 3RSFA 1LIIA 4XDAA 3RU2A 4K9IA 3RRFA 4K8TA 5COJA 1RFUA 5F0ZA 2A9ZA 3RTCA 4DU5A 3LKIA 2QHPA 4N08A 4EOHA 3RPHA 3MBJA 5EY7A 3RQ2A 3UMPA 4S1IB 2R3BA 4UBEA 3UBOA 3IQ0A 1LHPA 2JG1A 2I6AA 2XTBA 4LCAA 3Q1YA 5BYEA 1ESQA 1JXIA 3RQQA 4X8FA 3RTDA 3RM5A 3B3LA 2Q5RA 5CM5A 1KYHA 3LOOA 2AFBA 4WJMA 4K93A 4O1LA 3NL6A 3B1NA 3RRJA 1VK4A 3RS8A 3RQXA 3KD6A 1WYEA 4S1MA 2AX3A 3NL3A 1UB0A 3H49A 2PKMA 3BGKA 4KBEA 1RKAA 3KZHA 4LBXA 2VARA 3RY7A 2PKNA 3RSSA 3UQ6A 2DCNA 1V1BA 1EKKA 4JKSA 3NBWA 2C49A 1RFTA 5TRWA 3LJSA 5C40A 1ESJA 2AWDA 3NBVA 2HW1A 2AB8A 2DDMA 3IN1A 4S1HA 5F11A 2DDWA 5C3YA 1C3QA 1TZ3A 3RREA 2YXUA 3UQEA 1YGJA 3IH0A 3W4SA 2HLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RU3 A;  2V78 A;  2F7K A;  3GO6 A;  3RSQ A;  3H74 A;  3HPD A;  4K8P A;  3B1P A;  4KAN A;  3RT7 A;  4C5J A;  4E3A A;  4E8W A;  4LC4 A;  2HQQ A;  4B8S A;  3RT9 A;  1DGM A;  1U2X A;  3CQD A;  4KAD A;  1L2L A;  3RQ6 A;  1LIJ A;  5BYD A;  4K9C A;  2A9Y A;  4S1I A;  1YHJ A;  3PL2 A;  4E8Z A;  1BX4 A;  5B6A A;  1LIK A;  4C5N A;  1LHR A;  3RRB A;  1TD2 A;  4KAL A;  1GC5 A;  3NM1 A;  3RTE A;  1EKQ A;  4YWR A;  4DC3 A;  3GO7 A;  1YGK A;  4E8Y A;  2FV7 A;  3NM3 A;  3UMO A;  1RK2 A;  3ZS7 A;  2F02 A;  5BYC A;  3N1C A;  3NC2 A;  1UA4 A;  4LBG A;  4K8K A;  3RTB A;  1JXH A;  3IKH A;  4XF6 A;  2AA0 A;  1GQT A;  1TYY A;  3IBQ A;  3Q92 A;  3KTN A;  2PKK A;  5CGA A;  3NC9 A;  2R3E A;  3VAQ A;  5C3Z A;  3RQ5 A;  3KEU A;  1RKD A;  3FHY A;  3UQD A;  3NCA A;  3K5W A;  5CGE A;  4EUM A;  4E84 A;  1TZ6 A;  4PVV A;  3LHX A;  2AJR A;  3HYO A;  4C5L A;  4XF7 A;  3FHX A;  3IE7 A;  1VM7 A;  3RPZ A;  2DDO A;  2RBC A;  4JJP A;  3UQ9 A;  2AJP A;  2NWH A;  1V1S A;  4GM6 A;  5BYF A;  2ABS A;  2C4E A;  3K9E A;  3RQ8 A;  4EN4 A;  3RQH A;  4E69 A;  3BF5 A;  5EYN A;  4XCK A;  3NL5 A;  2ABQ A;  3RTG A;  2I5B A;  4EBU A;  3B1Q A;  3GBU A;  1LIO A;  2JG5 A;  1VI9 A;  3QA2 A;  3RS9 A;  3B1O A;  3DRW A;  3B1R A;  3MBH A;  2I6B A;  3JUL A;  1V1A A;  4U7X A;  3RSG A;  2PKF A;  2YXT A;  4B8R A;  2JGV A;  3RO4 A;  1RFV A;  1RKS A;  3DZV A;  4YL5 A;  4C5M A;  3I3Y A;  3RTA A;  2QCV A;  3EWM A;  4N09 A;  4O1G A;  4KAH A;  5TQI A;  3OTX A;  3QAI A;  3HIC A;  3VAS A;  4K8C A;  1V19 A;  4C5K A;  5C41 A;  4JKU A;  3PZS A;  3NL2 A;  3RSF A;  1LII A;  4XDA A;  3RU2 A;  4K9I A;  3RRF A;  4K8T A;  5COJ A;  1RFU A;  5F0Z A;  2A9Z A;  3RTC A;  4DU5 A;  3LKI A;  2QHP A;  4N08 A;  4EOH A;  3RPH A;  3MBJ A;  5EY7 A;  3RQ2 A;  3UMP A;  4S1I B;  2R3B A;  4UBE A;  3UBO A;  3IQ0 A;  1LHP A;  2JG1 A;  2I6A A;  2XTB A;  4LCA A;  3Q1Y A;  5BYE A;  1ESQ A;  1JXI A;  3RQQ A;  4X8F A;  3RTD A;  3RM5 A;  3B3L A;  2Q5R A;  5CM5 A;  1KYH A;  3LOO A;  2AFB A;  4WJM A;  4K93 A;  4O1L A;  3NL6 A;  3B1N A;  3RRJ A;  1VK4 A;  3RS8 A;  3RQX A;  3KD6 A;  1WYE A;  4S1M A;  2AX3 A;  3NL3 A;  1UB0 A;  3H49 A;  2PKM A;  3BGK A;  4KBE A;  1RKA A;  3KZH A;  4LBX A;  2VAR A;  3RY7 A;  2PKN A;  3RSS A;  3UQ6 A;  2DCN A;  1V1B A;  1EKK A;  4JKS A;  3NBW A;  2C49 A;  1RFT A;  5TRW A;  3LJS A;  5C40 A;  1ESJ A;  2AWD A;  3NBV A;  2HW1 A;  2AB8 A;  2DDM A;  3IN1 A;  4S1H A;  5F11 A;  2DDW A;  5C3Y A;  1C3Q A;  1TZ3 A;  3RRE A;  2YXU A;  3UQE A;  1YGJ A;  3IH0 A;  3W4S A;  2HLZ A; 
#chains in the Genus database with same CATH topology
 3RU3 A;  2V78 A;  2F7K A;  3GO6 A;  3RSQ A;  3H74 A;  3HPD A;  4K8P A;  3B1P A;  4KAN A;  4CVM A;  3RT7 A;  4C5J A;  2XPC A;  5A5F A;  4E3A A;  4E8W A;  4LC4 A;  2HQQ A;  4B8S A;  3RT9 A;  1DGM A;  1U2X A;  3CQD A;  4KAD A;  1L2L A;  3RQ6 A;  1LIJ A;  2GCA A;  4K9C A;  5BYD A;  4BUC A;  2A9Y A;  4S1I A;  1YHJ A;  3PL2 A;  4E8Z A;  1BX4 A;  5B6A A;  1LIK A;  4C5N A;  1LHR A;  3RRB A;  1TD2 A;  4KAL A;  1GC5 A;  4E8Y A;  2AM2 A;  3NM1 A;  3RTE A;  1EKQ A;  1O5Z A;  2GCB A;  3GO7 A;  1YGK A;  4YWR A;  2FV7 A;  2Y67 A;  3NM3 A;  3UMO A;  1RK2 A;  1GG4 A;  1EEH A;  3ZS7 A;  1J6U A;  2F02 A;  2JFF A;  3N1C A;  5BYC A;  3NC2 A;  4BUB A;  1UA4 A;  4LBG A;  3UBO A;  4K8K A;  3RTB A;  1JXH A;  3IKH A;  4XF6 A;  2AA0 A;  1GQT A;  1TYY A;  3IBQ A;  3Q92 A;  3KTN A;  2PKK A;  5CGA A;  3NC9 A;  2R3E A;  3VAQ A;  5C3Z A;  3RQ5 A;  3KEU A;  1RKD A;  3FHY A;  3UQD A;  3NCA A;  3K5W A;  5CGE A;  4EUM A;  4E84 A;  1GQY A;  1TZ6 A;  4PVV A;  3LHX A;  2AJR A;  3HYO A;  4QF5 A;  4C5L A;  4XF7 A;  3FHX A;  3LK7 A;  3IE7 A;  1VM7 A;  3RPZ A;  2DDO A;  2RBC A;  4JJP A;  3UQ9 A;  4CVK A;  2AJP A;  4DC3 A;  2NWH A;  1V1S A;  4GM6 A;  3ZM5 A;  5BYF A;  1P31 A;  2ABS A;  2C4E A;  3K9E A;  3RQ8 A;  3RQH A;  4E69 A;  4EN4 A;  3BF5 A;  5EYN A;  4XCK A;  3HJ6 A;  3NL5 A;  2ABQ A;  2UUP A;  3RTG A;  2I5B A;  4EBU A;  4HV4 A;  1JBV A;  3B1Q A;  1LIO A;  3GBU A;  2JG5 A;  1VI9 A;  3QA2 A;  3RS9 A;  2XJA A;  3EAG A;  3B1O A;  2WTZ A;  3B1R A;  1E0D A;  2I6B A;  3DRW A;  1V1A A;  3JUL A;  3MBH A;  4U7X A;  3RSG A;  1P3D A;  1E8C A;  2PKF A;  2VOR A;  2YXT A;  4C12 A;  4B8R A;  2JGV A;  3RO4 A;  1RFV A;  1W7K A;  1RKS A;  3DZV A;  4QDI A;  2Y66 A;  4YL5 A;  4C5M A;  3I3Y A;  3RTA A;  2QCV A;  4ZIY A;  3EWM A;  4N09 A;  5A5E A;  3N2A A;  4O1G A;  2VTE A;  4KAH A;  5TQI A;  2Y1O A;  3OTX A;  3QAI A;  3HIC A;  3VAS A;  4K8C A;  1V19 A;  4C5K A;  4CVL A;  1UAG A;  4JKU A;  4C13 A;  5C41 A;  3PZS A;  3NL2 A;  3RSF A;  1LII A;  3UAG A;  4XDA A;  3ZL8 A;  3RU2 A;  2VTD A;  4K9I A;  2F00 A;  3RRF A;  4K8T A;  5COJ A;  1RFU A;  5F0Z A;  2A9Z A;  3RTC A;  4DU5 A;  3LKI A;  2QHP A;  2UUO A;  4N08 A;  4EOH A;  2VOS A;  3RPH A;  3MBJ A;  5EY7 A;  3RQ2 A;  3UMP A;  4S1I B;  2R3B A;  2UAG A;  2JFG A;  3IQ0 A;  1LHP A;  4UBE A;  2I6A A;  2JG1 A;  2XTB A;  3HN7 A;  4LCA A;  3Q1Y A;  5BYE A;  1ESQ A;  1JXI A;  2Y68 A;  3RQQ A;  4X8F A;  3RTD A;  3RM5 A;  3B3L A;  1W78 A;  2Q5R A;  5CM5 A;  1KYH A;  3LOO A;  2AFB A;  2GC6 A;  4K93 A;  3QCZ A;  2JFH A;  3B1N A;  3NL6 A;  4O1L A;  3RRJ A;  1VK4 A;  3RS8 A;  3RQX A;  3KD6 A;  1WYE A;  4S1M A;  2AX3 A;  3NL3 A;  1UB0 A;  3H49 A;  2PKM A;  1JBW A;  3NRS A;  3BGK A;  4KBE A;  1RKA A;  2WJP A;  3KZH A;  4LBX A;  2VAR A;  3RY7 A;  2PKN A;  2X5O A;  3RSS A;  3UQ6 A;  2DCN A;  1V1B A;  1EKK A;  4JKS A;  3NBW A;  2C49 A;  1RFT A;  3ZM6 A;  4UAG A;  3PYZ A;  2AM1 A;  5TRW A;  3LJS A;  5C40 A;  1ESJ A;  2AWD A;  2GC5 A;  2HW1 A;  1FGS A;  2AB8 A;  2DDM A;  3IN1 A;  3NBV A;  4S1H A;  5F11 A;  2DDW A;  5C3Y A;  1C3Q A;  1GQQ A;  1TZ3 A;  2YXU A;  4WJM A;  1YGJ A;  3IH0 A;  3RRE A;  3UQE A;  3W4S A;  2HLZ A; 
#chains in the Genus database with same CATH homology
 3RU3 A;  2V78 A;  2F7K A;  3GO6 A;  3RSQ A;  3H74 A;  3HPD A;  4K8P A;  3B1P A;  4KAN A;  3RT7 A;  4C5J A;  4E3A A;  4E8W A;  4LC4 A;  2HQQ A;  4B8S A;  3RT9 A;  1DGM A;  1U2X A;  3CQD A;  4KAD A;  1L2L A;  3RQ6 A;  1LIJ A;  5BYD A;  4K9C A;  2A9Y A;  4S1I A;  1YHJ A;  3PL2 A;  4E8Z A;  1BX4 A;  5B6A A;  1LIK A;  4C5N A;  1LHR A;  3RRB A;  1TD2 A;  4KAL A;  1GC5 A;  3NM1 A;  3RTE A;  1EKQ A;  4YWR A;  4DC3 A;  3GO7 A;  1YGK A;  4E8Y A;  2FV7 A;  3NM3 A;  3UMO A;  1RK2 A;  3ZS7 A;  2F02 A;  5BYC A;  3N1C A;  3NC2 A;  1UA4 A;  4LBG A;  4K8K A;  3RTB A;  1JXH A;  3IKH A;  4XF6 A;  2AA0 A;  1GQT A;  1TYY A;  3IBQ A;  3Q92 A;  3KTN A;  2PKK A;  5CGA A;  3NC9 A;  2R3E A;  3VAQ A;  5C3Z A;  3RQ5 A;  3KEU A;  1RKD A;  3FHY A;  3UQD A;  3NCA A;  3K5W A;  5CGE A;  4EUM A;  4E84 A;  1TZ6 A;  4PVV A;  3LHX A;  2AJR A;  3HYO A;  4C5L A;  4XF7 A;  3FHX A;  3IE7 A;  1VM7 A;  3RPZ A;  2DDO A;  2RBC A;  4JJP A;  3UQ9 A;  2AJP A;  2NWH A;  1V1S A;  4GM6 A;  5BYF A;  2ABS A;  2C4E A;  3K9E A;  3RQ8 A;  4EN4 A;  3RQH A;  4E69 A;  3BF5 A;  5EYN A;  4XCK A;  3HJ6 A;  3NL5 A;  2ABQ A;  3RTG A;  2I5B A;  4EBU A;  3B1Q A;  3GBU A;  1LIO A;  2JG5 A;  1VI9 A;  3QA2 A;  3RS9 A;  3B1O A;  3DRW A;  3B1R A;  3MBH A;  2I6B A;  3JUL A;  1V1A A;  4U7X A;  3RSG A;  2PKF A;  2YXT A;  4B8R A;  2JGV A;  3RO4 A;  1RFV A;  1RKS A;  3DZV A;  4YL5 A;  4C5M A;  3I3Y A;  3RTA A;  2QCV A;  3EWM A;  4N09 A;  4O1G A;  4KAH A;  5TQI A;  3OTX A;  3QAI A;  3HIC A;  3VAS A;  4K8C A;  1V19 A;  4C5K A;  5C41 A;  4JKU A;  3PZS A;  3NL2 A;  3RSF A;  1LII A;  4XDA A;  3RU2 A;  4K9I A;  3RRF A;  4K8T A;  5COJ A;  1RFU A;  5F0Z A;  2A9Z A;  3RTC A;  4DU5 A;  3LKI A;  2QHP A;  4N08 A;  4EOH A;  3RPH A;  3MBJ A;  5EY7 A;  3RQ2 A;  3UMP A;  4S1I B;  2R3B A;  4UBE A;  3UBO A;  3IQ0 A;  1LHP A;  2JG1 A;  2I6A A;  2XTB A;  4LCA A;  3Q1Y A;  5BYE A;  1ESQ A;  1JXI A;  3RQQ A;  4X8F A;  3RTD A;  3RM5 A;  3B3L A;  2Q5R A;  5CM5 A;  1KYH A;  3LOO A;  2AFB A;  4WJM A;  4K93 A;  4O1L A;  3NL6 A;  3B1N A;  3RRJ A;  1VK4 A;  3RS8 A;  3RQX A;  3KD6 A;  1WYE A;  4S1M A;  2AX3 A;  3NL3 A;  1UB0 A;  3H49 A;  2PKM A;  3BGK A;  4KBE A;  1RKA A;  3KZH A;  4LBX A;  2VAR A;  3RY7 A;  2PKN A;  3RSS A;  3UQ6 A;  2DCN A;  1V1B A;  1EKK A;  4JKS A;  3NBW A;  2C49 A;  1RFT A;  5TRW A;  3LJS A;  5C40 A;  1ESJ A;  2AWD A;  3NBV A;  2HW1 A;  2AB8 A;  2DDM A;  3IN1 A;  4S1H A;  5F11 A;  2DDW A;  5C3Y A;  1C3Q A;  1TZ3 A;  3RRE A;  2YXU A;  3UQE A;  1YGJ A;  3IH0 A;  3W4S A;  2HLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...