2R47A

Crystal structure of mth_862 protein of unknown function from methanothermobacter thermautotrophicus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
154
Chain Sequence
GHMEKLKEFRGIKEHLGVFREAVKDAERIGFAGVPGVTPFAQLFAYAVRDKDNIFIPNTDFSKARKLEVTEYGVELGEISPGNVDVLVLLGGLSMPGIGSDIEDVKKLVEDALEEGGELMGLCYMDMFARAGWYELLDFDCVINADIDGYVLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MTH_862 protein of unknown function from Methanothermobacter thermautotrophicus.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein MTH_862
total genus 46
structure length 154
sequence length 155
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09897 DUF2124 Uncharacterized protein conserved in archaea (DUF2124)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r47A01
4Y9TA 4EVSA 1JYFA 2O20A 4YGXB 2E4XA 3CNBA 1NY5A 4XLTA 1P6QA 5IEJA 1KMIY 5T3YA 2RJOA 1TLFA 3FDFA 3RH0A 5BRJA 3EQ2A 4H60A 3GL9A 5FBKA 2QSJA 1TJYA 4D74A 2NZUG 3VNAA 2FW0A 3F6CA 3GWGA 1ZGZA 2JCGA 3UKJA 1OXKB 3TD9A 4HYEA 3Q7RA 3UUGA 4XASA 3FFTA 1JL3A 2DRIA 5KWSA 3GT7A 4QYWA 1PNTA 4YWHA 4S04A 5GQSA 3MIZA 3ROTA 2ID7A 2WB4A 3I5AA 5EWLA 3RVNA 1TMYA 3H1GA 4RWEA 1GUBA 1K68A 2JBAA 1EHCA 1U04A 2L18A 2TMYA 3H1EA 3JS5A 4JB0A 4MS1B 1E6KA 4MS4B 5TPWB 2A9OA 3LTEA 5JNUA 3LUJA 4DQDA 1ZVVA 5BR1A 5C5CA 3K4HA 4O1IA 3KKEA 2WWVD 3E3MA 4MS3B 1Z2DA 3G1WA 3N0XA 3KTOA 4LDAA 3KG2A 4TMYA 4EY3A 5BRAA 1NXVA 5JS2A 5HKOA 1NXXA 4Z4CA 4RK6A 2FN8A 3HUTA 4RK7A 2QW1A 4G97A 4TLLB 4DADA 1DP4A 1PEAA 4OATA 1JHZA 3P9YA 2A9QA 1YTUA 4FE4A 2FMFA 3M6MD 4TLMB 5HQJA 3Q41A 4LE1A 4F12A 1Z2EA 3N0RA 5TQJA 4MR9B 3RVJA 1JBEA 2FQXA 4YLEA 3OQMA 3OQOA 1BDIA 1WETA 4IMIB 2FMKA 4Q6WA 2AYZA 1RNLA 3R0JA 2L17A 1EWKA 2YHAA 5C5EA 4Z4GA 2CWDA 4EYOA 1DBQA 3JVDA 2WY2D 1RZRD 4PE5B 4G86A 2VYCA 2ZAYA 2JB9A 4QYMA 1QNLA 5JNWA 3LUGA 4W5TA 5EWJA 3C3KA 3LUKA 2RJNA 2HQOA 2HSGA 5KQPA 5TPZA 1E2BA 5KI6A 3T38A 1B00A 3QEMA 2NUBA 2OENG 4Z4EA 1GUDA 4G0QA 3I09A 5FWXB 3NNSA 4ETMA 3N53A 5TE9A 2E4ZA 5CNKA 1U8TA 1EWTA 3VNBA 1XWWA 4NCBA 3CZCA 4TN5A 4Z4FA 1Y1LA 4RZSA 2JK1A 4M88A 5JNVA 3DZDA 4MS4A 2QR3A 1DCKA 1NXTA 1NXPA 3A0UA 1TVMA 3N8IA 1SRRA 4G0OA 4KFCA 5JS1A 4IF4A 6CHYA 5CHYA 1YK1A 3Q9SA 5B3JA 1DCFA 2XDYA 5DKFA 3RVQA 1TM2A 4XARA 3RVSA 1LBIA 4E7OA 2FEPA 3DGFC 3GBPA 4MRMB 3OLVA 3NNNA 4EYQA 1D4ZA 1M5TA 1ZH4A 1ZESA 1DRKA 2FMIA 2HQRA 2RGYA 3I42A 3H5VA 4ZYLA 3JY6A 1Z17A 1ZN2A 2FMHA 1BAPA 4PYRA 2W42A 1JF8A 3F7NA 3JPYA 1NATA 1JFTA 2MYTA 2PL9A 3KYJB 4Q7EA 1H9CA 1K66A 1SXGA 2LUOA 3H5LA 2QVGA 4JAVC 3IPCA 3OLWA 4MYRA 3TMYA 2E4UA 1A04A 3LUHA 3EULA 4L85A 4WWHA 2MYPA 4WUTA 4KV7A 4RU1A 2FVYA 2JVKA 4MAAA 4CBVA 1VRVA 1ABFA 3A10A 1HEYA 4KK3A 4KQCA 4KQ9A 3RVPA 3W9SA 2WJAA 3N6VA 1D1PA 3CG4A 3O2JA 1T34A 4PICA 3CRNA 3BRQA 4N41A 1QQAA 3HUUA 5DTEA 2PL1A 3HDGA 1YMVA 3LMKA 4OTZA 5E3JA 2P9HA 3H75A 4RK5A 3QLUA 3CFYA 2PUAA 3M9WA 3SQNA 3GYBA 3C3WA 1Z16A 4MR8B 3Q7TA 3CHYA 3HEBA 5TQ2A 3F73A 1OXBB 4PZ0A 5GOTA 1VPWA 4RXMA 4NCAA 1CEYA 1EWVA 4O5AA 1D2AA 4RXUA 4JOQA 2J48A 4MPTA 4OLBA 2A9PA 4WXMA 5IULC 1MB0A 2FTKE 1M2FA 3K9CA 2CHEA 1J56A 4HNRA 3IPAA 1P6UA 4YR7A 3CLKA 3Q7SA 5F64A 3HDVA 3KJXA 2LPMA 2IYNA 4MR9A 3L6UA 3L49A 3QEKA 1A0OA 5DCLA 3CKMA 1QO0D 2FN9A 2L19A 2KYRA 3M9XA 4MQEB 3ILHA 1MB3A 5FBHA 1E6LA 1W25A 4JB2A 2VUIB 1AB6A 3IP6A 4D6XA 4ETNA 3D02A 1QPZA 2FQWA 4EYKA 2N9UA 2CD7A 4ZMRA 1ISRA 3MMNA 4Z4HA 3KLNA 3HVRA 2GBPA 4LE2A 1DC8A 2IDMA 4Z0NA 4XAQA 2CHFA 4KPYA 3LKVA 5CNIA 4YV7A 3O1HB 1Z26A 3H6HA 4IRXA 1DBWA 3B2NA 2LIVA 3BILA 2HJ9A 5EWMA 2PLNA 4KVFA 1BDJA 4LE0A 4MQFB 1DG9A 4O1HA 2FKAA 1ZY2A 3IP9A 3QELA 4WXEA 3ROFA 2B4AA 3KHTA 4P1ZA 3QLTA 3RVKA 3EODA 3QEMB 3O2QB 5KC8A 2MSLA 3CG0A 4ZMSA 3HJFA 2IOYA 4IILA 3E61A 3UK0A 2QVCA 3H6GA 4LX8A 2FLKA 5IUNC 5PNTA 4RSMA 3G85A 2B1JA 2R4QA 4KNYA 3D8UA 1GCAA 4H3HB 3BREA 3KLOA 1LJUA 2BGGA 1KGSA 2FEWB 1DBPA 2F8TA 1D1QA 1QMPA 4N47A 3MM4A 1NTRA 3NNDA 1AB5A 2FSPA 3QLVA 5KQGA 2YHBA 4MGEA 1JFSA 4RS3A 5ED4A 2ZWMA 3URMA 3O1JC 2GX6A 3DLBA 3HZHA 2IKSA 1ISSA 2R48A 4P98A 4PEVA 3TX6A 1L5ZA 3SAJA 2VUHB 2PUGA 4N03A 4Q6BA 2I6FA 2IPAB 1APBA 5TQ0A 5KQLA 1YS6A 4MQEA 3IP7A 2Q5CA 2IPLA 3CTPA 5CNJA 1PNRA 3MA0A 4EYGA 2PUFA 1YS7A 3T95A 3GBVA 4XXHA 3HO1A 1Z13A 5IEBA 3C6QA 5D2CA 4WZZA 4RY9A 2NT4A 3GV0A 4YP9A 4UHKA 3MF4A 4RY0A 4JA2A 1W9HA 4WT7A 3SNKA 4W5QA 2JBAB 1JFVA 5FWXA 4Z99A 4N0QA 3OO0A 1KRWA 1RXEA 5FWYA 3JVIA 2PJUA 3HV2A 3C3MA 1FFGA 3HK2A 4MR8A 4W5OA 2WJWA 5BQ3A 2HPHA 5IC5A 1E6MA 4F11A 3N0WA 1M5UA 3JPWA 5FWYB 5IUJC 2E4VA 3HXMA 4DN6A 1QP7A 1FFWA 1LJLA 1QO0A 4N0PA 1PHRA 1YVUA 5JNSA 2ID9A 1Z12A 4LRQA 4JP1A 4RXTA 2WRZA 2PKXA 1DZ3A 3HS3A 1ZGGA 3H5OA 3OMXA 1JWLA 3KSMA 1XHEA 2FLWA 4KREA 4EVRA 1QKKA 2E4WA 4RK4A 2JRLA 3RVLA 4ML3A 3GA5A 4MRMA 1F51E 5TQ2B 4MR7A 4Z9BA 2MSKA 3KYIB 9ABPA 3DLHA 1ZDMA 2GWRA 1DJMA 1LK0A 4FE7A 1GCGA 3EDCA 1FSPA 1KRXA 3LKBA 4QICA 3BBLA 4MS3A 2QV0A 5I4CA 3HM9A 3EAFA 3OQNA 3ILYA 1QQBA 5JNRA 4RDCA 1PEYA 3QK7A 3EJWA 4KRFA 1MIHA 2GI4A 1M2EA 1YIOA 2RDMA 1USGA 3SY8A 4YS6A 4NV3A 4XFKA 2HQBA 2AYXA 3IP5A 1FQWA 2E4YA 1PUXA 1P8AA 5T7BA 4H3KB 4NICA 5EWLB 4W5NA 1SXIA 4NQRA 5TQ0B 5HM6A 2PE5A 1Z18A 4MR7B 3EGCA 3O74A 3KCNA 3NHMA 5B3JC 3EQZA 4MQFA 3C97A 1RXIA 3OM1A 5IX8A 1ZH2A 4OLAA 2PUBA 4F06A 1GLGA 3T6KA 1CYEA 1UDRA 4Z9AA 2PUEA 3QLVC 4RKQA 3LUFA 3RVMA 2R47A 2V0NA 4YO7A 3NHZA 3DGEC 3FFXA 3H1FA 3MYYA 4OG2A 2PAFA 1I3CA 3OLXA 4G0MA 3A0RB 4MLCA 1Z25A 3SG0A 4LDZA 4YRZA 1JYEA 1YMUA 4Z4IA 2NZVG 5HSGA 1NXSA 1YK0A 4GPAA 2MSWA 3MQ4A 4F8JA 4MLDA 5IUKC 2LP4Y 1ZITA 2IPMA 4RKRA 3DBIA 1BA2A 1ZHHA 4QPJC 4RV5A 4RK0A 1SD5A 5KQMA 1VKRA 1NXWA 3RQIA 4G0XA 4L4UA 2JVJA 4G0PA 1FFSA 5EWMB 3GRCA 3NBMA 1SXHA 6ABPA 1BDHA 3F6PA 2H3HA 2IPNA 3LFTA 4FB4A 1RZRA 4F3TA 1IIBA 2FEKA 3CS3A 1QP0A 2PUDA 1U2QA 3JTEA 3OLZA 3TB6A 3CU5A 2L2QA 1U2PA 3FGZA 3SM9A 5JNTA 3LOPA 2R25B 3BRSA 1ABEA 3H5TA 5KC9A 4LZLA 4G0ZA 3RVRA 2OQRA 3QX8A 3Q15C 4S05A 3I45A 3OM0A 3O75A 3FFWA 4ZJPA 1BVHA 4IMJB 5DGCA 4E7PA 4ETIA 2QZJA 4EUKA 3H5WA 2QU7A 2JVIA 1USKA 8ABPA 5TPWA 4GNRA 4W5RA 4MS1A 1U0SY 3RVOA 1D5WA 1JH9A 3H5IA 3O2SB 4EGSA 4N76A 1C0EA 3LUCA 5TPZD 2X7XA 2H0AA 1CHNA 1JDNA 3T8YA 1S8NA 3CZ5A 3O21A 3S99A 2FXIA 7ABPA 1USIA 2A9RA 2FQYA 1DRJA 1C4WA 3FMVA 3OMWA 1DCMA 2WMYA 5EWJB 3TO5A 1RPJA 1URPA 3HCWA 1L5YA 3QX9A 4HNQA 1DC7A 5DLEA 4YCSA 1JDPA 1VLZA 4KZKA 4OBBA 4UHJA 3LUAA 1A2OA 4KMRA 3QELB 2VK2A 1MVOA 1MAVA 5CNMA 1EAYA 2M98A 3IDOA 3O1IC 2M1ZA 5IBQA 3OO1A 4D6YA 4HNSA 3LUDA 4IGAA 4G0YA 3KS9A 1R8JA 2NT3A 1ZAYA 1QP4A 2MYNA 3OLYA 4B09A 2MYUA 4RK1A 2PUCA 2GKGA 1Z15A 1JX6A 1P2FA 3HSYA 2P4UA 4KK4A 4ZPJA 5ABPA 1EFAA 2F8SA 2LBPA 1JLKA 4EVQA 3QLUC 3A3KA 4JASB 3N75A 1F4VA 1LBHA 1NXOA 2QXYA 4RY8A 1XHFA 2PMCA
chains in the Genus database with same CATH superfamily
1WP9A 4EZIA 2VUTA 3ZS9A 5FOTA 3HVUA 2FLVA 3CWQA 1NY5A 5J2UF 1I01A 1LCIA 3KYCA 4X94A 9LDTA 3D5QA 3I5YA 1TLFA 2ZI3A 3N6XA 3V2HA 1AV6A 2KHZA 2CUZA 4E03A 4ZAYA 2H57A 4RGBA 4PNEA 2C8JA 1ADGA 2I3BA 4HH1A 5JD3A 4E5UA 3E58A 5E7JA 5L7YA 1DAIA 1YBVA 3U31A 1ZGZA 1Q12A 2PUJA 5KAMA 3SK0A 1RQ2A 2I2WA 5KVQA 1N2IA 2QDXA 3ZC3A 2OWEA 4I6JA 1SULA 2D3WA 1H6DA 4FMDF 3HP7A 4GFDA 1UBGA 2XZOA 3E9DA 1U3CA 1T9GR 3GLIE 3LL4A 1GYRA 2DWUA 4IRMA 2GAOA 4BNFA 2CCGA 1ZMXA 3A9TA 1HDXA 1FFHA 1UJBA 2BL4A 3B1XA 4I4CA 1Z45A 2O8CB 5AK5A 3OZWA 3CNOA 3WL7A 2NZ2A 1E20A 1WULS 5LUBA 2IHTA 4R6WA 3TFWA 1DIRA 1N9ZA 2EP5A 4KJZA 3S3TA 4CKEB 2ZZMA 4B4KA 4YMVA 1GWNA 1ZVVA 2P27A 4PBSA 4FHFA 3E3NA 2JFYA 1EWYA 1WSDA 3EW9A 3R23A 2R79A 2E2WA 1PD1A 3DAHA 3C6KA 3KKZA 4MUFA 1ST3A 3F9IA 4R8MA 3P26A 3D7NA 4NOLA 2C2GA 4WIAA 4C7OA 3HRKA 3QE4A 4JLOA 1XVIA 4G97A 5TGTA 2ZJFA 3D3JA 421PA 2QTWB 3Q9UA 3P9YA 4AJ2A 1QBGA 2YY7A 3PGJA 4PZLA 4X91A 4KQ6A 1QX3A 1V8ZA 1U0BB 3WI7A 3K6SB 1HFWA 1LA2A 1GZVA 4TYNA 4MV0A 5BUSA 4N0MA 3KM0A 3QBTA 5K2MA 1UDAA 2CY0A 1Z62A 2R8BA 4WOBA 3V3TA 7AT1A 3QI2A 1KQNA 1EM6A 3E4DA 1SIOA 1M33A 1G17A 5CT4A 2AYZA 3AEQA 1RNLA 1D8TA 4A1OA 1AJEA 4Q39A 1Y8CA 1CT9A 2R96A 1Z5UA 3JVDA 4XUGB 1MAUA 3F6RA 1MC1A 3FKQA 1MXFA 4JVSB 3ABQB 4Y6PA 5DWQA 4ZU1X 1FC0A 4XPIA 4ZU6X 4JI1B 1MCZA 2FDRA 4FDTA 1O97D 5EWJA 4FVTA 4BV3A 1UBKS 4YUVA 1E2BA 1JR6A 1L5WA 1USWA 4DR7B 5EJ8A 3W90A 5JH7F 4OU4A 4Z4EA 3CLUC 3BMOA 3T5PA 2E48A 4YMUA 4QTZA 5LMCA 1WAMA 1LLFA 3NWOA 3GLKA 4PFQA 2GESA 4PHFA 3LQ1A 3NPMA 1OFGA 3NQ41 5BYKA 3COVA 4JVMA 4HH4A 3CZCA 4R0VA 3A9WA 3N3BC 2JAHA 2IUUA 5DSZA 4MUHA 1R5NA 2C9OA 4MSUA 5L3ZA 5JNVA 3SBEA 4RLHA 2GETA 3ESYA 1T3HA 3PLRA 3N2GB 1XAJA 4LKRA 4YJ2F 2I2XB 3CR7A 4HWGA 4P3NA 3GT0A 3JQPA 2PPVA 4DIOA 3NP9A 2CXTA 2P40A 2DR2A 1E5VA 1GQSA 1VHQA 2JD2A 4M9SA 5AM1A 3IHWA 1ZBQA 4GQIA 1JR3D 2QOEA 4AWAA 3STHA 3KDPA 1Y8QB 3D4IA 4BAUA 4RJLA 3B1FA 2W83A 3ADBA 2X0KA 3H9CA 5A5VA 1ADFA 2O2IA 3E9YA 2E5FA 3F0TA 5FLKA 2UU9B 3R9XB 3KQVA 3U16A 1XKXA 2PQ0A 1RI2A 3RS8A 4D43A 2OCGA 3R5HA 5T8KA 3GEBA 4AM8A 1TA4A 1XQYA 1EQUA 5HCUA 3TZKA 1N0WA 1OZAA 2BKVA 1Z17A 2J8ZA 3H8SA 4B4OA 1PZEA 3NHLA 1TOAA 4R3WA 2DVMA 3B38A 3UB3A 1QZTA 3H9JA 4OKNA 5CDTA 2C9BA 2PLFA 3ONEA 3RKRA 4Q05A 3TMYA 1ZLXA 1E7QA 3R0QA 5IM4A 2VBIA 3RRMA 1Z0SA 5CM8B 1YHNA 1FU8A 3JCZA 4B87A 2ZS8A 4RU1A 1X8LA 3SX0A 3W1EA 1E9RA 2QAGC 2RH5A 3TMAA 1NN3A 1R0SA 5EXPA 2I4IA 4N3CA 2YIJA 3RVPA 2B92A 5A5DA 1ZUIA 3DEIA 3GFTA 3CG4A 5JSUA 2VRNA 4NV1A 5K0ZA 3QE0A 4OGKA 1QFZA 4EW1A 3AETB 1FS5A 2DLNA 4LRSB 3JQAA 4I66A 5FJJA 4BLRA 3RHSA 4DQ0A 3DTTA 4GL2A 1KSHA 4X41A 3UXHA 4N41A 2C1ZA 2YKGA 4K9PA 5AIBA 1PS9A 4JUIA 3TW8B 4DLYA 4M6WA 1D9ZA 2XF8A 3W9UA 3T5TA 3HVJA 3H4MA 3U17A 5LOVF 4NEGA 2RONA 2NSYA 1Z16A 1DT3A 4UMFA 2I8AA 3B1KA 4Q19A 2CNDA 1NJFA 3R3WA 1U99A 4RVFA 2GSDA 3FD8A 2OLJA 4J75A 5C1DA 1ZFNA 2J48A 2Q5HA 5KWEA 5FPYA 3FPBA 1L4BA 5BN3A 2F8SA 1ZSYA 3OUUA 3SQLA 4EPRA 1EG2A 1U7DA 4JYAB 1TMGE 4LVOA 5ALJA 5F7OA 4URHA 1SXJB 1LS6A 2XOKA 3CLKA 1FJXA 3UHOA 3AVXA 1W46A 1OYYA 5CT9A 4MR9A 3RSGA 4DEXA 3SZMA 1TI7A 3LOQA 2J6CA 1AE1A 3L18A 3O1LA 1TO2E 3V5NA 1XK7A 3VHRA 1FDRA 1A69A 5L7WA 4PAWA 2ZR8A 3EC7A 4CQMB 3OX4A 3PXXA 1R6DA 4JQSA 2HJGA 2JGMA 4CQLB 4S1TA 2VZ9A 3G0CA 4I9FA 1Y8QA 2CXOA 3MGBA 1MT0A 2MINA 3EA4A 2ZRFA 2V8OA 3F9RA 1FDOA 4EB0A 3D02A 1W5SA 2R6GA 4U8GA 5AI0A 1H2WA 1DC8A 1ZM2A 4ABTA 2B99A 2P69A 2RC6A 1Y81A 4JFRA 3LC7O 1AK1A 1N2CE 3ZE0B 5LKAA 4TXJA 1HYHA 1XAHA 2BM9A 4QJ5A 3DJFA 1BDJA 3A1TA 1ZUWA 2R44A 3IP9A 4WBSA 4WXEA 1XA4A 1JDUA 4OQFA 2ESRA 1OI2A 3HKCA 5JEEA 4LJAA 2WQ7A 1SPXA 2GCIA 2JIMA 3PUIA 4KQGA 3GLIB 1UXGA 3KBOA 1UK8A 4R69A 4TYWA 1IOLA 2I6GA 2H1OA 1B0AA 1Y63A 4CMCA 4BJ5A 1UEJA 3GC6A 4L5BA 1RU3A 1W49A 3E9CA 4HZUB 4KKXB 3FTNA 5ILGA 3O9MA 5KDDA 2JI6A 2QD5A 1FP4A 5D5PA 2O6LA 5E7IA 5HCIA 4E6EA 4G63A 5KYTA 1GCAA 1CVIA 3JD2A 1GJRA 3KLOA 2ZSAA 3QENA 4LW8A 1KGSA 3ETCA 2P4QA 5F1YA 4E4YA 1Z63A 3MCZA 121PA 2WMDA 3MM4A 5FP0A 5IJWA 5DHSA 4X6LA 3VMFA 3BQ9A 1B0UA 3A1WA 2OZVA 1AS2A 1WQ4A 4R1MA 4IZOA 4Q4CA 3GQVA 4ILKA 2IHNA 2EVWX 1GQYA 4FSXA 1GXSB 3MT7A 4UFOA 4LC9A 1U4SA 1DAEA 2O5RA 2RK4A 4OI4A 4D56A 5KNBH 4PFJA 2QN3A 2IL1A 2P1RA 3AEUA 3P97A 5TQ0A 1F48A 2BEVB 2WSYB 4N7MA 3UJ3X 4B4WA 4CKZA 3WV5A 1PNRA 1T2DA 2AK2A 1C7QA 2D2XA 3DF7A 1NJ1A 3GBVA 1QIMA 4EG4A 4OQPA 4I50A 5DTJA 2Q5LA 3F5FA 4FIDA 1A4RA 2FE1A 5JEDA 2HA5A 4ALLA 4JDUA 1KL7A 2QT0A 4RY0A 4X85A 3ROEA 2VRWA 2GEVA 1EFDN 1USUA 2M2IA 1X70A 3P52A 4LHEA 5IXSA 1CZUA 4W7SA 5EXXA 2JA1A 2P5SA 1TCBA 2J3DA 1HYGA 3IBTA 4OJYA 4RPHA 3E5MA 1FSSA 3BHMA 3L1VA 1IBLB 5MN4A 4DMGA 1SVLA 2N1MA 2W2KA 3TLJA 4F38A 3OC0A 3FROA 4MNTA 4UKDA 3PCXA 2C5LA 1QGUA 5BQ3A 2IOQA 1ZA2A 4KI7A 1YR9A 1J8VA 2H5JA 1J9EA 1QOZA 3GR6A 3KPJA 3RASA 4XLZA 3U48A 1VHWA 4I5GA 4IIUA 3TJZA 5IUJC 1W0CA 5AESA 1UZUA 3UMMA 4B8WA 4CM8A 1FFWA 4WESA 4B85A 1IONA 1AKMA 4ROTA 1XZMA 1D1SA 4K6KA 4CM4A 1TKCA 4B6OA 5DI3B 5JTTA 1Z5NA 1J8MF 3UHJA 2JD1A 2PKXA 3PC6A 1G59A 5LDGA 4JD5A 5FPTA 1E2IA 3H4TA 2B5VA 4LIPD 2GDJA 3IKMB 2DPLA 1YH3A 2FLWA 4ZMBA 3J7AC 2PV0A 5JMWA 4QQNA 1T4CB 4V39A 1PT6A 5LA6B 1VIMA 5AXBA 2C88A 1M1YA 3NWEA 5BWBA 5TQ2B 1PX0A 4QQ8A 1KEVA 2GCNA 3BSYA 1FUUA 1T8RA 4EDFA 1I7QB 1KRXA 3NC1C 3Q2OA 3QXJA 1C9JA 4RHTA 1FDSA 4JJZA 3E70C 3C24A 2XXAA 4MS3A 5I4CA 1Z7BA 4TTSA 4F4UA 1MD9A 3ILYA 1VLQA 1X1DA 1NR5A 2PXXA 3MXTA 1ODLA 2EGHA 3NRJA 4M1EA 3TZBA 2QRHA 1WXDA 2DWPA 3IE1A 4PQRA 3KB1A 1VG1A 3IMGA 3T54A 1Z9BA 4LJ4A 3MRSA 4Y0AA 1NU8A 1B1AA 1BNCA 2AOUA 4C1BA 1MRSA 1PDVA 1TU0A 2ZTUA 4P08A 1NF3A 4EHFA 2GYYA 4LHVA 3JQRA 3GLHA 3FOWA 3AEUB 3BD9A 3KJQA 5TQ0B 3VZDA 4MR7B 5D00A 1IHUA 1GGHA 1PGQA 4MQ6A 3BCSA 1L0BA 4Y6LA 1I36A 4S0XA 3FX2A 4YRCA 3ROMA 4Q4JB 3WMRA 1LSSA 3QVGA 2V7QD 4D8TA 5A7FA 1OE0A 2G8NA 5K6AA 2QMHA 2IYEA 1AKRA 2HWUA 3QZUA 1FNBA 2Y4NA 1SBCA 4HNHA 4Q1VA 4V3BA 1VSBA 3E84A 1ZXBA 4QBGB 4A8JA 2V0NA 5JQGB 1N2HA 2ZTVA 3LQ4A 1ZJWA 4OG2A 1YRWA 2R1TA 1U5AA 4RKWA 3FVVA 4NATA 2JIRA 3K4PA 3RYCB 1BFKA 4MV5A 2C7QA 1FW6A 2YR0A 1NNEA 3SOZA 2W58A 1CUDA 3GHYA 3KPWA 4Y30A 3HB7A 1DMRA 3M4JA 2HBYA 2AB0A 2O23A 4R98A 4ZAFA 4CMEC 4F1WA 4RTNA 1FXUA 1D4AA 1EUCB 3VSCA 1XYVA 1ZITA 3UT6A 1JIXA 1SBZA 3SEQA 5CA1B 1BMFA 2BUBA 2HCTA 3DBIA 3UG7A 4QPJC 1ZJ6A 1EB8A 1HTWA 1XEWY 4ZCLA 1VKRA 2VQFB 1HYQA 1Q7EA 2C2WA 1N5JA 3Q5EA 5TY0A 1ZKMA 3G9XA 4MHTA 2W2NA 1TQ8A 2VTDA 4ENSA 1GU0A 2GCPA 1MMFB 1UQRA 1KEEB 2QL7A 4AYTA 4BPRA 2CKDA 3QJ5A 3SJBA 1NKVA 3PI7A 1IIBA 2FEKA 2W43A 3U4HA 4F3TA 1A88A 1A8QA 2PGAA 4B8ZA 4J0DA 3GJ0A 1TT5B 2WWIA 4N9WA 2GR9A 5ICGA 4AJPA 2WNHA 3NZEA 1WZUA 3C3XA 4NVRA 3BMQA 3K16A 4UBMA 5CTJA 5CVJA 4DNOA 2JIDA 3QU9A 5C4MA 3FOFC 4FNMA 2Y6UA 2P11A 2GVNA 2PHZA 2VH5R 3I0NA 3AVOA 3LYHA 3HGQA 4I9UA 4JLNA 3UAXA 5CVVA 4XI9A 3X1KA 1K6JA 1T9CA 3DC2A 3IBYA 2TMDA 4WZBA 4XDYA 3UMJA 3G5LA 1U3VA 3UV3A 3FDZA 1GG5A 3D4OA 4TUYB 3U4CA 4MUNA 3IRUA 4IDCA 1UZMA 2Y92A 2Q4DA 3RVOA 3V4ZA 1F5NA 2VNIA 1BJKA 4C6RA 4NBKA 3HN7A 5M7EA 3P7MA 1J24A 3I4LA 4E2WA 3I1IA 4HEA1 4Q7KA 3M1LA 3U39A 3OZ7A 4LNHA 3OFKA 4TVSA 1XT6A 2ZVJA 2A9RA 1V3TA 4IUCS 1PK7A 1QV9A 3GMDA 4QOHA 1T25A 1Q0ZA 2WMYA 4OUDA 5EIAA 3ZH2A 2QMQA 3IYLW 2FW7A 1LK5A 4KZKA 2X2PA 1Z2OX 3QKIA 4YREA 5KZMB 2Q27A 2X40A 5DLDA 4BFVA 2I3ZA 1AKEA 3QKSA 2AR0A 5BN1A 5AHOA 3UF0A 4DPKA 1XRLA 3K0FB 3SDZA 4G0VA 2JIZD 1N0VC 1XBTA 1AURA 3G1TA 5CLIA 5HA5A 1RFGE 4LBZA 2PL3A 4G36A 5IAKA 1M6YA 2PSEA 1NHWA 4FE3A 3TTYA 3ZWKA 5CHEA 2EX1A 1S2DA 2Y67A 4YECA 3THYB 2OZLA 1RM5A 3TTWA 2QQ5A 1LBHA 3L8YA 3RS5A 1FP1D 3JALA 5EN4A 3IQDB 4DRXA 1IPEA 1I10A 1QSGA 2ZRHA 2B8WA 1RMYA 3MT0A 4FR0A 4Z1MA 4Q18A 1CE8A 5JFGA 4P3YA 1OUMA 1XCLA 5JI2E 3ILVA 2BFCB 2W9XA 4Q9DA 4RA6A 1RAIA 3RRYA 4K3UA 2NTVA 2JFPA 3AI1A 2QLBA 3DMNA 1NU6A 4U4AA 3EQ2A 1E3QA 2P2DA 4B74A 4M1SA 3AWIA 1UK9A 1J5PA 2UZIR 3FMGA 1EUDA 3FLEA 5EE0A 3ZDZB 4CEJB 2FR8A 2NU7A 3NM6B 3IODA 2I67A 3FM9A 1CQJA 1FX0B 2R6ZA 3AQIA 3BCHA 1QAMA 1VMKA 4OXYA 4O5OA 3RTGA 5HRCA 2XTJA 3ZWOA 1QE0A 4A7PA 3IL2A 3HL0A 1JE1A 2QQEA 4XCQA 5EUBA 1T5BA 2ID7A 1I4DD 1ML4A 1OQAA 1RHRA 2E7ZA 1SCNE 1JA9A 3IT1A 4M0CA 4PZDA 4XWTA 2JHCA 3IXMA 4NCHA 4DXDA 5KX5A 5BQ5A 2G70A 3IUEA 5I9TA 1GXSA 2NNLD 4US0R 1HOTA 2EARA 2LV8A 3DMTC 4PLHA 4R31A 4QGFA 1XMOB 2CVFA 2G3YA 4D4KA 5C18A 3EGXB 5PGMA 4QUAA 2L82A 4M0DA 1SUWA 4WXYB 2JLQA 4BNNA 1P80A 1P72A 2ZCVA 3EVDA 2P75A 4LXTA 1WXFA 1VFPA 2FK7A 1NVDA 4LVNA 3K4HA 4NYMQ 2JBHA 4O1IA 4DAEA 4CKYA 4H7PA 1KC3A 1ZNXA 2GOYA 4RIEA 1CUYA 1KVRA 2Q49A 2RFLA 2O8DB 3S2IA 4EY3A 5KNCH 1NXVA 3QFTA 1NXXA 4RK6A 1C1DB 1DP4A 1V1MA 2I4OA 1VE6A 1XRNA 4FGLA 4Q7LA 4NBWA 5THXA 5EJGA 4YAGA 3OD1A 3JQEA 4JN6B 4DWOA 2DBZA 1U3FA 4GNKA 1EFCA 4RD2A 2AJDA 4CEHB 4NYMR 3GMTA 1U11A 1UBRS 2AMFA 2YWFA 4FCTA 3DFZA 3ZZMA 4HATA 2ZZKA 4DMKA 5EGNA 4PPNA 2C8VA 2Q4OA 1U3DA 3ZKWB 4MP3A 5MN5A 4RTOA 1X87A 5HQTA 3MD0A 1YGPA 4CM6A 5C35A 4XX0B 4QO7A 3P2IA 4FM9A 3HZRA 3LWNA 1DT5A 4H0NA 2GDZA 2HXGA 3HZZA 4BMNA 4WBXC 3KTFA 1Z4NA 3ONNA 1NONA 4K9NA 5C3MA 5KQPA 2ODAA 4MPPA 3RBXA 4HWTA 1LDMA 5EMHA 3S55A 2O8BB 2OCYC 1H2ZA 2Q3DA 3PC8C 1SKAA 4BNHA 5KVCA 4PIVA 5B4TA 2JFFA 3PJRA 5JYBA 4WVFA 2P9EA 1XKQA 1SOMA 2JI4A 5AKXA 4ANFA 4KYIB 1PVOA 4CKBB 4ZYWA 2EWWA 2AJBA 4M8NE 4CG0A 5CPBA 1LRKA 2O7RA 3KE9A 4TT3A 1CBUA 3KLBA 3IT2A 1KU6A 5IZCC 3UH0A 3H3JA 3ODPA 2G76A 1IHYA 1Q6ZA 1SKUA 3GN2A 3SYRA 3A4VA 4FYKA 3BTVA 2DOKA 3L84A 4UVIA 4WFJA 4X64B 4IDQA 1VXOA 2PU7A 1FP7A 3KOMA 4UXIA 1GT91 1I1QB 4JYBA 3AHEA 1ZC3A 4FFOA 4A92A 4ZHQF 4HLDA 3AFMA 1TUGA 4MINA 2UYYA 2CXNA 4EYQA 1Q1NA 4QOSA 1ZH4A 4OMUA 1QHHB 1W5TA 2FRVA 4EO7A 3U19A 2OILA 3R5KA 5CDFE 3PDCA 1E7WA 2EIHA 2WZBA 3KB8A 3ZE2B 3JY6A 5M2QA 3S27A 4BRSA 2H5LA 1YZFA 4KV9A 2V9CA 1BAPA 3BG5A 4BQEA 1VJ0A 2FUEA 5CLGA 3WYBA 1UT8A 5K2OA 2PL9A 1SC1A 4BV9A 4LVCA 2XD9A 2C5FA 4JAVC 3E8XA 3F7TA 3G7UA 3N9IA 1FYVA 1PFWA 3N05A 1OSNA 3ED5A 5DHUA 2ZRAA 3QJYA 2J4CA 5B57C 1C50A 5A6SB 1UMDA 2R00A 2FVYA 4MAAA 3TEJA 1XD2A 2QRLA 4FFLA 4BLQA 4R7TA 1NC1A 3UUEA 1QVRA 2X19A 3LNTA 4L72A 2E5WA 3KHSA 1BWPA 2CL5A 4L0MA 1W5FA 1PLLA 2PS0A 4KXYA 2QORA 2AQHA 4QJ4A 3TZLA 1OX5A 4MCIA 3O2JA 1E4EB 3RWOA 2D1YA 1C4XA 1E2UA 3BMXA 4AKSA 4O29A 1DKLA 3ZLTA 1MAWA 1DV2A 4MKZA 1ODIA 2QAIA 4TSFD 3RJ5A 4LC1A 4OEHA 2QIPA 4O8ZA 2F7SA 4YRQA 5ESRA 1EK1A 4BWGA 1PWXA 1U8YA 1LU9A 4RO0A 4XQCA 4JITA 2C07A 3EX7C 1WR8A 1ZK3A 2EDCA 4K9KA 1GQRA 4PLFA 3WL4A 4EFKA 1VJCA 1K5GA 2ID4A 3GZJA 5CJJA 2PNJA 5U9CA 3HVHA 3TBKA 3BH0A 3OZVA 1OXBB 1E89A 5GOTA 5KNLA 4OK5A 3E7DA 4WDQA 3BGOS 4RXUA 4DWWA 3P2MA 5LFAA 2GM5A 4I5EA 1FUEA 1VZ2A 2HMUA 3KZCA 2XMCA 5DM1A 1U1IA 3SWWA 4MTLA 5IBPA 3TS1A 2YV1A 1NIJA 1Q22A 1OY1A 3H1PA 1Y3IA 2ERCA 3L6CA 4RZ2A 3UWKA 4CCYB 3EFOB 1TJ4A 3DTNA 3OJCA 3RRXA 1SVKA 5BOVA 3MINB 4QFBA 3ADOA 4JJ6A 4N5MA 4DCSA 4A2CA 3HDVA 2WTBA 3PXGA 1X2BA 3ITEA 3FNEA 4CFSA 1CJKC 1E61A 1Y6ZA 4K26A 4MX8A 3VBCA 2GBLA 1SZDA 3OCWA 3SQDA 1KJ9A 1T13A 4BLVA 1JBKA 4MQEB 3M6IA 1NLUA 3IMKA 1XZHA 5CIWA 2H4HA 1E6LA 4WKBA 5EHXA 5IAOA 1X7WB 3WWOA 5CM2Z 5AXAA 5J9FA 3IAHA 10MHA 2FW6A 3UBTA 2N9UA 5TJHA 3T3OA 3WC4A 5FOWA 4ZYXA 5FCDA 2VDRB 1MEEA 1ZM3A 1U3UA 4H59A 4J3FA 1OI4A 2ACEA 4RIIA 1RBYA 3PQ2A 5CYFA 3VZCA 2IZ6A 1E0SA 3QKRA 5KOYA 5ELXA 4GDMA 2G4LA 2C5GA 4A0HA 3BERA 3HDJA 1WUTA 2I4RA 1OLXA 1NI3A 1XRSB 3AB7A 3TTVA 2PX2A 4QLBA 1Z4JA 5KMGA 1OXVA 1U4NA 1HE5A 3U37A 2EERA 5HKAA 3K2BA 4Y67A 1N6RA 2NTNA 2W0MA 4WK0B 1ZCZA 2OY0A 3CF2A 3DH0A 2OCLA 3LO8A 5WRFA 2OFOA 5IDQA 2YQ4A 3HVKA 1DX4A 1Y7HA 4P53A 4ERXA 3I3SR 3AHDA 2GFQA 2GZAA 3LWDA 1T1RA 3ME5A 3OIYA 1UXHA 5DYNA 3U5TA 4H3HB 3LRPA 5AKIA 2ILVA 2M9MA 4QNNA 3Q7QA 5FAXA 2OGUA 2OO7A 4NENB 3P9SA 3LQYA 1Z33A 2FSPA 2ZYDA 4JK3A 4ND3A 2JHAA 3G02A 3EFOA 4Z0TA 5JWRA 1R0RE 4RHEA 3COYA 4RCZA 4TMKA 5L45A 1Z22A 3HZHA 3GFQA 3WISA 5LMNB 2FZ5A 3USCS 2IVFA 2MT9A 4MQBA 1NQ5A 1V1MB 4M0FA 4F4DA 4YRMA 2VJDA 2I03A 3NBKA 4FDMA 4MQEA 4P81A 5SY4A 2DPXA 3ZQUA 3PFHA 3WRXC 5IU6A 4CKCB 3QPDA 5JJIA 3DVAA 1SIBE 3KDSE 1WW2A 1ZIXA 4KFRA 5JCJA 1TQHA 1F4LA 4D7AA 3K1AA 3TLMA 5HR5A 4BNYA 4MVJF 3VYVA 4INZA 2D1SA 3GV0A 3EMVA 5GV8A 1E60A 1YB5A 2W00A 3MF4A 1BX0A 1WPXA 4DMCA 2IEAA 4C89A 2J4DA 4GS5A 4F04A 2GJAA 5K6RA 1Y1TA 2CL6X 1Z3IX 2XMZA 1C7RA 2ATVA 3NTXA 1MB4A 3BDAA 3H11B 3CEAA 4ZAGA 1KRWA 1EEHA 1XC7A 4Q9IA 1T3LA 2BGKA 2J4FA 5FWYA 3GEHA 2GPAA 3DV0B 3W3AA 5JLAA 3ST7A 2BFFB 4TXNA 1FFGA 4YHBA 4D4LA 1R10A 2JI7A 3VPFA 5LQJA 1PQUA 2O2YA 1GPDG 1GSOA 2C4HA 3GDGA 4UHCA 3FPLA 3JPWA 4CWAA 3EZ2A 3I4FA 4P34A 3I9KA 1YIAA 3PWTA 4BNXA 3PUKA 4JH0A 2YVAA 5K01A 1N33B 2OV2A 3FVRA 4EY8A 4RJTA 1GTG1 1PU2A 3L7AA 5DF1A 1GPUA 1Z39A 3V1YA 4WXHA 2QJOA 1P19A 4QLOA 1NW3A 5H83A 4E88A 2AXQA 1F17A 3GQBA 5JG7A 1L9XA 4HDAA 3SEAA 1IXSB 1NPTO 3K4QA 4P4LA 2XV1A 2FX3A 5E6UA 5FHRA 5AW5A 4B0PA 3PQ8A 4EHBA 2GN4A 4F92B 1N3LA 1KQGA 1PDOA 4X1KB 5AM0A 1J2UA 3UJAA 5BWCA 2MSKA 1ZDMA 2F59A 2P0YA 1CK4A 2HLDA 3ENNA 4MUAA 4C20A 1D6MA 1THMA 4CG3A 3KXIA 4D9IA 5HP4A 1FSPA 1V7ZA 3A26A 4XQGA 4BGVA 1FFBA 1M1NB 3IV7A 2I7TA 4KWCA 1KMQA 4ZJUA 3DOCA 4OKIA 4QWMA 2D0PB 2ZUEA 2BJHA 3M70A 4O1MA 1DO0A 1C4OA 2HT1A 2AE1A 2NSJA 1B43A 2HR1A 2IHVA 2ZYTX 4IJ6A 1RQXA 5AK4A 1U7UA 3IMEA 1YIOA 1SA0B 3TJMA 2RGUA 3F4KA 1NASA 2RHBA 4G4GA 4LZOA 5DASA 3VJKA 1E3IA 2CFRA 3DHWC 5ICFA 3RB8A 2J5XA 4AZ3B 1MRNA 1E9DA 4TYQA 4IDFA 4UPDA 4JV5B 4D82A 3FOZA 1G9SA 2ZBEA 3RBAA 4D3ZA 4H3KB 4AZSA 4W5NA 4DXHA 1HZJA 5KUTA 3VR3D 5HM6A 2IDZA 1A5ZA 4G1FA 2GYWA 2OQVA 4AO7A 2VT3A 2FMUA 3W7VA 3AR3A 1PIWA 2ET6A 1VBMA 4DLNA 1QMGA 4DG9A 1L7DA 3MW8A 4BFXA 1SQSA 1HNNA 2IP2A 3RK1A 5C46F 1ZH2A 2PWAA 3C5HA 4CRWB 1KBZA 5DYGA 1E1KA 4FT4A 4RKQA 2ZG6A 2R5NA 1JT9A 1DKQA 2EWVA 1J0AA 2IUEA 2UUPA 1FTWA 3CUKA 4HMPA 4HVTA 4NZNA 4QO8A 2D13A 1PBTA 2HEGA 2IYPA 3QE2A 1KIMA 4FU0A 5IC6A 3C43A 3IVMA 1X86B 1YK0A 1DAKA 4JVNA 2Q3FA 3GRRA 1XTSA 2O06A 1YOVA 1XLUA 2ENWA 2E37A 3LQRA 3L79A 4FUTA 4NNOA 1XMQB 3ZJVA 1X80B 3SEZA 3AG5A 5EEGA 3DPUA 1SD5A 4KI0A 4P93A 5KQMA 5LUAA 2ADOA 1HE8B 2Q46A 4OHOA 5KOJA 4RVCA 4PTYA 1R00A 2IV3A 5FWNA 1HK7A 5TGZA 5EWMB 4DZZA 4DMHA 3K0EA 4MDHA 3I0MA 5MF6A 5IVHA 4G5GA 1TIPA 1Z2NX 3LBIA 3LPLA 5COAA 5C4GB 5JXIA 1KK2A 4LMAA 1I6WA 1LNZA 3IR6A 3AEZA 1UP6A 1S3FA 1DQSA 2WPDA 5IHXA 5IT9A 1XZIA 3C2QA 1MFPA 1EE1A 2R8YA 3ZI0A 1R4NA 2QN6A 5JAOA 3LX5A 3MMXA 4AJEA 4AAYA 2ZRCA 3FDJA 4TM8A 1MB9A 3AONB 4GM4A 3VQTA 2CXPA 2C8LA 1YR6A 1HDCA 2ZT5A 3I6QA 5LDDC 5MFZA 2JAOA 3BXEA 4TTIA 5BXYA 3UCXA 4IMJB 2BDEA 3DDUA 1DWPA 5DGCA 5DW3A 1DJPA 3V1LA 3F6EX 2QU7A 3JRNA 4NCIA 1P0QA 6YASA 1GVHA 4JYCA 3IJEB 2PLWA 2A9VA 3IA7A 3ZX4A 2H0RA 4KACA 1M2HA 1R6UA 2HBQA 3TZHA 4Y1RA 4M53A 5JVDA 2HMWA 1NF2A 2C4VA 2H0AA 3GOHA 2B4YA 3OI7A 5JZSA 1ENOA 2ZRNA 3HR4A 1WABA 4ZVRA 5LZ7A 4IQFA 4IHJF 4OKSA 5I5GA 1YRAA 4L9AA 2PZGA 3OJFA 1ZEMA 5TT1A 1D2MA 4JJGA 1R37A 4BN0A 3TW6A 1RWXA 1P4RA 5BY2A 3ACDA 5IPFA 3TEMA 4JODA 5C0OE 1V8OA 3L1IA 2QUJA 1YMQA 1I0ZA 2NIPA 5DLEA 3VOAA 4NLLA 4D4JA 1JRLA 1VMAA 4GI3A 2GK4A 1OLXB 2A4MA 2QRKA 2DUNA 2V7XA 3HCNA 3SJ7A 3SZLA 5AVXA 1PJAA 4R1OA 5FWAA 4RM3A 1FQKA 4XIFA 2NO5A 3TRHA 1T91A 2V98A 3AHHA 3RU9A 3WR5A 3ZJYA 4LDQA 3U7RA 4DRZA 5CA0B 1G7TA 3NH6A 4L78A 4P31A 1HKHA 3UHPA 4DHWA 1SKBA 2P68A 2EQAA 1N3YA 2NT3A 1CJSA 3NALA 4ZVPA 2G25A 4IG9A 3L05A 1UDCA 3OLYA 1QHXA 2YXEA 2NU8B 3NTQA 1LVGA 3GARA 5GONA 2AL7A 2F3PA 2XQKA 1W4BA 3V7WA 4EVIA 2WAOA 3ZVNA 4CKCA 5DGIA 5BSHA 4EVQA 5ICEA 1PZGA 1XCMA 4IOLA 4WFIA 3WDKA 3S7TA 3DNFA 3CO5A 2C3MA 4Q4HB 3SX4A 1BH2A 4BVBA 1HNWB 1ZD4A 2HRCA 2XNCA 2QZ9A 3TQHA 1I2AA 2BV3A 3WMFA 2F9FA 1XMIA 1MG0A 1TZCA 2W7TA 3H9GA 4QRDA 4MWOA 4RJJA 4AC9A 4YR9A 2F1RA 3P96A 3V32A 5KYYB 3ICPA 4D9CA 3KXDA 4E33A 5HKKA 4UUOA 1L7EA 2COEA 2C2ZA 2CHGA 2VQ3A 4WK6A 4PSCA 5JWHA 2O59A 1NMEA 4OHUA 4BBAA 4QDTA 4TVKA 2JCGA 3QYPA 3HN6A 3GH3A 3QTLA 4RUKA 3TD9A 4EA6A 5EJFA 2W70A 4CMIB 2CLHB 3KP1A 2C3OA 3M81A 3P4UA 4DFDA 4D42A 3WYDA 1YZTA 3NRBA 4MUYA 1AS0A 4NH4A 4CQLA 2YY5A 2CXUA 3ADKA 3PQDA 1SKQA 3Q5DA 1PQWA 4LPSA 4YXWD 4MROA 2MMCA 1T5SA 4OHXA 3I3OA 4NHOA 1NMXA 4BFWA 1WCWA 4G85A 2C0PA 3T3DA 2C5AA 4OA5A 2FG6C 3VAAA 4JQYA 5AW9A 5CBKA 1L5OA 5L3QA 2P6PA 2BMWA 1ISHA 4QE3A 2W71A 2PX6A 1YS2X 3FI0A 3HB5X 4H7KA 3I34X 3MFQA 2DH5A 3OICA 1S1MA 4PF1A 3KKEA 5DO9A 4L0QA 2X4DA 4EGJA 2I6SA 1AGXA 1ZG3A 4UCFA 4YT4A 1M2VA 1ML3A 4EJSB 5B1HA 2X2FA 2Y1KA 3L8EA 5AOCA 3OFND 3GEGA 3OIFA 2FSGA 3B1JA 4HQNA 4TVBA 4V0NA 5FH9A 1Z0ZA 2JLWA 1K3UB 1S3GA 3LDHA 4KFTA 1J0BA 3TSWA 2FEOA 2OZLB 4X65B 2BJWA 5CAEA 1WVGA 3BMCB 2Z2YA 3AL3A 1DO8A 1O97C 1YI8A 3AJEA 2C99A 3QNWA 2ZFUA 1Z37A 1Q95A 4JR2A 1QH1A 3R24A 3PTAA 4UCXA 2XODA 4Z54A 1GPKA 3UICA 4KPUA 1IU9A 2G4VA 4BO0A 1WXEA 2OM6A 4QU5A 1YULA 4JKYA 1JIJA 3FJOA 2QJTA 3Q3HA 1QTNA 1JIQA 2Q1SA 2A3NA 3TLEA 1OZ0A 3PKIA 4PE5B 4EB6A 2BW0A 2EF0A 3KR0A 3E8MA 1FF9A 3EDQA 4QYMA 5FRDA 3A1DA 5P21A 4EW3A 2YWJA 1TUIA 2ZPAA 4LRWA 3GFBA 1YJQA 4LJSA 4BJHB 5FNVB 1X6VA 1HDIA 1JTVA 1KIAA 1M75A 2OSBA 3AILA 3QF7A 5K1ZA 4FFPA 1XR3A 2ZIFA 2CNWD 2RGDA 1S1CA 3BFXA 4CKXA 1NYTA 1OAKA 4AN1A 1DPFA 1R9GA 1W1UA 1VRCA 3OX3A 1JALA 1SB8A 3EFEA 1XD8A 3QHAA 4IDEA 1EWTA 3ONDA 4YMLA 1U2DA 2WKWA 1F6DA 3HFGA 4KIJA 1FTNA 3CLVA 3CRQA 3QXSA 4GRDA 1JLHA 1DIBA 1UOOA 4AULA 4F3YA 1G8SA 2V9ZA 4L4ZA 3NJ8A 1E0JA 1DAHA 1X92A 2A78A 3IVRA 1O9GA 4QGSA 1V6SA 3INYA 4HAUA 1XZFA 2QROA 2SECE 4OL9A 5KYWA 4MWEA 4RULA 3P0EA 5C9ZA 3EDOA 4KBFA 4N0EA 1WU7A 2GKOA 1CUUA 3NDIA 1IY0A 4HWKA 3B3FA 5KTYA 2VDNB 1TM2A 4BBPA 2ZCJA 5H3HA 3RGGA 4G84A 5LDHA 4BQOA 3ET5A 1ONNA 4TZ0A 4BNKA 3H9EO 5AXCA 3B6ZA 3PWZA 2VR1A 5ADVA 4QXRA 3A3OA 1NRJB 2IEBA 4L8YA 1RYHA 1UXKA 2IKQA 2HSEA 4GQAA 1HI9A 4MRSA 1U7TA 5EFOA 3IDZA 4PFSA 1LD3A 4GOMD 1F7VA 3EWSA 2P5TB 1ZN2A 3A4MA 1BZYA 3ZCQA 2X9NA 5IHPA 1JF8A 2W6JD 3RIXA 2ZXUA 1EJ6A 2X3UA 2IF0A 1NQUA 2FY8A 3TXAA 3V2UA 2Z2IA 3E7WA 4C5CA 3R6GA 5EKTA 3D59A 3OPQA 5F4BA 4ND8B 3BXFA 3DXFA 2QENA 3CQ9A 3AKYA 4TV9A 2QUKA 4WWHA 2DJ5A 3FZGA 4EBFA 4D0RA 2GJKA 3R5XA 4D0GA 3NUGA 2WFZA 5AJVB 3HHEA 3AHCA 3DHYA 5C53B 3K0BA 3AOEC 8GPBA 1OBVA 1TFRA 3KBBA 4DV5B 4HQ6A 3SXJA 2Y1CA 4DIKA 3PQ3A 4GU5A 1G18A 3M3PA 3OSUA 2Z04A 4LQ4A 1ONOA 3A37A 4UM9B 4UATA 3JAMA 4CGZA 3S6JA 3WV4A 2OQIA 1WB4A 3KAQA 2J5QA 5KKAA 4D4MA 3DEAA 2Q8NA 4OLHA 5G53C 3FB4A 2VBCA 1G5TA 3CVOA 3OTWA 4XB6B 2VYFA 2JGLA 4EPWA 1YMVA 1SFRA 4XYLA 1UJ5A 4UJ5A 2ECKA 1F2DA 2B7LA 5KHOC 3VDRA 5T5QA 4DF3A 2BGNA 5DXFA 2PT7A 3OURA 4M36A 1JAIA 5DYIA 2J9FB 5CEFA 4BCDA 3Q9NA 3QI7A 4AJLA 4QGHA 3GI1A 3HEBA 2OCPA 1UP4A 3C3YA 4ONEA 5DIFA 2NM0A 2H2HA 4AG6A 3ABZA 1RS0A 2D5AA 4K9SA 4LCBA 1IXZA 4WLNA 3L82B 2OHXA 1OX4A 5E2IA 2JIPA 4HTAA 1JR2A 2CF6A 1RWWA 1S2NA 1RDFA 3E7FA 3O82A 2AUTA 1RTTA 2P2GA 3EF1A 3EW7A 2EFJA 3IQZA 1DOHA 3JWPA 4KWTA 4MEBA 4Q24A 3Q7SA 2IQIA 3NTRA 4OMDA 4RH1A 3HGMA 2ZTLA 3VFDA 3VU8A 3IP8A 2O2SA 2V7EA 5B12A 1CD5A 1A0OA 2IDJA 2P9JA 2O8EA 3M6VA 4N49A 1YBMA 4B2LA 4AY3A 2B0CA 4QARA 4WKGA 4KYVA 5JSHA 4D4GA 1E99A 1P3DA 1RQ7A 4MWGA 1YCDA 3STTA 3WP0A 1X1BA 3TDNA 1JVSA 1B7GO 3A6HA 1ZUNA 2EF1A 4JB2A 4KBYA 2RCNA 1AB6A 1VBFA 1WWKA 3BGIA 4OO3A 1CUWA 2CSUA 1YS1X 1TEZA 3R20A 1Q0SA 3OPMA 5LQSA 3RFXA 3TF5A 1GCUA 4ZARA 4DEYA 3I39X 4XAQA 4PWYA 5DW0A 4D9KA 2ZSBA 2QR5A 4N7BA 1R6TA 3D3WA 2PH3A 4L7VA 1PG5A 4NYIQ 3ZE9A 5IT4A 2XT9A 2PLNA 3PNPA 4GYJA 4CV2A 3ZPXA 4HB2A 2VYQA 1ZSNA 4JR1A 3VH2A 3FPAA 4Q9KA 3K09C 3GLVA 1WUKS 4UMVA 1B0ZA 2XUHA 3CG0A 3OE7A 1UM8A 2N47A 3PKJA 1CZNA 1N2OA 2FPKA 2GCGA 1H2EA 4QUGA 4LWPA 4K9RA 1UKVY 1AK2A 1DG3A 2ID8A 3V7NA 4IWNA 1V5WA 2ZUTA 1W8IA 4C22A 4LECA 1BMQA 1L4LA 4QKQA 1LKZA 1YGYA 2N42A 1DBPA 4YX9A 4ZI7F 3T9EA 1FS4A 2CC2A 4CKBA 1L7RA 2PWBA 2OLEA 4M9ZA 5B2ZA 1V5IA 2B8JA 2Q6KA 5F7ZA 1IHOA 3FRHA 3URMA 1DUVG 2FJUA 4HX9A 4HX2A 4IGFA 3TW0A 1ISSA 1PWYE 1EFTA 2R7NA 3ODGA 4FFSA 4IH9A 1T24A 4QOFA 5DGHA 1IM2A 1Y82A 4HHEA 2OXTA 5FLXA 5CLHA 2CMKA 1CDEA 4DJ5X 2PGLA 2BBOA 3AV3A 3RI3A 4PW0A 2I3AA 4KXWA 3F3KA 4RD0A 3C7AA 1XQ9A 1BQEA 2I1QA 1PZHA 2RI0A 2WQZA 1IN5A 2IXBA 3MA0A 4EYGA 4OHPA 4Q01A 3ESZA 4NOKA 1DLJA 2EXXA 3FPCA 4LTNA 1F0PA 4Q03A 2RGBA 3G23A 3RLIA 1GY8A 4YMWA 2IEZA 3G49A 1XDSA 4OYHA 2WFLB 1GPLA 3BFJA 3R7DA 3QU2A 4R9VA 1EVKA 2P3QA 2X1VA 4LQLA 4B79A 3ADCA 2AEJA 3CRMA 3MS2A 1W2GA 1XZEA 4X93A 3KUCA 2YJZA 5IYZB 3OO0A 1EUQA 1OILA 1RXEA 3RNLA 1G2OA 3D1LA 1XMVA 4PC2A 5CAEB 4FSDA 5IRCD 3FJYA 4KXQA 4R2WA 4ZVLA 5C51B 1U3TA 2FPLA 5D7NA 1A96A 3JYQA 1M0TA 4HR7A 2AT1A 3M1AA 4FC6A 3IBCA 4ZGGA 1CWUA 2Z9DA 3TQSA 1ZYUA 1L8OA 3ZDFA 3NVKI 1G8HA 2VEDA 4PWZA 3R0XA 5FWYB 5EMNA 2ZTSA 2HNKA 1M2VB 1QHSA 1E3SA 1J25A 1FDVA 1M54A 1O94C 1UBUS 1NJ6A 3GJYA 5AFSA 3DDCA 5G1OA 2QU8A 3OJ0A 2IHZA 3MIIA 4G9GA 3AF5A 3VPSA 1Q5PA 1UKYA 2VLIA 2AC7A 4UCWA 5CT8A 5KIAA 1KI7A 2B4QA 5JZ9A 4IMPA 1EFRA 4DNPA 1XHEA 4QDKA 3R9IA 4GR9A 1XP5A 4I4TA 4OHWA 4LY9A 4ZEOA 3X2FA 4BZZA 1R6AA 3A28A 3L9WA 1S4QA 1W34A 4MR7A 2C2XA 5F5NA 2KW5A 4CL2A 1LK0A 1YZUA 3I32A 1ZD9A 2O0JA 1IN7A 3LKBA 2ZT7A 3LCVB 2ZE6A 2AG5A 2HTEA 5G0UA 1EE2A 3S2SA 5LQDA 2QVYX 2R8OA 1L2TA 5JPCA 3CVUA 3TCKA 4BQQA 4R2KA 2OV3A 3AVQA 1E62A 2H1WA 4X84A 4RDCA 5FUBA 2P6NA 3T7KA 3W4IA 3DPIA 4UXJA 2XZLA 5D5HA 3NORA 3NYIA 1C7ZA 5B3AA 2G5TA 3QX7A 1EXVA 3IA2A 1SC6A 3DWFA 3KOOA 4HAVA 4IIYA 5KTSA 4D3YA 1FQWA 3TIXB 5F2NA 2VP3A 2Y1FA 4NHEA 4DCVA 1JEAA 5KO2A 4L2IA 4QDOA 1WZEA 1XQ6A 2RKOA 5A71A 3PXBA 1PLJA 2Q6OA 4ZO4A 2Q1XA 4NFSA 3L0DA 1YQEA 3CE9A 4IL5A 1SHLA 2Z3WA 3DZGA 3ZZ0A 3EGIA 5G2OA 4BB6A 4CR7A 4DCCA 5B3JC 1RPZA 2WVGA 2OO5C 1FRZA 1GFSA 2VYVD 3CGGA 3E8SA 2DEUA 4MTCA 1EP2B 1RXIA 1VIYA 2WSBA 3NHBA 2AVNA 5KU7A 2CB0A 1I5RA 3E9NA 3ENZA 3FGOA 2WKQA 3MMZA 5FIUA 3UTDA 4OLAA 4MIYA 3QKRB 2V1UA 4Z9AA 3EZGA 1RMQA 1O96A 4HVCA 4B75A 4AUNA 3TKLA 4TZTA 2C57A 1NJ5A 4G0MA 1BEUB 2QTNA 4YRZA 4TT3D 1MJNA 4HGZA 2VAXA 5A1JA 4CIAA 1DMSA 2WF9A 1B0PA 1UPTA 2JGKA 3LIPA 4QDJA 1A9RA 2YW2A 2AG1A 2I3GA 3OSZA 1BA2A 3PQCA 3A9VA 2QBYA 3CA8A 3SR0A 5L6LB 2JKZA 2NUPB 1X1SA 4G0XA 2B8TA 5L9AA 4F3CA 3OTGA 3FVWA 4KR7A 2GBFA 1OASA 1EFPA 2QTLA 4MV7A 4TVOA 1NIPA 3CZ9A 4U9UA 3NDBB 3IVCA 3I53A 1UDBA 1V0JA 3G8CA 2HSDA 4OFBA 2OL4A 2PUDA 1WMSA 4B6GA 2AFRA 1TK3A 3L7CA 3KT8A 2IZZA 1JR4A 1IJBA 4XCVA 3RFVA 1X7WA 2R25B 4POAA 1EGVB 3WZLA 4BUCA 5KC9A 1Q7RA 3CX4A 3CH5A 3NTLA 1G6Q1 5C4IA 2OVBA 3KQQA 4B6PA 3QHPA 3Q15C 2E9SA 2IV2X 4HWSA 3SBDA 1R0ZA 4AZ0A 2AMYA 3H05A 3H86A 1U8AA 4OCZA 4KRYA 1VI5A 3IBSA 4EUKA 2YQZA 4BBZA 1G55A 2XUDA 1N5LA 2VHVA 3EMKA 3DBLA 4CF5A 2PM8A 4Y7DA 1FDUA 3BEOA 4B4DA 1R4ZA 4Y9UA 5JO9A 3WIVA 4UBIA 1FBNA 4E2XA 1JDBC 1CHNA 3GP3A 3MK31 3OOSA 2ZIVB 4LY3A 4O2AA 5DNCA 4UFNA 2WEKA 1PK9A 3N5KA 1D2CA 1Z8NA 1RPTA 3AFGA 7ABPA 3CXUA 1AM4D 1FW8A 1M8PA 1AN9A 1MJFA 1VHLA 4JT2A 3UVEA 1GGVA 2CK3A 3G2NA 1RPJA 4HDMA 2NZYA 5BR4A 2OP0A 1C41A 3TYXA 2VSYA 5FFMA 3P4XA 3G0OA 1FQOA 3NTOA 3QOFA 4GO1A 3B7GA 5JWOA 3G5MA 1UANA 2CEAA 5ECWA 1OXUA 4LOAA 1YFJA 1D4OA 1XZGA 3U6KA 1KJYA 3A1UA 3RSHA 4U2DA 3ZY2A 1ZD3A 3CPHA 1VL0A 2EJUA 2NQ8A 2V59A 3GEPA 2AMVA 1K7YA 4RPJA 4XD7A 3ROPA 2Q3CA 3V1TC 1ZR4A 3WP1B 4ND4A 5L3VA 1VYUA 2VHXA 5KCZA 1A9XB 1SG9A 1TCCA 1P2FA 4RIGA 1XHLA 5L53A 2R86A 3B1YA 1N7HA 3ZH9B 5A6SA 1JQ5A 2EYUA 3A3KA 4EARA 3ZQ4A 2RB4A 4N39A 5JCJD 1FMFA 1IJEA 2FF5A 4Q0MA 3P2JA 2ZRQA 1U8FO 2WYHA 3L0PA 4GSLA 3KV1A 5JAQA 1U63A 3B13B 2PRIA 4OIMA 3F8SA 2ZAMA 1KMIY 1NR7A 1VP9A 4QUDA 4BZXA 4MUBA 5KYXB 4EY5A 2F8LA 1I30A 2EX4A 3MWLA 4MYCA 5CFNA 2VOJA 3EEQA 3F71A 2QX7A 1W88A 3FLMA 1EFKA 1TAHA 1DTWB 3ZHZA 1CE8B 4UC0A 5F78A 1B42A 4J9VA 5TJ9A 3TM4A 5G02A 4O4HF 2FJPA 2AIRA 3D81A 5IJ0B 1B23P 2R84A 3KR1A 3VZSA 1BCSB 5BVGA 1RQLA 3DLPX 2IPOA 3I6BA 1MLDA 5BW8A 5CDGA 1K92A 1T9BA 2G40A 4ZANA 1DQZA 1HY3A 3ORSA 1MOSA 3ROTA 2WB4A 3I6MA 3ZK7A 2E49A 4GSKA 2JH8A 4FYVA 4X62B 4RTPA 2GAJA 2QPAA 2JNWA 3N8DA 4EHIA 3U56A 1PT5A 1V4BA 3V8QA 1JNXX 3DBOB 3IX7A 1U7ZA 3F74A 1KVSA 3RFFA 3PVSA 1H66A 1GQ2A 1L7OA 1E6KA 2JANA 3FYCA 4MS4B 1KMMA 3QWFA 1LEHA 2QA5A 2XW6A 621PA 1RRFA 3QGMA 1EVIA 3K15A 2ZIWB 1QXSA 2ICAA 4RTLA 3LY8A 4GLJA 2PT6A 3KETA 3RTDA 4EPVA 4FJ0A 1QB8A 1TCUA 1EVLA 4KQFA 2IZ7A 4ZD6A 1LF0A 2H4XA 3DMHA 1RKUA 1FXSA 3HLYA 2CB9A 2JF0A 3BRWD 5AUPB 2IUTA 1UKCA 2L42A 1QKIA 3G68A 4H6PA 4B3HA 5DNWA 2RK6A 2CXSA 2YYZA 1OWLA 2P91A 1ENPA 4A27A 1WZIA 2YMMA 4FCCA 2A1IA 4QQRA 1VGRA 1AXRA 2FQXA 1SEPA 2DHEA 2Q1YA 3D7KA 3IOYA 3L6RA 2B8EA 3QUQA 2LCQA 4Y2XA 4RTKA 4L0CA 2BE9A 1L3IA 1P1CA 2EZTA 1PQPA 3M5PA 4KREA 4Q6WA 3GGJA 4XD2A 2GZ1A 2VC2B 4EEZA 4N7RA 1E5QA 3T5DA 1E2HA 4X0EA 5ITVA 4JSYA 2AOWA 2CJYA 2L17A 5AKHA 2YHAA 4I55F 4OV6B 2CWDA 2JFXA 4EYOA 3HB0A 4D0SA 3EQ7A 2ARKA 4MKXA 3TQRA 2AE2A 5JNWA 4QULA 4GP6A 4Z3OA 2R1UA 4W5TA 4G65A 1NQAO 3G2LA 4PQFA 1G0NA 1DEXA 3C3KA 3HJUA 3PNMA 3UHFA 2QB5A 2AZMA 3LYUA 2JFOA 2B30A 5A2QA 5JHHB 3V9AA 4YMGA 1UWKA 1SPBS 4YRBA 2VTBA 4EBBA 4R9RA 2X86A 1VSVA 4ETMA 2WJVA 2OOSA 3A25A 1IE3A 5JR3A 2BFPA 1RT9A 2O57A 3JVEA 4ALMA 4TN5A 3KNZA 2DSNA 2V4UA 5LOVB 2DPMA 1FVXA 2E55A 4MS4A 2BHTA 3LZCA 2JAWA 1NNI1 1DCKA 2ADMA 4IG4A 5AHWA 3GDWA 1XVLA 3HLTA 1QQTA 2WIFA 2B2CA 3FUXA 3I0ZA 3RTBA 3AIIA 3UQYS 4E11A 4IF4A 5JS1A 3I01A 3LWBA 2RH4A 4Z7OB 3IKLA 3BMNA 2XJ9A 4M8SA 2Z5VA 1AY0A 2G5PA 5A03A 3D7RA 4JNKA 1PGNA 5ALDA 3KYDA 5CXXA 1B6SA 2X0RA 4AURA 5KNBD 4KYTA 1ZJ5A 1PEKE 1K7FB 3NBAA 2ZB4A 1ZXLA 3QXGA 5EXSA 1TK9A 5I7VA 3NNNA 4KLRA 4KUHA 1D07A 1WTCA 5J4LA 2GZMA 4A8TA 5JCOC 4PNPA 3BK2A 1UJMA 2HQRA 5EMJA 1GTRA 5K8CA 1JHMA 3BDIA 5TVGA 5J5AA 4E94A 2OFXA 2F1JA 4WLEA 1I4OA 1NW8A 2FE4A 3ZHYA 4KPEC 4M1MA 1YR2A 3MJ4A 4FQ7A 3WLKX 1U0FA 4U5QA 1EJ0A 1LC0A 1XLWA 3I2KA 1WOYA 3ORQA 1G3QA 4BP3A 1TYAE 3FFAA 1H4QA 3RG8A 1NQXA 1TAUA 1AMNA 4TWBA 1JSZA 5LSAA 3INRA 1K66A 5AJYA 2C9ZA 2BGLA 1K86A 3IB6A 2D1TA 2H18A 2E4UA 4MUGA 4RKYA 5ALQA 3G8YA 5HF5A 2PMEA 1TTPB 1I13A 1JSCA 3P9KA 4B33A 4EITA 2DT8A 3L6OO 1QRSA 2I4TA 3ZU2A 1VDZA 3ZGNA 5G0VA 2JVKA 1AMUA 2G9NA 1NV9A 4NU6A 3HXTA 4O4LF 4IIFA 2FU5C 3GELA 4HPXB 1OU4A 3ZR4B 1I4WA 1P0CA 1RAAA 2PMDA 5BYJA 3ZDAA 4YGYA 1SIUA 4OLJA 1DKMA 1ZCBA 5ECGC 3T3EA 3WLHA 3HU3A 3QUTA 4BP8A 3TTTA 4ZCMA 2WOOA 1NVXQ 4IDDA 1WY7A 2EW8A 2D7CA 4F2PA 2IE0A 4V38A 2BKAA 2YHUA 4G8JA 2PL1A 1H1LA 1UJ6A 1YCGA 2B61A 3QOXA 1OJ7A 1UOQA 5KHAA 2OM2A 4PO3X 3QLUA 2HJRA 3D6NB 4IUDS 3EVFA 5AWFC 1W0KA 1G64A 3C3WA 1ZRNA 1T9ZA 2NV2B 3QE9Y 4Q3KA 4L6IA 1Z4PX 2GUWA 3NUQA 2P0EA 4FC7A 5KSWB 3PC2A 1JAYA 2WVAA 3CH7A 3AU8A 1IDN1 3UYKA 4B0OA 2CJFA 3SHTA 3DR3A 1Q14A 3WRYC 4MUJA 1X0VA 1J9GA 4OXQA 5KDOA 5CD1A 3AMVA 2FTKE 3TNLA 5CXQA 4TSKA 3K9CA 5DM4A 4CUJA 5AVWA 2YWEA 3Q8XB 2WU1A 3ESDA 4WMLA 5JHGB 1LQTA 2BR4A 1R2QA 1VE9A 5B53A 4N12A 2P9GA 4FCVA 3RJTA 5DX8A 1WSAA 4NU8X 1W581 2PY6A 3L6UA 4X1YA 5E6RB 4P80A 1P1KA 4EUNA 4Q1EA 1RTKA 4GP9A 4CYMA 3P9XA 1P0MA 2V55B 4ZZ2A 2VJLA 3HNPA 5CJ2A 2YMLA 4Q5IA 1MB3A 3MWKA 3MOSA 4X7PA 3LLCA 4Z2YA 4F5YA 1C9NA 1NUQA 1UBJS 2PANA 4JBNA 3EXFB 1I1NA 1OF1A 4BTLA 3D6TB 1GILA 3VMMA 4ZMRA 4N5LA 5C34B 3TIFA 5JBNA 3C5EA 1HFEL 3JR3A 4FMDB 1KP2A 1N9GA 1VMEA 1FPQA 4C0AC 2I62A 3B36A 1RRPA 4GWLA 2YC4C 3A1SA 5JZBA 1VHTA 5EJIA 3DL2A 2LIVA 4IEEA 5KBYA 3B9BA 3EQ6A 1HORA 3LXMA 1Z5PA 1DG9A 2IDKA 3UXEA 4N65A 4EF4A 5B4UA 5K3AA 3QELA 4OQLA 1KI6B 2BZSA 3ASYA 4BQSA 4FILA 1EFRD 3TGLA 3WMEA 4UBJA 2Q4EA 5EOVA 1RPNA 2VTEA 2YV5A 2C2HA 2RGNA 4ZMSA 3HJFA 5IT5A 4JLDA 3V4RA 1P7CA 2XCQA 2R5WA 1GAEO 3PJGA 1UFVA 4N3AA 1P2BA 1T29A 2W8ZA 4FK8A 4YAUA 4RSMA 1M0WA 3OIGA 1BYIA 1V7CA 4UHDA 3EWIA 5K3DA 2NU9A 3BREA 5I9BA 5EUQB 3M5CA 4X8HA 1JJBA 2XWPA 3G2JA 1JGTA 2E87A 5ALSA 4AY4A 3NNDA 1I8TA 1U6KA 1AB5A 1J8YF 1XNQB 1H2YA 4M83A 4WV3A 2PO7A 2VAVA 4RV9A 3RJ9A 2WSMA 3HEAA 4CDGA 1KOJA 2I2CA 1E6UA 3HI6A 2Y1GA 4GPBA 4TMWA 3QKSB 3GEMA 4LFAB 4UU1A 4PEVA 4GBJA 4UVEA 4PRZA 3FSJX 5JFTA 5JD6A 3OZGA 4M9QA 4TWAA 1QUEA 3EXG2 4IDHA 4FUQA 3HFRA 4QVKA 3RJMA 5CG1A 1APBA 3F5DA 1I2BA 1H1DA 3NYQA 4FYJA 4O4JB 4RE6A 2WJ3A 4H4DA 3TQTA 3ZV6A 4QZVA 4ZYUA 5LQKA 1NRXA 4I55B 4LZPA 4TRRA 5DRTA 4F4HA 3G9TA 1R66A 1T6XA 1XEAA 4V0LA 4YRFA 4ZI7A 3K0CA 3KTAB 1VCIA 1NBOA 2JZNA 4V1CB 3GRPA 1XZKA 3ICWA 5E1OA 3ZCXA 2HIAA 5BQPA 4P4SA 1KTVA 4RJIA 3BRWA 1NWHA 3KZKA 3NM4A 4JBXA 3T7SA 3E9ZA 4EL0A 2O3JA 1RHMA 1XD2B 2VK4A 3P2KA 3IJ5A 2X1LA 4FONA 3HC7A 4ZDJA 5KTKA 1MO3A 3SFVA 1WXHA 1YZHA 1UFKA 1E6MA 1V8DA 3K1TA 3DUWA 3DE0X 1GN8A 2YXPX 3I1JA 3IAM6 1NMQA 5EZQA 1M6EX 2C78A 5HBGA 4BYGA 2PSFA 1K08A 4O8CA 3UOWA 3PRYA 3Q11A 5BP7A 4OY3A 2R7KA 3JQCA 2A86A 4UOQA 3FVTA 1K97A 2YWXA 3UMGA 2VJKA 4DIDA 4DILA 4C7XA 5ITZA 4KLZA 1H2FA 3H5OA 4IO1A 1YJCA 3ICEA 2AN4A 5BUQA 3RC2A 2GO7A 2CVZA 3L1JA 5E8RA 2QMUA 2Z5FA 4M98A 1DEOA 2J31A 5FTMA 5I47A 1RP1A 1ZPDA 2GAAA 3FLBA 5FPPA 3CZ4A 4FXPA 4OQXA 3RUAA 2R11A 1IHDA 1Y7PA 3A2MA 2A5LA 1BD3A 5BSMA 1Z4IA 3WLNA 3I58A 1R4MA 3V8NA 1U98A 3D6HA 1DX9A 3NWBA 1ATZA 2O3TA 2NPFA 1YXMA 2WKSA 2WM3A 4QICA 3MVEA 2DQZA 4L28A 3R2JA 3AY7A 3UFBA 2NG1A 2BWJA 4NYIR 4GDFA 4BEWA 4NY1A 3FNGA 1AQYA 2PRJA 3FSRA 3WICA 3H9UA 4QPNA 4HNVA 2VXYA 3P20A 1INLA 2A0WA 4EWLA 1GAJA 5JROA 1MAHA 3ZV3A 4ZOBA 3DKPA 4U2KA 5AVUA 2ZXFA 2ZYSA 2ZQYA 1UKZA 3CUTA 4WLUA 2EW1A 3A3NA 4EF5A 1KDVA 1CIPA 4KVAA 2OZPA 4MVJD 3ZU5A 1CPYA 4QREA 3WE7A 1CS0B 2IE8A 1TLLA 2IW1A 1SBIA 1JDVA 4JJ4A 1C30A 2ODBA 2V97A 3WYEA 4EOGA 1EQAA 2OFWA 1PGOA 4L74A 1J70A 4AUEA 4WBNF 1KEPA 1W2WB 3JU3A 4DYVA 1CQXA 1PW7A 2JL1A 2VOEA 3KCNA 3RE1A 4A0RA 3GLIA 1NBEA 3HVIA 4CM7A 1C7FA 3IULA 4NDZA 1Q1GA 3JR7A 4FFMA 4MHSA 1KGDA 2NO9A 5KMGB 1TADA 2EQ5A 2BI8A 4LF7B 4NAUA 3JARA 3ETHA 1GLGA 1EE9A 2R47A 2XTAA 3GRFA 1FFCA 2LVBA 3CYFA 2ZBVA 3L8MA 3RVJA 3WNDA 2POQX 2ZR0A 4GHWA 2BGWA 3LH5A 3IV9A 2G7ZA 1PRYA 4LDZA 4XQ9A 3THXA 2ZVDA 4RY2A 4F71A 1FP4B 2WUGA 1EINA 1YJBA 4IJQA 4GEGA 1K98A 2WSSD 3DE7X 4G26A 1SHJA 1E3LA 2LP4Y 3CLTD 3EGDB 2PXAA 3QMPA 1G8MA 1N1MA 1J2RA 1I5OA 3PC8A 2NP6A 4I4LA 1XU9A 3KOWA 3O26A 3RC9A 2A2ZA 1QF7A 4Q3LA 1BDHA 2W6IA 1O6GA 3RUHA 4IGIA 1GDDA 4DWVA 1BS2A 1P7YA 1O4WA 1TZJA 2OMKA 1CIVA 4IYJA 5IFKA 3PWKA 3CLRD 2FR1A 4TWZA 1QP0A 4ZVVA 1KI3A 1WNTA 2MMGA 2SBTA 3ZHBA 1EFUA 2ZYVX 2L2QA 5FNVA 2UUCB 3O73A 1NQTA 2XB6A 3K8OE 3EY4A 2O50A 3NX4A 3BRSA 3AG6A 1K5PA 2QKYA 4J9UE 2UZ3A 3A6PC 1B6TA 4G0ZA 4Q3DA 4QUIA 2HCFA 2HDWA 4EX7A 2FOIA 4H18A 3D0OA 5AKKA 4MIOA 3A3PA 2DG2A 2D0IA 4RGQA 1E1NA 2GK3A 3O75A 4ARUA 1CP3A 3DZFA 4HWRA 1QIKA 2Q3EA 2YN2A 3B52X 2FPIA 3KUXA 5KYUA 1UP7A 5CVEA 2FJ0A 1UJ2A 4JIGA 4MS1A 1TTQB 4AX4A 4DLAA 2CLLB 1JH9A 4LYEA 2RKBA 4AT1A 1GPNA 3R6LA 2VPXA 4RLFA 1VPVA 4M7RA 1FLVA 1Q0HA 2XITA 2PYIA 4IICA 1JDNA 4MQ5A 1XCPA 5ALHA 3VH4A 4XSGA 1QRAA 4QDZA 3T8YA 2PUVA 1XUOA 2FXIA 2IT1A 3QU5A 2WU8A 1ZINA 2FQYA 1JJIA 1A5TA 1V71A 3ETJA 3QV2A 4XVRA 3URKA 5JZVA 1L7NA 3HBFA 3EG9A 5H70A 4HNQA 5D87A 2RGRA 3AKDA 1W75A 3JQQA 3ENWA 4YJ2A 3ZK9A 2HZ7A 4RMJA 2XAUA 1KAOA 3EUEA 2ZBPA 1FSFA 3TAXA 1GEEA 4E5NA 2GYVA 5F1PA 3DYIA 5FOUA 3TLKA 1W48A 3ISVA 4Q3AA 3EIEA 1ZISA 3TOSA 1FTYA 1PBNA 4HGPA 3B3GA 2IP4A 1ZM7A 2R0QC 4H1VA 3ZS8A 1WB5A 5EFZA 4OHYA 4NEHB 1PZFA 2MYNA 2FSVA 3OEWA 3VVMA 1PEDA 4CIXA 1HLDA 1QLWA 2YDYA 4LG1A 2G9RA 1QIIA 1IBCA 1BOOA 2ODNA 5I01A 3LNCA 4EG6A 2ORYA 1I7DA 3PUYA 1EU1A 4GI5A 5T4HA 4X7RA 4ZVMA 4A16A 5K6TA 1PR1A 4IVRA 2A0YA 1NV8A 3K1ZA 4LPKA 3VX3A 2VHCA 1E1QD 3TRFA 2EOAA 1L5HA 1DV1A 3C4VA 2O20A 4EPXA 2RHWA 4H0CA 1U7HA 1PJ2A 3MS7A 3WY9A 1PT8A 5T3YA 2QRPA 3GUHA 3LDUA 3IVGA 4PVCA 1OTYA 1Q16A 2VH1A 4E14A 1BWQA 2QSJA 2FPIB 3HWRA 2P1ZA 1NSTA 4RA9A 3AKCA 3QVGB 3TZCA 3V33A 1EXNA 4EPYA 4JI2B 4PV7A 2X41A 3MB5A 2Z58A 2HCRA 3ANXA 2ZCUA 2I2FA 2V3WA 1M76A 4BVEA 4R0MA 5KWSA 1ES9A 4LV5B 4ZWNA 3H2JA 1G98A 5HFJA 4JI8B 2G04A 1IN8A 2LKCA 5CB6A 3Q3GE 2GTHA 1P2TA 1VSTA 4CF7A 4JC4A 3RFCA 2EKLA 4TRJA 4NBSA 4OXKA 1QO9A 2B9VA 1YQUA 2YV4A 5AVOA 2NSHA 1TM7E 3C4JA 1F7UA 1Z5ZA 3NIDB 2WIDA 1O3YA 3DP7A 3HCCA 3UC9A 1QVVA 1X38A 3B9QA 2A0KA 4Y9DA 3BXXA 4QUEA 4C6TA 3E22B 4WVLA 1KBOA 2A9OA 2AKYA 2Q0QA 4HZGA 3N07A 3E23A 1CG6A 2B35A 3IAS6 3D3WB 3ND9A 4R0NA 4V2UA 4Q3OA 4Q4AB 1R8XA 4DNFA 4EG3A 1E2GA 1PJQA 3SKXA 4ZI7B 2PJRA 5HDBB 1BMTA 2CE2X 4QOEA 3UWSA 1F14A 1Y1SA 2R65A 4IGKA 1QANA 3KG2A 4TMYA 5B1SA 1JI0A 1R4MB 3C3CA 2RHTA 1Z06A 1SG6A 1GRVA 5JS2A 1PNQA 4Z4CA 1DWUA 2GN9A 2VRCD 1H3FA 2IRWA 3D6VA 5KVSA 4PIPA 4MI3A 3RIYA 2PK3A 4C5BA 1PLKA 1JWLA 2F9LA 4JLWA 4TLMB 1H0RA 2BRUC 5IVIA 1FX1A 1D0IA 2GEFA 5ITSA 5HRUA 3ZIUA 2PBRA 1RXSA 3VAYA 4FTWA 3VR6H 5C7YA 2FN7A 1CX9B 2OTCA 3SIPA 1K75A 3Q6MA 5HF9A 3MJCA 3OQJA 4YDSA 3PXAA 4R1TA 3TDKA 3ENKA 3KLPX 3OJWA 2PQMA 5ULLA 4UTVA 5C5EA 4D9GA 2GNAA 2ISCA 3B7PA 5FPHA 4K9MA 4G5QA 4XSHA 3PT9A 1W4RA 1GG9A 5F1OA 1M66A 1XK6A 2OUIA 2VDUE 2HGZA 1ADCA 2RJNA 2WT4A 2Z8YM 4N0DA 3N59A 2WW8A 1YZQA 5AVJA 3G9ZA 1J1UA 3FPEA 3QKTA 4KLCA 2Q2OA 2Q28A 4C43A 1C7JA 3GIWA 4MKRA 1RI3A 5TE9A 5CFPA 4G1CA 5CNKA 1RXVA 1IPFA 2HU7A 4XIJA 3V8VA 2YHSA 3QXCA 4I8DA 4LTMA 3VO8A 2WI8A 4TSFA 1ZICA 2K2QB 3OM9A 4XFJA 3ICQB 1GQQA 4KKVA 4C7MA 3IEPA 3WGJA 5H9WA 4K6FA 2P4SA 5K0SA 3IUNA 4MV9A 2WAMA 2ZJ4A 3ABSB 4Q34A 2VPPA 1YRQA 4AJNA 1G6KA 1LLUA 1XL0A 5B3JA 5EJ7A 2F3SA 4IOMA 3IERA 3CPJB 4N3GA 3WK4A 3KQNA 5U1PA 3G2OA 2QI9F 1R7RA 2VKQA 1A9SA 4LF6B 1KZ7B 1WF3A 1Q44A 4BLTA 2Y2UA 2FEPA 2OV6A 2RSLA 3BMNB 3DGFC 4UNQA 3J81A 3ONFA 1EKXA 3BK1A 3W2HA 5FT9A 4UUPA 2RGYA 4DV2B 2Q1WA 5JMOA 5FAKA 4HK4A 4PLCA 2ZW9A 3H5VA 3LCUA 1ZJZA 4FGZA 2R66A 1Q0TA 1GL7A 2XT6A 1GP2A 1OIVA 2FMHA 2H65A 2NU9B 1AQUA 5TMPA 4U9HS 3D3QA 1LDYA 2KQUA 2EJTA 3KT3A 3TAHA 4E15A 2RD2A 2WHQA 4N82A 1YFLA 4YMTA 2GM3A 4L85A 5BW5A 1DQNA 2WABA 5KU1A 2DJIA 1Z6TA 1QZZA 5AW7A 2Z43A 3JD4A 4X1KA 4E3WA 4B32A 1B3BA 2ZU6A 1THGA 4H1UA 4LNAA 4RVNA 3DO6A 3NIWA 2MJLA 1DIOB 3MG9A 3I12A 2YY6A 3MFYA 2FSUA 2AK3A 4WNYA 3LAWA 5ALVA 1H0HA 3DBLB 2Y1DA 1HEUA 1ST2A 5DBFA 4Z6KA 2YFKA 5G1PA 3C7TA 5K3BA 3DBHA 3I6IA 3L8FA 5EWJB 1QHFA 1UBSB 3M89A 1AF7A 1QQAA 1NG9A 4ZV7A 2ATXA 2WWHA 4KR6A 1LVHA 1EBBA 2Z6AA 5HUJA 1X13A 1XTBA 2EZ4A 3U4DA 3IUQA 4X20A 1ZUNB 1Z0AA 2JAUA 3F2IA 5H7XA 3GYBA 1O58A 1ZD1A 4RQTA 1GUZA 3VU9B 3CHYA 4DUPA 3F46A 3Q2KA 2VYND 4O5AA 4OBXA 1RAHA 2CLFB 3KJGA 4EZBA 1XDGA 1MC4A 3WBFA 1F1JA 4JLKA 2A9PA 1OA1A 2BF7A 3LECA 3PHJA 3CMCO 1RXWA 1V4NA 4S0ZA 5ETJA 4OFWA 1MOPA 4UAGA 4KU4A 4WE3A 4AJ1A 1B8NA 4MWZA 4U9IS 5KWVA 3K71B 5CD9A 3SR3A 1L5KA 4UTXA 4Z3KA 2AC2A 2IEIA 4LWZA 5ECDA 4L07A 5LR6A 2DM6A 1Y4UA 2ZWOA 1ZW6A 2VN8A 2JFWA 3U7JA 1E2JA 2L19A 1P5ZB 2ZJYA 3ILHA 5I9LA 3EVGA 2ZJZA 1UC5B 2BHLA 2NPIA 3SZ3A 3OAAD 1L4UA 5LQRA 4U3JA 4ZVOA 2QMEA 3AJAA 2ANBA 2PUHA 4UTOA 4UTRA 721PA 5KNCA 4LJYA 4P3OA 2HT6A 2RHCA 4FYWA 3CXRA 4IFTA 4Z7JA 5IT0A 2GBPA 4LE2A 4Z0NA 3TBHA 4DDMA 2IYXA 2TMGA 3GLHE 5HQ3A 1N1GA 1JKIA 4EL5A 5ENZA 1AIPA 1EDDA 2P3LA 2VFAA 5HDQA 3VTKA 5JJCA 3KXLA 4MV3A 2P5YA 4MUEA 5TVKA 1N32B 2AMLA 3ESQA 3P9PA 2UV8A 3LL7A 4V0ME 1N9GB 2VJMB 1M1XB 4P5DA 4XR9A 3AUUA 2NMVA 4MV8A 1FRFS 4F4FA 3I9MA 1MGOA 2CBGA 1U90A 1XFDA 4GXNA 3TTXA 2YOGA 1AO3A 1ZONA 2PMKA 4PHGA 2QVCA 3PDJA 1OV4A 3KEFA 3GDHA 3L7JA 1PJLA 5IUNC