2R3BA

Crystal structure of a ribokinase-like superfamily protein (ef1790) from enterococcus faecalis v583 at 1.80 a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
283
Chain Sequence
ENLYFQGMRYLSKDILEEVITQRPSDSYKSNFGRVVLIGGNRQYGGAIIMSTEACINSGAGLTTVITDVKNHGPLHARCPEAMVVGFEETVLLTNVVEQADVILIGPGLGLDATAQQILKMVLAQHQKQQWLIIDGSAITLFSQGNFSLTYPEKVVFTPHQMEWQRLSHLPIEQQTLANNQRQQAKLGSTIVLKSHRTTIFHAGEPFQNTGGNPGMATGGTGDTLAGIIAGFLAQFKPTIETIAGAVYLHSLIGDDLAKTDYVVLPTKISQALPTYMKKYAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative kinase in the ribokinase-like superfamily from Enterococcus faecalis V583 (NP_815490.1) at 1.80 A resolution
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords YjeF-related protein
total genus 99
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2r3bA01
3RQ8A 5C3ZA 2VARA 2YXUA 3RSSA 4PVVA 5C3YA 3BGKA 2AJRA 5F0ZA 1TZ3A 1LHPA 4K9IA 3QA2A 3KD6A 1RKAA 5TRWA 3RQHA 3RU3A 1C3QA 3B1OA 3B3LA 3BF5A 3RO4A 3NM3A 2A9ZA 1JXIA 3QAIA 3B1PA 4KANA 3W4SA 2HLZA 3LHXA 4K9CA 5EY7A 4C5KA 3ZS7A 1RFTA 3NCAA 3Q1YA 3RTEA 3DRWA 1V19A 1VM7A 3H49A 3LOOA 3IH0A 1TZ6A 3PZSA 3KZHA 3IN1A 4C5NA 2RBCA 4LCAA 1LHRA 1VK4A 3CQDA 3H74A 4XDAA 1BX4A 5CM5A 2YXTA 4KALA 5EYNA 2PKKA 2AFBA 3VASA 3I3YA 2PKNA 2XTBA 3IKHA 4JJPA 4E8ZA 3RY7A 5C40A 1TD2A 1L2LA 3VAQA 2AB8A 4LBXA 4E84A 4E69A 2QHPA 4UBEA 3UQEA 3RQXA 2DCNA 1YHJA 1TYYA 3GO6A 4K8TA 1EKQA 1ESJA 2PKMA 4S1IA 2JGVA 4JKUA 4K93A 3RRFA 2DDMA 3EWMA 3RSGA 2NWHA 3RRBA 4KADA 2C4EA 3UMOA 3GBUA 3HYOA 1LIOA 1LIIA 3NM1A 3UQDA 2AWDA 2Q5RA 3HICA 1RKSA 2AJPA 4S1MA 1V1AA 1GC5A 1RK2A 3RPZA 5COJA 2R3EA 2DDOA 4YWRA 1V1BA 2AX3A 3K9EA 4K8KA 2FV7A 1RFUA 1U2XA 2A9YA 3NL6A 3PL2A 4DU5A 2JG1A 4DC3A 4E8YA 3UQ6A 3NL2A 5CGAA 1YGKA 4S1HA 4E3AA 5C41A 1RKDA 3UBOA 4S1IB 3RSQA 2QCVA 3RPHA 3RTGA 2V78A 3RTBA 4U7XA 3RQ2A 3UQ9A 4C5LA 2ABSA 3Q92A 5F11A 1UA4A 3KEUA 3RRJA 2I6AA 4GM6A 4YL5A 3RTCA 4C5MA 3NC9A 3NL5A 1GQTA 4EN4A 4XF6A 3GO7A 3RSFA 4B8RA 4C5JA 4LBGA 4KAHA 4O1LA 3RQ5A 3JULA 5BYEA 2DDWA 1LIJA 3K5WA 4XF7A 5BYDA 4XCKA 1UB0A 3RT9A 4JKSA 1VI9A 1WYEA 4N08A 4K8PA 3B1QA 3LKIA 3MBHA 4WJMA 4LC4A 3RM5A 5CGEA 3RT7A 4N09A 3IQ0A 3MBJA 1JXHA 3UMPA 3NBWA 5BYFA 3RS8A 3RU2A 1V1SA 5BYCA 2PKFA 3B1RA 3FHXA 1LIKA 3NL3A 3NBVA 4X8FA 3RREA 3RTAA 3RTDA 4EUMA 3FHYA 5B6AA 2HQQA 2F02A 1YGJA 3NC2A 1DGMA 3DZVA 4O1GA 1RFVA 1EKKA 3IBQA 2JG5A 5TQIA 1KYHA 3LJSA 3RS9A 3N1CA 1ESQA 3OTXA 3RQQA 3KTNA 4B8SA 3HPDA 4EBUA 4E8WA 3IE7A 2I6BA 2C49A 2I5BA 2HW1A 4KBEA 4K8CA 4EOHA 2ABQA 3B1NA 2AA0A 2R3BA 2F7KA 3RQ6A
chains in the Genus database with same CATH superfamily
3RQ8A 5C3ZA 2VARA 2YXUA 3RSSA 4PVVA 5C3YA 3BGKA 2AJRA 2UAGA 5F0ZA 1TZ3A 1LHPA 4K9IA 3QA2A 3KD6A 1RKAA 5TRWA 3RQHA 3RU3A 1JBVA 1C3QA 5A5FA 3B1OA 3B3LA 3BF5A 3RO4A 2WTZA 3NM3A 2A9ZA 1JXIA 3QAIA 4CVLA 3B1PA 4KANA 1P31A 3W4SA 2HLZA 3LHXA 4K9CA 2JFGA 5EY7A 4C5KA 3ZS7A 1RFTA 3NCAA 3Q1YA 2AM1A 3RTEA 4QF5A 3DRWA 1V19A 1VM7A 3H49A 3LOOA 3IH0A 1TZ6A 3PZSA 3KZHA 3IN1A 4C5NA 2RBCA 4LCAA 1LHRA 1VK4A 1W78A 1E8CA 3CQDA 3H74A 4XDAA 1BX4A 2Y1OA 5CM5A 4HV4A 2YXTA 4KALA 5EYNA 3ZL8A 1EEHA 2PKKA 2AFBA 3VASA 3I3YA 2GCAA 2PKNA 1GQYA 2X5OA 2XTBA 3IKHA 4JJPA 3RY7A 4E8ZA 5C40A 1TD2A 1L2LA 3VAQA 2AB8A 4LBXA 4E84A 4E69A 2QHPA 4UBEA 3UQEA 1UAGA 2UUOA 3RQXA 2DCNA 1YHJA 1TYYA 5A5EA 3GO6A 4K8TA 4UAGA 3ZM6A 1EKQA 1ESJA 2PKMA 4CVKA 4S1IA 2JGVA 2GCBA 4JKUA 4K93A 3RRFA 2DDMA 3EWMA 3RSGA 2NWHA 3RRBA 4KADA 2VTEA 2C4EA 3UMOA 1J6UA 2F00A 3GBUA 3HYOA 1LIOA 1LIIA 3NM1A 3UQDA 2AWDA 2Q5RA 3HICA 1RKSA 4C12A 2AJPA 2Y66A 1V1AA 1GC5A 1RK2A 4S1MA 5COJA 3RPZA 4BUCA 2R3EA 2DDOA 4YWRA 1V1BA 2AX3A 3K9EA 4K8KA 4CVMA 2FV7A 1RFUA 1U2XA 2A9YA 3NL6A 3PL2A 2Y67A 4DU5A 2R3BA 2JG1A 2XJAA 4DC3A 4E8YA 3UQ6A 3NL2A 5CGAA 1YGKA 4S1HA 4E3AA 5C41A 1P3DA 3HN7A 1RKDA 3UBOA 4S1IB 2JFFA 2XPCA 4ZIYA 1FGSA 3RSQA 1O5ZA 2QCVA 3RPHA 2UUPA 2V78A 3RTGA 2WJPA 3LK7A 3RTBA 4U7XA 3RQ2A 3UQ9A 4C5LA 2ABSA 3Q92A 5F11A 1UA4A 3KEUA 4BUBA 2GC6A 3RRJA 2I6AA 4GM6A 4YL5A 3RTCA 2VOSA 4C5MA 3NC9A 3NL5A 1GQTA 4EN4A 1E0DA 4XF6A 3GO7A 3RSFA 4B8RA 4C5JA 4LBGA 4KAHA 4O1LA 3RQ5A 2GC5A 3JULA 5BYEA 2DDWA 1LIJA 3HJ6A 3K5WA 3N2AA 4XCKA 1UB0A 4XF7A 3RT9A 5BYDA 1GQQA 4JKSA 1VI9A 4QDIA 1WYEA 4N08A 4K8PA 3B1QA 3PYZA 3LKIA 3ZM5A 3MBHA 4WJMA 4LC4A 3RM5A 5CGEA 3RT7A 3NRSA 4N09A 3IQ0A 3MBJA 1JXHA 4C13A 3UMPA 1JBWA 3NBWA 3RS8A 5BYFA 3RU2A 5BYCA 3EAGA 3QCZA 3UAGA 2PKFA 3B1RA 2Y68A 3FHXA 1LIKA 3NL3A 3NBVA 2VORA 4X8FA 2VTDA 3RREA 3RTAA 3FHYA 3RTDA 4EUMA 5B6AA 2HQQA 2F02A 1YGJA 3NC2A 1DGMA 3DZVA 4O1GA 1RFVA 1EKKA 3IBQA 2JG5A 5TQIA 1KYHA 3LJSA 3RS9A 3N1CA 1ESQA 1W7KA 3OTXA 3KTNA 3RQQA 3HPDA 4B8SA 4E8WA 3IE7A 4EBUA 2AM2A 2I6BA 2C49A 2I5BA 2HW1A 4KBEA 2JFHA 4K8CA 4EOHA 1GG4A 2ABQA 3B1NA 2AA0A 1V1SA 2F7KA 3RQ6A
chains in the Genus database with same CATH topology
3RQ8A 5C3ZA 2VARA 2YXUA 3RSSA 4PVVA 5C3YA 3BGKA 2AJRA 5F0ZA 1TZ3A 1LHPA 4K9IA 3QA2A 3KD6A 1RKAA 5TRWA 3RQHA 3RU3A 1C3QA 3B1OA 3B3LA 3BF5A 3RO4A 3NM3A 2A9ZA 1JXIA 3QAIA 3B1PA 4KANA 3W4SA 2HLZA 3LHXA 4K9CA 5EY7A 4C5KA 3ZS7A 1RFTA 3NCAA 3Q1YA 3RTEA 3DRWA 1V19A 1VM7A 3H49A 3LOOA 3IH0A 1TZ6A 3PZSA 3KZHA 3IN1A 4C5NA 2RBCA 4LCAA 1LHRA 1VK4A 3CQDA 3H74A 4XDAA 1BX4A 5CM5A 2YXTA 4KALA 5EYNA 2PKKA 2AFBA 3VASA 3I3YA 2PKNA 2XTBA 3IKHA 4JJPA 4E8ZA 3RY7A 5C40A 1TD2A 1L2LA 3VAQA 2AB8A 4LBXA 4E84A 4E69A 2QHPA 4UBEA 3UQEA 3RQXA 2DCNA 1YHJA 1TYYA 3GO6A 4K8TA 1EKQA 1ESJA 2PKMA 4S1IA 2JGVA 4JKUA 4K93A 3RRFA 2DDMA 3EWMA 3RSGA 2NWHA 3RRBA 4KADA 2C4EA 3UMOA 3GBUA 3HYOA 1LIOA 1LIIA 3NM1A 3UQDA 2AWDA 2Q5RA 3HICA 1RKSA 2AJPA 4S1MA 1V1AA 1GC5A 1RK2A 3RPZA 5COJA 2R3EA 2DDOA 4YWRA 1V1BA 2AX3A 3K9EA 4K8KA 2FV7A 1RFUA 1U2XA 2A9YA 3NL6A 3PL2A 4DU5A 2JG1A 4DC3A 4E8YA 3UQ6A 3NL2A 5CGAA 1YGKA 4S1HA 4E3AA 5C41A 1RKDA 3UBOA 4S1IB 3RSQA 2QCVA 3RPHA 3RTGA 2V78A 3RTBA 4U7XA 3RQ2A 3UQ9A 4C5LA 2ABSA 3Q92A 5F11A 1UA4A 3KEUA 3RRJA 2I6AA 4GM6A 4YL5A 3RTCA 4C5MA 3NC9A 3NL5A 1GQTA 4EN4A 4XF6A 3GO7A 3RSFA 4B8RA 4C5JA 4LBGA 4KAHA 4O1LA 3RQ5A 3JULA 5BYEA 2DDWA 1LIJA 3HJ6A 3K5WA 4XF7A 4XCKA 1UB0A 3RT9A 5BYDA 4JKSA 1VI9A 1WYEA 4N08A 4K8PA 3B1QA 3LKIA 3MBHA 4WJMA 4LC4A 3RM5A 5CGEA 3RT7A 4N09A 3IQ0A 3MBJA 1JXHA 3UMPA 3NBWA 5BYFA 3RS8A 3RU2A 1V1SA 5BYCA 2PKFA 3B1RA 3FHXA 1LIKA 3NL3A 3NBVA 4X8FA 3RREA 3RTAA 3RTDA 4EUMA 3FHYA 5B6AA 2HQQA 2F02A 1YGJA 3NC2A 1DGMA 3DZVA 4O1GA 1RFVA 1EKKA 3IBQA 2JG5A 5TQIA 1KYHA 3LJSA 3RS9A 3N1CA 1ESQA 3OTXA 3RQQA 3KTNA 4B8SA 3HPDA 4EBUA 4E8WA 3IE7A 2I6BA 2C49A 2I5BA 2HW1A 4KBEA 4K8CA 4EOHA 2ABQA 3B1NA 2AA0A 2R3BA 2F7KA 3RQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQ8 A;  5C3Z A;  2VAR A;  2YXU A;  3RSS A;  4PVV A;  5C3Y A;  3BGK A;  2AJR A;  5F0Z A;  1TZ3 A;  1LHP A;  4K9I A;  3QA2 A;  3KD6 A;  1RKA A;  5TRW A;  3RQH A;  3RU3 A;  1C3Q A;  3B1O A;  3B3L A;  3BF5 A;  3RO4 A;  3NM3 A;  2A9Z A;  1JXI A;  3QAI A;  3B1P A;  4KAN A;  3W4S A;  2HLZ A;  3LHX A;  4K9C A;  5EY7 A;  4C5K A;  3ZS7 A;  1RFT A;  3NCA A;  3Q1Y A;  3RTE A;  3DRW A;  1V19 A;  1VM7 A;  3H49 A;  3LOO A;  3IH0 A;  1TZ6 A;  3PZS A;  3KZH A;  3IN1 A;  4C5N A;  2RBC A;  4LCA A;  1LHR A;  1VK4 A;  3CQD A;  3H74 A;  4XDA A;  1BX4 A;  5CM5 A;  2YXT A;  4KAL A;  5EYN A;  2PKK A;  2AFB A;  3VAS A;  3I3Y A;  2PKN A;  2XTB A;  3IKH A;  4JJP A;  4E8Z A;  3RY7 A;  5C40 A;  1TD2 A;  1L2L A;  3VAQ A;  2AB8 A;  4LBX A;  4E84 A;  4E69 A;  2QHP A;  4UBE A;  3UQE A;  3RQX A;  2DCN A;  1YHJ A;  1TYY A;  3GO6 A;  4K8T A;  1EKQ A;  1ESJ A;  2PKM A;  4S1I A;  2JGV A;  4JKU A;  4K93 A;  3RRF A;  2DDM A;  3EWM A;  3RSG A;  2NWH A;  3RRB A;  4KAD A;  2C4E A;  3UMO A;  3GBU A;  3HYO A;  1LIO A;  1LII A;  3NM1 A;  3UQD A;  2AWD A;  2Q5R A;  3HIC A;  1RKS A;  2AJP A;  4S1M A;  1V1A A;  1GC5 A;  1RK2 A;  3RPZ A;  5COJ A;  2R3E A;  2DDO A;  4YWR A;  1V1B A;  2AX3 A;  3K9E A;  4K8K A;  2FV7 A;  1RFU A;  1U2X A;  2A9Y A;  3NL6 A;  3PL2 A;  4DU5 A;  2JG1 A;  4DC3 A;  4E8Y A;  3UQ6 A;  3NL2 A;  5CGA A;  1YGK A;  4S1H A;  4E3A A;  5C41 A;  1RKD A;  3UBO A;  4S1I B;  3RSQ A;  2QCV A;  3RPH A;  3RTG A;  2V78 A;  3RTB A;  4U7X A;  3RQ2 A;  3UQ9 A;  4C5L A;  2ABS A;  3Q92 A;  5F11 A;  1UA4 A;  3KEU A;  3RRJ A;  2I6A A;  4GM6 A;  4YL5 A;  3RTC A;  4C5M A;  3NC9 A;  3NL5 A;  1GQT A;  4EN4 A;  4XF6 A;  3GO7 A;  3RSF A;  4B8R A;  4C5J A;  4LBG A;  4KAH A;  4O1L A;  3RQ5 A;  3JUL A;  5BYE A;  2DDW A;  1LIJ A;  3K5W A;  4XF7 A;  5BYD A;  4XCK A;  1UB0 A;  3RT9 A;  4JKS A;  1VI9 A;  1WYE A;  4N08 A;  4K8P A;  3B1Q A;  3LKI A;  3MBH A;  4WJM A;  4LC4 A;  3RM5 A;  5CGE A;  3RT7 A;  4N09 A;  3IQ0 A;  3MBJ A;  1JXH A;  3UMP A;  3NBW A;  5BYF A;  3RS8 A;  3RU2 A;  1V1S A;  5BYC A;  2PKF A;  3B1R A;  3FHX A;  1LIK A;  3NL3 A;  3NBV A;  4X8F A;  3RRE A;  3RTA A;  3RTD A;  4EUM A;  3FHY A;  5B6A A;  2HQQ A;  2F02 A;  1YGJ A;  3NC2 A;  1DGM A;  3DZV A;  4O1G A;  1RFV A;  1EKK A;  3IBQ A;  2JG5 A;  5TQI A;  1KYH A;  3LJS A;  3RS9 A;  3N1C A;  1ESQ A;  3OTX A;  3RQQ A;  3KTN A;  4B8S A;  3HPD A;  4EBU A;  4E8W A;  3IE7 A;  2I6B A;  2C49 A;  2I5B A;  2HW1 A;  4KBE A;  4K8C A;  4EOH A;  2ABQ A;  3B1N A;  2AA0 A;  2R3B A;  2F7K A;  3RQ6 A; 
#chains in the Genus database with same CATH topology
 3RQ8 A;  5C3Z A;  2VAR A;  2YXU A;  3RSS A;  4PVV A;  5C3Y A;  3BGK A;  2AJR A;  2UAG A;  5F0Z A;  1TZ3 A;  1LHP A;  4K9I A;  3QA2 A;  3KD6 A;  1RKA A;  5TRW A;  3RQH A;  3RU3 A;  1JBV A;  1C3Q A;  5A5F A;  3B1O A;  3B3L A;  3BF5 A;  3RO4 A;  2WTZ A;  3NM3 A;  2A9Z A;  1JXI A;  3QAI A;  4CVL A;  3B1P A;  4KAN A;  1P31 A;  3W4S A;  2HLZ A;  3LHX A;  4K9C A;  2JFG A;  5EY7 A;  4C5K A;  3ZS7 A;  1RFT A;  3NCA A;  3Q1Y A;  2AM1 A;  3RTE A;  4QF5 A;  3DRW A;  1V19 A;  1VM7 A;  3H49 A;  3LOO A;  3IH0 A;  1TZ6 A;  3PZS A;  3KZH A;  3IN1 A;  4C5N A;  2RBC A;  4LCA A;  1LHR A;  1VK4 A;  1W78 A;  1E8C A;  3CQD A;  3H74 A;  4XDA A;  1BX4 A;  2Y1O A;  5CM5 A;  4HV4 A;  2YXT A;  4KAL A;  5EYN A;  3ZL8 A;  1EEH A;  2PKK A;  2AFB A;  3VAS A;  3I3Y A;  2GCA A;  2PKN A;  1GQY A;  2X5O A;  2XTB A;  3IKH A;  4JJP A;  3RY7 A;  4E8Z A;  5C40 A;  1TD2 A;  1L2L A;  3VAQ A;  2AB8 A;  4LBX A;  4E84 A;  4E69 A;  2QHP A;  4UBE A;  3UQE A;  1UAG A;  2UUO A;  3RQX A;  2DCN A;  1YHJ A;  1TYY A;  5A5E A;  3GO6 A;  4K8T A;  4UAG A;  3ZM6 A;  1EKQ A;  1ESJ A;  2PKM A;  4CVK A;  4S1I A;  2JGV A;  2GCB A;  4JKU A;  4K93 A;  3RRF A;  2DDM A;  3EWM A;  3RSG A;  2NWH A;  3RRB A;  4KAD A;  2VTE A;  2C4E A;  3UMO A;  1J6U A;  2F00 A;  3GBU A;  3HYO A;  1LIO A;  1LII A;  3NM1 A;  3UQD A;  2AWD A;  2Q5R A;  3HIC A;  1RKS A;  4C12 A;  2AJP A;  2Y66 A;  1V1A A;  1GC5 A;  1RK2 A;  4S1M A;  5COJ A;  3RPZ A;  4BUC A;  2R3E A;  2DDO A;  4YWR A;  1V1B A;  2AX3 A;  3K9E A;  4K8K A;  4CVM A;  2FV7 A;  1RFU A;  1U2X A;  2A9Y A;  3NL6 A;  3PL2 A;  2Y67 A;  4DU5 A;  2R3B A;  2JG1 A;  2XJA A;  4DC3 A;  4E8Y A;  3UQ6 A;  3NL2 A;  5CGA A;  1YGK A;  4S1H A;  4E3A A;  5C41 A;  1P3D A;  3HN7 A;  1RKD A;  3UBO A;  4S1I B;  2JFF A;  2XPC A;  4ZIY A;  1FGS A;  3RSQ A;  1O5Z A;  2QCV A;  3RPH A;  2UUP A;  2V78 A;  3RTG A;  2WJP A;  3LK7 A;  3RTB A;  4U7X A;  3RQ2 A;  3UQ9 A;  4C5L A;  2ABS A;  3Q92 A;  5F11 A;  1UA4 A;  3KEU A;  4BUB A;  2GC6 A;  3RRJ A;  2I6A A;  4GM6 A;  4YL5 A;  3RTC A;  2VOS A;  4C5M A;  3NC9 A;  3NL5 A;  1GQT A;  4EN4 A;  1E0D A;  4XF6 A;  3GO7 A;  3RSF A;  4B8R A;  4C5J A;  4LBG A;  4KAH A;  4O1L A;  3RQ5 A;  2GC5 A;  3JUL A;  5BYE A;  2DDW A;  1LIJ A;  3HJ6 A;  3K5W A;  3N2A A;  4XCK A;  1UB0 A;  4XF7 A;  3RT9 A;  5BYD A;  1GQQ A;  4JKS A;  1VI9 A;  4QDI A;  1WYE A;  4N08 A;  4K8P A;  3B1Q A;  3PYZ A;  3LKI A;  3ZM5 A;  3MBH A;  4WJM A;  4LC4 A;  3RM5 A;  5CGE A;  3RT7 A;  3NRS A;  4N09 A;  3IQ0 A;  3MBJ A;  1JXH A;  4C13 A;  3UMP A;  1JBW A;  3NBW A;  3RS8 A;  5BYF A;  3RU2 A;  5BYC A;  3EAG A;  3QCZ A;  3UAG A;  2PKF A;  3B1R A;  2Y68 A;  3FHX A;  1LIK A;  3NL3 A;  3NBV A;  2VOR A;  4X8F A;  2VTD A;  3RRE A;  3RTA A;  3FHY A;  3RTD A;  4EUM A;  5B6A A;  2HQQ A;  2F02 A;  1YGJ A;  3NC2 A;  1DGM A;  3DZV A;  4O1G A;  1RFV A;  1EKK A;  3IBQ A;  2JG5 A;  5TQI A;  1KYH A;  3LJS A;  3RS9 A;  3N1C A;  1ESQ A;  1W7K A;  3OTX A;  3KTN A;  3RQQ A;  3HPD A;  4B8S A;  4E8W A;  3IE7 A;  4EBU A;  2AM2 A;  2I6B A;  2C49 A;  2I5B A;  2HW1 A;  4KBE A;  2JFH A;  4K8C A;  4EOH A;  1GG4 A;  2ABQ A;  3B1N A;  2AA0 A;  1V1S A;  2F7K A;  3RQ6 A; 
#chains in the Genus database with same CATH homology
 3RQ8 A;  5C3Z A;  2VAR A;  2YXU A;  3RSS A;  4PVV A;  5C3Y A;  3BGK A;  2AJR A;  5F0Z A;  1TZ3 A;  1LHP A;  4K9I A;  3QA2 A;  3KD6 A;  1RKA A;  5TRW A;  3RQH A;  3RU3 A;  1C3Q A;  3B1O A;  3B3L A;  3BF5 A;  3RO4 A;  3NM3 A;  2A9Z A;  1JXI A;  3QAI A;  3B1P A;  4KAN A;  3W4S A;  2HLZ A;  3LHX A;  4K9C A;  5EY7 A;  4C5K A;  3ZS7 A;  1RFT A;  3NCA A;  3Q1Y A;  3RTE A;  3DRW A;  1V19 A;  1VM7 A;  3H49 A;  3LOO A;  3IH0 A;  1TZ6 A;  3PZS A;  3KZH A;  3IN1 A;  4C5N A;  2RBC A;  4LCA A;  1LHR A;  1VK4 A;  3CQD A;  3H74 A;  4XDA A;  1BX4 A;  5CM5 A;  2YXT A;  4KAL A;  5EYN A;  2PKK A;  2AFB A;  3VAS A;  3I3Y A;  2PKN A;  2XTB A;  3IKH A;  4JJP A;  4E8Z A;  3RY7 A;  5C40 A;  1TD2 A;  1L2L A;  3VAQ A;  2AB8 A;  4LBX A;  4E84 A;  4E69 A;  2QHP A;  4UBE A;  3UQE A;  3RQX A;  2DCN A;  1YHJ A;  1TYY A;  3GO6 A;  4K8T A;  1EKQ A;  1ESJ A;  2PKM A;  4S1I A;  2JGV A;  4JKU A;  4K93 A;  3RRF A;  2DDM A;  3EWM A;  3RSG A;  2NWH A;  3RRB A;  4KAD A;  2C4E A;  3UMO A;  3GBU A;  3HYO A;  1LIO A;  1LII A;  3NM1 A;  3UQD A;  2AWD A;  2Q5R A;  3HIC A;  1RKS A;  2AJP A;  4S1M A;  1V1A A;  1GC5 A;  1RK2 A;  3RPZ A;  5COJ A;  2R3E A;  2DDO A;  4YWR A;  1V1B A;  2AX3 A;  3K9E A;  4K8K A;  2FV7 A;  1RFU A;  1U2X A;  2A9Y A;  3NL6 A;  3PL2 A;  4DU5 A;  2JG1 A;  4DC3 A;  4E8Y A;  3UQ6 A;  3NL2 A;  5CGA A;  1YGK A;  4S1H A;  4E3A A;  5C41 A;  1RKD A;  3UBO A;  4S1I B;  3RSQ A;  2QCV A;  3RPH A;  3RTG A;  2V78 A;  3RTB A;  4U7X A;  3RQ2 A;  3UQ9 A;  4C5L A;  2ABS A;  3Q92 A;  5F11 A;  1UA4 A;  3KEU A;  3RRJ A;  2I6A A;  4GM6 A;  4YL5 A;  3RTC A;  4C5M A;  3NC9 A;  3NL5 A;  1GQT A;  4EN4 A;  4XF6 A;  3GO7 A;  3RSF A;  4B8R A;  4C5J A;  4LBG A;  4KAH A;  4O1L A;  3RQ5 A;  3JUL A;  5BYE A;  2DDW A;  1LIJ A;  3HJ6 A;  3K5W A;  4XF7 A;  4XCK A;  1UB0 A;  3RT9 A;  5BYD A;  4JKS A;  1VI9 A;  1WYE A;  4N08 A;  4K8P A;  3B1Q A;  3LKI A;  3MBH A;  4WJM A;  4LC4 A;  3RM5 A;  5CGE A;  3RT7 A;  4N09 A;  3IQ0 A;  3MBJ A;  1JXH A;  3UMP A;  3NBW A;  5BYF A;  3RS8 A;  3RU2 A;  1V1S A;  5BYC A;  2PKF A;  3B1R A;  3FHX A;  1LIK A;  3NL3 A;  3NBV A;  4X8F A;  3RRE A;  3RTA A;  3RTD A;  4EUM A;  3FHY A;  5B6A A;  2HQQ A;  2F02 A;  1YGJ A;  3NC2 A;  1DGM A;  3DZV A;  4O1G A;  1RFV A;  1EKK A;  3IBQ A;  2JG5 A;  5TQI A;  1KYH A;  3LJS A;  3RS9 A;  3N1C A;  1ESQ A;  3OTX A;  3RQQ A;  3KTN A;  4B8S A;  3HPD A;  4EBU A;  4E8W A;  3IE7 A;  2I6B A;  2C49 A;  2I5B A;  2HW1 A;  4KBE A;  4K8C A;  4EOH A;  2ABQ A;  3B1N A;  2AA0 A;  2R3B A;  2F7K A;  3RQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...