2R3ZA

Crystal structure of mouse ip-10
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-inducible cytokine B10
publication title Structure of mouse IP-10, a chemokine
pubmed doi rcsb
source organism Mus musculus
molecule tags Attractant
total genus 9
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r3zA00
4IUQA 5EPKA 2Q8RE 3I3CA 5DNFA 4CJ1B 1LV9A 4QUFA 4ZKBB 3Q6SA 4ZLTF 1KNAA 1HRJA 2B2WA 2K01A 1SAPA 4RAUC 5E4WC 2K03A 5CBEE 3I90A 3IFDA 1G2SA 1WTQA 4OIJA 2MPMA 4R8IA 1X3PA 1WTRA 2IL8A 3GV3A 3KUPA 4IUUA 1X3QA 1RTNA 1PDQA 3QO2A 4RA8A 1WTPA 1PFBA 1QE6A 1A15A 1ICWA 1TVXA 1B53A 4U68A 1NCVA 2XIWA 2Q8TA 1F9PA 1G2TA 3SVMA 2HCIA 1HUMA 1ML0D 5EPJA 1KNEA 1VMCA 1PLFA 2DY7A 2B2TC 1EL0A 3HP3A 1WD0A 3DEPA 3I8ZA 1NR4A 3UI2A 4CJ0B 1DONA 2L1BA 1S4ZA 4RWSC 2RSOA 1ESRA 1M8AA 2VXWA 5CMDA 1SDFA 1F9RA 4X3KA 1MSHA 2BDNA 1ILPA 2KECA 1F9QA 4O42A 5JJZA 1HFGA 2B2YC 5CBAE 2L9HA 2B2VC 3R93A 1BNZA 4NW2A 1WD1A 2L11A 4X3SA 1RJTA 2K04A 1HFNA 2NWGA 4CJ2C 2RVLA 1DOKA 1O80A 5EKIA 4XT1B 2HCCA 2KEEA 2X69A 4LMQD 5EPLA 2EPBA 4R9WA 4DN4M 1O7YA 1F2LA 1B4OA 1E0BA 2HDLA 1RTOA 2KUMA 2R3ZA 3F2UA 2FFKB 2RA4A 5COYA 4ZAIA 1EIHA 1AP0A 1IKLA 1ILQA 1U4RA 4MN3A 3P7JA 4QUCA 3D6WA 1J9OA 2B2UC 1J8IA 1B3AA 3DM1A 2B2YA 2KEDA 1MI2A 2EOTA 3KBXA 5CORA 4ZKCB 1WTXA 3G7LA 1BF4A 3N52A 1WVLA 1B50A 1RODA 2FMMA 2B2WC 5EJWA 1DOMA 1G6ZA 4IUVA 1U4MA 1IL8A 4HCSA 1HA6A 4ZK9B 1QNKA 2FHTA 1X32A 2H1EA 2K1BA 2L4NA 2MJ8A 3I91A 3LWEA 4HSVA 5E4XA 5T1IA 2JYOA 4OIKA 1CA5A 2HUGA 5EQ0A 2K05A 2EE1A 2RSNA 2X6LA 1SSOA 3MTSA 3FDTA 1Q3LA 2B2TA 2D9UA 1JE4A 1EOTA 2B2UA 1B2TA 2K28A 2MP1A 5D14A 1WTWA 5D65A 1CA6A 4XDXA 2FINB 1XYIA 1C8CA 1GUWA 2NYZD 1IKMA 1NAPA 2MGSA 1NR2A 5AFWA 4IUPA 1EIGA 2M2LA 2X6GA 1XX8A 2CVRA 2SDFA 4UAIA 4X3UA 1PFMA 3FPUB 3MWYW 4XT3B 2JP1A 1DOLA 1JICA 3TN2A 1U4LA 1HHVA 3TZDA 2B2VA 4HAEA 1G91A 2KOLA 2N88A 1VMPA 3H91A 3IL8A 1AZQA 1BBXC 2J7ZA 1MGSA 1BO0A 2DY8A 2FJ2A 4HEDA 1DZ1A 1CM9A 1O7ZA 3GV6A 3ONAB 1WTVA 1HUNA 2HDMA 4X3TA 1U4PA 1WTOA 1RHPA 1MSGA 3DEOA 1QG7A 4MHEA 4IURA 1AZPA 1F9SA 1PFNA 2N55A 2L12A 2KVMA 5T1GA 1ZXTA 1EQTA 4IUTA 2NZ1D
chains in the Genus database with same CATH superfamily
3G71A 2SOBA 3H0GB 5D3DA 1A0IA 2HT1A 3SR1A 4C3IG 4A3CH 1HRJA 2EXDA 4EQPA 1ASZA 2R6GA 4R1JA 4A3BH 3K7AB 3NHHA 1EY7A 2F0EA 1G2SA 2PI2A 1PH4A 3ULLA 2ENBA 1WTRA 2WACA 1F77A 1GXDC 1V43A 4H7BA 3ERSX 1PYBA 3S1RB 4R4IA 1GO3E 3GTOB 3HZXA 4QL5A 1F9PA 2J0TD 3BYTB 2BA0A 2H4OA 4N8X1 4A3EG 4V190 2ZTCA 5LMUL 1NR4A 2K5WA 1B9MA 2K6AA 1W6JA 1VQLA 3NBHA 4JI5L 2MQHA 1JOKA 2I5HA 4LAAA 4DV5Q 4BBRH 3MXGA 1F9QA 2BA1A 4WFN3 4FXGC 3H3VH 2QGQA 1XTDA 2A6ED 2QDBA 2V1CC 1A2TA 5IT9L 3OWFA 2LFNA 3BG3A 2IWHA 1X55A 1A6XA 1JORA 3KF8A 1J9OA 3X3NA 1VQ7A 4FYDA 2R7DA 2KEDA 1E22A 1MI2A 4DV2Q 1J5EL 3NBIA 1HQRD 2PMZE 2F4IA 5JAVA 4DR7L 3GDEA 1GM5A 4JI8Q 1NBWA 3S16B 2L4NA 4A93B 4FF3A 1QNUA 1KLUD 3GD7A 4DV7L 1HR0W 3L0OA 3C2PA 2RSNA 2OXPA 3I4LA 4KJOA 1K73C 2C5CA 2OCEA 2M9VA 1L2FA 2K5NA 4LK1C 3D4RA 5K36G 2JN4A 3M3YB 1GUWA 5LMNW 2B39A 3ZJYC 3J81c 1XX8A 1I94L 3HOZG 1ZYRC 3Q22A 1HNXL 2XWBB 1IBML 1E2WA 2KOLA 3F8TA 3I4MB 3RN5A 2NN6H 1KAAA 2WKCA 4A3IG 2J7ZA 2L55A 3GV6A 1EYAA 3BS1A 3PUXA 1KTKA 1MSGA 1NY4A 4IURA 2PI2E 1XNQL 2KVMA 1IBKL 1CFMA 3AQQA 1AH9A 3IAYA 2VUMB 4C3HH 4IUQA 2Z9HA 4RKLA 4KHPQ 4L8JA 3HGBA 1Q8KA 4NXMQ 4KMUC 3HOVG 1SAPA 3UDFA 4DAPA 5C4XB 4IALA 3GTQH 5H1SE 2RHQB 3MVVA 4DK3C 4LF5Q 3NK9A 4ZYSA 4M1UB 2MPMA 4OO1I 1K3BC 4OHJA 4CKCA 1A15A 4QF4A 4JPBW 3DWAA 1KRSA 2DN8A 1SNCA 3VYRA 2B2TC 4JOIC 4CJ0B 1HQMC 1F9RA 2PCFB 5IYBH 3GTLH 3C1FA 4DR1Q 1I4XA 1PFSA 4GNXA 3J81j 2EIFA 4H02A 4A3MG 1DJRD 1TWHH 1WCMH 1XJVA 4RG1A 4ZAIA 1JOQA 4BY7B 3P7JA 1BXTA 4OGQC 1A2UA 4DR3Q 2CHBD 4K8JA 4ZKCB 3NXWA 3E9IA 1RF2D 1WYDA 1DOMA 5J3BA 2UUBL 3E5SA 1IL8A 2NVTB 1HA6A 4XYOA 4A3FH 3UDIA 3J81L 2E5LQ 4G7ZC 1SRUA 2Z0SA 1X6OA 5FJ8H 3A56A 4B9XA 3MTSA 2G5DA 1V1PA 1D2BA 1QVFA 3GTKH 1C48A 2K28A 3KDFB 4LUVA 3S14H 5I4DA 4DR5L 1JMCA 5C3XA 2JA8B 5IP7H 3MEHA 5E1FA 4AH6A 4ZRZA 1CKMA 4DV3L 4A3EB 3K0YA 4POGA 1L1OA 5JVG3 1Y1WG 1TS2A 4LFCL 4IUNA 1GKHA 2WAQE 2R92B 4LF7Q 1EYCA 4DUYL 1SNPA 4A3BG 4YHHL 2CH4W 1SBBB 2WAQG 2KCCA 3STBC 1TY0A 2HHHL 1HXYD 1LACA 2UUAL 2F0NA 3KOJA 3S1MB 3Q6SA 3OTOQ 2F0KA 3BVMA 4K0KQ 3RZDH 5E3FA 2K03A 3H94A 3VR6A 4TVAB 2HD3A 4OIJA 4Z9CB 3UDGA 1WOCA 4O0AA 5IWAL 1WTPA 4GKJL 2RDGA 1BOSA 4DXGA 1SMXA 1VQOA 4DAVA 1K83B 5KNBA 4A3LH 4BBRG 2PMZB 4DR7Q 2IHEA 2OT2A 1E3PA 4FVMA 2V4DA 3HOXH 1SLJA 2K5QA 3TP6A 1SE4A 1SDFA 2ZJRA 1EZ8A 2UXCQ 2DNCA 4IO9A 2K32A 2KECA 3K80C 4LUOA 2B2YC 3MAQA 3HOZB 1N36Q 4X3SA 1HFNA 1Q1BA 1U9RA 1YEZA 4XT1B 5FO8B 3WOEA 3A8KE 3EA6A 2Q2HA 1ET6A 3CCEA 1STGA 4DV0L 2KBNA 2D0PA 2FFKB 4B3ML 2IJ0A 3DHQA 2PW7A 2AHOB 4H44C 1VQAA 2E2DC 2WV6D 3S2DB 1VF5C 1I6HB 1HCZA 1TY2A 3HOVB 3A0JA 2A6EC 1HZBA 1VS0A 2K1BA 3QG1A 5T1IA 4DNTB 2K33A 3CP0A 4CKBA 4FF1A 3VA5A 3X3MA 2QILA 3AFQA 4WRDA 1Q3LA 2D9UA 2QKIC 4KY6A 3HKZB 1I5FA 2MO0A 4RHSA 1VQHA 4DK1A 4R8NA 2CFMA 2L5TA 4LUZA 3QOJA 4DFAA 1SYCA 3U58A 1HNZQ 4QMGA 1M4VA 2YYZA 4RCNA 1UWVA 4K5WA 3H6MA 4C3HG 1U5KA 1Z9FA 1DD2A 3T1HQ 2A74C 2VNUD 1U4PA 3CC7A 1JC7A 2N8NA 3DLLA 1ASYA 2B29A 3S17B 1ZXTA 2ZM6L 1HR0Q 4YY3Q 3RN2A 2MFIA 4A3MB 2JA7H 3M4OH 4R4TA 4YCUA 1IHZA 4CJ1B 4DV4Q 3CCQA 1IZ6A 5LMNQ 1VQ5A 1B8AA 3HOWG 4YWMA 3EROA 1WTQA 3GTPB 4IPGA 1IXRA 3A54A 4DR2Q 3TP7A 1RTNA 3QO2A 1TWGB 4DUZQ 2F0JA 4U673 2UU9L 4RGTA 1KDCA 3OMGA 4KTAA 1MD2D 3Q0AA 4K5XA 5GAEC 4LF4L 4LFBL 3HP3A 2YU9B 5JEAJ 5C3EB 1XPUA 1MSHA 4L63B 1N33Q 2IY5B 1YNNC 2MUYA 1PHJA 2KHJA 1RJTA 2K04A 3O13A 4MIUA 4P72A 2JXMB 3TEHB 3GTMH 1S72A 1DGSA 3VR4A 4KN7C 3U4VA 3F2UA 1MKHA 5COYA 1VQ6A 2UXDL 1NJIC 4A3FG 5D3IB 4PMCA 5GAGC 5FJ8G 1CSPA 3QR8A 4X66Q 4FO2A 1JT8A 5IGFA 3R2TA 4LWCA 4ZK9B 3ERQA 3FRPB 2P5ZX 4JYAL 5IP7G 1EY8A 2HUGA 1B44D 4LF8L 2JK8A 1YHQA 4FDBA 3NTIA 4BY1H 3KK7A 4FF2A 5L37A 1VQCA 3SK6A 4KY5A 4NMZA 2BH2A 1NAPA 3GTGH 2RDHA 2M2LA 2NVYH 3BDOA 1D5MC 1YBYA 5C0XH 3I72A 4UY8C 4HAEA 1EFWA 3KLWA 1I4GA 2OTLA 1C4QA 3MFGA 4GNXB 1X54A 1WTVA 2IX3A 4B3SL 3W3AA 3S1NH 1LTGD 3L7ZC 1LTBD 4B3RL 1B1ZA 2AKWB 2B63B 1PFNA 1X3FA 2N55A 3E6ZX 5T1GA 2PQAA 1YI2A 3J7ZC 1KD1C 3I3CA 1ENFA 3OHXC 4QUFA 4JV5Q 1T5XD 5CGKA 4RFBA 4JI6Q 4ZQ3A 4QIWB 2MHVA 4A3LG 4B3TL 2IL8A 1K0SA 1Z47A 2LXJA 4RA8A 5IODA 1PFBA 1YNJC 4A3DG 1FNVA 4DV6L 1V1PB 1TVXA 1I3QB 2GN5A 4U68A 2XIWA 4DV1L 5BR8L 3PO3G 1KDBA 3Q8DA 4JBKA 2DY7A 2F0VA 2YTXA 4OWXB 4G7HC 3T56B 3KYHC 3AB9A 2F0SA 4OX9L 3KLSX 4X3KA 1PZKD 4MNOA 4WORA 5EKKA 1EZ6A 3NQTA 4O42A 1S5CD 1TKWB 1HH2P 4K2KA 2C9OA 2L11A 2EPBA 3CQZH 3ND9A 3PF5A 2EJMA 4JI0L 4JK1C 1IKLA 1TQOA 3URYA 2KHSA 2BE5C 2R93H 1J8IA 4LFAL 3K5OA 5CORA 1I50H 3G7LA 1BF4A 3MHBA 4HJAA 2OQKA 2FMMA 4RHRA 5CV4A 5JOBA 2ZM6Q 1EUJA 1O7IA 2E2HB 2F03A 4GS3A 2FHTA 3EBEA 1EWHA 2EY5A 4G4KA 4K5VA 2F0QA 1JQYD 3HOWB 1YNXA 3J80i 4IFDI 4RGNA 1TWAH 1V9PA 2B2UA 2JA5G 5DEHA 3VYUA 3JAMi 4Q5VA 3H15A 1YIJA 2Z6BA 2PZWA 4X3UA 1VQPA 2SDFA 4GKKL 2JA6H 4XQNA 4A3KH 4AYBE 4K2LA 2B2VA 5FOBB 5JJLA 4JI1L 1VMPA 4DR6Q 5M3MH 2JA7G 1GUNA 3NUCA 1UE5A 4AYBG 1Y69U 4LFBQ 3ONAB 2Z1CA 4X3TA 4PMBA 1II3A 2EDGA 4GNXC 5C3WA 1N9WA 3FKIH 2F0DA 3PUYA 2NTTA 5GQOA 3GTJB 1CK1A 1A62A 1QOHA 2LXKA 1LV9A 1I4RA 5TSSA 4IFDG 1SYDA 5JVH3 2BH8A 3PGZA 1XNRQ 5CR3A 3I55A 2KENA 2PPBC 3RMHA 4LF9Q 4QGUA 3U50C 4DR4L 3GV3A 3D31A 4P2CB 1K8AC 1CI3M 1ICWA 1NCVA 3TBIB 5I2XA 4IPHA 1UNSA 2I46A 3SVMA 2DJFC 1VQ9A 1JE5A 4CDCC 3I4NB 3FMCA 1DONA 2KQ3A 4AQYL 1LT3D 5AJ3Q 2A1AA 1WI5A 3RR5A 5M5WH 3TS0A 3ULPA 1L1OC 1T9HA 1UEBA 1PMRA 1SNOA 4NPSA 3M7GA 4CJ2C 2ZJQA 2PO4A 3KJOA 3CU7A 5E7NA 3M85A 4X6AH 4XQJA 2A8VA 3HEJA 1BBWA 1K8OA 4JI3L 1B4OA 3PCOB 1F2YA 1E1TA 2R3ZA 4EX5A 3K5NA 1EIHA 3EIVA 4KN4C 3T1YL 3RLFA 1CTMA 1QWYA 3D6WA 4B3SQ 2RQXA 5G3LF 1EOVA 4GN4B 2CW0D 4BY1G 4GOPB 1WVLA 3HRZC 1QCBD 3OSOA 2LS01 3NSWA 2F0WA 2NZOA 4A3GH 1W6KA 1HTPA 1IBLL 4K14A 3TRZA 3NPPA 2Q8IB 1AFPA 4A3JG 2RDFA 1TS3A 1JE4A 3RLOA 5D14A 1BCPF 2GVBA 4B3TQ 2EYOA 3K5MA 4A3DB 4X64L 1IKMA 5AFWA 2AUKA 1Q82C 1DOLA 3PO3B 2PW5A 4JC0A 1TS4A 1HZCA 3WDNA 5M3FB 1K0RA 2XSCA 4EQNA 5KNDA 3L9AX 5M5XH 3DEOA 2VQEQ 4MHEA 1LABA 3BZDB 4OX9Q 1V8QA 4ID6A 2L12A 1HJPA 2K14A 3S24A 3TQYA 4XYQA 1OXUA 3HOYG 4ZLTF 1SROA 3D4WA 5CBEE 3S2HB 1JWMD 2WFWA 3E0JA 4GLVB 2L15A 1TIID 4ULLA 1B53A 3PO2H 3FVQA 2BCOA 3S1QB 4JI2Q 5EBCA 2E8GA 4HIOA 2PNHA 3OIPA 5CMDA 2RSOA 2JA5B 4N9PA 4ZUJA 4C2MH 5FLXE 1ILPA 2F0PA 5CBAE 4JI4Q 1HA5A 2LSSA 1YNND 3T13A 1EY4A 1N32Q 2R93G 5IYDH 4OONA 5EPLA 5M5YH 1NMGA 2PQAB 5EBDA 2F4VQ 2E2IB 2NBFA 2WINB 2MO1A 4X65Q 2Q2TA 3VR3A 4JBJA 2VB2X 2QW7A 3N52A 3IRBA 3NWSA 3VA7A 1O7LA 1K9MC 3CCLA 1G6ZA 3M4QA 3G48A 5IGEA 4GOPC 1H9JA 3SHLA 4LF6Q 3MA2B 2EYFA 2CQOA 2EJFC 2K75A 3S15H 1XMQL 4A3KG 1PYSB 3ZYYX 2ZXOA 1VQIA 3KF6B 4HJ7A 4I65A 1ICFB 5M3MG 1CZGA 2E2JH 5GROA 2FINB 2NVQB 2NYZD 3OWEB 3AMUA 5IYCH 4JBMA 1U4LA 1PTOD 3FKIG 5C44G 3IL8A 1C0AA 2DY8A 4C3IB 1RIPA 4P75A 4B08A 1DM0B 1TWCB 3F2BA 1CM9A 3CRKC 4YCVA 1WTOA 1GJXA 1R9TH 2QF7A 4FNFA 4Q0FA 4A4IA 1S5DD 1L0YB 3CAMA 2VB3X 2R7ZG 4CKEA 1KDAA 4X62L 4PG3A 2Q2IA 2CKZB 4C3JG 3HOUH 1NE3A 1TWFH 3A8JE 3KFUA 1CHQD 3TMEA 3DXJC 3J7AF 4MZ9A 4JI3Q 1PYWD 1SJHD 1Q90A 3M7NA 4LNQA 1PH1A 5LMUQ 4BBSH 5C4ZA 1FVIA 1VQGA 4A3CG 1O78A 3BJUA 3AU7A 3G6EA 3QWNA 5HGTA 5FLMH 3GP7A 4JI5Q 3H3VI 1YNJD 5DAUA 3RZOB 3KLRA 3BZCA 1QUQB 4A3JB 1AE2A 3H0GH 4HIMA 1B7YB 4QCLA 5ELCA 1LTSD 3K7AH 5ELDA 4LW1A 4QY7A 1SNMA 1SR3A 2R61A 1RL2A 3Q23A 2F0FA 4LMQD 2EY2A 3HS0C 3A8IE 4GLXA 3S1RH 3I4OA 1CSQA 3GTOH 1CKNA 2JEBI 1J5EQ 3J81i 4PNYA 2RA4A 3AEVA 1YHBA 1U4RA 3K5LA 2ASBA 4QUCA 4A3GG 1U0LA 3KBXA 1WTXA 4DF7A 3NQIA 1D5XC 4DV7Q 2BE5D 1A3VA 2I0QA 1KIXA 3HOYB 1LUZA 2XNAC 3D6CA 4HN7A 1X32A 5E4XA 2JYOA 1E7ZA 5EQ0A 1K3RA 1I94Q 1FNWA 1WFQA 4A3IB 1KABA 3V96A 1HNXQ 1ENCA 1A8VA 2I07B 4POFA 1IBMQ 1FJGL 3SXHA 1Y1VH 1XYIA 2MGSA 1KAWA 3EFXD 5CV5A 1KRTA 2F52A 4IUPA 1JWUD 3MWYW 2CW0C 3M4YA 2JP1A 1JICA 4Y7NB 1UE6A 1JCKB 4DU9A 5JPNC 1XNQQ 1IBKQ 1AEXA 5C4JB 3I73A 2VW9A 3S16H 1QZHA 3D4DA 1QG7A 4A93H 2VS1A 2DNEA 2PYKA 2NZ1D 1K8MA 3PQIA 2NN6G 5EPKA 1PTOB 2Q8RE 4WJ4A 1RD9D 4KI0A 2EVBA 1FGUA 3M3YH 3DUZA 4GN3B 4YWKA 1A3TA 4RMFA 4I7ZC 2WIIB 4NXNL 3NBHB 2NVXB 5J1ZA 1V1OA 3PO2G 3I90A 4BXXH 2DGYA 1SYGA 3I4MH 2EY1A 1DYQA 1Y8OB 1G8ZD 2B8FA 1LT5D 3KUPA 3OPOA 3CD6A 2KCNA 1OO9B 1TU2B 1GHKA 4F88A 3MXNA 1PH2A 1STHA 1ML0D 1S5FD 1I4HA 4KKTA 2VUMH 3A7AB 3KF8B 2EYMA 5ELFA 1PXUA 2VXWA 5IYDG 3C1EA 4R4OA 1SFOB 1STYA 3VDYA 3CPFA 5C4XH 2E76C 1SEBD 2BDNA 3MZ5A 2MNAA 3T53B 2B2VC 2H5XA 3EN2A 4JG2A 2Z8LA 1K28A 2NWGA 1DOKA 2O2LD 5C44B 2Q2UA 2KEEA 2OEOA 3DWQA 2X69A 4O2DA 1CHPD 3ICEA 5I9PA 3NWTA 4JOIA 1O7YA 1ET9A 1E0BA 5IYBG 4F8MA 2UUBQ 3HKSA 3OMCA 3L2PA 3P20A 2LKVA 3FPPA 3BDCA 4P74A 1EIYB 4JI7L 1WCMG 4KJNA 2R7ZB 1PZJD 3FP9A 5NUCA 2UUCL 1B50A 3CRLC 3C3LA 1U4MA 4TKOB 3SGIA 4ZUIA 2A69D 4HSVA 4DR5Q 1KC8C 3ITPA 4C3JB 2EYLA 2ID0A 5FK9C 5IYCG 1STAA 2K5VA 1Y1WB 1SYBA 4L5QA 1D1KA 1X3EA 3J80c 4DV3Q 2XTIA 4KK7A 2CCZA 1XMOL 5C5LA 4XDXA 2F3IA 3W1BA 4LFCQ 4HIKA 1VQKA 5EPJA 1EIGA 4A3BB 2X6GA 1VF7A 4BY7H 1PFMA 2Z4IA 3AYHB 5IGCA 2WAQB 4NP5A 4DUYQ 3SE0A 4YHHQ 3PV0A 3NP8A 4HEDA 4V0BA 1ESFA 1STNA 4DKAC 4KD4A 2HHHQ 2HDMA 2NVTH 3K58A 2UUAQ 2B3GA 2IPKD 4JBWA 3C46A 1E2ZA 1F9SA 3HOUG 3LNNA 1GVPA 1Q46A 5ELBA 1N34L 5CV6A 2WB1E 1KLGD 2RBMA 2RCFA 2ICEC 5DNFA 2KHIA 4BBSG 1VQBA 3E9HA 1RKNA 2WB1G 4BA2I 2B2WA 1PTOC 3G6JB 5IWAQ 4GKJQ 4RAUC 2JA8H 4BBRB 1GUTA 1R4PB 4JW0A 3DM3A 1EQRA 3F2CA 4DAYA 3K7UC 4HMIA 1EYGA 4IPCA 4DK0A 4J1MA 4A3EH 1T5EA 2F0MA 5DM73 2GA4B 4PMWA 3H0GG 4HJ9A 2F0LA 4PQXA 2R92H 1OXVA 2HQEA 2EYPA 1PRTB 1VMCA 1ZEQX 1J6QA 2YV5A 2EQSA 3R3OA 3S1MH 3CCUA 5FLXc 2N78A 2PQEA 4HMJA 4MTNA 2Z6KA 4XIGS 4G7OC 4ME3A 3R8BA 3CCSA 3NTKA 1QZGA 1Y8PB 4DV0Q 4IZ8A 4B3MQ 1E1OA 3HOXG 2HCCA 4DV5L 4R9WA 1Q81C 1JJGA 1K83H 1STEA 1CZWA 4XTCS 2O4XA 2B2YA 4G57A 4CDFC 5IGGA 5JJKA 3SEBA 4ZCKA 1L1OB 3W2DA 3J80L 1H9KA 5K36H 5I6WA 4KV6A 1GUSA 1Y1VG 2MJ8A 4K6DA 3TP8A 2CQAA 3HOZH 1CA5A 5C4HA 4NXNQ 4DV2L 4DXFA 4C3HB 3J7A5 3BYYB 1GUGA 2IW3A 4JI8L 4IN3A 2EXZA 3BU2A 5D65A 3EJIA 1VQJA 1H95A 5C5MA 4HJ8A 1X65A 4XT3B 3GTQB 1R4QB 4A93G 5FKAC 3S2DH 1Y8NB 1SE8A 4CDEC 3HOVH 3D8GA 2JQOA 5FO7B 3MFYA 4TQUS 5A2QL 1AN8A 4DAMA 1Q8IA 1CKNB 1EFID 3KDFA 1M90C 4IFDJ 3I4MG 2F0IA 4ILWA 3PMFA 1P8LA 1TXYA 4KY7A 3RLNA 4QJFA 5IP9H 4RH6A 1YJNA 1JB7A 1JJCB 4HSPA 1K8GA 1EWCA 3GTLB 1OXTA 2UU9Q 4APVA 1XXGA 4NXML 1I6VC 2A6HD 2A73B 2O5JC 4L5SA 4LF4Q 1TWHB 1WTHA 1WCMB 4Y52H 3H3VC 3IFTA 5KGUA 4EQ5A 1EY6A 5FLXL 4LF5L 1PH8A 5C4XG 3PIO3 3S17H 1BR9A 3CCJA 4RCOA 3T51B 1G6PA 2PZUA 4R4CA 1KQSA 4A3MH 3UI2A 4GZYC 2FMCA 3EQLC 1ESRA 1M8AA 1PRTC 2PNRC 4OO1H 2EYHA 2L0CA 4K6LA 5FO9B 3D3RA 3J7AV 1HFGA 4A3FB 2L9HA 3L3OC 1WD1A 3CHBD 3GTPH 1LTLA 1F2MA 2UXDQ 1S5ED 4P73A 3GTKB 3BDLA 1LM0A 1TWGH 1VQEA 3S14B 1BDOA 4DR1L 2E75C 5HGQA 4HR7B 3JC66 4E6IA 2KJXA 3ND8A 3PIOA 3PSIA 1SN8A 2DJGC 3M9BA 1AP0A 3A74A 3NTHA 4N8FA 4K8IA 4NDXA 1HTLD 4JYAQ 2EOTA 1NUCA 4P71A 4WJWA 2YU9H 4LF8Q 5IOCA 5C3EH 1W3SA 5EJWA 5C0XI 3SK5A 2H1EA 4DR3L 1NMFA 3PIPA 2AWNA 2NB0A 1EEFD 1EOTA 2BOSA 4UP9A 2DUDA 5LL6X 2HIVA 2E5LL 4IQZA 3RZDB 4UAIA 1Q1EA 5LL6S 1SE3A 2Y0SE 2AMCB 3TZDA 1VQFA 4B3RQ 1X3GA 4TSSA 4ALPA 2A69C 2Y0SG 1CKOA 2OTJA 3UE0A 2NZHA 4O1NA 1AE3A 2JA8G 1N8RC 4OELB 4BA1I 3M4PA 5C0XG 5CV8A 1EQTA 4IUTA 3FPUB 4BS9A 3J80E 1ZKOA 2XWJB 3HOXB 4LF7L 3I56A 4ZKBB 4CGYB 4UHVA 3JAME 2YTYA 5I2YA 2SEBD 2R92G 4R4QA 5J22A 4F87A 4DV6Q 2A19A 5CV9A 4DV1Q 4PZ6A 5BR8Q 5HURA 3NELA 1BCPC 3OTOL 4A76A 4K0KL 3PUZA 4IUUA 1C9OA 2AQ1B 4FP5D 2G9HD 1EU4A 1JR0D 3WWVA 1Y1VB 1G51A 3LX0A 3RUZA 4H0LC 2HCIA 1H9SA 2B63H 3K81C 1D8LA 3DEPA 4RWSC 3OW2A 2D62A 2TSSA 2N49A 4BWGB 5DM63 2JEAI 1L0XB 5A2QE 3I2ZA 5IGDA 5IIFA 4DPGA 5HY6A 4RGOS 3P1HA 2CWAA 5ELEA 4JI0Q 2CWPA 2RVLA 2ATWA 4DK6C 2UXCL 5IGBA 5BN4A 5A35A 2NTSA 1PVOA 1D1IA 4LFAQ 3DMUA 4GLAC 1AW7A 1F2LA 1OXXK 1JWSD 1I3QH 2RKSA 1N36L 3N6RA 2RF4A 3TDQA 3T4AC 1D7QA 1GD7A 3AFPA 5KIXA 2F0HA 5J39A 4EVOA 4DAYB 1LYLA 4YCWA 3BZKA 4IUVA 4L6TB 3I91A 3LWEA 4WJ3M 1EQQA 1EY5A 4GKKQ 1DXMA 3M4OB 2JA7B 5EKLA 1CT1D 4AYBB 2A68C 1B2TA 4JI1Q 2MP1A 4NKLA 1C8CA 1GHJA 1MIUA 4KKUA 4PZ8A 3HG9A 3A7LA 4C1NK 1VQ4A 1HHVA 1MJCA 1FR3A 2SNSA 3HKZE 2EJGC 4GN5A 1AZQA 2R7FA 5CYUA 2FJ2A 3UE1A 1HNZL 3HKZG 2E2HH 1HUNA 2XVSA 5IP9G 5KYIA 1V1QA 1PH6A 2JA6G 3HOWH 1NNXA 5I9OA 3T1HL 4RGMA 1XTCD 1VQMA 3VYTA 4DR4Q 2IX0A 2C35B 4CHTB 1HR0L 2F0GA 4YY3L 4IOAA 2AWOA 3IFDA 2RHSB 2O5IC 3NE5B 4DV4L 1KL9A 1X3PA 5LMNL 4UP8A 3E0EA 3U9SA 3GTMB 1TS5A 1X3QA 2IX1A 3QOLA 3PF4A 3CXCA 4IJLA 4OO1G 4AQYQ 1XPRA 1G2TA 4J8QA 1S40A 4DR2L 3U9OA 2HQLA 3CMEA 1PH7A 3GTJH 1EL0A 2QCPX 1STBA 4DUZL 1S4ZA 1XWEA 4QB4A 1SJED 4CDDC 3RD4A 2VY3A 2K5HA 1KXLA 3W5OA 3DWPA 2A6HC 2VL6A 2QEJC 3K6OA 1X9NA 5EAYA 1QVCA 1YHAA 3T1YQ 5JPMC 4BY1B 2Y0SB 1N33L 1GUOA 5BN3A 2WP8J 1YITA 5C3EG 5JEAH 5ELOA 3GTGB 1IW7D 1WJJA 2NVYB 3MXUA 4M8AA 5M9OA 3I4NH 3CF5A 1YZ6A 2K5DA 1SMYD 4KHVA 1IBLQ 4ME5A 5BN5A 1S5BD 5IT9E 2F3WA 3CCMA 2UXBL 2B2WC 3R2IA 4I7AA 4UP7A 4L5RC 3S1NB 1HPCA 3VYSA 1BBUA 2ZXRA 4X66L 4X64Q 3MC0B 2K50A 1CA6A 3CPWA 2EZVA 1NR2A 4RKBA 3R93A 5EKIA 3TN2A 1MJEA 2JA9A 2K4KA 3BVZA 2EYJA 2LMCB 3H91A 4KD3A 2XRQD 2FXQA 3K8AA 5JJIA 1OXSC 1CQVA 3TS2A 1O7ZA 3Q24A 2Z6KC 3GQBA 1PH5A 1HNWL 3FHWA 2NN6I 1IYUA 1DCZA 1W2BA 2OF1A 4YWLA 1YVCA 4IPDA 1KNAA 3A55A 4A3DH 1Z6HA 3W1GA 2G9DA 1B70B 5KNCA 3PO3H 1EYDA 2B63G 4JV5L 1UE7A 1LO5D 1MBYA 1LT4D 2VZAA 4QIWE 1NTGA 5M3FH 4JI6L 4HIDA 3CQZB 2QDLA 3NEMA 2JSOA 4OEMB 3MXPA 1HUMA 3I7FA 2AQ2B 1OTCA 1LTTD 3CC4A 2R93B 2F0UA 3LGJA 1I50B 1PZID 4J15A 2KCTA 3NENA 2QEXA 3SDZA 1PRTD 5ELNA 3S2HH 1Q86C 4XXEA 1O80A 3B6YA 3IKJA 2QA4A 1TWAB 3KJPA 2PZTA 4DN4M 2HDLA 5GADC 3OIQA 3S1QH 2ZT9C 1ILQA 2JA6B 1Q12A 4A3KB 1JOOA 2B2UC 3CKIB 3DM1A 2J4XA 3PUWA 4FXKC 4QQBX 1EY9A 1LTID 5M3MB 1C7YA 1PV4A 1XMQQ 2JA5H 1RODA 4IOCA 1Z7TA 3EVQA 4HCSA 1QNKA 4N9TA 2N3SA 4OIKA 4A75A 3OW7A 3FKIB 2K05A 2X6LA 3CCVA 3FDTA 2B2TA 1NSNS 1H9SB 1I4QA 3TREA 1WTWA 4L5TA 3QB3A 4JCVE 3KLSA 1LT6D 3TP5A 2E2IH 1H9MA 4OWTB 2F0OA 3J81E 4H13C 4IJHA 3OYYA 4GOPA 1KHIA 3S9WA 2ZXPA 1VQDA 2VQFL 1BO0A 2ZJPA 1G291 1DZ1A 4IFDH 2CH4A 2YTVA 1TR5A 4JVZA 3A5UA 4FF4A 4X62Q 4DR6L 1QB5D 1LTRD 4TRDA 1SYEA 3K57A 5G3LD 1SXTA 1E24A 2LY7A 1X56A 1ENAA 1UE1A 3VR2A 3WOFA 3JAMc 2GVAA 4LJZC 2NVQH 1FYCA 3RNUA 2K01A 2OWOA 4DGZA 4OWWB 2BDOA 5M5WB 5C6AA 2M00A 1PH9A 4R8IA 3K59A 3CC2A 4C3IH 5LHY1 1XNRL 1TWCH 3TSSA 1PDQA 1BCPD 1Q7YC 1EY0A 1GOZA 4KKSA 1A63A 3PUVA 2XN9C 3SK4A 5EGTA 4LF9L 2AUJD 2UXBQ 2JE6I 1HZAA 1PLFA 1HZ9A 2XGTA 1WD0A 3CW2C 3I8ZA 3FEWX 2L1BA 1UUPA 2JJQA 1RCVD 1BVSA 5FLMG 5JEAG 5JJZA 3UDXA 1SNQA 4A3GB 1D5ZC 1FD7D 1PTOF 3I4NG 1P16A 3ULJA 1SE2A 1VDZA 1BQQT 3OOCA 5AJ3L 4ODGA 1RTOA 2ES2A 3RZOH 1I4PA 3I70A 1FL0A 1EQVA 1MHWC 1L0WA 1HNWQ 4A3JH 2Z4HA 3G4SA 1JB3A 5DLQE 5KYLA 4DNRB 4EQOA 2D0OA 1ZYRD 3P75A 2IHFA 1SNDA 5IE8A 1FJGQ 5M5XB 2IT1A 1VCIA 4EGVA 1SYFA 2KA7A 1D6EC 3K0XA 3SK8A 4B9WA 2E74C 1YJ9A 4FXDA 1IW7C 1VQ8A 1RDPD 1H9RA 3MEFA 1TT2A 2OQ0A 2F0TA 2A68D 1EEID 1SMYC 1FNUA 1Y14B 2CVRA 3V2TA 4DA2A 2N88A 4PV1C 2HIXA 3ER0A 1XPOA 3HOYH 3BVGA 1LLRD 3JAML 2ALYB 3PO2B 1JJ2A 1S3OA 4OXPA 3KF6A 5F2DA 4A3IH 4PZ7A 1QVGA 1UEAB 1EU3A 4NB3A 2VQEL 2K52A 5M3FG 4F7XA 4C2MB 5E4WC 2I5LX 4Y7NH 4C1NI 1EIFA 1VQNA 5K5PA 1I6HH 5C4JH 5ISRA 5M5YB 1CQFA 1QE6A 3E3XA 3CCRA 2B8GA 2ZTEA 5CC4A 3HFZB 2Q8TA 2I5MX 3J7YW 3LWUA 4BXXG 1KNEA 3QIAA 1QJOA 4HCEA 1PTOH 3F1ZA 4ABNA 1FGBD 3GO5A 3F2DA 1CUKA 1BCPB 3T16A 4JI2L 2NVXH 2KCMA 2A5HA 4CBVA 5CV7A 4KHPL 5KRUA 1BNZA 4NW2A 1EWIA 2VUMG 3S15B 1QILA 3TZUA 4HJ5A 1IYVA 3H09A 1IL2A 3VR5A 2E2JB 3V05A 4JI7Q 3U4ZA 4C56C 2VQFQ 4JI4L 2UUCQ 2KUMA 4YIJA 1QUQA 1PA6A 1N32L 2D5DA 4J6HA 4MN3A 2TMPA 1IYJB 5IT9c 1B3AA 2NUCA 1BUVT 2WKDA 5KEEA 4S3SA 1B9NA 4KHZA 1B3QA 1SFOH 2F4VL 2K7VA 4X65L 2RCNA 2D2CC 2ICIA 1XMOQ 1R9TB 1M1KC 2F3VA 3PIP3 1PRTF 2EE1A 1LTAD 2F1MA 1SSOA 2XRSD 4AIMA 5IY0A 1E2VA 5C44H 4UPAA 4DNIA 1BKBA 3KBGA 3STBD 4LF6L 2AQ3B 1ONLA 4HTHA 5I6YA 2ZTDA 3CMAA 3HOUB 1TWFB 3D0FA 2EY6A 1A3UA 4MTKA 5GAHC 1G91A 4UDUC 1BBXC 1MGSA 3A5ZB 1YJWA 1N34Q 2R7ZH 4BBSB 4KLKA 2WB1B 3QJYA 2SNMA 1UAPA 5C0XJ 1RHPA 1F2ZA 4C3JH 4BY7G 1AZPA 1PH3A 1Y1WH 4OL7A 4XQQA 3MXNB
chains in the Genus database with same CATH topology
2SOBA 3H0GB 5D3DA 3SR1A 4C3IG 1HRJA 4EQPA 2R6GA 3K7AB 3NHHA 1EY7A 2F0EA 1G2SA 2ENBA 1WTRA 2WACA 1F77A 1GXDC 1V43A 4H7BA 3S1RB 3GTOB 3HZXA 1F9PA 2J0TD 3BYTB 2BA0A 2H4OA 4V190 1NR4A 2K5WA 1B9MA 2K6AA 1W6JA 3NBHA 1JOKA 4LAAA 3MXGA 1F9QA 2BA1A 4WFN3 4FXGC 2A6ED 2QDBA 1A2TA 5IT9L 3OWFA 2LFNA 3BG3A 2IWHA 1A6XA 1JORA 3KF8A 1J9OA 3X3NA 4FYDA 2KEDA 1MI2A 3NBIA 1HQRD 2F4IA 5JAVA 3S16B 2L4NA 4A93B 4FF3A 1QNUA 1KLUD 3GD7A 3C2PA 2RSNA 2OXPA 3I4LA 4KJOA 2C5CA 2M9VA 4LK1C 5K36G 3D4RA 3M3YB 1GUWA 2B39A 1XX8A 1ZYRC 3Q22A 2XWBB 1E2WA 2KOLA 3I4MB 2NN6H 1KAAA 2WKCA 2J7ZA 2L55A 3GV6A 1EYAA 3BS1A 3PUXA 1KTKA 1MSGA 4IURA 2KVMA 1CFMA 3IAYA 2VUMB 4IUQA 4RKLA 4L8JA 3HGBA 4KMUC 1SAPA 4DAPA 5C4XB 4IALA 3MVVA 3NK9A 4ZYSA 4M1UB 2MPMA 4OO1I 4OHJA 4CKCA 1A15A 4QF4A 3DWAA 2DN8A 1SNCA 3VYRA 2B2TC 4CJ0B 1HQMC 1F9RA 2PCFB 3C1FA 1I4XA 1DJRD 4ZAIA 1JOQA 4BY7B 3P7JA 1BXTA 4OGQC 1A2UA 2CHBD 4K8JA 4ZKCB 3NXWA 1RF2D 1DOMA 3E5SA 1IL8A 2NVTB 1HA6A 4XYOA 3J81L 4G7ZC 3A56A 4B9XA 3MTSA 1V1PA 1D2BA 1C48A 2K28A 5I4DA 5C3XA 2JA8B 3MEHA 5E1FA 4ZRZA 4A3EB 3K0YA 5JVG3 1TS2A 4IUNA 2R92B 1EYCA 1SNPA 1SBBB 2KCCA 1TY0A 1HXYD 1LACA 2F0NA 3S1MB 3Q6SA 2F0KA 3BVMA 5E3FA 2K03A 3H94A 3VR6A 4OIJA 4Z9CB 1WTPA 2RDGA 1BOSA 4DXGA 4DAVA 1K83B 5KNBA 2PMZB 2OT2A 4FVMA 2V4DA 2K5QA 3TP6A 1SE4A 1SDFA 1EZ8A 2DNCA 2K32A 2KECA 2B2YC 3MAQA 3HOZB 4X3SA 1HFNA 1Q1BA 1U9RA 4XT1B 5FO8B 3WOEA 3A8KE 3EA6A 1ET6A 1STGA 2FFKB 2IJ0A 3DHQA 2PW7A 4H44C 2E2DC 2WV6D 3S2DB 1VF5C 1I6HB 1HCZA 1TY2A 3HOVB 2A6EC 5T1IA 2K1BA 3QG1A 4DNTB 2K33A 4CKBA 4FF1A 3X3MA 3VA5A 2QILA 4WRDA 1Q3LA 2D9UA 2QKIC 4KY6A 3HKZB 4RHSA 4DK1A 4R8NA 2L5TA 4DFAA 3QOJA 1SYCA 4QMGA 1M4VA 2YYZA 4RCNA 4K5WA 3H6MA 4C3HG 1DD2A 2A74C 2VNUD 1U4PA 1JC7A 3S17B 1ZXTA 4A3MB 1IHZA 4CJ1B 3EROA 1WTQA 3GTPB 3A54A 3TP7A 1RTNA 3QO2A 1TWGB 2F0JA 4U673 4RGTA 1KDCA 3OMGA 4KTAA 1MD2D 3Q0AA 4K5XA 3HP3A 2YU9B 5JEAJ 5C3EB 1MSHA 4L63B 1YNNC 2MUYA 1RJTA 2K04A 3O13A 4MIUA 2JXMB 3VR4A 4KN7C 3F2UA 5COYA 5D3IB 4PMCA 4FO2A 5IGFA 3R2TA 4ZK9B 3ERQA 3FRPB 1EY8A 2HUGA 1B44D 3NTIA 3KK7A 4FF2A 3SK6A 4KY5A 4NMZA 1NAPA 2RDHA 2M2LA 3BDOA 1D5MC 5C0XH 3I72A 4HAEA 1I4GA 1C4QA 3MFGA 1WTVA 2IX3A 3W3AA 1LTGD 3L7ZC 1LTBD 1B1ZA 2B63B 1PFNA 2N55A 3E6ZX 5T1GA 3I3CA 1ENFA 3OHXC 4QUFA 1T5XD 5CGKA 4RFBA 4ZQ3A 4QIWB 2MHVA 2IL8A 1Z47A 4RA8A 5IODA 1PFBA 1YNJC 1FNVA 1V1PB 1TVXA 1I3QB 4U68A 2XIWA 1KDBA 2DY7A 2F0VA 4G7HC 3T56B 3AB9A 2F0SA 3KLSX 4X3KA 1PZKD 4WORA 5EKKA 1EZ6A 3NQTA 4O42A 1S5CD 1TKWB 4K2KA 2C9OA 2L11A 2EPBA 3ND9A 2EJMA 4JK1C 1IKLA 1TQOA 3URYA 2KHSA 2BE5C 1J8IA 3K5OA 5CORA 3G7LA 1BF4A 3MHBA 2FMMA 4RHRA 5CV4A 5JOBA 2E2HB 2F03A 4K5VA 2FHTA 1EWHA 2EY5A 4G4KA 2F0QA 1JQYD 3HOWB 4IFDI 4RGNA 2B2UA 5DEHA 3VYUA 4Q5VA 2PZWA 4X3UA 2SDFA 4XQNA 4K2LA 2B2VA 5FOBB 1VMPA 1GUNA 3NUCA 1Y69U 3ONAB 2Z1CA 4X3TA 4PMBA 1II3A 2EDGA 5C3WA 2F0DA 3PUYA 2NTTA 3GTJB 1CK1A 1QOHA 1LV9A 1I4RA 5TSSA 4IFDG 1SYDA 5JVH3 5CR3A 2PPBC 3RMHA 3GV3A 3D31A 4P2CB 1CI3M 1ICWA 1NCVA 3TBIB 5I2XA 1UNSA 2I46A 3SVMA 3I4NB 3FMCA 1DONA 2KQ3A 1LT3D 1PMRA 1SNOA 3M7GA 4CJ2C 2PO4A 3CU7A 3M85A 4XQJA 3HEJA 1K8OA 1B4OA 1F2YA 3K5NA 2R3ZA 1EIHA 4KN4C 3RLFA 1CTMA 1QWYA 3D6WA 2RQXA 5G3LF 2CW0D 1WVLA 3HRZC 1QCBD 3OSOA 2LS01 3NSWA 2F0WA 1W6KA 1HTPA 4K14A 3NPPA 2Q8IB 1AFPA 2RDFA 1TS3A 1JE4A 5D14A 1BCPF 2EYOA 3K5MA 4A3DB 1IKMA 5AFWA 2AUKA 1DOLA 3PO3B 2PW5A 1TS4A 3WDNA 5M3FB 2XSCA 4EQNA 5KNDA 3L9AX 3DEOA 4MHEA 1LABA 3BZDB 1V8QA 4ID6A 2L12A 4XYQA 1OXUA 4ZLTF 3D4WA 5CBEE 3S2HB 1JWMD 3E0JA 1TIID 4ULLA 1B53A 3FVQA 2BCOA 3S1QB 5EBCA 3OIPA 5CMDA 2RSOA 2JA5B 4N9PA 4ZUJA 5FLXE 1ILPA 2F0PA 5CBAE 1HA5A 1YNND 3T13A 1EY4A 5EPLA 5EBDA 2E2IB 2NBFA 2WINB 3VR3A 2VB2X 3N52A 3NWSA 3VA7A 1O7LA 1G6ZA 5IGEA 1H9JA 3SHLA 3MA2B 2EYFA 2EJFC 3ZYYX 2ZXOA 4I65A 1CZGA 2FINB 2NVQB 2NYZD 3OWEB 3AMUA 1U4LA 1PTOD 3IL8A 2DY8A 4C3IB 4B08A 1DM0B 1TWCB 1CM9A 3CRKC 1WTOA 1GJXA 2QF7A 4FNFA 4Q0FA 1S5DD 1L0YB 2VB3X 4CKEA 1KDAA 4C3JG 3A8JE 1CHQD 3TMEA 3DXJC 3J7AF 1PYWD 1SJHD 1Q90A 3M7NA 5C4ZA 1O78A 3AU7A 3QWNA 5HGTA 3GP7A 1YNJD 5DAUA 3RZOB 3KLRA 4A3JB 4QCLA 5ELCA 1LTSD 5ELDA 1SNMA 2R61A 3Q23A 2F0FA 4LMQD 2EY2A 3HS0C 3A8IE 2JEBI 4PNYA 2RA4A 1U4RA 3K5LA 4QUCA 3KBXA 1WTXA 4DF7A 3NQIA 1D5XC 2BE5D 1A3VA 3HOYB 2XNAC 3D6CA 4HN7A 1X32A 5E4XA 2JYOA 5EQ0A 1FNWA 4A3IB 1KABA 3V96A 1ENCA 2I07B 3SXHA 1XYIA 2MGSA 3EFXD 5CV5A 4IUPA 1JWUD 2CW0C 3MWYW 3M4YA 2JP1A 1JICA 4Y7NB 1JCKB 4DU9A 5JPNC 1AEXA 5C4JB 3I73A 3D4DA 1QG7A 2DNEA 2PYKA 2NZ1D 1K8MA 2NN6G 5EPKA 1PTOB 2Q8RE 1RD9D 4KI0A 2EVBA 3DUZA 1A3TA 4I7ZC 2WIIB 2NVXB 5J1ZA 1V1OA 3I90A 1SYGA 2EY1A 1DYQA 1Y8OB 1G8ZD 2B8FA 1LT5D 3KUPA 3OPOA 2KCNA 1OO9B 1TU2B 1GHKA 4F88A 3MXNA 1STHA 1ML0D 1S5FD 1I4HA 4KKTA 3A7AB 2EYMA 5ELFA 1PXUA 2VXWA 3C1EA 1SFOB 1STYA 2E76C 1SEBD 2BDNA 3MZ5A 3T53B 2B2VC 2Z8LA 2NWGA 1DOKA 2O2LD 5C44B 2KEEA 2OEOA 3DWQA 2X69A 1CHPD 5I9PA 3NWTA 1O7YA 1ET9A 1E0BA 4F8MA 3OMCA 3P20A 2LKVA 3FPPA 3BDCA 4KJNA 2R7ZB 1PZJD 5NUCA 1B50A 3CRLC 3C3LA 1U4MA 4TKOB 4ZUIA 2A69D 4HSVA 3ITPA 4C3JB 2EYLA 2ID0A 5FK9C 1STAA 1Y1WB 1SYBA 1D1KA 4KK7A 5C5LA 4XDXA 5EPJA 1EIGA 4A3BB 2X6GA 1VF7A 1PFMA 2Z4IA 5IGCA 2WAQB 4NP5A 3SE0A 3PV0A 3NP8A 4HEDA 4V0BA 1ESFA 1STNA 4KD4A 2HDMA 3K58A 2IPKD 4JBWA 3C46A 1E2ZA 1F9SA 3LNNA 5ELBA 5CV6A 1KLGD 2RBMA 2ICEC 5DNFA 1RKNA 4BA2I 2B2WA 1PTOC 3G6JB 4RAUC 4BBRB 1GUTA 1R4PB 4DAYA 4HMIA 4DK0A 4J1MA 1T5EA 2F0MA 5DM73 2GA4B 4PMWA 2F0LA 4PQXA 1OXVA 2HQEA 2EYPA 1PRTB 1VMCA 1ZEQX 3R3OA 2PQEA 4HMJA 4XIGS 4G7OC 3R8BA 3NTKA 1Y8PB 4IZ8A 2HCCA 4R9WA 1STEA 1CZWA 4XTCS 2O4XA 2B2YA 4G57A 5IGGA 3SEBA 5K36H 3W2DA 3J80L 1H9KA 5I6WA 4KV6A 1GUSA 2MJ8A 4K6DA 3TP8A 2CQAA 1CA5A 5C4HA 4DXFA 4C3HB 3BYYB 1GUGA 2IW3A 4IN3A 2EXZA 5D65A 3EJIA 5C5MA 4XT3B 3GTQB 1R4QB 5FKAC 1Y8NB 3D8GA 5FO7B 3MFYA 4TQUS 5A2QL 1AN8A 1Q8IA 1EFID 4IFDJ 2F0IA 4ILWA 3PMFA 4KY7A 4RH6A 4HSPA 1EWCA 3GTLB 1OXTA 1XXGA 1I6VC 2A6HD 2A73B 2O5JC 1TWHB 1WCMB 3H3VC 3IFTA 5KGUA 1EY6A 5FLXL 3PIO3 1BR9A 4RCOA 3T51B 2PZUA 3UI2A 4GZYC 2FMCA 3EQLC 1ESRA 1M8AA 1PRTC 2PNRC 4OO1H 2EYHA 2L0CA 4K6LA 5FO9B 3D3RA 3J7AV 1HFGA 4A3FB 2L9HA 3L3OC 1WD1A 3CHBD 1F2MA 1S5ED 3GTKB 3BDLA 3S14B 1BDOA 2E75C 4HR7B 4E6IA 2KJXA 3ND8A 1AP0A 3NTHA 4K8IA 4NDXA 1HTLD 2EOTA 1NUCA 4WJWA 5IOCA 5EJWA 5C0XI 3SK5A 2H1EA 2AWNA 2NB0A 1EEFD 1EOTA 2BOSA 5LL6X 4IQZA 3RZDB 4UAIA 1Q1EA 5LL6S 1SE3A 3TZDA 4TSSA 2A69C 4O1NA 4BA1I 5C0XG 5CV8A 1EQTA 4IUTA 3FPUB 4BS9A 3J80E 1ZKOA 2XWJB 3HOXB 4ZKBB 4CGYB 3JAME 5I2YA 2SEBD 5J22A 4F87A 5CV9A 5HURA 1BCPC 3PUZA 4IUUA 2AQ1B 4FP5D 2G9HD 1EU4A 1JR0D 1Y1VB 3LX0A 3RUZA 4H0LC 2HCIA 1H9SA 3DEPA 4RWSC 2D62A 2TSSA 4BWGB 5DM63 2JEAI 1L0XB 5A2QE 5IGDA 5IIFA 4RGOS 3P1HA 5ELEA 2RVLA 5IGBA 5BN4A 5A35A 2NTSA 1D1IA 3DMUA 1AW7A 1F2LA 1OXXK 1JWSD 2RKSA 3N6RA 3TDQA 3T4AC 5KIXA 2F0HA 5J39A 4EVOA 4IUVA 4L6TB 3I91A 3LWEA 1EY5A 1DXMA 3M4OB 2JA7B 5EKLA 1CT1D 4AYBB 2A68C 1B2TA 2MP1A 4NKLA 1C8CA 1GHJA 4KKUA 3HG9A 3A7LA 4C1NK 1HHVA 1FR3A 2SNSA 2EJGC 1AZQA 5CYUA 2FJ2A 1HUNA 2XVSA 5KYIA 5I9OA 4RGMA 1XTCD 3VYTA 2IX0A 4CHTB 2F0GA 2AWOA 3IFDA 2O5IC 3NE5B 1X3PA 3U9SA 3GTMB 1TS5A 1X3QA 2IX1A 3QOLA 4OO1G 1G2TA 4J8QA 3U9OA 1EL0A 2QCPX 1STBA 1S4ZA 1XWEA 4QB4A 1SJED 3RD4A 3DWPA 2A6HC 2QEJC 3K6OA 5JPMC 4BY1B 2Y0SB 1GUOA 5BN3A 2WP8J 5JEAH 3GTGB 1IW7D 2NVYB 3MXUA 4M8AA 5M9OA 2K5DA 1SMYD 4KHVA 4ME5A 5BN5A 1S5BD 5IT9E 2F3WA 2B2WC 3R2IA 3S1NB 1HPCA 3VYSA 2ZXRA 3MC0B 1CA6A 2EZVA 1NR2A 4RKBA 3R93A 5EKIA 3TN2A 3BVZA 2EYJA 2LMCB 3H91A 4KD3A 2XRQD 1OXSC 1CQVA 1O7ZA 3Q24A 3GQBA 2NN6I 1IYUA 1DCZA 2OF1A 1KNAA 3A55A 1Z6HA 2G9DA 5KNCA 1EYDA 1LO5D 1MBYA 1LT4D 3CQZB 2JSOA 3MXPA 1HUMA 2AQ2B 1LTTD 2R93B 2F0UA 1I50B 1PZID 3SDZA 1PRTD 4XXEA 1O80A 3IKJA 1TWAB 2PZTA 4DN4M 2HDLA 3OIQA 2ZT9C 1ILQA 2JA6B 1Q12A 4A3KB 1JOOA 2B2UC 3CKIB 3DM1A 2J4XA 3PUWA 4FXKC 1EY9A 1LTID 5M3MB 1RODA 1Z7TA 3EVQA 4HCSA 1QNKA 4N9TA 4OIKA 3OW7A 3FKIB 2K05A 2X6LA 3FDTA 2B2TA 1NSNS 1H9SB 1I4QA 1WTWA 3QB3A 3KLSA 1LT6D 3TP5A 1H9MA 2F0OA 3J81E 4H13C 3S9WA 2ZXPA 1BO0A 1G291 1DZ1A 4IFDH 1TR5A 4FF4A 1QB5D 1LTRD 4TRDA 1SYEA 3K57A 5G3LD 1SXTA 2LY7A 1ENAA 3VR2A 3WOFA 4LJZC 1FYCA 2K01A 4DGZA 2BDOA 5M5WB 5C6AA 2M00A 4R8IA 3K59A 5LHY1 3TSSA 1PDQA 1BCPD 1EY0A 1GOZA 4KKSA 3PUVA 2XN9C 3SK4A 5EGTA 2AUJD 2JE6I 1PLFA 1WD0A 3I8ZA 3FEWX 2L1BA 1UUPA 1RCVD 5JEAG 5JJZA 1SNQA 4A3GB 1D5ZC 1FD7D 1PTOF 1SE2A 1VDZA 1BQQT 3OOCA 4ODGA 1RTOA 1I4PA 3I70A 1EQVA 2Z4HA 1JB3A 5KYLA 4DNRB 4EQOA 1ZYRD 3P75A 1SNDA 5M5XB 2IT1A 1VCIA 4EGVA 1SYFA 2KA7A 1D6EC 3SK8A 4B9WA 2E74C 4FXDA 1IW7C 1RDPD 1H9RA 1TT2A 2F0TA 2A68D 1EEID 1SMYC 1FNUA 2CVRA 3V2TA 4DA2A 2N88A 4PV1C 3BVGA 1LLRD 3JAML 3PO2B 5F2DA 1UEAB 1EU3A 4F7XA 4C2MB 5E4WC 4C1NI 5K5PA 5ISRA 5M5YB 1CQFA 1QE6A 2B8GA 5CC4A 2Q8TA 3J7YW 3LWUA 1KNEA 3QIAA 1QJOA 4HCEA 1PTOH 4ABNA 1FGBD 3GO5A 1BCPB 3T16A 2A5HA 4CBVA 5CV7A 5KRUA 1BNZA 4NW2A 3S15B 1QILA 3TZUA 1IYVA 3H09A 3VR5A 2E2JB 3V05A 4C56C 2KUMA 4YIJA 2D5DA 4J6HA 4MN3A 2TMPA 1B3AA 2NUCA 1BUVT 2WKDA 5KEEA 4S3SA 1B9NA 4KHZA 2K7VA 2D2CC 2ICIA 1R9TB 2F3VA 3PIP3 1PRTF 2EE1A 1LTAD 2F1MA 1SSOA 2XRSD 1E2VA 3KBGA 2AQ3B 1ONLA 4HTHA 5I6YA 3HOUB 1TWFB 2EY6A 1A3UA 1G91A 4UDUC 1BBXC 1MGSA 4BBSB 2WB1B 3QJYA 2SNMA 1UAPA 5C0XJ 1RHPA 1F2ZA 1AZPA 4OL7A 4XQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUQ A;  5EPK A;  2Q8R E;  3I3C A;  5DNF A;  4CJ1 B;  1LV9 A;  4QUF A;  4ZKB B;  3Q6S A;  4ZLT F;  1KNA A;  1HRJ A;  2B2W A;  2K01 A;  1SAP A;  4RAU C;  5E4W C;  2K03 A;  5CBE E;  3I90 A;  3IFD A;  1G2S A;  1WTQ A;  4OIJ A;  2MPM A;  4R8I A;  1X3P A;  1WTR A;  2IL8 A;  3GV3 A;  3KUP A;  4IUU A;  1X3Q A;  1RTN A;  1PDQ A;  3QO2 A;  4RA8 A;  1WTP A;  1PFB A;  1QE6 A;  1A15 A;  1ICW A;  1TVX A;  1B53 A;  4U68 A;  1NCV A;  2XIW A;  2Q8T A;  1F9P A;  1G2T A;  3SVM A;  2HCI A;  1HUM A;  1ML0 D;  5EPJ A;  1KNE A;  1VMC A;  1PLF A;  2DY7 A;  2B2T C;  1EL0 A;  3HP3 A;  1WD0 A;  3DEP A;  3I8Z A;  1NR4 A;  3UI2 A;  4CJ0 B;  1DON A;  2L1B A;  1S4Z A;  4RWS C;  2RSO A;  1ESR A;  1M8A A;  2VXW A;  5CMD A;  1SDF A;  1F9R A;  4X3K A;  1MSH A;  2BDN A;  1ILP A;  2KEC A;  1F9Q A;  4O42 A;  5JJZ A;  1HFG A;  2B2Y C;  5CBA E;  2L9H A;  2B2V C;  3R93 A;  1BNZ A;  4NW2 A;  1WD1 A;  2L11 A;  4X3S A;  1RJT A;  2K04 A;  1HFN A;  2NWG A;  4CJ2 C;  2RVL A;  1DOK A;  1O80 A;  5EKI A;  4XT1 B;  2HCC A;  2KEE A;  2X69 A;  4LMQ D;  5EPL A;  2EPB A;  4R9W A;  4DN4 M;  1O7Y A;  1F2L A;  1B4O A;  1E0B A;  2HDL A;  1RTO A;  2KUM A;  2R3Z A;  3F2U A;  2FFK B;  2RA4 A;  5COY A;  4ZAI A;  1EIH A;  1AP0 A;  1IKL A;  1ILQ A;  1U4R A;  4MN3 A;  3P7J A;  4QUC A;  3D6W A;  1J9O A;  2B2U C;  1J8I A;  1B3A A;  3DM1 A;  2B2Y A;  2KED A;  1MI2 A;  2EOT A;  3KBX A;  5COR A;  4ZKC B;  1WTX A;  3G7L A;  1BF4 A;  3N52 A;  1WVL A;  1B50 A;  1ROD A;  2FMM A;  2B2W C;  5EJW A;  1DOM A;  1G6Z A;  4IUV A;  1U4M A;  1IL8 A;  4HCS A;  1HA6 A;  4ZK9 B;  1QNK A;  2FHT A;  1X32 A;  2H1E A;  2K1B A;  2L4N A;  2MJ8 A;  3I91 A;  3LWE A;  4HSV A;  5E4X A;  5T1I A;  2JYO A;  4OIK A;  1CA5 A;  2HUG A;  5EQ0 A;  2K05 A;  2EE1 A;  2RSN A;  2X6L A;  1SSO A;  3MTS A;  3FDT A;  1Q3L A;  2B2T A;  2D9U A;  1JE4 A;  1EOT A;  2B2U A;  1B2T A;  2K28 A;  2MP1 A;  5D14 A;  1WTW A;  5D65 A;  1CA6 A;  4XDX A;  2FIN B;  1XYI A;  1C8C A;  1GUW A;  2NYZ D;  1IKM A;  1NAP A;  2MGS A;  1NR2 A;  5AFW A;  4IUP A;  1EIG A;  2M2L A;  2X6G A;  1XX8 A;  2CVR A;  2SDF A;  4UAI A;  4X3U A;  1PFM A;  3FPU B;  3MWY W;  4XT3 B;  2JP1 A;  1DOL A;  1JIC A;  3TN2 A;  1U4L A;  1HHV A;  3TZD A;  2B2V A;  4HAE A;  1G91 A;  2KOL A;  2N88 A;  1VMP A;  3H91 A;  3IL8 A;  1AZQ A;  1BBX C;  2J7Z A;  1MGS A;  1BO0 A;  2DY8 A;  2FJ2 A;  4HED A;  1DZ1 A;  1CM9 A;  1O7Z A;  3GV6 A;  3ONA B;  1WTV A;  1HUN A;  2HDM A;  4X3T A;  1U4P A;  1WTO A;  1RHP A;  1MSG A;  3DEO A;  1QG7 A;  4MHE A;  4IUR A;  1AZP A;  1F9S A;  1PFN A;  2N55 A;  2L12 A;  2KVM A;  5T1G A;  1ZXT A;  1EQT A;  4IUT A;  2NZ1 D; 
#chains in the Genus database with same CATH topology
 3G71 A;  2SOB A;  3H0G B;  5D3D A;  1A0I A;  2HT1 A;  3SR1 A;  4C3I G;  4A3C H;  1HRJ A;  2EXD A;  4EQP A;  1ASZ A;  2R6G A;  4R1J A;  4A3B H;  3K7A B;  3NHH A;  1EY7 A;  2F0E A;  1G2S A;  2PI2 A;  1PH4 A;  3ULL A;  2ENB A;  1WTR A;  2WAC A;  1F77 A;  1GXD C;  1V43 A;  4H7B A;  3ERS X;  1PYB A;  3S1R B;  4R4I A;  1GO3 E;  3GTO B;  3HZX A;  4QL5 A;  1F9P A;  2J0T D;  3BYT B;  2BA0 A;  2H4O A;  4N8X 1;  4A3E G;  4V19 0;  2ZTC A;  5LMU L;  1NR4 A;  2K5W A;  1B9M A;  2K6A A;  1W6J A;  1VQL A;  3NBH A;  4JI5 L;  2MQH A;  1JOK A;  2I5H A;  4LAA A;  4DV5 Q;  4BBR H;  3MXG A;  1F9Q A;  2BA1 A;  4WFN 3;  4FXG C;  3H3V H;  2QGQ A;  1XTD A;  2A6E D;  2QDB A;  2V1C C;  1A2T A;  5IT9 L;  3OWF A;  2LFN A;  3BG3 A;  2IWH A;  1X55 A;  1A6X A;  1JOR A;  3KF8 A;  1J9O A;  3X3N A;  1VQ7 A;  4FYD A;  2R7D A;  2KED A;  1E22 A;  1MI2 A;  4DV2 Q;  1J5E L;  3NBI A;  1HQR D;  2PMZ E;  2F4I A;  5JAV A;  4DR7 L;  3GDE A;  1GM5 A;  4JI8 Q;  1NBW A;  3S16 B;  2L4N A;  4A93 B;  4FF3 A;  1QNU A;  1KLU D;  3GD7 A;  4DV7 L;  1HR0 W;  3L0O A;  3C2P A;  2RSN A;  2OXP A;  3I4L A;  4KJO A;  1K73 C;  2C5C A;  2OCE A;  2M9V A;  1L2F A;  2K5N A;  4LK1 C;  3D4R A;  5K36 G;  2JN4 A;  3M3Y B;  1GUW A;  5LMN W;  2B39 A;  3ZJY C;  3J81 c;  1XX8 A;  1I94 L;  3HOZ G;  1ZYR C;  3Q22 A;  1HNX L;  2XWB B;  1IBM L;  1E2W A;  2KOL A;  3F8T A;  3I4M B;  3RN5 A;  2NN6 H;  1KAA A;  2WKC A;  4A3I G;  2J7Z A;  2L55 A;  3GV6 A;  1EYA A;  3BS1 A;  3PUX A;  1KTK A;  1MSG A;  1NY4 A;  4IUR A;  2PI2 E;  1XNQ L;  2KVM A;  1IBK L;  1CFM A;  3AQQ A;  1AH9 A;  3IAY A;  2VUM B;  4C3H H;  4IUQ A;  2Z9H A;  4RKL A;  4KHP Q;  4L8J A;  3HGB A;  1Q8K A;  4NXM Q;  4KMU C;  3HOV G;  1SAP A;  3UDF A;  4DAP A;  5C4X B;  4IAL A;  3GTQ H;  5H1S E;  2RHQ B;  3MVV A;  4DK3 C;  4LF5 Q;  3NK9 A;  4ZYS A;  4M1U B;  2MPM A;  4OO1 I;  1K3B C;  4OHJ A;  4CKC A;  1A15 A;  4QF4 A;  4JPB W;  3DWA A;  1KRS A;  2DN8 A;  1SNC A;  3VYR A;  2B2T C;  4JOI C;  4CJ0 B;  1HQM C;  1F9R A;  2PCF B;  5IYB H;  3GTL H;  3C1F A;  4DR1 Q;  1I4X A;  1PFS A;  4GNX A;  3J81 j;  2EIF A;  4H02 A;  4A3M G;  1DJR D;  1TWH H;  1WCM H;  1XJV A;  4RG1 A;  4ZAI A;  1JOQ A;  4BY7 B;  3P7J A;  1BXT A;  4OGQ C;  1A2U A;  4DR3 Q;  2CHB D;  4K8J A;  4ZKC B;  3NXW A;  3E9I A;  1RF2 D;  1WYD A;  1DOM A;  5J3B A;  2UUB L;  3E5S A;  1IL8 A;  2NVT B;  1HA6 A;  4XYO A;  4A3F H;  3UDI A;  3J81 L;  2E5L Q;  4G7Z C;  1SRU A;  2Z0S A;  1X6O A;  5FJ8 H;  3A56 A;  4B9X A;  3MTS A;  2G5D A;  1V1P A;  1D2B A;  1QVF A;  3GTK H;  1C48 A;  2K28 A;  3KDF B;  4LUV A;  3S14 H;  5I4D A;  4DR5 L;  1JMC A;  5C3X A;  2JA8 B;  5IP7 H;  3MEH A;  5E1F A;  4AH6 A;  4ZRZ A;  1CKM A;  4DV3 L;  4A3E B;  3K0Y A;  4POG A;  1L1O A;  5JVG 3;  1Y1W G;  1TS2 A;  4LFC L;  4IUN A;  1GKH A;  2WAQ E;  2R92 B;  4LF7 Q;  1EYC A;  4DUY L;  1SNP A;  4A3B G;  4YHH L;  2CH4 W;  1SBB B;  2WAQ G;  2KCC A;  3STB C;  1TY0 A;  2HHH L;  1HXY D;  1LAC A;  2UUA L;  2F0N A;  3KOJ A;  3S1M B;  3Q6S A;  3OTO Q;  2F0K A;  3BVM A;  4K0K Q;  3RZD H;  5E3F A;  2K03 A;  3H94 A;  3VR6 A;  4TVA B;  2HD3 A;  4OIJ A;  4Z9C B;  3UDG A;  1WOC A;  4O0A A;  5IWA L;  1WTP A;  4GKJ L;  2RDG A;  1BOS A;  4DXG A;  1SMX A;  1VQO A;  4DAV A;  1K83 B;  5KNB A;  4A3L H;  4BBR G;  2PMZ B;  4DR7 Q;  2IHE A;  2OT2 A;  1E3P A;  4FVM A;  2V4D A;  3HOX H;  1SLJ A;  2K5Q A;  3TP6 A;  1SE4 A;  1SDF A;  2ZJR A;  1EZ8 A;  2UXC Q;  2DNC A;  4IO9 A;  2K32 A;  2KEC A;  3K80 C;  4LUO A;  2B2Y C;  3MAQ A;  3HOZ B;  1N36 Q;  4X3S A;  1HFN A;  1Q1B A;  1U9R A;  1YEZ A;  4XT1 B;  5FO8 B;  3WOE A;  3A8K E;  3EA6 A;  2Q2H A;  1ET6 A;  3CCE A;  1STG A;  4DV0 L;  2KBN A;  2D0P A;  2FFK B;  4B3M L;  2IJ0 A;  3DHQ A;  2PW7 A;  2AHO B;  4H44 C;  1VQA A;  2E2D C;  2WV6 D;  3S2D B;  1VF5 C;  1I6H B;  1HCZ A;  1TY2 A;  3HOV B;  3A0J A;  2A6E C;  1HZB A;  1VS0 A;  2K1B A;  3QG1 A;  5T1I A;  4DNT B;  2K33 A;  3CP0 A;  4CKB A;  4FF1 A;  3VA5 A;  3X3M A;  2QIL A;  3AFQ A;  4WRD A;  1Q3L A;  2D9U A;  2QKI C;  4KY6 A;  3HKZ B;  1I5F A;  2MO0 A;  4RHS A;  1VQH A;  4DK1 A;  4R8N A;  2CFM A;  2L5T A;  4LUZ A;  3QOJ A;  4DFA A;  1SYC A;  3U58 A;  1HNZ Q;  4QMG A;  1M4V A;  2YYZ A;  4RCN A;  1UWV A;  4K5W A;  3H6M A;  4C3H G;  1U5K A;  1Z9F A;  1DD2 A;  3T1H Q;  2A74 C;  2VNU D;  1U4P A;  3CC7 A;  1JC7 A;  2N8N A;  3DLL A;  1ASY A;  2B29 A;  3S17 B;  1ZXT A;  2ZM6 L;  1HR0 Q;  4YY3 Q;  3RN2 A;  2MFI A;  4A3M B;  2JA7 H;  3M4O H;  4R4T A;  4YCU A;  1IHZ A;  4CJ1 B;  4DV4 Q;  3CCQ A;  1IZ6 A;  5LMN Q;  1VQ5 A;  1B8A A;  3HOW G;  4YWM A;  3ERO A;  1WTQ A;  3GTP B;  4IPG A;  1IXR A;  3A54 A;  4DR2 Q;  3TP7 A;  1RTN A;  3QO2 A;  1TWG B;  4DUZ Q;  2F0J A;  4U67 3;  2UU9 L;  4RGT A;  1KDC A;  3OMG A;  4KTA A;  1MD2 D;  3Q0A A;  4K5X A;  5GAE C;  4LF4 L;  4LFB L;  3HP3 A;  2YU9 B;  5JEA J;  5C3E B;  1XPU A;  1MSH A;  4L63 B;  1N33 Q;  2IY5 B;  1YNN C;  2MUY A;  1PHJ A;  2KHJ A;  1RJT A;  2K04 A;  3O13 A;  4MIU A;  4P72 A;  2JXM B;  3TEH B;  3GTM H;  1S72 A;  1DGS A;  3VR4 A;  4KN7 C;  3U4V A;  3F2U A;  1MKH A;  5COY A;  1VQ6 A;  2UXD L;  1NJI C;  4A3F G;  5D3I B;  4PMC A;  5GAG C;  5FJ8 G;  1CSP A;  3QR8 A;  4X66 Q;  4FO2 A;  1JT8 A;  5IGF A;  3R2T A;  4LWC A;  4ZK9 B;  3ERQ A;  3FRP B;  2P5Z X;  4JYA L;  5IP7 G;  1EY8 A;  2HUG A;  1B44 D;  4LF8 L;  2JK8 A;  1YHQ A;  4FDB A;  3NTI A;  4BY1 H;  3KK7 A;  4FF2 A;  5L37 A;  1VQC A;  3SK6 A;  4KY5 A;  4NMZ A;  2BH2 A;  1NAP A;  3GTG H;  2RDH A;  2M2L A;  2NVY H;  3BDO A;  1D5M C;  1YBY A;  5C0X H;  3I72 A;  4UY8 C;  4HAE A;  1EFW A;  3KLW A;  1I4G A;  2OTL A;  1C4Q A;  3MFG A;  4GNX B;  1X54 A;  1WTV A;  2IX3 A;  4B3S L;  3W3A A;  3S1N H;  1LTG D;  3L7Z C;  1LTB D;  4B3R L;  1B1Z A;  2AKW B;  2B63 B;  1PFN A;  1X3F A;  2N55 A;  3E6Z X;  5T1G A;  2PQA A;  1YI2 A;  3J7Z C;  1KD1 C;  3I3C A;  1ENF A;  3OHX C;  4QUF A;  4JV5 Q;  1T5X D;  5CGK A;  4RFB A;  4JI6 Q;  4ZQ3 A;  4QIW B;  2MHV A;  4A3L G;  4B3T L;  2IL8 A;  1K0S A;  1Z47 A;  2LXJ A;  4RA8 A;  5IOD A;  1PFB A;  1YNJ C;  4A3D G;  1FNV A;  4DV6 L;  1V1P B;  1TVX A;  1I3Q B;  2GN5 A;  4U68 A;  2XIW A;  4DV1 L;  5BR8 L;  3PO3 G;  1KDB A;  3Q8D A;  4JBK A;  2DY7 A;  2F0V A;  2YTX A;  4OWX B;  4G7H C;  3T56 B;  3KYH C;  3AB9 A;  2F0S A;  4OX9 L;  3KLS X;  4X3K A;  1PZK D;  4MNO A;  4WOR A;  5EKK A;  1EZ6 A;  3NQT A;  4O42 A;  1S5C D;  1TKW B;  1HH2 P;  4K2K A;  2C9O A;  2L11 A;  2EPB A;  3CQZ H;  3ND9 A;  3PF5 A;  2EJM A;  4JI0 L;  4JK1 C;  1IKL A;  1TQO A;  3URY A;  2KHS A;  2BE5 C;  2R93 H;  1J8I A;  4LFA L;  3K5O A;  5COR A;  1I50 H;  3G7L A;  1BF4 A;  3MHB A;  4HJA A;  2OQK A;  2FMM A;  4RHR A;  5CV4 A;  5JOB A;  2ZM6 Q;  1EUJ A;  1O7I A;  2E2H B;  2F03 A;  4GS3 A;  2FHT A;  3EBE A;  1EWH A;  2EY5 A;  4G4K A;  4K5V A;  2F0Q A;  1JQY D;  3HOW B;  1YNX A;  3J80 i;  4IFD I;  4RGN A;  1TWA H;  1V9P A;  2B2U A;  2JA5 G;  5DEH A;  3VYU A;  3JAM i;  4Q5V A;  3H15 A;  1YIJ A;  2Z6B A;  2PZW A;  4X3U A;  1VQP A;  2SDF A;  4GKK L;  2JA6 H;  4XQN A;  4A3K H;  4AYB E;  4K2L A;  2B2V A;  5FOB B;  5JJL A;  4JI1 L;  1VMP A;  4DR6 Q;  5M3M H;  2JA7 G;  1GUN A;  3NUC A;  1UE5 A;  4AYB G;  1Y69 U;  4LFB Q;  3ONA B;  2Z1C A;  4X3T A;  4PMB A;  1II3 A;  2EDG A;  4GNX C;  5C3W A;  1N9W A;  3FKI H;  2F0D A;  3PUY A;  2NTT A;  5GQO A;  3GTJ B;  1CK1 A;  1A62 A;  1QOH A;  2LXK A;  1LV9 A;  1I4R A;  5TSS A;  4IFD G;  1SYD A;  5JVH 3;  2BH8 A;  3PGZ A;  1XNR Q;  5CR3 A;  3I55 A;  2KEN A;  2PPB C;  3RMH A;  4LF9 Q;  4QGU A;  3U50 C;  4DR4 L;  3GV3 A;  3D31 A;  4P2C B;  1K8A C;  1CI3 M;  1ICW A;  1NCV A;  3TBI B;  5I2X A;  4IPH A;  1UNS A;  2I46 A;  3SVM A;  2DJF C;  1VQ9 A;  1JE5 A;  4CDC C;  3I4N B;  3FMC A;  1DON A;  2KQ3 A;  4AQY L;  1LT3 D;  5AJ3 Q;  2A1A A;  1WI5 A;  3RR5 A;  5M5W H;  3TS0 A;  3ULP A;  1L1O C;  1T9H A;  1UEB A;  1PMR A;  1SNO A;  4NPS A;  3M7G A;  4CJ2 C;  2ZJQ A;  2PO4 A;  3KJO A;  3CU7 A;  5E7N A;  3M85 A;  4X6A H;  4XQJ A;  2A8V A;  3HEJ A;  1BBW A;  1K8O A;  4JI3 L;  1B4O A;  3PCO B;  1F2Y A;  1E1T A;  2R3Z A;  4EX5 A;  3K5N A;  1EIH A;  3EIV A;  4KN4 C;  3T1Y L;  3RLF A;  1CTM A;  1QWY A;  3D6W A;  4B3S Q;  2RQX A;  5G3L F;  1EOV A;  4GN4 B;  2CW0 D;  4BY1 G;  4GOP B;  1WVL A;  3HRZ C;  1QCB D;  3OSO A;  2LS0 1;  3NSW A;  2F0W A;  2NZO A;  4A3G H;  1W6K A;  1HTP A;  1IBL L;  4K14 A;  3TRZ A;  3NPP A;  2Q8I B;  1AFP A;  4A3J G;  2RDF A;  1TS3 A;  1JE4 A;  3RLO A;  5D14 A;  1BCP F;  2GVB A;  4B3T Q;  2EYO A;  3K5M A;  4A3D B;  4X64 L;  1IKM A;  5AFW A;  2AUK A;  1Q82 C;  1DOL A;  3PO3 B;  2PW5 A;  4JC0 A;  1TS4 A;  1HZC A;  3WDN A;  5M3F B;  1K0R A;  2XSC A;  4EQN A;  5KND A;  3L9A X;  5M5X H;  3DEO A;  2VQE Q;  4MHE A;  1LAB A;  3BZD B;  4OX9 Q;  1V8Q A;  4ID6 A;  2L12 A;  1HJP A;  2K14 A;  3S24 A;  3TQY A;  4XYQ A;  1OXU A;  3HOY G;  4ZLT F;  1SRO A;  3D4W A;  5CBE E;  3S2H B;  1JWM D;  2WFW A;  3E0J A;  4GLV B;  2L15 A;  1TII D;  4ULL A;  1B53 A;  3PO2 H;  3FVQ A;  2BCO A;  3S1Q B;  4JI2 Q;  5EBC A;  2E8G A;  4HIO A;  2PNH A;  3OIP A;  5CMD A;  2RSO A;  2JA5 B;  4N9P A;  4ZUJ A;  4C2M H;  5FLX E;  1ILP A;  2F0P A;  5CBA E;  4JI4 Q;  1HA5 A;  2LSS A;  1YNN D;  3T13 A;  1EY4 A;  1N32 Q;  2R93 G;  5IYD H;  4OON A;  5EPL A;  5M5Y H;  1NMG A;  2PQA B;  5EBD A;  2F4V Q;  2E2I B;  2NBF A;  2WIN B;  2MO1 A;  4X65 Q;  2Q2T A;  3VR3 A;  4JBJ A;  2VB2 X;  2QW7 A;  3N52 A;  3IRB A;  3NWS A;  3VA7 A;  1O7L A;  1K9M C;  3CCL A;  1G6Z A;  3M4Q A;  3G48 A;  5IGE A;  4GOP C;  1H9J A;  3SHL A;  4LF6 Q;  3MA2 B;  2EYF A;  2CQO A;  2EJF C;  2K75 A;  3S15 H;  1XMQ L;  4A3K G;  1PYS B;  3ZYY X;  2ZXO A;  1VQI A;  3KF6 B;  4HJ7 A;  4I65 A;  1ICF B;  5M3M G;  1CZG A;  2E2J H;  5GRO A;  2FIN B;  2NVQ B;  2NYZ D;  3OWE B;  3AMU A;  5IYC H;  4JBM A;  1U4L A;  1PTO D;  3FKI G;  5C44 G;  3IL8 A;  1C0A A;  2DY8 A;  4C3I B;  1RIP A;  4P75 A;  4B08 A;  1DM0 B;  1TWC B;  3F2B A;  1CM9 A;  3CRK C;  4YCV A;  1WTO A;  1GJX A;  1R9T H;  2QF7 A;  4FNF A;  4Q0F A;  4A4I A;  1S5D D;  1L0Y B;  3CAM A;  2VB3 X;  2R7Z G;  4CKE A;  1KDA A;  4X62 L;  4PG3 A;  2Q2I A;  2CKZ B;  4C3J G;  3HOU H;  1NE3 A;  1TWF H;  3A8J E;  3KFU A;  1CHQ D;  3TME A;  3DXJ C;  3J7A F;  4MZ9 A;  4JI3 Q;  1PYW D;  1SJH D;  1Q90 A;  3M7N A;  4LNQ A;  1PH1 A;  5LMU Q;  4BBS H;  5C4Z A;  1FVI A;  1VQG A;  4A3C G;  1O78 A;  3BJU A;  3AU7 A;  3G6E A;  3QWN A;  5HGT A;  5FLM H;  3GP7 A;  4JI5 Q;  3H3V I;  1YNJ D;  5DAU A;  3RZO B;  3KLR A;  3BZC A;  1QUQ B;  4A3J B;  1AE2 A;  3H0G H;  4HIM A;  1B7Y B;  4QCL A;  5ELC A;  1LTS D;  3K7A H;  5ELD A;  4LW1 A;  4QY7 A;  1SNM A;  1SR3 A;  2R61 A;  1RL2 A;  3Q23 A;  2F0F A;  4LMQ D;  2EY2 A;  3HS0 C;  3A8I E;  4GLX A;  3S1R H;  3I4O A;  1CSQ A;  3GTO H;  1CKN A;  2JEB I;  1J5E Q;  3J81 i;  4PNY A;  2RA4 A;  3AEV A;  1YHB A;  1U4R A;  3K5L A;  2ASB A;  4QUC A;  4A3G G;  1U0L A;  3KBX A;  1WTX A;  4DF7 A;  3NQI A;  1D5X C;  4DV7 Q;  2BE5 D;  1A3V A;  2I0Q A;  1KIX A;  3HOY B;  1LUZ A;  2XNA C;  3D6C A;  4HN7 A;  1X32 A;  5E4X A;  2JYO A;  1E7Z A;  5EQ0 A;  1K3R A;  1I94 Q;  1FNW A;  1WFQ A;  4A3I B;  1KAB A;  3V96 A;  1HNX Q;  1ENC A;  1A8V A;  2I07 B;  4POF A;  1IBM Q;  1FJG L;  3SXH A;  1Y1V H;  1XYI A;  2MGS A;  1KAW A;  3EFX D;  5CV5 A;  1KRT A;  2F52 A;  4IUP A;  1JWU D;  3MWY W;  2CW0 C;  3M4Y A;  2JP1 A;  1JIC A;  4Y7N B;  1UE6 A;  1JCK B;  4DU9 A;  5JPN C;  1XNQ Q;  1IBK Q;  1AEX A;  5C4J B;  3I73 A;  2VW9 A;  3S16 H;  1QZH A;  3D4D A;  1QG7 A;  4A93 H;  2VS1 A;  2DNE A;  2PYK A;  2NZ1 D;  1K8M A;  3PQI A;  2NN6 G;  5EPK A;  1PTO B;  2Q8R E;  4WJ4 A;  1RD9 D;  4KI0 A;  2EVB A;  1FGU A;  3M3Y H;  3DUZ A;  4GN3 B;  4YWK A;  1A3T A;  4RMF A;  4I7Z C;  2WII B;  4NXN L;  3NBH B;  2NVX B;  5J1Z A;  1V1O A;  3PO2 G;  3I90 A;  4BXX H;  2DGY A;  1SYG A;  3I4M H;  2EY1 A;  1DYQ A;  1Y8O B;  1G8Z D;  2B8F A;  1LT5 D;  3KUP A;  3OPO A;  3CD6 A;  2KCN A;  1OO9 B;  1TU2 B;  1GHK A;  4F88 A;  3MXN A;  1PH2 A;  1STH A;  1ML0 D;  1S5F D;  1I4H A;  4KKT A;  2VUM H;  3A7A B;  3KF8 B;  2EYM A;  5ELF A;  1PXU A;  2VXW A;  5IYD G;  3C1E A;  4R4O A;  1SFO B;  1STY A;  3VDY A;  3CPF A;  5C4X H;  2E76 C;  1SEB D;  2BDN A;  3MZ5 A;  2MNA A;  3T53 B;  2B2V C;  2H5X A;  3EN2 A;  4JG2 A;  2Z8L A;  1K28 A;  2NWG A;  1DOK A;  2O2L D;  5C44 B;  2Q2U A;  2KEE A;  2OEO A;  3DWQ A;  2X69 A;  4O2D A;  1CHP D;  3ICE A;  5I9P A;  3NWT A;  4JOI A;  1O7Y A;  1ET9 A;  1E0B A;  5IYB G;  4F8M A;  2UUB Q;  3HKS A;  3OMC A;  3L2P A;  3P20 A;  2LKV A;  3FPP A;  3BDC A;  4P74 A;  1EIY B;  4JI7 L;  1WCM G;  4KJN A;  2R7Z B;  1PZJ D;  3FP9 A;  5NUC A;  2UUC L;  1B50 A;  3CRL C;  3C3L A;  1U4M A;  4TKO B;  3SGI A;  4ZUI A;  2A69 D;  4HSV A;  4DR5 Q;  1KC8 C;  3ITP A;  4C3J B;  2EYL A;  2ID0 A;  5FK9 C;  5IYC G;  1STA A;  2K5V A;  1Y1W B;  1SYB A;  4L5Q A;  1D1K A;  1X3E A;  3J80 c;  4DV3 Q;  2XTI A;  4KK7 A;  2CCZ A;  1XMO L;  5C5L A;  4XDX A;  2F3I A;  3W1B A;  4LFC Q;  4HIK A;  1VQK A;  5EPJ A;  1EIG A;  4A3B B;  2X6G A;  1VF7 A;  4BY7 H;  1PFM A;  2Z4I A;  3AYH B;  5IGC A;  2WAQ B;  4NP5 A;  4DUY Q;  3SE0 A;  4YHH Q;  3PV0 A;  3NP8 A;  4HED A;  4V0B A;  1ESF A;  1STN A;  4DKA C;  4KD4 A;  2HHH Q;  2HDM A;  2NVT H;  3K58 A;  2UUA Q;  2B3G A;  2IPK D;  4JBW A;  3C46 A;  1E2Z A;  1F9S A;  3HOU G;  3LNN A;  1GVP A;  1Q46 A;  5ELB A;  1N34 L;  5CV6 A;  2WB1 E;  1KLG D;  2RBM A;  2RCF A;  2ICE C;  5DNF A;  2KHI A;  4BBS G;  1VQB A;  3E9H A;  1RKN A;  2WB1 G;  4BA2 I;  2B2W A;  1PTO C;  3G6J B;  5IWA Q;  4GKJ Q;  4RAU C;  2JA8 H;  4BBR B;  1GUT A;  1R4P B;  4JW0 A;  3DM3 A;  1EQR A;  3F2C A;  4DAY A;  3K7U C;  4HMI A;  1EYG A;  4IPC A;  4DK0 A;  4J1M A;  4A3E H;  1T5E A;  2F0M A;  5DM7 3;  2GA4 B;  4PMW A;  3H0G G;  4HJ9 A;  2F0L A;  4PQX A;  2R92 H;  1OXV A;  2HQE A;  2EYP A;  1PRT B;  1VMC A;  1ZEQ X;  1J6Q A;  2YV5 A;  2EQS A;  3R3O A;  3S1M H;  3CCU A;  5FLX c;  2N78 A;  2PQE A;  4HMJ A;  4MTN A;  2Z6K A;  4XIG S;  4G7O C;  4ME3 A;  3R8B A;  3CCS A;  3NTK A;  1QZG A;  1Y8P B;  4DV0 Q;  4IZ8 A;  4B3M Q;  1E1O A;  3HOX G;  2HCC A;  4DV5 L;  4R9W A;  1Q81 C;  1JJG A;  1K83 H;  1STE A;  1CZW A;  4XTC S;  2O4X A;  2B2Y A;  4G57 A;  4CDF C;  5IGG A;  5JJK A;  3SEB A;  4ZCK A;  1L1O B;  3W2D A;  3J80 L;  1H9K A;  5K36 H;  5I6W A;  4KV6 A;  1GUS A;  1Y1V G;  2MJ8 A;  4K6D A;  3TP8 A;  2CQA A;  3HOZ H;  1CA5 A;  5C4H A;  4NXN Q;  4DV2 L;  4DXF A;  4C3H B;  3J7A 5;  3BYY B;  1GUG A;  2IW3 A;  4JI8 L;  4IN3 A;  2EXZ A;  3BU2 A;  5D65 A;  3EJI A;  1VQJ A;  1H95 A;  5C5M A;  4HJ8 A;  1X65 A;  4XT3 B;  3GTQ B;  1R4Q B;  4A93 G;  5FKA C;  3S2D H;  1Y8N B;  1SE8 A;  4CDE C;  3HOV H;  3D8G A;  2JQO A;  5FO7 B;  3MFY A;  4TQU S;  5A2Q L;  1AN8 A;  4DAM A;  1Q8I A;  1CKN B;  1EFI D;  3KDF A;  1M90 C;  4IFD J;  3I4M G;  2F0I A;  4ILW A;  3PMF A;  1P8L A;  1TXY A;  4KY7 A;  3RLN A;  4QJF A;  5IP9 H;  4RH6 A;  1YJN A;  1JB7 A;  1JJC B;  4HSP A;  1K8G A;  1EWC A;  3GTL B;  1OXT A;  2UU9 Q;  4APV A;  1XXG A;  4NXM L;  1I6V C;  2A6H D;  2A73 B;  2O5J C;  4L5S A;  4LF4 Q;  1TWH B;  1WTH A;  1WCM B;  4Y52 H;  3H3V C;  3IFT A;  5KGU A;  4EQ5 A;  1EY6 A;  5FLX L;  4LF5 L;  1PH8 A;  5C4X G;  3PIO 3;  3S17 H;  1BR9 A;  3CCJ A;  4RCO A;  3T51 B;  1G6P A;  2PZU A;  4R4C A;  1KQS A;  4A3M H;  3UI2 A;  4GZY C;  2FMC A;  3EQL C;  1ESR A;  1M8A A;  1PRT C;  2PNR C;  4OO1 H;  2EYH A;  2L0C A;  4K6L A;  5FO9 B;  3D3R A;  3J7A V;  1HFG A;  4A3F B;  2L9H A;  3L3O C;  1WD1 A;  3CHB D;  3GTP H;  1LTL A;  1F2M A;  2UXD Q;  1S5E D;  4P73 A;  3GTK B;  3BDL A;  1LM0 A;  1TWG H;  1VQE A;  3S14 B;  1BDO A;  4DR1 L;  2E75 C;  5HGQ A;  4HR7 B;  3JC6 6;  4E6I A;  2KJX A;  3ND8 A;  3PIO A;  3PSI A;  1SN8 A;  2DJG C;  3M9B A;  1AP0 A;  3A74 A;  3NTH A;  4N8F A;  4K8I A;  4NDX A;  1HTL D;  4JYA Q;  2EOT A;  1NUC A;  4P71 A;  4WJW A;  2YU9 H;  4LF8 Q;  5IOC A;  5C3E H;  1W3S A;  5EJW A;  5C0X I;  3SK5 A;  2H1E A;  4DR3 L;  1NMF A;  3PIP A;  2AWN A;  2NB0 A;  1EEF D;  1EOT A;  2BOS A;  4UP9 A;  2DUD A;  5LL6 X;  2HIV A;  2E5L L;  4IQZ A;  3RZD B;  4UAI A;  1Q1E A;  5LL6 S;  1SE3 A;  2Y0S E;  2AMC B;  3TZD A;  1VQF A;  4B3R Q;  1X3G A;  4TSS A;  4ALP A;  2A69 C;  2Y0S G;  1CKO A;  2OTJ A;  3UE0 A;  2NZH A;  4O1N A;  1AE3 A;  2JA8 G;  1N8R C;  4OEL B;  4BA1 I;  3M4P A;  5C0X G;  5CV8 A;  1EQT A;  4IUT A;  3FPU B;  4BS9 A;  3J80 E;  1ZKO A;  2XWJ B;  3HOX B;  4LF7 L;  3I56 A;  4ZKB B;  4CGY B;  4UHV A;  3JAM E;  2YTY A;  5I2Y A;  2SEB D;  2R92 G;  4R4Q A;  5J22 A;  4F87 A;  4DV6 Q;  2A19 A;  5CV9 A;  4DV1 Q;  4PZ6 A;  5BR8 Q;  5HUR A;  3NEL A;  1BCP C;  3OTO L;  4A76 A;  4K0K L;  3PUZ A;  4IUU A;  1C9O A;  2AQ1 B;  4FP5 D;  2G9H D;  1EU4 A;  1JR0 D;  3WWV A;  1Y1V B;  1G51 A;  3LX0 A;  3RUZ A;  4H0L C;  2HCI A;  1H9S A;  2B63 H;  3K81 C;  1D8L A;  3DEP A;  4RWS C;  3OW2 A;  2D62 A;  2TSS A;  2N49 A;  4BWG B;  5DM6 3;  2JEA I;  1L0X B;  5A2Q E;  3I2Z A;  5IGD A;  5IIF A;  4DPG A;  5HY6 A;  4RGO S;  3P1H A;  2CWA A;  5ELE A;  4JI0 Q;  2CWP A;  2RVL A;  2ATW A;  4DK6 C;  2UXC L;  5IGB A;  5BN4 A;  5A35 A;  2NTS A;  1PVO A;  1D1I A;  4LFA Q;  3DMU A;  4GLA C;  1AW7 A;  1F2L A;  1OXX K;  1JWS D;  1I3Q H;  2RKS A;  1N36 L;  3N6R A;  2RF4 A;  3TDQ A;  3T4A C;  1D7Q A;  1GD7 A;  3AFP A;  5KIX A;  2F0H A;  5J39 A;  4EVO A;  4DAY B;  1LYL A;  4YCW A;  3BZK A;  4IUV A;  4L6T B;  3I91 A;  3LWE A;  4WJ3 M;  1EQQ A;  1EY5 A;  4GKK Q;  1DXM A;  3M4O B;  2JA7 B;  5EKL A;  1CT1 D;  4AYB B;  2A68 C;  1B2T A;  4JI1 Q;  2MP1 A;  4NKL A;  1C8C A;  1GHJ A;  1MIU A;  4KKU A;  4PZ8 A;  3HG9 A;  3A7L A;  4C1N K;  1VQ4 A;  1HHV A;  1MJC A;  1FR3 A;  2SNS A;  3HKZ E;  2EJG C;  4GN5 A;  1AZQ A;  2R7F A;  5CYU A;  2FJ2 A;  3UE1 A;  1HNZ L;  3HKZ G;  2E2H H;  1HUN A;  2XVS A;  5IP9 G;  5KYI A;  1V1Q A;  1PH6 A;  2JA6 G;  3HOW H;  1NNX A;  5I9O A;  3T1H L;  4RGM A;  1XTC D;  1VQM A;  3VYT A;  4DR4 Q;  2IX0 A;  2C35 B;  4CHT B;  1HR0 L;  2F0G A;  4YY3 L;  4IOA A;  2AWO A;  3IFD A;  2RHS B;  2O5I C;  3NE5 B;  4DV4 L;  1KL9 A;  1X3P A;  5LMN L;  4UP8 A;  3E0E A;  3U9S A;  3GTM B;  1TS5 A;  1X3Q A;  2IX1 A;  3QOL A;  3PF4 A;  3CXC A;  4IJL A;  4OO1 G;  4AQY Q;  1XPR A;  1G2T A;  4J8Q A;  1S40 A;  4DR2 L;  3U9O A;  2HQL A;  3CME A;  1PH7 A;  3GTJ H;  1EL0 A;  2QCP X;  1STB A;  4DUZ L;  1S4Z A;  1XWE A;  4QB4 A;  1SJE D;  4CDD C;  3RD4 A;  2VY3 A;  2K5H A;  1KXL A;  3W5O A;  3DWP A;  2A6H C;  2VL6 A;  2QEJ C;  3K6O A;  1X9N A;  5EAY A;  1QVC A;  1YHA A;  3T1Y Q;  5JPM C;  4BY1 B;  2Y0S B;  1N33 L;  1GUO A;  5BN3 A;  2WP8 J;  1YIT A;  5C3E G;  5JEA H;  5ELO A;  3GTG B;  1IW7 D;  1WJJ A;  2NVY B;  3MXU A;  4M8A A;  5M9O A;  3I4N H;  3CF5 A;  1YZ6 A;  2K5D A;  1SMY D;  4KHV A;  1IBL Q;  4ME5 A;  5BN5 A;  1S5B D;  5IT9 E;  2F3W A;  3CCM A;  2UXB L;  2B2W C;  3R2I A;  4I7A A;  4UP7 A;  4L5R C;  3S1N B;  1HPC A;  3VYS A;  1BBU A;  2ZXR A;  4X66 L;  4X64 Q;  3MC0 B;  2K50 A;  1CA6 A;  3CPW A;  2EZV A;  1NR2 A;  4RKB A;  3R93 A;  5EKI A;  3TN2 A;  1MJE A;  2JA9 A;  2K4K A;  3BVZ A;  2EYJ A;  2LMC B;  3H91 A;  4KD3 A;  2XRQ D;  2FXQ A;  3K8A A;  5JJI A;  1OXS C;  1CQV A;  3TS2 A;  1O7Z A;  3Q24 A;  2Z6K C;  3GQB A;  1PH5 A;  1HNW L;  3FHW A;  2NN6 I;  1IYU A;  1DCZ A;  1W2B A;  2OF1 A;  4YWL A;  1YVC A;  4IPD A;  1KNA A;  3A55 A;  4A3D H;  1Z6H A;  3W1G A;  2G9D A;  1B70 B;  5KNC A;  3PO3 H;  1EYD A;  2B63 G;  4JV5 L;  1UE7 A;  1LO5 D;  1MBY A;  1LT4 D;  2VZA A;  4QIW E;  1NTG A;  5M3F H;  4JI6 L;  4HID A;  3CQZ B;  2QDL A;  3NEM A;  2JSO A;  4OEM B;  3MXP A;  1HUM A;  3I7F A;  2AQ2 B;  1OTC A;  1LTT D;  3CC4 A;  2R93 B;  2F0U A;  3LGJ A;  1I50 B;  1PZI D;  4J15 A;  2KCT A;  3NEN A;  2QEX A;  3SDZ A;  1PRT D;  5ELN A;  3S2H H;  1Q86 C;  4XXE A;  1O80 A;  3B6Y A;  3IKJ A;  2QA4 A;  1TWA B;  3KJP A;  2PZT A;  4DN4 M;  2HDL A;  5GAD C;  3OIQ A;  3S1Q H;  2ZT9 C;  1ILQ A;  2JA6 B;  1Q12 A;  4A3K B;  1JOO A;  2B2U C;  3CKI B;  3DM1 A;  2J4X A;  3PUW A;  4FXK C;  4QQB X;  1EY9 A;  1LTI D;  5M3M B;  1C7Y A;  1PV4 A;  1XMQ Q;  2JA5 H;  1ROD A;  4IOC A;  1Z7T A;  3EVQ A;  4HCS A;  1QNK A;  4N9T A;  2N3S A;  4OIK A;  4A75 A;  3OW7 A;  3FKI B;  2K05 A;  2X6L A;  3CCV A;  3FDT A;  2B2T A;  1NSN S;  1H9S B;  1I4Q A;  3TRE A;  1WTW A;  4L5T A;  3QB3 A;  4JCV E;  3KLS A;  1LT6 D;  3TP5 A;  2E2I H;  1H9M A;  4OWT B;  2F0O A;  3J81 E;  4H13 C;  4IJH A;  3OYY A;  4GOP A;  1KHI A;  3S9W A;  2ZXP A;  1VQD A;  2VQF L;  1BO0 A;  2ZJP A;  1G29 1;  1DZ1 A;  4IFD H;  2CH4 A;  2YTV A;  1TR5 A;  4JVZ A;  3A5U A;  4FF4 A;  4X62 Q;  4DR6 L;  1QB5 D;  1LTR D;  4TRD A;  1SYE A;  3K57 A;  5G3L D;  1SXT A;  1E24 A;  2LY7 A;  1X56 A;  1ENA A;  1UE1 A;  3VR2 A;  3WOF A;  3JAM c;  2GVA A;  4LJZ C;  2NVQ H;  1FYC A;  3RNU A;  2K01 A;  2OWO A;  4DGZ A;  4OWW B;  2BDO A;  5M5W B;  5C6A A;  2M00 A;  1PH9 A;  4R8I A;  3K59 A;  3CC2 A;  4C3I H;  5LHY 1;  1XNR L;  1TWC H;  3TSS A;  1PDQ A;  1BCP D;  1Q7Y C;  1EY0 A;  1GOZ A;  4KKS A;  1A63 A;  3PUV A;  2XN9 C;  3SK4 A;  5EGT A;  4LF9 L;  2AUJ D;  2UXB Q;  2JE6 I;  1HZA A;  1PLF A;  1HZ9 A;  2XGT A;  1WD0 A;  3CW2 C;  3I8Z A;  3FEW X;  2L1B A;  1UUP A;  2JJQ A;  1RCV D;  1BVS A;  5FLM G;  5JEA G;  5JJZ A;  3UDX A;  1SNQ A;  4A3G B;  1D5Z C;  1FD7 D;  1PTO F;  3I4N G;  1P16 A;  3ULJ A;  1SE2 A;  1VDZ A;  1BQQ T;  3OOC A;  5AJ3 L;  4ODG A;  1RTO A;  2ES2 A;  3RZO H;  1I4P A;  3I70 A;  1FL0 A;  1EQV A;  1MHW C;  1L0W A;  1HNW Q;  4A3J H;  2Z4H A;  3G4S A;  1JB3 A;  5DLQ E;  5KYL A;  4DNR B;  4EQO A;  2D0O A;  1ZYR D;  3P75 A;  2IHF A;  1SND A;  5IE8 A;  1FJG Q;  5M5X B;  2IT1 A;  1VCI A;  4EGV A;  1SYF A;  2KA7 A;  1D6E C;  3K0X A;  3SK8 A;  4B9W A;  2E74 C;  1YJ9 A;  4FXD A;  1IW7 C;  1VQ8 A;  1RDP D;  1H9R A;  3MEF A;  1TT2 A;  2OQ0 A;  2F0T A;  2A68 D;  1EEI D;  1SMY C;  1FNU A;  1Y14 B;  2CVR A;  3V2T A;  4DA2 A;  2N88 A;  4PV1 C;  2HIX A;  3ER0 A;  1XPO A;  3HOY H;  3BVG A;  1LLR D;  3JAM L;  2ALY B;  3PO2 B;  1JJ2 A;  1S3O A;  4OXP A;  3KF6 A;  5F2D A;  4A3I H;  4PZ7 A;  1QVG A;  1UEA B;  1EU3 A;  4NB3 A;  2VQE L;  2K52 A;  5M3F G;  4F7X A;  4C2M B;  5E4W C;  2I5L X;  4Y7N H;  4C1N I;  1EIF A;  1VQN A;  5K5P A;  1I6H H;  5C4J H;  5ISR A;  5M5Y B;  1CQF A;  1QE6 A;  3E3X A;  3CCR A;  2B8G A;  2ZTE A;  5CC4 A;  3HFZ B;  2Q8T A;  2I5M X;  3J7Y W;  3LWU A;  4BXX G;  1KNE A;  3QIA A;  1QJO A;  4HCE A;  1PTO H;  3F1Z A;  4ABN A;  1FGB D;  3GO5 A;  3F2D A;  1CUK A;  1BCP B;  3T16 A;  4JI2 L;  2NVX H;  2KCM A;  2A5H A;  4CBV A;  5CV7 A;  4KHP L;  5KRU A;  1BNZ A;  4NW2 A;  1EWI A;  2VUM G;  3S15 B;  1QIL A;  3TZU A;  4HJ5 A;  1IYV A;  3H09 A;  1IL2 A;  3VR5 A;  2E2J B;  3V05 A;  4JI7 Q;  3U4Z A;  4C56 C;  2VQF Q;  4JI4 L;  2UUC Q;  2KUM A;  4YIJ A;  1QUQ A;  1PA6 A;  1N32 L;  2D5D A;  4J6H A;  4MN3 A;  2TMP A;  1IYJ B;  5IT9 c;  1B3A A;  2NUC A;  1BUV T;  2WKD A;  5KEE A;  4S3S A;  1B9N A;  4KHZ A;  1B3Q A;  1SFO H;  2F4V L;  2K7V A;  4X65 L;  2RCN A;  2D2C C;  2ICI A;  1XMO Q;  1R9T B;  1M1K C;  2F3V A;  3PIP 3;  1PRT F;  2EE1 A;  1LTA D;  2F1M A;  1SSO A;  2XRS D;  4AIM A;  5IY0 A;  1E2V A;  5C44 H;  4UPA A;  4DNI A;  1BKB A;  3KBG A;  3STB D;  4LF6 L;  2AQ3 B;  1ONL A;  4HTH A;  5I6Y A;  2ZTD A;  3CMA A;  3HOU B;  1TWF B;  3D0F A;  2EY6 A;  1A3U A;  4MTK A;  5GAH C;  1G91 A;  4UDU C;  1BBX C;  1MGS A;  3A5Z B;  1YJW A;  1N34 Q;  2R7Z H;  4BBS B;  4KLK A;  2WB1 B;  3QJY A;  2SNM A;  1UAP A;  5C0X J;  1RHP A;  1F2Z A;  4C3J H;  4BY7 G;  1AZP A;  1PH3 A;  1Y1W H;  4OL7 A;  4XQQ A;  3MXN B; 
#chains in the Genus database with same CATH homology
 2SOB A;  3H0G B;  5D3D A;  3SR1 A;  4C3I G;  1HRJ A;  4EQP A;  2R6G A;  3K7A B;  3NHH A;  1EY7 A;  2F0E A;  1G2S A;  2ENB A;  1WTR A;  2WAC A;  1F77 A;  1GXD C;  1V43 A;  4H7B A;  3S1R B;  3GTO B;  3HZX A;  1F9P A;  2J0T D;  3BYT B;  2BA0 A;  2H4O A;  4V19 0;  1NR4 A;  2K5W A;  1B9M A;  2K6A A;  1W6J A;  3NBH A;  1JOK A;  4LAA A;  3MXG A;  1F9Q A;  2BA1 A;  4WFN 3;  4FXG C;  2A6E D;  2QDB A;  1A2T A;  5IT9 L;  3OWF A;  2LFN A;  3BG3 A;  2IWH A;  1A6X A;  1JOR A;  3KF8 A;  1J9O A;  3X3N A;  4FYD A;  2KED A;  1MI2 A;  3NBI A;  1HQR D;  2F4I A;  5JAV A;  3S16 B;  2L4N A;  4A93 B;  4FF3 A;  1QNU A;  1KLU D;  3GD7 A;  3C2P A;  2RSN A;  2OXP A;  3I4L A;  4KJO A;  2C5C A;  2M9V A;  4LK1 C;  5K36 G;  3D4R A;  3M3Y B;  1GUW A;  2B39 A;  1XX8 A;  1ZYR C;  3Q22 A;  2XWB B;  1E2W A;  2KOL A;  3I4M B;  2NN6 H;  1KAA A;  2WKC A;  2J7Z A;  2L55 A;  3GV6 A;  1EYA A;  3BS1 A;  3PUX A;  1KTK A;  1MSG A;  4IUR A;  2KVM A;  1CFM A;  3IAY A;  2VUM B;  4IUQ A;  4RKL A;  4L8J A;  3HGB A;  4KMU C;  1SAP A;  4DAP A;  5C4X B;  4IAL A;  3MVV A;  3NK9 A;  4ZYS A;  4M1U B;  2MPM A;  4OO1 I;  4OHJ A;  4CKC A;  1A15 A;  4QF4 A;  3DWA A;  2DN8 A;  1SNC A;  3VYR A;  2B2T C;  4CJ0 B;  1HQM C;  1F9R A;  2PCF B;  3C1F A;  1I4X A;  1DJR D;  4ZAI A;  1JOQ A;  4BY7 B;  3P7J A;  1BXT A;  4OGQ C;  1A2U A;  2CHB D;  4K8J A;  4ZKC B;  3NXW A;  1RF2 D;  1DOM A;  3E5S A;  1IL8 A;  2NVT B;  1HA6 A;  4XYO A;  3J81 L;  4G7Z C;  3A56 A;  4B9X A;  3MTS A;  1V1P A;  1D2B A;  1C48 A;  2K28 A;  5I4D A;  5C3X A;  2JA8 B;  3MEH A;  5E1F A;  4ZRZ A;  4A3E B;  3K0Y A;  5JVG 3;  1TS2 A;  4IUN A;  2R92 B;  1EYC A;  1SNP A;  1SBB B;  2KCC A;  1TY0 A;  1HXY D;  1LAC A;  2F0N A;  3S1M B;  3Q6S A;  2F0K A;  3BVM A;  5E3F A;  2K03 A;  3H94 A;  3VR6 A;  4OIJ A;  4Z9C B;  1WTP A;  2RDG A;  1BOS A;  4DXG A;  4DAV A;  1K83 B;  5KNB A;  2PMZ B;  2OT2 A;  4FVM A;  2V4D A;  2K5Q A;  3TP6 A;  1SE4 A;  1SDF A;  1EZ8 A;  2DNC A;  2K32 A;  2KEC A;  2B2Y C;  3MAQ A;  3HOZ B;  4X3S A;  1HFN A;  1Q1B A;  1U9R A;  4XT1 B;  5FO8 B;  3WOE A;  3A8K E;  3EA6 A;  1ET6 A;  1STG A;  2FFK B;  2IJ0 A;  3DHQ A;  2PW7 A;  4H44 C;  2E2D C;  2WV6 D;  3S2D B;  1VF5 C;  1I6H B;  1HCZ A;  1TY2 A;  3HOV B;  2A6E C;  5T1I A;  2K1B A;  3QG1 A;  4DNT B;  2K33 A;  4CKB A;  4FF1 A;  3X3M A;  3VA5 A;  2QIL A;  4WRD A;  1Q3L A;  2D9U A;  2QKI C;  4KY6 A;  3HKZ B;  4RHS A;  4DK1 A;  4R8N A;  2L5T A;  4DFA A;  3QOJ A;  1SYC A;  4QMG A;  1M4V A;  2YYZ A;  4RCN A;  4K5W A;  3H6M A;  4C3H G;  1DD2 A;  2A74 C;  2VNU D;  1U4P A;  1JC7 A;  3S17 B;  1ZXT A;  4A3M B;  1IHZ A;  4CJ1 B;  3ERO A;  1WTQ A;  3GTP B;  3A54 A;  3TP7 A;  1RTN A;  3QO2 A;  1TWG B;  2F0J A;  4U67 3;  4RGT A;  1KDC A;  3OMG A;  4KTA A;  1MD2 D;  3Q0A A;  4K5X A;  3HP3 A;  2YU9 B;  5JEA J;  5C3E B;  1MSH A;  4L63 B;  1YNN C;  2MUY A;  1RJT A;  2K04 A;  3O13 A;  4MIU A;  2JXM B;  3VR4 A;  4KN7 C;  3F2U A;  5COY A;  5D3I B;  4PMC A;  4FO2 A;  5IGF A;  3R2T A;  4ZK9 B;  3ERQ A;  3FRP B;  1EY8 A;  2HUG A;  1B44 D;  3NTI A;  3KK7 A;  4FF2 A;  3SK6 A;  4KY5 A;  4NMZ A;  1NAP A;  2RDH A;  2M2L A;  3BDO A;  1D5M C;  5C0X H;  3I72 A;  4HAE A;  1I4G A;  1C4Q A;  3MFG A;  1WTV A;  2IX3 A;  3W3A A;  1LTG D;  3L7Z C;  1LTB D;  1B1Z A;  2B63 B;  1PFN A;  2N55 A;  3E6Z X;  5T1G A;  3I3C A;  1ENF A;  3OHX C;  4QUF A;  1T5X D;  5CGK A;  4RFB A;  4ZQ3 A;  4QIW B;  2MHV A;  2IL8 A;  1Z47 A;  4RA8 A;  5IOD A;  1PFB A;  1YNJ C;  1FNV A;  1V1P B;  1TVX A;  1I3Q B;  4U68 A;  2XIW A;  1KDB A;  2DY7 A;  2F0V A;  4G7H C;  3T56 B;  3AB9 A;  2F0S A;  3KLS X;  4X3K A;  1PZK D;  4WOR A;  5EKK A;  1EZ6 A;  3NQT A;  4O42 A;  1S5C D;  1TKW B;  4K2K A;  2C9O A;  2L11 A;  2EPB A;  3ND9 A;  2EJM A;  4JK1 C;  1IKL A;  1TQO A;  3URY A;  2KHS A;  2BE5 C;  1J8I A;  3K5O A;  5COR A;  3G7L A;  1BF4 A;  3MHB A;  2FMM A;  4RHR A;  5CV4 A;  5JOB A;  2E2H B;  2F03 A;  4K5V A;  2FHT A;  1EWH A;  2EY5 A;  4G4K A;  2F0Q A;  1JQY D;  3HOW B;  4IFD I;  4RGN A;  2B2U A;  5DEH A;  3VYU A;  4Q5V A;  2PZW A;  4X3U A;  2SDF A;  4XQN A;  4K2L A;  2B2V A;  5FOB B;  1VMP A;  1GUN A;  3NUC A;  1Y69 U;  3ONA B;  2Z1C A;  4X3T A;  4PMB A;  1II3 A;  2EDG A;  5C3W A;  2F0D A;  3PUY A;  2NTT A;  3GTJ B;  1CK1 A;  1QOH A;  1LV9 A;  1I4R A;  5TSS A;  4IFD G;  1SYD A;  5JVH 3;  5CR3 A;  2PPB C;  3RMH A;  3GV3 A;  3D31 A;  4P2C B;  1CI3 M;  1ICW A;  1NCV A;  3TBI B;  5I2X A;  1UNS A;  2I46 A;  3SVM A;  3I4N B;  3FMC A;  1DON A;  2KQ3 A;  1LT3 D;  1PMR A;  1SNO A;  3M7G A;  4CJ2 C;  2PO4 A;  3CU7 A;  3M85 A;  4XQJ A;  3HEJ A;  1K8O A;  1B4O A;  1F2Y A;  3K5N A;  2R3Z A;  1EIH A;  4KN4 C;  3RLF A;  1CTM A;  1QWY A;  3D6W A;  2RQX A;  5G3L F;  2CW0 D;  1WVL A;  3HRZ C;  1QCB D;  3OSO A;  2LS0 1;  3NSW A;  2F0W A;  1W6K A;  1HTP A;  4K14 A;  3NPP A;  2Q8I B;  1AFP A;  2RDF A;  1TS3 A;  1JE4 A;  5D14 A;  1BCP F;  2EYO A;  3K5M A;  4A3D B;  1IKM A;  5AFW A;  2AUK A;  1DOL A;  3PO3 B;  2PW5 A;  1TS4 A;  3WDN A;  5M3F B;  2XSC A;  4EQN A;  5KND A;  3L9A X;  3DEO A;  4MHE A;  1LAB A;  3BZD B;  1V8Q A;  4ID6 A;  2L12 A;  4XYQ A;  1OXU A;  4ZLT F;  3D4W A;  5CBE E;  3S2H B;  1JWM D;  3E0J A;  1TII D;  4ULL A;  1B53 A;  3FVQ A;  2BCO A;  3S1Q B;  5EBC A;  3OIP A;  5CMD A;  2RSO A;  2JA5 B;  4N9P A;  4ZUJ A;  5FLX E;  1ILP A;  2F0P A;  5CBA E;  1HA5 A;  1YNN D;  3T13 A;  1EY4 A;  5EPL A;  5EBD A;  2E2I B;  2NBF A;  2WIN B;  3VR3 A;  2VB2 X;  3N52 A;  3NWS A;  3VA7 A;  1O7L A;  1G6Z A;  5IGE A;  1H9J A;  3SHL A;  3MA2 B;  2EYF A;  2EJF C;  3ZYY X;  2ZXO A;  4I65 A;  1CZG A;  2FIN B;  2NVQ B;  2NYZ D;  3OWE B;  3AMU A;  1U4L A;  1PTO D;  3IL8 A;  2DY8 A;  4C3I B;  4B08 A;  1DM0 B;  1TWC B;  1CM9 A;  3CRK C;  1WTO A;  1GJX A;  2QF7 A;  4FNF A;  4Q0F A;  1S5D D;  1L0Y B;  2VB3 X;  4CKE A;  1KDA A;  4C3J G;  3A8J E;  1CHQ D;  3TME A;  3DXJ C;  3J7A F;  1PYW D;  1SJH D;  1Q90 A;  3M7N A;  5C4Z A;  1O78 A;  3AU7 A;  3QWN A;  5HGT A;  3GP7 A;  1YNJ D;  5DAU A;  3RZO B;  3KLR A;  4A3J B;  4QCL A;  5ELC A;  1LTS D;  5ELD A;  1SNM A;  2R61 A;  3Q23 A;  2F0F A;  4LMQ D;  2EY2 A;  3HS0 C;  3A8I E;  2JEB I;  4PNY A;  2RA4 A;  1U4R A;  3K5L A;  4QUC A;  3KBX A;  1WTX A;  4DF7 A;  3NQI A;  1D5X C;  2BE5 D;  1A3V A;  3HOY B;  2XNA C;  3D6C A;  4HN7 A;  1X32 A;  5E4X A;  2JYO A;  5EQ0 A;  1FNW A;  4A3I B;  1KAB A;  3V96 A;  1ENC A;  2I07 B;  3SXH A;  1XYI A;  2MGS A;  3EFX D;  5CV5 A;  4IUP A;  1JWU D;  2CW0 C;  3MWY W;  3M4Y A;  2JP1 A;  1JIC A;  4Y7N B;  1JCK B;  4DU9 A;  5JPN C;  1AEX A;  5C4J B;  3I73 A;  3D4D A;  1QG7 A;  2DNE A;  2PYK A;  2NZ1 D;  1K8M A;  2NN6 G;  5EPK A;  1PTO B;  2Q8R E;  1RD9 D;  4KI0 A;  2EVB A;  3DUZ A;  1A3T A;  4I7Z C;  2WII B;  2NVX B;  5J1Z A;  1V1O A;  3I90 A;  1SYG A;  2EY1 A;  1DYQ A;  1Y8O B;  1G8Z D;  2B8F A;  1LT5 D;  3KUP A;  3OPO A;  2KCN A;  1OO9 B;  1TU2 B;  1GHK A;  4F88 A;  3MXN A;  1STH A;  1ML0 D;  1S5F D;  1I4H A;  4KKT A;  3A7A B;  2EYM A;  5ELF A;  1PXU A;  2VXW A;  3C1E A;  1SFO B;  1STY A;  2E76 C;  1SEB D;  2BDN A;  3MZ5 A;  3T53 B;  2B2V C;  2Z8L A;  2NWG A;  1DOK A;  2O2L D;  5C44 B;  2KEE A;  2OEO A;  3DWQ A;  2X69 A;  1CHP D;  5I9P A;  3NWT A;  1O7Y A;  1ET9 A;  1E0B A;  4F8M A;  3OMC A;  3P20 A;  2LKV A;  3FPP A;  3BDC A;  4KJN A;  2R7Z B;  1PZJ D;  5NUC A;  1B50 A;  3CRL C;  3C3L A;  1U4M A;  4TKO B;  4ZUI A;  2A69 D;  4HSV A;  3ITP A;  4C3J B;  2EYL A;  2ID0 A;  5FK9 C;  1STA A;  1Y1W B;  1SYB A;  1D1K A;  4KK7 A;  5C5L A;  4XDX A;  5EPJ A;  1EIG A;  4A3B B;  2X6G A;  1VF7 A;  1PFM A;  2Z4I A;  5IGC A;  2WAQ B;  4NP5 A;  3SE0 A;  3PV0 A;  3NP8 A;  4HED A;  4V0B A;  1ESF A;  1STN A;  4KD4 A;  2HDM A;  3K58 A;  2IPK D;  4JBW A;  3C46 A;  1E2Z A;  1F9S A;  3LNN A;  5ELB A;  5CV6 A;  1KLG D;  2RBM A;  2ICE C;  5DNF A;  1RKN A;  4BA2 I;  2B2W A;  1PTO C;  3G6J B;  4RAU C;  4BBR B;  1GUT A;  1R4P B;  4DAY A;  4HMI A;  4DK0 A;  4J1M A;  1T5E A;  2F0M A;  5DM7 3;  2GA4 B;  4PMW A;  2F0L A;  4PQX A;  1OXV A;  2HQE A;  2EYP A;  1PRT B;  1VMC A;  1ZEQ X;  3R3O A;  2PQE A;  4HMJ A;  4XIG S;  4G7O C;  3R8B A;  3NTK A;  1Y8P B;  4IZ8 A;  2HCC A;  4R9W A;  1STE A;  1CZW A;  4XTC S;  2O4X A;  2B2Y A;  4G57 A;  5IGG A;  3SEB A;  5K36 H;  3W2D A;  3J80 L;  1H9K A;  5I6W A;  4KV6 A;  1GUS A;  2MJ8 A;  4K6D A;  3TP8 A;  2CQA A;  1CA5 A;  5C4H A;  4DXF A;  4C3H B;  3BYY B;  1GUG A;  2IW3 A;  4IN3 A;  2EXZ A;  5D65 A;  3EJI A;  5C5M A;  4XT3 B;  3GTQ B;  1R4Q B;  5FKA C;  1Y8N B;  3D8G A;  5FO7 B;  3MFY A;  4TQU S;  5A2Q L;  1AN8 A;  1Q8I A;  1EFI D;  4IFD J;  2F0I A;  4ILW A;  3PMF A;  4KY7 A;  4RH6 A;  4HSP A;  1EWC A;  3GTL B;  1OXT A;  1XXG A;  1I6V C;  2A6H D;  2A73 B;  2O5J C;  1TWH B;  1WCM B;  3H3V C;  3IFT A;  5KGU A;  1EY6 A;  5FLX L;  3PIO 3;  1BR9 A;  4RCO A;  3T51 B;  2PZU A;  3UI2 A;  4GZY C;  2FMC A;  3EQL C;  1ESR A;  1M8A A;  1PRT C;  2PNR C;  4OO1 H;  2EYH A;  2L0C A;  4K6L A;  5FO9 B;  3D3R A;  3J7A V;  1HFG A;  4A3F B;  2L9H A;  3L3O C;  1WD1 A;  3CHB D;  1F2M A;  1S5E D;  3GTK B;  3BDL A;  3S14 B;  1BDO A;  2E75 C;  4HR7 B;  4E6I A;  2KJX A;  3ND8 A;  1AP0 A;  3NTH A;  4K8I A;  4NDX A;  1HTL D;  2EOT A;  1NUC A;  4WJW A;  5IOC A;  5EJW A;  5C0X I;  3SK5 A;  2H1E A;  2AWN A;  2NB0 A;  1EEF D;  1EOT A;  2BOS A;  5LL6 X;  4IQZ A;  3RZD B;  4UAI A;  1Q1E A;  5LL6 S;  1SE3 A;  3TZD A;  4TSS A;  2A69 C;  4O1N A;  4BA1 I;  5C0X G;  5CV8 A;  1EQT A;  4IUT A;  3FPU B;  4BS9 A;  3J80 E;  1ZKO A;  2XWJ B;  3HOX B;  4ZKB B;  4CGY B;  3JAM E;  5I2Y A;  2SEB D;  5J22 A;  4F87 A;  5CV9 A;  5HUR A;  1BCP C;  3PUZ A;  4IUU A;  2AQ1 B;  4FP5 D;  2G9H D;  1EU4 A;  1JR0 D;  1Y1V B;  3LX0 A;  3RUZ A;  4H0L C;  2HCI A;  1H9S A;  3DEP A;  4RWS C;  2D62 A;  2TSS A;  4BWG B;  5DM6 3;  2JEA I;  1L0X B;  5A2Q E;  5IGD A;  5IIF A;  4RGO S;  3P1H A;  5ELE A;  2RVL A;  5IGB A;  5BN4 A;  5A35 A;  2NTS A;  1D1I A;  3DMU A;  1AW7 A;  1F2L A;  1OXX K;  1JWS D;  2RKS A;  3N6R A;  3TDQ A;  3T4A C;  5KIX A;  2F0H A;  5J39 A;  4EVO A;  4IUV A;  4L6T B;  3I91 A;  3LWE A;  1EY5 A;  1DXM A;  3M4O B;  2JA7 B;  5EKL A;  1CT1 D;  4AYB B;  2A68 C;  1B2T A;  2MP1 A;  4NKL A;  1C8C A;  1GHJ A;  4KKU A;  3HG9 A;  3A7L A;  4C1N K;  1HHV A;  1FR3 A;  2SNS A;  2EJG C;  1AZQ A;  5CYU A;  2FJ2 A;  1HUN A;  2XVS A;  5KYI A;  5I9O A;  4RGM A;  1XTC D;  3VYT A;  2IX0 A;  4CHT B;  2F0G A;  2AWO A;  3IFD A;  2O5I C;  3NE5 B;  1X3P A;  3U9S A;  3GTM B;  1TS5 A;  1X3Q A;  2IX1 A;  3QOL A;  4OO1 G;  1G2T A;  4J8Q A;  3U9O A;  1EL0 A;  2QCP X;  1STB A;  1S4Z A;  1XWE A;  4QB4 A;  1SJE D;  3RD4 A;  3DWP A;  2A6H C;  2QEJ C;  3K6O A;  5JPM C;  4BY1 B;  2Y0S B;  1GUO A;  5BN3 A;  2WP8 J;  5JEA H;  3GTG B;  1IW7 D;  2NVY B;  3MXU A;  4M8A A;  5M9O A;  2K5D A;  1SMY D;  4KHV A;  4ME5 A;  5BN5 A;  1S5B D;  5IT9 E;  2F3W A;  2B2W C;  3R2I A;  3S1N B;  1HPC A;  3VYS A;  2ZXR A;  3MC0 B;  1CA6 A;  2EZV A;  1NR2 A;  4RKB A;  3R93 A;  5EKI A;  3TN2 A;  3BVZ A;  2EYJ A;  2LMC B;  3H91 A;  4KD3 A;  2XRQ D;  1OXS C;  1CQV A;  1O7Z A;  3Q24 A;  3GQB A;  2NN6 I;  1IYU A;  1DCZ A;  2OF1 A;  1KNA A;  3A55 A;  1Z6H A;  2G9D A;  5KNC A;  1EYD A;  1LO5 D;  1MBY A;  1LT4 D;  3CQZ B;  2JSO A;  3MXP A;  1HUM A;  2AQ2 B;  1LTT D;  2R93 B;  2F0U A;  1I50 B;  1PZI D;  3SDZ A;  1PRT D;  4XXE A;  1O80 A;  3IKJ A;  1TWA B;  2PZT A;  4DN4 M;  2HDL A;  3OIQ A;  2ZT9 C;  1ILQ A;  2JA6 B;  1Q12 A;  4A3K B;  1JOO A;  2B2U C;  3CKI B;  3DM1 A;  2J4X A;  3PUW A;  4FXK C;  1EY9 A;  1LTI D;  5M3M B;  1ROD A;  1Z7T A;  3EVQ A;  4HCS A;  1QNK A;  4N9T A;  4OIK A;  3OW7 A;  3FKI B;  2K05 A;  2X6L A;  3FDT A;  2B2T A;  1NSN S;  1H9S B;  1I4Q A;  1WTW A;  3QB3 A;  3KLS A;  1LT6 D;  3TP5 A;  1H9M A;  2F0O A;  3J81 E;  4H13 C;  3S9W A;  2ZXP A;  1BO0 A;  1G29 1;  1DZ1 A;  4IFD H;  1TR5 A;  4FF4 A;  1QB5 D;  1LTR D;  4TRD A;  1SYE A;  3K57 A;  5G3L D;  1SXT A;  2LY7 A;  1ENA A;  3VR2 A;  3WOF A;  4LJZ C;  1FYC A;  2K01 A;  4DGZ A;  2BDO A;  5M5W B;  5C6A A;  2M00 A;  4R8I A;  3K59 A;  5LHY 1;  3TSS A;  1PDQ A;  1BCP D;  1EY0 A;  1GOZ A;  4KKS A;  3PUV A;  2XN9 C;  3SK4 A;  5EGT A;  2AUJ D;  2JE6 I;  1PLF A;  1WD0 A;  3I8Z A;  3FEW X;  2L1B A;  1UUP A;  1RCV D;  5JEA G;  5JJZ A;  1SNQ A;  4A3G B;  1D5Z C;  1FD7 D;  1PTO F;  1SE2 A;  1VDZ A;  1BQQ T;  3OOC A;  4ODG A;  1RTO A;  1I4P A;  3I70 A;  1EQV A;  2Z4H A;  1JB3 A;  5KYL A;  4DNR B;  4EQO A;  1ZYR D;  3P75 A;  1SND A;  5M5X B;  2IT1 A;  1VCI A;  4EGV A;  1SYF A;  2KA7 A;  1D6E C;  3SK8 A;  4B9W A;  2E74 C;  4FXD A;  1IW7 C;  1RDP D;  1H9R A;  1TT2 A;  2F0T A;  2A68 D;  1EEI D;  1SMY C;  1FNU A;  2CVR A;  3V2T A;  4DA2 A;  2N88 A;  4PV1 C;  3BVG A;  1LLR D;  3JAM L;  3PO2 B;  5F2D A;  1UEA B;  1EU3 A;  4F7X A;  4C2M B;  5E4W C;  4C1N I;  5K5P A;  5ISR A;  5M5Y B;  1CQF A;  1QE6 A;  2B8G A;  5CC4 A;  2Q8T A;  3J7Y W;  3LWU A;  1KNE A;  3QIA A;  1QJO A;  4HCE A;  1PTO H;  4ABN A;  1FGB D;  3GO5 A;  1BCP B;  3T16 A;  2A5H A;  4CBV A;  5CV7 A;  5KRU A;  1BNZ A;  4NW2 A;  3S15 B;  1QIL A;  3TZU A;  1IYV A;  3H09 A;  3VR5 A;  2E2J B;  3V05 A;  4C56 C;  2KUM A;  4YIJ A;  2D5D A;  4J6H A;  4MN3 A;  2TMP A;  1B3A A;  2NUC A;  1BUV T;  2WKD A;  5KEE A;  4S3S A;  1B9N A;  4KHZ A;  2K7V A;  2D2C C;  2ICI A;  1R9T B;  2F3V A;  3PIP 3;  1PRT F;  2EE1 A;  1LTA D;  2F1M A;  1SSO A;  2XRS D;  1E2V A;  3KBG A;  2AQ3 B;  1ONL A;  4HTH A;  5I6Y A;  3HOU B;  1TWF B;  2EY6 A;  1A3U A;  1G91 A;  4UDU C;  1BBX C;  1MGS A;  4BBS B;  2WB1 B;  3QJY A;  2SNM A;  1UAP A;  5C0X J;  1RHP A;  1F2Z A;  1AZP A;  4OL7 A;  4XQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...