2R49A

Mutational and structural studies of e85i reveal the flexible loops of fibrobacter succinogenes 1,3-1,4-beta-d-glucanaseglucanase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
b'SAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSIKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
molecule tags Hydrolase
source organism Fibrobacter succinogenes
publication title Mutational and Structural Studies of E85I Reveal the Flexible Loops on Truncated Fibrobacter succinogenes 1,3-1,4-beta-D-Glucanase
rcsb
total genus 59
structure length 241
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2007-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r49A00
5KXEA 1IS5A 3WZ1A 1GZCA 1PZ9A 3HN1A 4FOVA 2AR6A 4LBKA 2DV9A 2YY1A 3AP4A 4P9YA 3PVEA 4BPZA 3AXEA 1QMJA 4YFWA 5DG2A 1AJOA 1VIWB 3AYDA 4Q8KA 1G8WA 3ZSJA 1SFYA 3T2TA 1S0DA 2V73A 2DUOA 4FP3A 1Q56A 3WNXA 3WDYA 2E7QA 2ZHKA 1UZZA 2WLQA 2D3PA 1BKZA 3RMYA 2EXKA 1YYNA 1ENRA 3PJQA 1ENQA 2R16A 3LSEA 4CRQA 5E8AA 2VU9A 3H0OA 3M3QA 2DUPA 3AK0A 1YXWA 2DVGA 3M1HA 4CTEA 2CYFA 4YW3A 3HR9A 2NN8A 1LESA 4C1XA 1Q8SA 3CNAA 1V6NA 2PHWA 1FATA 5DZFA 1SACA 1N1YA 5F5QA 1A3KA 1H9PA 3WUDA 2YROA 1LODA 3IKWA 1W0OA 4XBQA 3VKMA 2YXSA 3PVOA 3UJOA 3N7JA 5IK4A 3WV6A 2A6ZA 1W6NA 4XBNA 1MS1A 1HQLA 3W59A 1Q8QA 2CNAA 5DUWA 3WG3A 2ZGRA 1APNA 1ULFA 1W6OA 2NYYA 2UWCA 4YM1A 5CA6A 4Y1YA 1N3PA 1KJRA 4YM3A 1AXYA 2DYCA 1GNZA 4YZ5A 5IK8A 3RRDA 4YLZA 1CONA 5T50A 3FLTA 4FPCA 4XJUA 1SLCA 2D6MA 2P3JA 2D6LX 2WJSA 2ZMKA 5JMCA 1LGBA 1QU0A 4XDQA 2OW4A 2H0BA 2ZKNA 2EALA 4LBLA 4R9CA 2ZGUA 5T54A 5DG1A 4YZ2A 1FV2A 3JU9A 5GLWA 5F9TA 1WCSA 1W6NB 2WNEA 5EYYA 4IQPA 1AX0A 1LOEA 3MW4A 4ASMB 2R1BA 4BLJA 1J1TA 1MS0A 3N3HA 2NP0A 3AXDA 5CBLA 5JOWA 4BMEA 3ENRA 1MVQA 3WG1A 3ZYPA 3UJQA 4YW5A 2EXHA 5L73A 3VKNA 1AXZA 4FPGA 3RSJA 3WCSA 1LOCA 3W58A 1D2SA 3SH3A 1SCRA 3A0NA 2CTVA 3NWKA 4R9BA 3ZSMA 1AX2A 1LOBA 2TEPA 2DVAA 2ZHNA 3BTAA 1O4ZA 2W08A 4UW5A 3UK9A 1DQ4A 4YM0A 4YG0A 1RINA 5GZFA 5H9RA 4ZXKA 2OVUA 3WCRA 2ZBJA 4YZ4A 2CY6A 1RIRA 2GMEA 4DQAA 4JCKA 1W6MB 1KDKA 2GNMA 2JJ6A 1S0JA 3GALA 4GXLA 4PCRA 4TYSA 3ZSKA 2JDZA 4FPYA 1CN1A 1S0GA 2D3SA 1MS4A 1CJPA 1CPNA 3N7MA 5LK5A 2E51A 1KQRA 2D6NA 5H9SA 1GLHA 4Y20A 3ZXFA 2EIGA 4W65A 4XE9A 2V5YA 1YIFA 2VW2A 3WHUA 1IOAA 1N1VA 4FPOB 3MEPA 3O0VA 3I8TA 1URXA 4Y1XA 2ZMNA 1XQNA 2PHRA 4AGVA 1JOJA 4GKYA 5GZGA 1KRIA 2ZA9A 1WBFA 4FPEA 1W6MA 4FPKA 2JD4A 2NMOA 3USUA 4Y1ZA 5EYXA 2ZGSA 1LGNA 2ES3A 4LBJA 3WDUA 3APBA 5T5JA 4Z8BA 3POYA 1GNHA 2UU8A 3NV2A 1C1FA 1SBFA 1KJLA 4XMAA 1MZ6A 2ERFA 1MZ5A 1BZWA 4GWNA 4Y20B 1UMZA 4NOTA 4FPJA 4BMBA 1JBCA 1QKQA 2ZGOA 4PQ9A 1DQ6A 4K1ZA 2B7YA 4Q8LA 5KXBA 4ITCA 2W68A 3RMXA 3AYAA 1WLDA 1V6LA 1FNYA 2GNDA 4LBMA 3ZXLA 4UW6A 2RHPA 1AX1A 1O4YA 3N35A 5GLVA 1G9CA 1CESA 1X50A 1C1LA 3B3QE 3VKLA 4UW3A 2GALA 3VKFC 1MS8A 1QF3A 2DURA 2ZGPA 3WVJA 3FLRA 1DQ2A 2ZGKA 3WDXA 3OYWA 2WQZC 3B01A 1D0HA 1R1ZA 1MS5A 4AVSA 1F31A 2D3RA 2R49A 4LBQB 1LOFC 1MR5A 3V0BB 4C1WA 2WT1A 1S0IA 5EXOA 1AJKA 3IMNA 1VAMA 5DUUA 4AYUA 3PVNA 4AVTA 2G4IA 1LCLA 1FAYA 4XXAA 1WW5A 1JYCA 3NV1A 1WLCA 2A71A 3AZWA 1NLSA 4R9AA 1Z0HA 1WUVA 3B69A 4Y24A 1GZWA 1W6PA 5FREA 2VY0A 4XXPA 4JC1A 2W39A 3O0XA 5H9QA 3SH5A 4PBPA 3OYWB 1U0AA 4FPFA 3N7LA 5JLVA 2UWAA 1QOOA 1DZQA 2AUYA 5IT6A 3L2YA 2ARBA 2ZGMA 3NV3A 4TZDA 2YMZA 5T55A 1LEDA 2DVDA 1S0BA 5KXCA 2LTNA 5SV8A 3O5SA 2VW1A 3ILNA 1DQ5A 4XIOA 4I30A 5CB7A 1AVBA 4KBBA 4CZSA 3ILRA 4LBQD 3POWA 1MS3A 1WW7A 2AREA 4FOQA 2CWSA 3U4XA 1SLLA 3FLPA 1BJQA 5BYNA 1ULEA 3D5OA 3BIWE 3WDTA 4M3CE 3SLIA 5GALA 2A6XA 3OY8B 4GALA 4M3CF 1V6JA 5JOYA 4M3CB 2A5ZA 1GYKA 4NO4A 3A4UA 2YZ4A 1CPMA 3BOPA 4OZXA 5E89A 1LHVA 3MW2A 4YW4A 3AZVA 4ATFA 1W6QB 1VLNA 3WDWA 4UW4A 1SLAA 1G7YA 3VKOA 1LHOA 2OUHA 2XB6C 2EXIA 4AWDA 1HQWA 2P3KA 2NMNA 1SBEA 2C9AA 3TAYA 1CIWA 1N47A 3ZXEA 1Q8PA 1V6IA 2EF6A 4R9DA 1NXD1 3AX4A 1SLTA 1OKQA 4U36A 1DIWA 3OBRA 3M3CA 2I2SA 2GMMA 1MS9A 4F83A 1G9FA 1ONAA 4XOGA 1DGLA 1F5FA 2BQPA 3WUCA 1WW6A 4YG3A 2WSUA 1W6OB 1W6PB 4DRRA 5GZDA 3OY8A 4XIKA 3ZXJA 3WHTA 3QLQA 5JOXA 1V6KA 3INAA 3ILFA 2JE9A 3OBTA 1HDKA 1VALA 5FRAA 3OGGA 1DHKB 1QOSA 3SH4A 1SLIA 3FBYA 1WBLA 1H9WA 5T5LA 3RS6A 2P3IA 3WDVA 1UL9A 4FP2A 3V0AA 4XTMA 3DGTA 1IS6A 2GN3A 3ZSLA 4Y26A 2PHTA 2R1DA 3ZXKA 4D69A 4FPHA 1AXKA 2ZACA 4YW2A 2JECA 3Q9OA 1JW6A 5DUXA 2ENRA 1DLLA 1GBGA 1WD4A 3QCWA 5JVVA 4DFSA 2C5DA 3USUB 2E7TA 4Q1RA 2DVFA 1A78A 2DVBA 2ZGQA 2JE7A 2CWMA 2P2KA 1YRZA 1ENSA 4Y22A 3O0WA 2FMDA 1S1AA 2ZMLA 3R05A 4ISQA 2XG3A 1UZYA 4RL7A 4WVVA 4XJZA 3WG4A 4HL0A 4MYEA 3AJYA 2NZ9A 4YGDA 1N1SA 1W6QA 3AYCA 2WT2A 3UL2A 1WW4A 2ARXA 2JKBA 1LEMA 4XYXA 1LOFA 3ATGA 3N7KA 1H30A 1WD3A 3A0KA 3FFZA 3WLUA 1JHNA 3SNMA 2AYHA 1QNYA 2DU1A 2GNBA 1G9BA 1RITA 2ZGLA 3FUQA 3HMYA 1QDCA 4Y1UA 4YG6A 1WLWA 2ZHMA 3KM5A 1DQ1A 2GDFA 4YZ1A 1B09A 3AFKA 3I4IA 3AP6A 4LBOA 4BM8A 1GKBA 1LHWA 3LCPA 3M3OA 3IM0A 3O12A 4XJWA 4DPNA 4PF5A 1SBDA 3N36A 1OFSA 1ULGA 1Z78A 1G9DA 1SCSA 2VW0A 5GLTA 2A3YA 3D4KA 4LBNA 1LGCA 2DTWA 3V64A 4ATEA 2CL2A 5JOZA 4DS0A 3AZXA 2D7FA 3AZYA 1LULA 2DWRA 1BQPA 4XJ8A 4GKXA 4YW1A 1CVNA 1I3HA 2A3WA 4XJ9A 2A70A 2WT0A 2PELA 4XMIA 3AZZA 3RG0A 1AZDA 2P37A 3B9CA 1TEIA 4M01A 4BOWA 3ZPYA 4DRVA 1CQ9A 5EWSA 2SBAA 3B00A 5IK7A 4BLIA 2SLIA 1OQ1A 1ULCA 3M3EA 2FHRA 4XTPA 5GZEA 4ISRA 5HCAA 3IN9A 3M2MA 5GZCA 3D6EA 4P9WA 4Y22B 2AH2A 1S0EA 2NM1A 3OJBA 1GV9A 1HLCA 3ZVXA 3T1MA 1CR7A 3GNEA 3LSDA 2D43A 5JDBA 2VH9A 3V0BA 2GN7A 4H55A 5HCFA 1BYHA 1S0CA 1SLBA 1MACA 3FUOA 3MPPG 3V0AB 4BQ1A 1KITA 1QOTA 1N1TA 1FX5A 2PHFA 3R4SA 4Q27A 2A6VA 4M00A 1IKQA 4U2AA 5T52A 1LOAA 1LU1A 2WSVA 4WV8A 2P34A 2ZGNA 1V6OA 3AP9A 5AVAA 1DYPA 4XBLA 2ZGTA 3VV1A 4RA0A 1V00A 3MW3A 1UPSA 1LECA 1PZ8A 2A7AA 3RQ0A 4ZKTB 2A3XA 2UWBA 1FV3A 1QGLA 3IPVA 4SLIA 1DYKA 4Q2FA 3TB0A 4XHBA 2PHUA 4LBQA 2D44A 4GWMA 1LOGA 4YGBA 4YGCA 5T5PA 2E6VA 2HYKA 1DFQA 2R0FA 1BXHA 4FPLA 1IKPA 4AGGA 4GA9A 4K20A 2R0HA 1QNWA 4P9XA 2Q5TA 4YGEA 1IS4A 1IS3A 1LTEA 1C4RA 1HKDA 5IUQA 2YV8A 3OPZA 3AP5A 4XJAA 3V65A 1AF9A 2KM2A 1VAVA 1FYUA 4YZ3A 4FVVA 4Y1VA 2LALA 3AYEA 3POSA 1GANA 1GZWB 2PHXA 5DZEA 1LU2A 5HCBA 2WKKA 4XHXA 4M3CA 5T5OA 4WVWA 1GICA 1DQ0A 3JUUA 4WZFA 4K1YA 2ZHLA 1Q8VA 3KQRA 1JYIA 1C57A 5E88A 5DUVA 1FNZA 4HANA 5GJ6A 4XILA 1A8DA 1Q8OA 4JRAA 3NV4A 1YO8A 2ZZJA 2EAKA 4PBOA 1G86A 2D6KA 3WG2A 1KDMA 4FQZA 1JN2P 2W52A 1YI7A 1LENA 1JXNA 5GLZA 4YFZA 4YM2A 1LHUA 1UAIA 1LHNA 3SITA 1DBNA 5DZGA 2ZABA 4L8QA 1S0FA 1UN1A 2GMPA 4FQ4A 4XZPA 1N3QA 1ZA4A 5GM0A 4FOWA 3T1LA 3IPVB 5IK5A 1GZ9A 2AENA 2UURA 4AGRA 3WOGA 1MVEA 2A75A 2GNTA 2VXRA 3BODA 4K21A 2D6OX 2D6PA 3ASIA 4FOYA 2VUAA 2EXJA 1GSLA 4P14A 1PZ7A 2OUJA 1G9AA 2DTYA 5CNAA 1V6MA 2ZAAA 5DXDA 3ZYRA 1UX6A 5GLUA 3R4UA 2A6YA 4Q26A 1I1EA 1QDOA 5H9PA 2DUQA 3SISA 1LJ7A 1JUIA 2Z42A 1UKGA 3PMEA 1EPWA 3AJZA 3VUOA 4Q1PA 3AP7A 2A6WA 2AGSA 2DU0A 5KXDA 3DUIA 1W0PA 1ZM1A 5CAZA 1F9KA 3C2UA 1N3OA 1ULDA 1Y7BA 2E53A 4AVVA
chains in the Genus database with same CATH superfamily
1JOPA 4QGMA 1IS5A 3DL3A 2Q30A 3WZ1A 1VRH1 2BGOA 3S57A 1W8NA 1PZ9A 2HWF1 3USSA 4YARA 3N4MA 3ACHA 4NHMA 3AXEA 5DG2A 2XWJB 5F3IA 1O6UA 1VIWB 2VZOA 3AYDA 4PLMA 1DF0A 1YI9A 5ISLA 5IVJA 3MI8A 4FP3A 1NQJA 1R081 1CAXB 3VHPA 1ST8A 4PDWB 5FO9B 5KR7A 4FSJA 3A21A 4B4QA 5BNOA 1ODMA 4LTAA 1OI6A 4DMIA 3NKGA 5IAXA 5C3SA 2R16A 1ASJ1 3K2OA 3IWZA 1RUI3 2RS11 1OOPC 4MGSA 3POGA 1JUHA 2O14A 2OQ7A 3AK0A 1HJGA 1HX6A 3M1HA 1ZRIA 3MICA 1VBE2 5FOBB 3HR9A 3OOXA 3VBOB 5KHIA 4C1XA 2VZ3A 5JUVA 1AR82 1Q8SA 3JB4C 4F8AA 2JDNA 2WR9A 5JXHA 3JXSA 2PHWA 1FATA 4LIUA 5FAXA 1N1YA 1XNDA 4BQ5A 2VO5A 1RTVA 4YYOA 4D6SA 2YROA 1I6XA 5BNNA 1UY1A 1PHMA 2WQ8A 1YIPA 2YXSA 1ND2B 3N7JA 4UYBA 5IK4A 4CEWC 2A6ZA 4IE7A 4CUAA 5K9YA 1R1A3 5FY8A 1XE8A 3HT1A 3WG3A 1XYNA 2G19A 2ZEWA 5CA6A 4C91A 4WM7B 4Y1YA 4BK4A 4BIOA 5C4WB 4CXWA 1GNZA 4TSVA 4GH4B 3VN4A 1OLQA 1DGWA 4N9IA 4BZ4A 4Y3OA 4A45A 2Q8OA 1WCQA 4XAEA 3MFAA 4CDWC 2OA2A 1QU0A 3KLSA 3ZM8A 2OW4A 2AC1A 2H0BA 4LBLA 3PLQA 1ENXA 2W46A 2ZGUA 3RI8A 4AFCA 4EN6B 4YZ2A 3DN7A 4CCEA 4DUVA 1K42A 5FZBA 4XFFA 3VHRA 1XE0A 5CFCB 5F9TA 1WCSA 5FYMA 4Q4V2 4AQ6A 1LOEA 2R1BA 4BH9A 1MS0A 3I2IA 3N3HA 1Y9QA 2NP0A 5FKCA 3HJRA 3HQRA 3GYDA 1JZ7A 2FDHA 2ZX2A 4AI1A 1COV1 2QQVA 3WCSA 2G9GA 4I01A 3MV11 4Q4W1 5C8CA 1D2SA 3D0JA 3KVBA 2MHFA 4CP9B 1F5JA 1K5MB 1UX7A 2HWC2 3TRSB 5FCCA 3A0NA 3VZLA 4IE6A 1GFF2 1S2KA 1W8OA 3NWKA 1WCDJ 1R082 1LOBA 5FPAA 1C8M1 3UK9A 4YG0A 5IATA 3NJZA 3QH7A 4HN1A 5CIRA 1S2BA 3WCRA 5BNOB 2GMEA 3ZYBA 4JCKA 3C3VA 1AYN3 2IZWA 4I0AA 4JGZC 1O59A 2WO7A 5BNQA 5A32B 2J1VA 3O14A 3ZSKA 4AFAA 5A7WB 4ZHNA 3OBZA 4RS5B 4BQWA 2LRPA 1CJPA 2JENA 2JG9A 3NRUA 5JIUA 4YVSA 1W39A 1NY72 2D6NA 2P1BA 4Z2WA 5FUNA 4PLOA 4Y20A 1RUJ3 3ZXFA 4IETA 2EIGA 4XE9A 5BV6A 3UYJA 5A3NA 2QQJA 4CCDA 4ET7A 2LS6A 3MIHA 4Q0UA 3PIGA 3PJYA 5CADA 5FYHA 3MEPA 4DEQA 2KA3A 2PQQA 4DOUA 1H1MA 4Y1XA 5JAXA 4EN7B 1NCQB 3MV01 1JOJA 4EN0A 4GKYA 4O9EA 4R4XA 2AZ5A 1W6MA 2JD4A 4DZGA 1GR3A 2NMOA 3CF6E 4IEVA 4NROA 4WBBA 2P17A 4WVMB 1YJLA 4Y1ZA 3USUA 2ORXA 2ZGSA 5FZKA 1GNHA 2UU8A 3NV2A 3UT0A 4AQTA 4HPKA 1AR72 1ZRCA 4ONUA 1VBB1 1H2LA 1MZ6A 2Q1MA 5I8YA 5L7OC 3HNMA 1BZWA 1F15A 1ZBA3 4GWNA 4Y20B 1QKQA 2GH8A 2ZGOA 1DQ6A 2VOKA 4Q8LA 2B7YA 3POJA 1KEXA 4ITCA 3ACIA 4XCBA 3AYAA 2XVKA 1VPHA 2GNDA 2IXJA 2E26A 4NN0A 4JGYC 3IIAA 4P9GA 2FCTA 5GLVA 1SZBA 2R7EB 4JHZA 1CESA 1UMIA 1C1LA 3NJVA 3VKLA 2HWC3 2V4VA 2Y6JA 3B94A 3VKFC 4A44A 5JI7A 2CGOA 1QF3A 2DURA 4QPYA 3ZOIA 3O1PA 5IJRA 2ZGKA 1K12A 2JKXA 3OYWA 4JGZB 4LOSA 4AVSA 1F31A 5I91A 1K5MA 1OF4A 5F39A 3VBOA 4COWA 4M4PA 1J58A 3MDPA 5DUUA 3PVNA 1LCLA 1FAYA 2C26A 2W87A 1XRUA 2XLFA 3MHZA 3O1TA 3TEWA 2ZAHA 2VZQA 4X6QB 2WWSA 2BZDA 1PVC2 2A71A 3JQXA 4A3ZA 1NLSA 1V70A 2VCCA 5C3OA 4Y24A 1XSRA 2HWF3 1BK0A 2QFEA 2DFCA 1NCQC 1GQHA 2PLV2 2VY0A 3FFQA 3K46A 5C3RA 2W39A 3LIGA 3ON7A 2VE1A 3GBGA 3SH5A 3UV9A 4KNCA 3OYWB 4FFHA 5HCHA 2UWAA 3BPSA 1TNFA 2AUYA 2LM3A 3EMRA 4I3PA 5LB6A 5FZDA 4TZDA 4AI0A 5T55A 4I3GA 4RQPA 5SV8A 3ZXDA 5ABJA 1VMJA 2VW1A 2HWB2 1DQ5A 4LHNA 1W8FA 5EJ1B 3KT4A 3Q8EA 5KHGA 2VL4A 1WW7A 3BB6A 4IL7A 3U4XA 1KXGA 3FLPA 3LEKA 4QHBA 3ORJA 1BJQA 2X09A 3VDDA 5FQ0A 3BIWE 2DCKA 1ASJ3 4ZY9A 2RJKA 2W5FA 3BYWA 3OG2A 1IZ3A 3K4DA 1GYKA 4NO4A 5CG8A 3R4DB 5A1LA 2VAUA 4UAPA 5AFBA 4OZXA 4YW4A 1O3QA 1YUDA 1SLAA 1REDA 1J84A 2JG8C 3VKOA 1SDDB 1W8TA 3KD4A 3VD9A 3PDQA 1HQWA 3B7MA 3L9JT 3TAYA 1T6GC 1VBA3 4IESA 3ZYFA 1YWKA 1Q8PA 1V6IA 4W8JA 2GH2A 4QMAA 2X5IA 2CSGA 4XFBA 1R091 4QWNA 4U36A 1GU3A 4XUNA 5F3EA 2FDKA 3M3CA 5DPNA 2QQUA 1MS9A 4Y5SA 4QKNA 4QX0A 2ADEA 2CHHA 4XDPA 4YG3A 4AK3A 4W4ZA 3VBFC 1TZOA 1W6PB 4ASLA 4HSLA 4DRRA 2EA7A 3ZXJA 3LDKA 3QLQA 5JOXA 2YG0A 2W91A 1NZIA 1XU2A 3W5MA 1HDKA 1NX9A 1VALA 3W21A 2H6CA 5JZGB 1OMIA 3G7DA 1XOYA 4KMQA 1ZRDA 4KGGA 1SLIA 4DXRA 3FBYA 3H1YA 5DAQA 3N9QA 4EE2A 3K3OA 5FZOA 2N7GA 5DAVA 4CEYA 3MIEA 4XEZA 1HRV3 1L7LA 4X8PA 4CVUA 1XE7A 1FPN2 2W1SA 2GN3A 3BGAA 4X8NA 3AMMA 3ZXKA 4D69A 5AC91 4FPHA 2CV6A 1F4HA 2ZACA 4YW2A 4AG4A 4CYDA 4JDNA 4QM8A 1JW6A 1QQP2 3MFCA 1W9SA 2ZX3A 1RMU2 1ENSA 1J1LA 4GJZA 4MGIE 2FMDA 1S1AA 1YFYA 2ARAA 4MO3M 5JXJA 1UZYA 2L9LA 1PNFA 2WNUC 3KVAA 4YGDA 1D7PM 1UF2C 2NZ9A 5IVFA 1W8WA 2WZR3 2WT2A 5A3OA 1JI6A 3UL2A 5CKNA 1WW4A 2ARXA 3KF5A 2YB7A 1E5RA 3ZYIB 3POEA 1WD3A 3IIIA 3WLUA 2Y8KA 3BN6A 3SNMA 2W1QA 4MGQA 1E5SA 1QNYA 2GNBA 1G9BA 1X7NA 1BBT2 2XPJA 1C3HA 3FHQA 3FUQA 2ILMA 3HMYA 4MSVA 4RGAA 4XPVA 5J96B 1SHWB 2G9FA 4OHXA 1RUE1 4B1LA 3SMHA 1X9PA 1Y4WA 2VC9A 3RYRA 3I4IA 4HMZA 1KFUL 3AP6A 4KG0A 4LBOA 4CA9A 5KHKA 4O7XA 1LHWA 4DPNA 2D97A 3WP3A 3S7EA 3N36A 3NL1A 4P00B 1Z78A 5CU1A 1QJX2 1G9DA 4YRDA 4EJRA 1UYZA 3ME2A 5FZ8A 4ATEA 4G4FA 3VBUC 2ZZQA 2DBNA 5LY1A 1A6CA 5D8AB 2D7FA 1LULA 4KBZA 3C7EA 2RS33 1TME3 3JBG1 3J9SA 5F8PA 1NCRB 4XVHA 5FMOL 4NIAA 1CVNA 1V9U1 1XSQA 4KU7A 4BU2A 1RUC2 4XMIA 1C8M3 3AZZA 4M01A 1TEIA 4NWWA 4KI5M 4BOWA 2SBAA 5EV7A 4FTEA 5HCAA 2FHRA 3M2MA 1XNKA 5IFPA 1UPIA 3DPRA 1BMV1 4BE3A 1L7QA 3GNEA 1PK6A 3EHKA 2R6QA 1HRI1 2IWGB 4BA6A 4KL1A 2PXJA 5FDBA 5BUVA 4L11A 5HCFA 3DYMA 3EBRA 2ZX4A 2JG8A 2FD8A 4BB3A 3KF3A 4L9BA 4BQ1A 1PO23 5FJKA 1QOTA 1N1TA 1VBC3 1W2AX 3WNLA 2A6VA 4M00A 4U2AA 5T52A 2X10A 4NIDA 1MEC3 2Q4SA 2ZGNA 1V6OA 2TUNA 3AP9A 5AVAA 5FZGA 5BXXA 1XNAA 1RUG2 1XJAA 5A7SA 5C9AB 3VV1A 2W92A 1V00A 5CFDA 1OLMA 1UPSA 3DYOA 3A23A 3I2KA 4QQLA 4OUEA 4P5HA 3VL9A 4AHWA 5A7WA 2J1AA 4KH9A 4LLFA 4ZKTB 1CGPA 2JDUA 4SLIA 1DYKA 4IE5A 1D2QA 1ZZCA 4ZZ5A 4Z1VA 3P1IA 4WM8B 3ZFGA 2GZWA 3FHAA 4GWMA 1OUSA 2EIBA 5I0DA 2R0FA 1IKPA 4QPIC 4K20A 1QIQA 2R0HA 4Q0VA 1QNWA 2R041 4AHYA 4AEDB 4YGEA 5IUQA 4GD4A 3T0DA 2JDMA 1NCRC 2I74A 3AP5A 1AF9A 1CAXA 2KM2A 1STMA 5DDJ2 1Q43A 1QH7A 4LQRA 4QXHA 1LRHA 1R092 4I2OA 5DZEA 5HV0A 5HCBA 1PGL1 3E5XA 1UD1A 3KWVA 5A7QA 1MQTB 1QJX3 1GICA 3ZSEA 4HFSA 4K1YA 4WZFA 3ZFFB 5K0UB 2VECA 3LPGA 3BCWA 3MF6A 4HPKB 4LPLA 5DUVA 5IWFA 3VD3A 4HANA 5GJ6A 1RB8G 3N9PA 3SCHA 2X05A 1VBE1 1HQNA 3KCYA 1A8DA 3MIBA 1ZRFA 2ZZJA 3ZX7A 2VUJA 2D6KA 2X5IB 1KDMA 4PIZA 4QPWA 3CKHA 5FK8A 1H6XA 1JN2P 2W52A 3RZLA 1LENA 4H2AA 2EVXA 5GLZA 3S7IA 4OQ9A 4YFZA 1ND3B 1D4VB 2UYAA 1LHUA 1QJY2 1U5IA 1E5HA 1WLTA 4B7EA 2WZR2 1MZEA 2GMPA 4M0HA 4FQ4A 5C9AC 3U4SA 5JI9A 1ZA4A 2CDOA 1YLLA 1CX4A 3T1LA 3VBHC 1PO22 3IPVB 5FZ3A 2AENA 5EJZB 3VD5A 2GNTA 3RWKX 2VXRA 4GH4A 1X9TA 2WINB 4Q29A 4YVWA 5JZGA 1QQP3 2BNMA 1CZSA 1GSLA 3OGJA 2HWD3 2DTYA 1V6MA 3AKRA 1ODNA 3KQ4B 2RMU1 1UX6A 3H8UA 2A6YA 1GNYA 3H3LA 1W0NA 3R4UA 1I1EA 4CCKA 1YQCA 2DDUA 3GBFA 4ZU4A 4FAHA 2RR11 1JUIA 1QJEA 3CU7A 1B35B 3ES1A 2AEZA 4Q1PA 4NR1A 2YC4A 2DU0A 3DKQA 2WL1A 3DUIA 3MIFA 1W0PA 1ZM1A 2XL9A 3E5UA 1F9KA 1XB9A 3C2UA 3BU7A 4N8MA 5A7OA 5LA9A 3MO4A 4AFDA 3MPBA 1SDWA 5LBFA 2LUWA 3HN1A 2QCSB 5IVBA 2DV9A 3IB3A 1BLZA 4P9YA 3LKJA 3PVEA 4CSWA 3BU0A 4YFWA 4B1MA 5FZIA 1G8WA 2HWC1 3I97A 3LAGA 3ZN6B 1ZBE1 4AFBA 1S0DA 5FUPA 1GWKA 2R073 5A80A 1Q56A 3WNXA 3DKWA 4DEVA 4E8CA 2ZHKA 2JEMA 3DXTA 1HB3A 4FO9A 4HKWA 3RFRA 2PAEA 3RMYA 4CU7A 2OIIA 3PJQA 3Q8AA 4HVQA 3O1RA 4MOAA 4QPGC 4RFRB 3ALQA 3CZJA 4AI3A 5E8AA 4O65A 1TG7A 4H7LA 1FI2A 4HVRA 1XNBA 1VR3A 5DMYA 4EWAA 3K4ZA 3VBFA 1YXWA 1Q5OA 5JSPA 3JCIA 2WDBA 2NN8A 1LESA 4BK5A 4OQ8A 3KT1A 3CDZB 2XL7A 3PU8A 4F7ZA 1SACA 5ANQA 1WMEA 1A3KA 2GC0A 1M06G 3AVRA 3IKWA 2QUOA 1RMU3 4LOTA 3K4AA 4XBQA 2VMIA 3WV6A 4OI1A 2Y0IA 5FY5A 5LBCA 1HQLA 1QWRA 1K3IA 2ZGRA 3WXPA 2EAAA 2O1QA 1ULFA 1CAWA 2UWCA 1ZA7A 3A22A 3ROUA 4ARYA 2FZ2A 4NIIA 2WS91 4YZ5A 3RRDA 4GIQA 2HWD2 5FYCA 3FLTA 2K2SA 4FPCA 4BHPA 4DIQA 2C1FA 1EYBA 1Z7S3 1UYPA 2ZMKA 3D0SA 5JMCA 4XDQA 2ZKNA 5C8WA 2FZ1A 2QQLA 3PUQA 2QJVA 4IDZA 5L9VA 4AZZA 4CDUC 4TTGA 3JU9A 2XXZA 4YSFA 1YQ6A 4HK8A 1JZ2A 4PDWA 2ATFA 1W6NB 4NMIA 4TN7A 4IQPA 1QEXA 2VXJA 4CCLA 1NQDA 1WCKA 3AXDA 1DU3D 1ZZBA 1RHI1 3ENRA 3LA3A 3NAPC 2ZS6B 3BI3A 4YW5A 5L73A 1AXZA 4FPGA 3U1XA 4LKFA 3W58A 4LJHA 3UGFA 3W20A 2CTVA 5K7PA 1LR5A 1AR81 1GMMA 4IEYA 2HH9A 1XBFA 3LZZA 3ZSMA 2TEPA 4UW5A 1AYM2 1O4ZA 1OUXA 1O8PA 1RINA 2XH6A 3I2HA 3RJ2X 5GZFA 5A1AA 5C33A 2VOVA 4DUXA 4ARXA 4KU8A 1RIRA 4DQAA 2TNFA 1KDKA 3WP4A 2GNMA 2WA4A 1S0JA 4GXLA 3ZPOA 5BNPA 4INDA 1CAWB 1QH6A 2XQRA 4UWDA 1NA1C 1DLCA 4AEJA 1H8TC 1V9U3 2J1SA 2Y6HA 4WM7A 2EIDA 1MS4A 5FO7B 3TN92 4BDVB 5JR7B 5LK5A 5CISA 4N43B 1GWLA 1KQRA 4AHXA 2QQPA 2DF7A 4KGQA 1GLHA 2VZUA 1VBD2 1K5JA 1YIFA 1F8VA 5F3GA 1D4M1 1N1VA 1GOGA 4C90A 4CDWB 1FOD1 4HT1T 1W05A 1CD3G 1URXA 2WNVB 4UOJA 4AGVA 1RUH3 4RR3B 4OZOA 4CDUB 1V0AA 1RUG3 1WBFA 2XUMA 3QD6A 1Q3EA 1PGW2 3T4VA 2XBO1 1YC61 1LGNA 4LO7A 1PO21 3POYA 2WZEA 4LLOA 4OMDA 4D6RA 4P08A 3OD4A 4BWOA 5A1FA 4QU2A 4MZUA 2WWUA 1PIV1 1UMZA 1AYN2 4FPJA 4HBNA 4BCUA 5A3PA 3GCWA 5F7UA 2BVVA 4PQ9A 4UFHA 3BPZA 1RUH2 2BUKA 5IW0A 1W2UA 3J7NA 1FPN3 3CMGA 3VBRC 3NO8A 4K7JA 1RUC1 2Q1FA 2RHPA 1AX1A 3WW4A 4OCTA 1O4YA 1G9CA 3LD8A 2BV4A 2VTXJ 3IAPA 4NAOA 3RI9A 2BOIA 1MS8A 4YPJA 1RUNA 4AFMA 2ZGPA 3WVJA 3FLRA 5DABA 3WDXA 3KB5A 3IDBB 4HK9A 1R1ZA 2FCVA 2QVSB 2D3RA 2R49A 2UY8A 2VVEA 2Y6LA 1LOFC 2BOJA 3I59B 4XFAA 2VOWA 4LITA 1JU3A 3PHMA 4N43C 1S0IA 2VULA 3NNLA 4QX2A 4FCAA 3IMNA 4XFCA 4AYUA 3RGBA 4PDWC 4BQXA 3PVBB 4CP0A 1WW5A 4NVPA 1AR93 1JYCA 3AKTA 3LA2A 1UXZA 2WS93 3C7OA 2VOXA 4RD7A 4N90A 4UF0A 5CVRA 3UGGA 1O91A 2E7AA 5F6LB 3JD72 4J1WA 2OKXA 3DEMA 4XETA 2JDKA 3F95A 1AL23 2NPIA 4JC1A 4RHV1 3BOWA 1OHFA 4FXKB 2JG9B 4FPFA 2XJSA 3N7LA 1W90A 5JLVA 4NPMA 1KS5A 2B46X 4OULA 1RMU1 4L92A 5IT6A 4AEKA 4D3WA 2MEV1 3NV3A 4IEQA 2YMZA 1VBD3 2DCTA 2ZCWA 1CJDA 2LTNA 2HWD1 1OPOA 5L9BA 3BVCA 1VRBA 3VD4A 4AEDA 2R042 3HQUA 3OB8A 4CEYB 2BNNA 2R063 2RMU3 4CZSA 5IHRA 4I09A 1VMFA 4I0BA 1MS3A 1LKNA 1IG0A 3VBRB 1U12A 4JGYB 4PT6A 4WM7C 3VHNA 3ZYJB 4AW7A 1Z7S2 5C4WC 2E31A 5JSRA 1RUF1 2A6XA 1VAKA 1UO9A 2XONA 3I2GA 4GALA 3WF0A 2A5ZA 1HRV2 1UNBA 3ACLA 3BOPA 2B5HA 4LO6B 1LHVA 3AZVA 2ZEZA 4RYDA 1PX3A 4CCJA 5FKBA 1C5HA 4XQWA 1NLRA 3VDCA 3N9NA 2XDVA 4AI8A 2NMNA 4S2HA 3NNJA 4XF4A 5FPXA 1CIWA 5CFCC 2HBUA 3ZXEA 3FJSA 1RUI1 5DAWA 3AX4A 1OKQA 3UETA 3OBRA 3LDRA 2I2SA 1X36A 4GMP1 3WUCA 5FYYA 1F5FA 4KWKA 4CDXB 4XURA 2QBXA 1WW6A 2RS52 2WSUA 1QJU2 4ZS3A 5FQ0B 4C8DA 5JMOA 3RZJA 3CJIB 4XIKA 2VUCA 4XFIA 2VUDA 2BGPA 1H2MA 1VBA2 1K5MC 2JE9A 3OBTA 1AHSA 2CDPA 5FRAA 1XC6A 2HJIA 4L0PA 2JE8A 1QOSA 2VVFA 4K3UA 3ZFEB 4EQVA 5C5TA 1WBLA 3LF7A 5C71A 5T5LA 3RS6A 2MNGA 4QB2A 5F37A 5IVYA 2HEYF 4QDSA 4Q4X3 2HWB1 4IEWA 2YFUA 3T2QA 4QX7A 2PHTA 3ZSLA 1XXNA 2R1DA 5CFCA 4PLNA 5L19A 3I2OA 4KG8A 1D4M3 3VBSB 3AKPA 4OLLA 1DLLA 1W9WA 4RS5C 1WZXA 2DVFA 1H2KA 2ADDA 2DVBA 4P02B 3SQOA 2CWMA 2R062 2ZEXA 2R043 5FP3A 3R05A 4KQ7A 4WVVA 1HRI2 3RPQA 3ZXAC 5I0RA 4RL7A 2BBVA 4M4RA 4HL0A 2F4LA 4BIFA 4TLGA 4BJ0A 1W6QA 5JWPA 3ZDVA 2WN3A 3U78A 5A3WA 5AFEA 1EV13 3I2JA 2JKBA 1NXMA 3OSDA 1VBE3 1TMF1 3ATGA 1OD3A 2A1XA 3N7KA 1NT0A 3A0KA 3DYPA 3FFZA 4QM9A 4AHZA 4AQSA 2AYHA 3OPTA 1RUD3 2BFUS 3K51A 3OTFA 5M0TA 2RVAA 5HXMA 1HN0A 2HEVF 5F2SA 1QDCA 4XAAA 4HXCA 1ND2A 3VD7A 2ZHMA 1UYXA 3KM5A 5A6QA 3TEXA 2YBSA 3K3NA 3VBSA 4BM8A 1TVGA 1PMHX 2GSYA 3LCPA 5FTTC 2QQWA 1W3XA 4HETA 3VBFB 2WO1A 1AR71 5LBBA 4XF0A 4BQ3A 4E8DA 3RYKA 2DCJA 2VW0A 4AI2A 3U07A 2DTWA 2CL2A 3NW4A 3AZXA 4DS0A 3M3IA 2DWRA 2RS53 3TOJA 2RS13 4GKXA 4OHZA 3CJXA 1TNRA 4JHTA 1Y9MA 2Y6KA 5SV5A 2WT0A 2PELA 3RG0A 3LEIA 4META 3OCPA 5BNNB 3ZPYA 5EWSA 1R083 4E2GA 3AVSA 3MF9A 3EYPA 4BLIA 3KV4A 4B8EA 1UKRA 1PGL2 3HIFA 3BTXA 5GZEA 1P8JA 5LA0A 3IN9A 1VMHA 3D6EA 4P9WA 2VD7A 1S0EA 2NM1A 4QX8A 3SHRA 3WW1A 3HPNA 4Y4RA 5FO8B 3ZVXA 3T1MA 2D93A 3LQCA 5FOJB 5J3UA 3LSDA 1EAH3 1VP6A 2IFRA 5JDBA 4R8HA 1YFWA 3QACA 2FDFA 1VBB3 1H8VA 1I5ZA 1ZBA2 5IAVA 3U10A 4GZ9A 5D21A 3HBKA 1MZFA 1MACA 1H4HA 3MPPG 2ZOEB 1JYWA 3WF4A 2HWE1 1ZBE3 3POBA 3R4SA 4Q27A 5DDJ3 4QD2A 4EV0A 1HRI3 1IKQA 3VDDC 5J7MA 5JCTA 4KWLA 1Y3TA 2RMU2 4WV8A 2P34A 4XF1A 4A6SA 4COZA 3CQOA 5J36A 4S2FA 1DGRA 2WZR1 4RA0A 4QHZA 4CCNA 2Y26A 1OKOA 2QQKA 1LECA 3PL0A 4IEOA 4LORA 4Q0PA 1MQTA 4WZCA 1HN1A 4BQ4A 1VB4A 3WW3A 3IPVA 4Q2FA 4XHBA 2D44A 1RUJ1 4YGBA 2E6VA 5LW9A 4XCAA 1DFQA 3HT2A 3LDBA 1W3VA 4GA9A 4MADA 2HWF2 3THDA 3VBUB 4AVBA 2Q5TA 3WNKA 3NJYA 1HB2A 2QQOA 3TN93 3ZXGA 1C4RA 1ZZ6A 3NQHA 2YV8A 4UXAA 3V65A 3W5NA 4GWJA 2W9XA 4A4AA 5JPNB 1VAVA 1VBC2 4Y1VA 3WEZA 2LALA 1W28A 1UOBA 5BNNC 4E4SA 3S6PA 3GXUA 3AMPA 3KGZA 2DBIA 3M8LA 4DY5A 3BKZA 4IGQA 2YBPA 1QY4A 2VM9A 3T0BA 2VCAA 3KV9A 4Q4W2 1J3RA 1GUIA 4A41A 1CAVB 4DXZA 5IVCA 1GP4A 1ZNPA 2W47A 3JUUA 1W9YA 1UZWA 4URAA 4LA3A 1JYIA 1Q8VA 4YVSB 5E88A 1O3SA 5FLJA 3FHIB 3J8F1 1NY71 4NHXA 5FPLA 4QDQA 4XF3A 3WX5A 2WQ4A 4JRAA 4NRPA 2VZ1A 1YO8A 1F4AA 1UWWA 2BVBA 3C7HA 1W03A 3I3MA 3EQEA 3GZEA 1UY3A 2OS2A 2DCZA 4LMFA 3IDCB 5FZ4A 3UGHA 1JXNA 1FPN1 4YM2A 4MV2A 1LHNA 1RVF3 3SITA 5FWEA 1S0FA 1PM4A 2Q0AA 5DAPA 3VL8A 2WNUA 3HQXA 1PK6C 4IERA 2WFPA 5GM0A 1VBA1 2LW8A 2XQXA 1IPJA 1NE6A 4P9IA 3T09A 2UURA 3ACGA 2WO2A 4K21A 3WOGA 3ST7A 2PA7A 2D6OX 2VNVA 3ASIA 5LZ6A 4FOYA 4GMP0 2IXIA 4GB32 2IC1A 1PZ7A 1PIV2 1G9AA 5CNAA 2ZAAA 1QXJA 3ZN6A 4CU6A 2IUWA 3ZYRA 4IUGA 3ZKYA 4P9JA 3FE5A 3L2HA 1SPPA 1HW5A 1ZREA 2Z42A 1UKGA 5CFDC 2BWAA 3AP7A 2A6WA 3JD73 5KXDA 1T2XA 5CAZA 4Q4X1 3S5QA 1N3OA 1ULDA 2WS92 3AL6A 4LKSA 2E53A 2ZTNA 4JGZA 4NHKA 4RGKA 4KWUA 1W8HA 3ZLIA 4NAMA 3GBWA 1SQ4A 3KHCA 4EZHA 4W6WA 2YY1A 1UQXA 1QMJA 1YFUA 5C4WA 2B39A 4Q8KA 4CCOA 1EAH2 3ZSJA 5DQ0A 4DNYA 3T2TA 4E27A 2V73A 2PMWB 1VRH3 2DUOA 4FT8A 3GHMA 1UZZA 5FBJA 3DPRC 1BKZA 4QU1A 4ASKA 1ENRA 5FR3A 1UXXX 3ITQA 4DUWA 4IEXA 3LSEA 3VBRA 3GF6A 1OH3A 2HYXA 2VU9A 3H0OA 4HN0A 3ZIWA 5I93A 1JYNA 1US3A 1PMIA 4YNIA 1COV2 3M3QA 1QJX1 2P4EA 3RYPA 3J8F2 4EROA 3IZOA 5D8AC 2QZ2A 4N7IA 4YW3A 4OI2A 1POQA 3CBNA 3PUSA 3SKJE 4K40A 1O4TA 2FDGA 5F5QA 4URTA 5BY5A 3OEAA 1H9PA 3IBMA 1LODA 4XACA 3VKMA 3BTYA 1OOPA 1JZ4A 1GQGA 3MZHA 2RE9A 2YFZA 5C7GA 3W59A 1Q8QA 2OPKA 4EN9B 4AOCA 3ACFA 1APNA 4LK6A 5FUIA 2XJQA 4QXCA 2VBBA 3SCGA 5CFDB 5HBAA 2NYYA 3D8CA 4G3YC 5TSWA 4YM3A 1AXYA 4RS5A 5JR2A 2ZX1A 1RUD2 4NRMA 2JB4A 3MUY1 1X33A 4UI9L 4XJUA 4AXOA 4MHRA 1T6BX 2GC2A 2OT7A 1BVVA 2WJSA 3P6BA 1LGBA 2B4KA 3OGSA 1JZ6A 5FYTA 3EO6A 4QXKA 4R9CA 5T54A 2FMYA 3MIGA 4H3WA 2FQPA 5ERLA 4LR4A 1AUYA 2HWB3 5EYYA 3E5QA 3VDBA 4TXWA 3MW4A 1PM7A 5F1RA 3DPRB 1AR63 4JDOA 2WFF2 4D8MA 1POV0 1OLME 5CBLA 5JOWA 4WM8C 4BMEA 2Y6GA 4QDRA 1MVQA 3LE0A 4UT5A 3QBQA 3ZYPA 3H8XA 1GP6A 2EXHA 2VGDA 3PTYA 3S5AA 1H4GA 1AYM3 5FWJA 5FMCA 4Y5Z0 5FYUA 3PUIA 2KXLA 1AL22 1SCRA 1PO11 1PO13 1TQ5A 5EQUA 4L99A 1AX2A 2ZHNA 3GDBA 2DVAA 4LT5A 5J37A 1O7FA 3CZUA 5L9RA 5H9RA 4ZXKA 3LOIA 1TME1 3JBG3 4N9HA 4YZ4A 2CY6A 3U75A 5ACA1 4PCRA 2JJ6A 4JV4A 3T0AA 2IXCA 3VBHA 2YBKA 4NE9A 4TYSA 2JDZA 2A73B 4FPYA 1RUE3 1S0GA 1WMFA 3IDEA 3U37A 2J1RA 3M4FA 4QX1A 1EPZA 1DCSA 5FIXA 1JHJA 1NG0A 2QQIA 1H8TA 2VBPA 2V5DA 5BPXA 5I8TA 5L7OA 2MPFA 2CAUA 2CAVA 5H9SA 4AAXA 4CDQB 1I5PA 4LXLA 4W65A 3WNNA 2V5YA 4N53B 2VW2A 2WZ8A 3U14A 1RUOA 4FPOB 1K45A 3LEGA 3O0VA 2O8QA 3WR0A 1OFNA 3VGIA 1XQNA 2PHRA 1UU5A 1W04A 4LULA 1KRIA 4FPKA 5JPMB 3VBHB 1YFXA 1MPXA 1MEC2 5FY1A 5EYXA 3HNYM 1RUD1 2DFBA 4LBJA 5C3QA 3H7JA 5LCWL 5ACA3 4Z8BA 3ZN5A 1H0BA 5KWRA 1C1FA 1W99A 1SBFA 4IEPA 2BBAA 3NAPB 2VQ0A 4XABA 4XMAA 1HRV1 4ZZ8A 4LKDA 4BMBA 5CKMA 4NOTA 3J7MA 1IQAA 1D0GA 1JBCA 2QQNA 2VZRA 1AL21 2Y33A 3JBG2 5KXBA 3VZJA 4LKEA 3RMXA 1WLDA 4LBMA 2B9UA 4IGPA 3ZXLA 3MGUA 4NWVA 2BERA 3OBAA 4UW6A 2GC1A 1COV3 5E6HA 4K8FA 1X50A 2OZJA 2O8OA 3B3QE 5DN2A 4AQ2A 3RZKA 3LA7A 1OQDA 4MX3A 2WAAA 4AL9A 4WVMA 4CUGA 3J7LA 4E9KA 3H3ZA 2WQZC 3B01A 5A7PA 1VRH2 3RZGA 1OF3A 1MS5A 2V09A 2X53S 2XR4A 3E97A 4L97A 2RS32 4LBQB 3U0ZA 3RZMA 1MR5A 3VLBB 3WF3A 3V0BB 1UU6A 2J1EA 2WT1A 1JYXA 4XDOA 1TMF3 4OI0A 3WQ7A 5EXOA 4V2VA 3BTZA 1VAMA 4AVTA 4XXAA 4LE3A 4QPGB 4AE2A 3MLJA 2WLPA 2VMFA 4H7MA 3J26N 1WLCA 5C9AA 1OOPB 3B69A 1DG6A 2Y64A 3O0XA 1QQP1 3WNPA 4BXSV 5FZLA 3MIDA 3VBOC 3OPWA 3R6SA 1NAEA 1OQEA 1S4CA 2AACA 3WD5A 5A33B 5K8SA 2ARBA 1REEA 1LEDA 2DVDA 1S0BA 3EXUA 2VG9A 1YEWA 5KXCA 5C5UA 3O5SA 4AVAA 3VBUA 4XIOA 4UFMA 3ZMNA 1JZ8A 2YGLA 3OF1A 1GOHA 4HZFA 3POWA 3R0RA 4MXWA 4FOQA 4AEDC 1DYOA 1SFNA 3MYXA 2BPA2 1SLLA 3CL1A 1NLQA 2JICA 1ULEA 3D5OA 3J7HA 2D98A 1RVF2 5FXZA 5GKAC 4M3CE 3SLIA 3WDTA 4BQYA 2XKPA 5FZAA 3OY8B 4M3CF 2R061 5JOYA 1JS9A 1RC6A 2OZ6A 3AFGA 4IXLA 1L7RA 2V4AA 3A4UA 3RDIA 1FMD2 5E89A 4CPBD 3MW2A 4IV3C 1HB4A 1W6QB 1MQTC 1VLNA 4LO4B 2PHLA 1BHGA 3I59A 2OUHA 2EXIA 4HLTA 4AWDA 2VMEA 3H3UA 4V2WA 2P3KA 3AC0A 4LNVA 3WINE 3HAGA 3KCXA 3MLKA 1ZVFA 4ZU7A 1VBC1 2EF6A 4JKKA 5A7NA 1I9RA 4R9DA 5BNPC 1NXD1 4B3NA 4DINB 1JODA 1C8M2 1SLTA 1DIWA 3O1VA 1RUE2 5I0UA 1SPPB 2GMMA 4GMP3 1ONAA 3LGRA 1UMHA 4XOGA 4D7YA 1TME2 1UIJA 1ZZ7A 5HPOA 1AR83 1NUKA 5GZDA 2FDIA 3OY8A 1WCUA 3SEEA 3WHTA 4IE0A 2ARCA 3ILFA 2C0ZA 2FDJA 3I3DA 4B29A 2D5HA 3TN91 1PO12 1UOFA 5FZMA 2WBKA 5FMDA 3JB8A 2Q8CA 5D8AA 3I2FA 4IV1C 4NUBA 5FP4A 2P3IA 1F2NA 3DXUA 3WDVA 4FP2A 2ET7A 3DGTA 1IS6A 1O3RA 2P3YA 4UBHA 4Y26A 5IFTA 2R072 3RWNA 4JKLA 1AXKA 2WFF3 2RR12 1IPSA 2JECA 3Q9OA 5DUXA 1GBGA 4DFSA 3QCWA 5JVVA 4DXSA 2BW8A 3USUB 4Y4YA 1RVF1 4NJ4A 4Q1RA 5EHDA 2JE7A 1YRZA 4AEMA 4PHZA 2C6SA 2ZMLA 2YC0A 3GJAA 2UYBA 4ISQA 4ZONA 4LIVA 5DAXA 5A33A 1AR91 4MYEA 4YVWB 1N1SA 4IEUA 2VQUA 4MGZE 5F6KA 1H2NA 1TE1B 5FK7A 1LNSA 5FYIA 3VZNA 2CGPA 2WYFA 1VBB2 1H30A 1WKYA 4P5YA 1KD7A 4IV1A 2WZPP 2G1MA 2B45X 1RITA 2ZGLA 2GU9A 4YG6A 1RUI2 1WLWA 3M70A 1H6YA 2GDFA 5BNPB 4A7YA 1B09A 3AFKA 3HN3A 1U5YA 1BEV2 2CU5A 3I3BA 4OVEA 4CDXA 2J22A 4QB1A 1GKBA 3FWEA 4QKDA 3M3OA 2HWE3 3IM0A 3O12A 1OVPA 4XJWA 3ZR5A 3ZR6A 1ULGA 4K6BA 4FTSA 3LIHA 3CJIC 1W2TA 1RUC3 3ETPA 4LHSA 4RQPC 5E1RA 5EJ3A 5GLTA 3S30A 5ABJC 3D4KA 4XC9A 5FFOC 2BFUL 4Q0SA 1YCIA 1W2NA 5EFUA 4OHVA 1RYYA 1BK1A 2A3WA 2XJTA 4XJ9A 2A70A 2K46A 3POFA 4IV1B 4R4ZA 4F3JA 5CEHA 1JYVA 4DRVA 1UOJA 1CQ9A 2YPDA 5EZWA 5FY0A 1QJU1 5IK7A 3P3PA 5D2AA 4ZXEA 2K9ZA 1OQ1A 1ULCA 4XTPA 3T30A 3C8XA 5GZCA 3GJBA 2YC2A 5E16A 3OJBA 4OUMA 3TEYA 1GV9A 3PMSA 1XYOA 4OI4A 2WIIB 4A2UA 4HKLA 4OHWA 3RZZA 2RG4A 2D43A 3ZN4A 1NE4A 4XUPA 3V0BA 4H55A 1VB2A 5A70A 2XLAA 1AR73 1HV0A 1SLBA 1ZZ9A 2C9KA 4JVAA 5LRSA 1S55A 4ES8A 1FX5A 2PHFA 4CP2A 1GP5A 3KSCA 4JQRA 2BEOA 2WSVA 1BBT1 5KC6A 1RJ7A 2PAKA 2RM23 1DYPA 2RM21 4XBLA 1RXFA 4QQOA 3OGRA 3MW3A 3BUCA 1DZRA 5FP7A 1H1AA 5A32A 3RQ0A 3ETQA 5G05L 1PGSA 3PNAA 1QJFA 2A3XA 4GWIA 3TB0A 1POV1 4IW3A 4QQHA 4Q4X2 5I0SA 4LBQA 2VTXA 4PF1A 4YGCA 3THPA 1O5UA 2BRTA 3GM8A 1BXHA 3FZ3A 4RQPB 3ZYHA 4FPLA 4AGGA 5ABJB 4JRLA 2XHKA 1DDLA 4NIHA 1IS3A 3OPZA 4QKBA 4XJAA 5KBFA 1BEV1 1FYUA 4YZ3A 2WNVA 4FVVA 3AYEA 1GANA 1OURA 4MGTA 2QNKA 3NNMA 4CU9A 5BNOC 1W9FA 3HNBM 2WKKA 3ZFGC 4FBFA 4XFHA 4XHXA 5FZCA 1OA4A 5T5OA 5FY4A 4R52A 1RXGA 2LROA 4I02A 4WVWA 3RVHA 4CP1A 5LWBA 4OMCA 1DQ0A 3M7AA 2ZHLA 1C57A 1NOVA 1NZCA 1H1IA 4OFGA 1ULPA 2QDNA 5I8SA 4CDQA 1FNZA 4XQ4A 5B2GB 4XILA 4X6RB 3AKQA 1NCRA 1IG3A 2Q8DA 1UYYA 2OX0A 4GULA 3NV4A 4ZS2A 5LATA 1WWYA 5FZ6A 2EAKA 4OHYA 4PBOA 3WG2A 4CDXC 5FP9A 3UKTA 3B02A 2VPVA 4Q4V3 1ASJ2 2E63A 1UAIA 3JZVA 4CDUA 2RM22 1DBNA 2WNVC 1UN1A 3V56A 3F2ZA 3DF0A 1GZTA 1E5IA 4B4RA 3TNPB 2BTVC 4UBGA 4FTBA 3ZFEC 3LPFA 2OYZA 4FI9A 1MVEA 2A75A 4AGRA 4CCCA 2HLEA 3UKNA 2VUAA 1HXS3 3DCQA 4P14A 2XJPA 4NPLA 1OC1A 1YQ8A 3TBDA 4QB6A 1ND2C 3H50A 2JXAA 3E1F1 1GOFA 5APAA 4L2NA 4CEWB 2MEV3 2J1UA 3Q8BA 3LWCA 5I0TA 1QDOA 3I54A 2DUQA 1RGSA 5H9PA 3VBSC 5KC5A 1CX1A 1QXPA 4IEZA 2EICA 5FXWA 3SISA 2XBO2 2UY9A 3T3YA 3AJZA 4CUBA 3VUOA 2AGSA 5FPZA 3CIHA 3NKTA 4C0HA 5LA1A 4GH4C 2B9VA 3MBWA 4K8RB 1AR92 3GCXA 4WM8A 3ZFGB 5KXEA 1RHI2 4TWTA 1O5LA 1GZCA 3K48A 1HXS1 4J1XA 3CLPA 4FOVA 2AR6A 1QXRA 4LBKA 3ZFEA 3AP4A 4Q0QA 4BPZA 4PI0A 1ZYBA 1AJOA 2ORZA 4E2SA 1IPKA 1NKGA 1SFYA 3WDYA 2E7QA 3MUZ1 3ZYGA 2WLQA 4AF9A 4CUCA 1DZTA 2D3PA 2EXKA 1UZVA 1YYNA 1E57A 2FCUA 3VDAA 3J4UH 1ENQA 2DCYA 2QE3A 1CAUA 1OD5A 2VZPA 2XGXA 1RUF3 1UIKA 3HOBA 4A7KA 4B4PA 4CRQA 5FZHA 3Q8FA 4CPBA 2KR2A 3AMNA 5K4LA 3IMMA 2DUPA 2W1WA 3VZOA 2EIEA 1EY2A 2DVGA 1OLRA 4CTEA 1BMV2 1PK6B 2CYFA 2VCMA 3LOBA 2ZX0A 3WQBA 4COUA 4UFKA 2WO3A 2JG9C 5ANNA 4H14A 4MG2A 4MHUA 5JXGA 1U5ZA 3CNAA 3SC7X 1V6NA 1Y43B 2BWCA 2VCBA 4HKOA 3AB0A 5DZFA 3P5BA 1ZX5A 1VBD1 5JXIA 4NHLA 3OUHA 3WUDA 4QGLA 4CEWA 3WY6A 2JD9A 1W0OA 1CIYA 1OA2A 3PVOA 4IGOA 3UJOA 1NYWA 4UFIA 2YU2A 4XUQA 1W6NA 1WGPA 4XBNA 1MS1A 4CEYC 1G6NA 1CWPA 5LK7B 3B93A 2CNAA 2RR13 1WMDA 4FFFA 5DUWA 2H6BA 3T08A 2XBO3 4XZUG 4FXGB 1W6OA 3URFA 4YM1A 4QQ2A 4NPRA 1N3PA 1KJRA 4W6YA 4XUOA 5LA2A 2MEV2 2DYCA 4W50A 1SMVA 3E6BA 1VJ2A 5IK8A 1C8NA 5FLHA 3GZTB 4XW3A 4YLZA 3HD8B 1CONA 5T50A 2GP3A 3VZKA 5CG9A 1HXS2 1SLCA 3KZ4C 2D6MA 1HB1A 2D6LX 2P3JA 1RUJ2 1POV3 4NRQA 5KHHA 3WF2A 1R1A2 2EALA 2FBEA 2JG8B 1AYN1 1OSGA 4N53A 5FZEA 5T3NA 3PIJA 5DG1A 3RJRA 4CDWA 1X8EA 1EAH1 1FV2A 2V72A 1ZBE2 3H9AA 1J59A 5FJHA 5GLWA 1AL0G 1OA3A 1RUG1 3RNSA 3D3AA 2ZKLA 3I3EA 2WNEA 4PIXA 2X29A 4QAWA 3WNMA 1AX0A 4ASMB 1MEC1 4BLJA 1J1TA 1FMD1 4GQ7A 3N9MA 4QQPA 2I07B 2PAMA 2W0XA 3W9AA 3H7YA 3CHXA 3KV6A 3SKVA 3WG1A 5C6CA 3UJQA 3VKNA 1BVP1 5L7OB 3CO2A 3RSJA 4A7ZA 1LOCA 2WA3A 3ES4A 4YW6A 3SH3A 2PLV3 3X29B 3LEMA 1HIXA 1DGRN 1WMXA 3FX3A 3KGLA 3TEZA 4R9BA 5JZGC 3BTAA 4C0BA 4OYUA 2W08A 1DQ4A 4YM0A 2IXLA 3D82A 2VR4A 2OVUA 2RS51 3QH6A 5JIAA 2ZBJA 1YQ5A 2RS12 3HBZA 4LK7A 3DECA 3UNPA 1W6MB 1QJU3 1HV1A 3ECQA 3FN9A 3GALA 4QGNA 2P5BA 3NVCA 2R30A 4ES9A 3WP6A 1QJY1 1UCXA 1CN1A 2I45A 2IFWA 4QT6A 3ZFFC 4YVSC 1UOGA 2D3SA 3AM2A 1CPNA 3N7MA 1JZ5A 1LAJA 3O1UA 4PJYA 2JDPA 4EWEA 2E51A 3UESA 4CE8A 5K0UA 4AAPA 4AVCA 4K9SA 5EP9A 2YDEA 5FZ0A 1W8ZA 1IHMA 2P6CA 2BDRA 3WHUA 4GB31 1IOAA 4YW7A 1S2EA 2E33A 1EP0A 1R1A1 4QPGA 1OXCA 3PUAA 2ET1A 3I8TA 4RFT0 2ZPXA 2ZMNA 2W2IA 5GZGA 2ZA9A 1EV12 4FPEA 1JU4A 3KHBA 2Q8EA 2WWJA 4JQTA 2VQTA 2C24A 2ES3A 2VMGA 2VMCA 2VTFA 3APBA 5G04L 2P6HA 3WDUA 4FFGA 5T5JA 4E2QA 4O9GA 4Y5TA 2VMHA 4XQDA 4JDMA 1DGWX 2F4PA 5FPBA 4DO0A 1KJLA 4MGYE 1TMF2 2CGNA 1M4WA 2KD7A 2XUEA 4G9SB 2ERFA 4TLFA 4UFLA 1MZ5A 3PURA 2RDNA 4K1ZA 1SFPA 3ZKUA 1PMJX 2W68A 2JB8A 4HSJA 1V6LA 1FNYA 1B35C 3GZUC 4UF0B 4MGKE 2JIJA 4GJYA 3HWJA 5FXVA 3THCA 1IGOA 3N35A 2WFF1 4JGYA 5FY7A 1ACCA 1JH5A 4UW3A 2GALA 4Q4Y1 1FXZA 3IT8A 1PVC3 1DQ2A 2VNRA 4RGGA 2W94A 4BQ2A 4LO5B 1D0HA 4W6XA 4LHKA 2D5FA 4CP9A 4JTOA 1RL3A 2HKXA 4C1WA 4EN8B 4ZU5A 1US2A 2JIGA 4FFIA 5HV4A 1AJKA 2XJUA 3H1MA 4CDQC 1GWMA 2G4IA 4O61A 5ACA2 2HWE2 3NV1A 2G9ZA 2YYOA 4N53C 4QX3A 2VZVA 5A6YA 5LEKA 3VZMA 3AZWA 3LFIA 4E4ZA 4PIYA 4R9AA 1Z0HA 1WUVA 3VDDB 5A3TA 3DV8A 3PTRB 2WC2A 1LB2A 1GZWA 5FP8A 1W6PA 3SEPA 3TYJA 2HBTA 5FREA 4COYA 5AC92 1PGW1 4XXPA 1EUTA 4A42A 1F35A 2HEWF 4PI2A 5H9QA 1UY4A 5C70A 4BISA 4PBPA 3T4HB 1U0AA 3N9LA 2JWPA 2WAOA 3NAPA 1QOOA 1DZQA 2IVIB 3O1OA 3L2YA 2ZGMA 1REFA 4J6GA 1O8SA 4LE4A 3NSTA 4D0QA 4RHV3 4Z82A 2JDYA 5FXXA 3ILNA 5FY9A 1WA6X 4I30A 4PQQA 5CB7A 1AVBA 2Y60A 2ZJCA 3ILRA 4KBBA 4LBQD 4QPIB 4CU8A 2AREA 1KGYA 4WVZA 2CWSA 3I49A 2NLRA 4XF9A 3ABZA 3C7FA 3OUJA 5FV3A 3SXWA 5BYNA 1BCXA 5D1IA 2PHDA 4QKFA 2VJXA 5GALA 2GAUA 5C8CC 2PN5A 1V6JA 2WNUB 4Q4V1 1CAVA 2XVGA 4IV3A 2C4XA 2Z4FA 4M3CB 3J8F3 3Q8CA 4CXYA 2YZ4A 1CPMA 4QHOA 3KMHA 4ATFA 3T2OA 3WDWA 4UW4A 1G7YA 4QXBA 2K0GA 3VB9A 4D7SA 1LHOA 2XB6C 1RUH1 1A8MA 4HVOA 5B4XA 1XNTA 2J7MA 5K0UC 1RJ8A 1SBEA 2C9AA 2RDQA 2Z2SB 2ZXQA 1KS4A 1N47A 5IVVA 5DDJ1 1UW8A 5HI0A 3T2PA 4J25A 5IYYA 2XWBB 1V9U2 2VBDA 2W3JA 4HONA 1AR62 2X8KA 3WSOA 5FZ1A 4JAAA 4F83A 1G9FA 2X5IC 1PVC1 1DGLA 1ND3A 2BQPA 3NNGA 1U5XA 3OUIA 2YUEA 5A6XA 4DXTA 2XKOA 1W6OB 1PNGA 3SCFA 4JKMA 1DP0A 2PQSA 5FYBA 3CEWA 3H42B 1V6KA 2JDAA 2RDSA 3INAA 2BNOA 2BP6A 3H1WA 3I3QA 4HOOA 3TNQA 3OGVA 3OGGA 4LHLA 2XHNA 1C28A 1DHKB 3SH4A 2Y6FA 4I0WB 1H9WA 1BEV3 2PFWA 1HJFA 2WRAA 5FYSA 1UL9A 2J1TA 3V0AA 4XTMA 3KT7A 1UY2A 3FL7A 3RZHA 4MXWB 1O3TA 2NQYA 1X82A 2IXHA 3JD71 2BU9A 3JQWA 3LB9A 4LO8A 2PLV1 3AL5A 1NCQA 4DB5A 4NIGA 2E9QA 3WF1A 4GB33 1R64A 5FZFA 2ENRA 1WD4A 4KWJA 4A6OA 2BYVE 2BJSA 2C5DA 1VE0A 2E7TA 4COVA 1A78A 1J3PA 2ZGQA 5C3PA 2P2KA 2GC3A 2J42A 4Y22A 2XLGA 3O0WA 1XYPA 1RHI3 3VHOA 2VQAA 3N9OA 2XG3A 4N43A 3WG4A 4XJZA 2RJ2A 2QQMA 5C8CB 4IE4A 3AJYA 1ZBA1 4S2GA 1PX4A 3AYCA 5EIYB 3WT3A 5F3CA 2IXKA 1YJKA 3E6CC 3MLLA 1QJY3 3E6DA 1LEMA 4ORFA 1LOFA 4MVTA 3BALA 4XYXA 5FMOS 3U11A 3OEBA 3GZAA 3FC0A 5CYYA 1JHNA 5HXVA 1FOD2 4RR3C 4S2DA 1SEFA 1UU4A 2DU1A 5CZKA 4A3XA 5IVEA 2W95A 3WNOA 5LEJA 4LUKA 4Y1UA 1Z7S1 2PTMA 4AR2A 1EV11 1DQ1A 1RUF2 2B42B 2XMLA 2Y38A 4YZ1A 1CZVA 1YQ2A 4OUSA 4XFGA 1W2OA 4M0NA 5FMBA 1ZZ8A 1A34A 4JTNA 5FZ9A 2YGMA 5LY2A 4MLOA 2XOMA 4N7UA 4PF5A 1CZTA 1SBDA 2JX9A 1OFSA 1XPWA 2Y34A 3AKSA 2AEYA 1SCSA 2YPJA 4CCMA 2O0OA 4D94A 2A3YA 4LBNA 3KS7A 1LGCA 4MUVA 3V64A 5JOZA 3O1MA 5LASA 5L36A 1JOBA 3AZYA 4D7TA 2RS31 4SBVA 1BQPA 3IAQA 4XJ8A 2OQ6A 3ZMOA 4YW1A 5FZOB 1I3HA 2IVJA 3ELNA 3H8RA 4LUMA 3POIA 4NHYA 1AZDA 2Z69A 1OVSA 2P37A 3B9CA 5F5CA 3BIEA 3ZO0B 5A6ZA 3B00A 1Y9GA 2F6BA 2SLIA 4Q4Y2 1W9TA 3M3EA 4ISRA 3O1SA 2QKDA 1EUUA 4Y22B 2AH2A 2WNOA 3S0MA 1PVXA 2ETEA 2QDRA 3PU3A 4Z07A 1HLCA 3G6JB 1BBT3 1CR7A 2VNGA 1IQDC 1FMD3 1XNCA 5F5AA 4EWDA 5FYVA 5FPVA 1JMUB 3AMQA 2VH9A 5J98B 2RDRA 2GN7A 5AC93 4GAZA 1BYHA 1S0CA 3H8OA 1C5IA 3THTA 1OPMA 4YVWC 4ZPIA 2Y0OA 3FUOA 4EZ4A 3WQ0A 3V0AB 1KITA 2R071 1ND3C 1LOAA 1LU1A 3HEIA 4DY3A 4BYYA 4YWAA 3AMHA 1JTZX 3K77A 2ZGTA 5FPUA 5AVPA 5FYZA 2Z79A 4RHV2 2QTWB 1PZ8A 2A7AA 4LA2A 5A3MA 1JZ3A 5A3LA 3B9IA 2D40A 1FV3A 1QGLA 2UWBA 3QOPA 3TWIA 3NNFA 2YU1A 1X8MA 2WN2A 5FZ7A 5J1XA 2PHUA 2VVDA 1LOGA 1YHFA 3PUHA 4HG6B 5T5PA 2E32A 2HYKA 3FBMA 4JZRA 3FMGA 4UFJA 4P9XA 1IS4A 4QPIA 1LTEA 1HKDA 3GGLA 2Z5WA 4P9LA 4Q4W3 3UKVA 1J3QA 4E4HA 3KV5A 1J83A 2VMDA 5F5IA 3POSA 1B35A 1GZWB 1UZ0A 2PHXA 4EYUA 1LU2A 1UY0A 2F17A 2BGCA 4XUTA 4IV3B 4M3CA 3CJIA 3P3NA 3O7OA 3OD0A 1W06A 4QX5A 4FAGA 5J09A 1NA1B 3WQ1A 2Q1ZB 1H8TB 2VZTA 3EJKA 3KQRA 3NMBA 5FLIA 5CKQA 4AI9A 5KHJA 2B8MA 3B5LB 1XU1A 2W1UA 1AYM1 3A7QA 1KFXL 1JYTA 4Q4Y3 3EB7A 1Q8OA 4CXXA 1ALYA 2WUHA 2WYSA 2PYTA 3C7GA 5EPAA 1G86A 4FQZA 2VNOA 1AR61 2ID4A 2TBVA 4LEJA 5JSOA 1L3JA 1YI7A 4RR3A 4MXVA 5F2WA 4Y33A 3KCCA 2H0VA 1SG3A 2ZEYA 2VOTA 1CAUB 1R093 1ULOA 2ZABA 4L8QA 5DZGA 1FT9A 1QHDA 2OXBA 1YNAA 3ZDSA 1W8UA 4XZPA 4BXFA 1N3QA 2RJLA 4Z2AA 3I2DA 4FOWA 4MH0E 3K75B 2WABA 4D6QA 1OH4A 2XVLA 1GZ9A 5IK5A 1NA1A 3WP5A 1GQPA 3BODA 5LBEA 1ZRRA 1QJZA 2D6PA 5F32A 3ZFFA 4B7KA 5FBZA 2EXJA 5LRRA 1D4M2 2OUJA 1OBNA 2OPWA 3LFMA 2XJVA 4JX0A 4Q5OA 4Z92B 2XJRA 2YHJA 4E4DX 5DXDA 1OT5A 3NJXA 4RSUA 5GLUA 4Q26A 5J48A 1WA4A 3WW2A 3ZIXA 3IDAA 5A3UA 2JDHA 2QZ3A 2RV9A 3HVDA 1FOD3 1LJ7A 3GHNA 1PIV3 3PMEA 3I7DA 1EPWA 2VZSA 2R32A 4V1PA 2GP5A 4RN5A 5B4NA 1Y7BA 4AVVA
chains in the Genus database with same CATH topology
4QGMA 1IS5A 3DL3A 2Q30A 3WZ1A 1VRH1 1PZ9A 2HWF1 3USSA 4YARA 3N4MA 4NHMA 3AXEA 5DG2A 2XWJB 1VIWB 4PLMA 3AYDA 1DF0A 1YI9A 3MI8A 4FP3A 1NQJA 1R081 1CAXB 3VHPA 4PDWB 5FO9B 4FSJA 4B4QA 5BNOA 4LTAA 1OI6A 4DMIA 3NKGA 2R16A 1ASJ1 3IWZA 1RUI3 2RS11 1OOPC 1JUHA 3AK0A 1HX6A 3M1HA 3MICA 1VBE2 5FOBB 3HR9A 5KHIA 3VBOB 4C1XA 1AR82 1Q8SA 3JB4C 4F8AA 2PHWA 1FATA 5FAXA 1N1YA 1XNDA 4YYOA 1RTVA 2YROA 1I6XA 5BNNA 1PHMA 2YXSA 1YIPA 5IK4A 1ND2B 3N7JA 4CEWC 2A6ZA 5K9YA 1R1A3 1XE8A 3HT1A 3WG3A 1XYNA 5CA6A 4C91A 4WM7B 4Y1YA 4BIOA 5C4WB 1GNZA 4TSVA 4GH4B 3VN4A 1OLQA 1DGWA 4N9IA 4BZ4A 2Q8OA 3MFAA 4CDWC 2OA2A 1QU0A 3KLSA 2OW4A 2H0BA 4LBLA 3PLQA 1ENXA 3RI8A 2ZGUA 4AFCA 4EN6B 4YZ2A 3DN7A 4XFFA 3VHRA 5CFCB 5F9TA 1WCSA 4Q4V2 4AQ6A 1LOEA 2R1BA 4BH9A 1MS0A 3N3HA 2NP0A 1Y9QA 3GYDA 2ZX2A 4AI1A 1COV1 3WCSA 2G9GA 4I01A 4Q4W1 5C8CA 1D2SA 3D0JA 2MHFA 1F5JA 1K5MB 5AC93 2HWC2 3TRSB 5FCCA 3A0NA 3VZLA 1GFF2 1S2KA 3NWKA 1WCDJ 1R082 1LOBA 1C8M1 3UK9A 4YG0A 3NJZA 3QH7A 4HN1A 5CIRA 1S2BA 3WCRA 5BNOB 2GMEA 4JCKA 3C3VA 1AYN3 2IZWA 4I0AA 4JGZC 5BNQA 5A32B 3ZSKA 3O14A 4AFAA 4RS5B 1CJPA 2JENA 2JG9A 5JIUA 4YVSA 1W39A 1NY72 2D6NA 4Z2WA 4PLOA 4Y20A 1RUJ3 3ZXFA 4IETA 2EIGA 4XE9A 5BV6A 4Q0UA 3MIHA 3PJYA 5CADA 3MEPA 2KA3A 2PQQA 4DOUA 1H1MA 4Y1XA 5JAXA 4EN7B 1NCQB 1JOJA 4EN0A 4GKYA 4O9EA 4R4XA 2AZ5A 1W6MA 2JD4A 4DZGA 1GR3A 2NMOA 3CF6E 4IEVA 4WBBA 4WVMB 2P17A 4Y1ZA 1YJLA 3USUA 2ZGSA 1GNHA 2UU8A 3NV2A 4AQTA 4HPKA 1AR72 1ZRCA 4ONUA 1VBB1 1H2LA 1MZ6A 2Q1MA 5I8YA 5L7OC 1BZWA 1ZBA3 4GWNA 4Y20B 1QKQA 2GH8A 2ZGOA 1DQ6A 2VOKA 4Q8LA 2B7YA 4ITCA 3AYAA 2XVKA 2IXJA 2GNDA 4NN0A 4JGYC 3IIAA 4P9GA 5GLVA 1CESA 1C1LA 3VKLA 2HWC3 3B94A 3VKFC 5JI7A 2CGOA 1QF3A 2DURA 4QPYA 2ZGKA 3OYWA 4JGZB 4AVSA 1F31A 5I91A 1K5MA 3VBOA 4COWA 1J58A 3MDPA 5DUUA 3PVNA 1LCLA 1FAYA 2XLFA 1XRUA 2ZAHA 4X6QB 2WWSA 3JQXA 1PVC2 2A71A 1NLSA 1V70A 4Y24A 2HWF3 2QFEA 2DFCA 1NCQC 1GQHA 2PLV2 2VY0A 3FFQA 2W39A 3GBGA 3SH5A 3UV9A 4KNCA 3OYWB 2UWAA 1TNFA 2AUYA 2LM3A 4I3PA 4TZDA 4AI0A 5T55A 4I3GA 4RQPA 5SV8A 3ZXDA 5ABJA 2VW1A 2HWB2 1DQ5A 4LHNA 3KT4A 5KHGA 1WW7A 3BB6A 4IL7A 3U4XA 1KXGA 3FLPA 4QHBA 1BJQA 3VDDA 5FQ0A 3BIWE 2DCKA 1ASJ3 2RJKA 1IZ3A 1GYKA 4NO4A 5CG8A 3R4DB 5AFBA 4OZXA 4YW4A 1O3QA 1YUDA 1SLAA 1REDA 2JG8C 3VKOA 3KD4A 1HQWA 3B7MA 3L9JT 3TAYA 1T6GC 1VBA3 4IESA 1YWKA 1Q8PA 1V6IA 2GH2A 4QMAA 2X5IA 4XFBA 1R091 4U36A 3M3CA 1MS9A 4YG3A 4AK3A 3VBFC 1W6PB 4ASLA 4HSLA 4DRRA 2EA7A 3ZXJA 3QLQA 5JOXA 1XU2A 1HDKA 1VALA 2H6CA 5JZGB 1OMIA 3G7DA 1ZRDA 4KGGA 1SLIA 3FBYA 3H1YA 2N7GA 4CEYA 3MIEA 4XEZA 1HRV3 4X8PA 1XE7A 1FPN2 2GN3A 4X8NA 3ZXKA 3AMMA 4D69A 5AC91 4FPHA 2CV6A 2ZACA 4YW2A 4AG4A 4CYDA 4JDNA 4QM8A 1JW6A 1QQP2 3MFCA 2ZX3A 1RMU2 1ENSA 1J1LA 4MGIE 2FMDA 1S1AA 1YFYA 1UZYA 1PNFA 2WNUC 4YGDA 1UF2C 2NZ9A 2WZR3 2WT2A 3UL2A 1WW4A 2ARXA 3ZYIB 1WD3A 3WLUA 3SNMA 1QNYA 2GNBA 2XPJA 1G9BA 1X7NA 1BBT2 1C3HA 3FUQA 4RGAA 2ILMA 3HMYA 4MSVA 4XPVA 5J96B 2G9FA 4OHXA 1RUE1 3SMHA 3RYRA 3I4IA 4HMZA 1KFUL 3AP6A 4KG0A 4LBOA 5KHKA 1LHWA 4DPNA 2D97A 3WP3A 3S7EA 3N36A 3NL1A 5CU1A 1Z78A 1G9DA 1QJX2 4YRDA 4EJRA 3ME2A 4ATEA 4G4FA 3VBUC 2ZZQA 1A6CA 5D8AB 2D7FA 1LULA 2RS33 1TME3 3JBG1 3J9SA 1NCRB 5FMOL 1CVNA 1V9U1 4KU7A 1RUC2 4XMIA 1C8M3 3AZZA 4M01A 1TEIA 4NWWA 4BOWA 2SBAA 5EV7A 4FTEA 5HCAA 2FHRA 3M2MA 1XNKA 1UPIA 3DPRA 1BMV1 4BE3A 3GNEA 1PK6A 3EHKA 2R6QA 1HRI1 2IWGB 4BA6A 4KL1A 5FDBA 5BUVA 4L11A 5HCFA 3EBRA 2ZX4A 2JG8A 4BQ1A 4L9BA 1PO23 1QOTA 1N1TA 1VBC3 2A6VA 4M00A 4U2AA 5T52A 1MEC3 2Q4SA 2ZGNA 1V6OA 2TUNA 3AP9A 5AVAA 5BXXA 5C9AB 1RUG2 3VV1A 1V00A 5CFDA 1UPSA 3VL9A 4QQLA 4P5HA 4AHWA 4ZKTB 1CGPA 4KH9A 4LLFA 4SLIA 1DYKA 1D2QA 1ZZCA 4Z1VA 4WM8B 3ZFGA 2GZWA 4GWMA 2R0FA 1IKPA 4QPIC 4K20A 4Q0VA 2R0HA 4AHYA 1QNWA 2R041 4AEDB 4YGEA 5IUQA 1NCRC 2I74A 3AP5A 1AF9A 1CAXA 2KM2A 5DDJ2 1Q43A 1QH7A 1LRHA 1R092 4I2OA 5DZEA 5HCBA 1PGL1 3E5XA 1UD1A 1MQTB 1QJX3 1GICA 3ZSEA 4HFSA 4K1YA 4WZFA 3ZFFB 5K0UB 2VECA 3BCWA 3MF6A 4HPKB 5DUVA 4HANA 5GJ6A 1RB8G 3SCHA 1VBE1 1HQNA 3KCYA 1A8DA 3MIBA 1ZRFA 2ZZJA 3ZX7A 2VUJA 2D6KA 2X5IB 1KDMA 4PIZA 1JN2P 2W52A 1LENA 5GLZA 2EVXA 3S7IA 4YFZA 2UYAA 1ND3B 1D4VB 1LHUA 1QJY2 1U5IA 1WLTA 4B7EA 2WZR2 1MZEA 2GMPA 4M0HA 4FQ4A 5C9AC 5JI9A 1ZA4A 1YLLA 1CX4A 3T1LA 3VBHC 1PO22 3IPVB 2AENA 2GNTA 2VXRA 4GH4A 2WINB 4Q29A 4YVWA 5JZGA 1QQP3 2BNMA 3OGJA 1GSLA 2HWD3 2DTYA 1V6MA 3AKRA 2RMU1 1UX6A 3H8UA 2A6YA 3R4UA 1I1EA 3GBFA 4ZU4A 4FAHA 2RR11 1JUIA 3CU7A 1B35B 3ES1A 4Q1PA 4NR1A 2DU0A 2WL1A 3DUIA 3MIFA 1W0PA 1ZM1A 2XL9A 3E5UA 1F9KA 3C2UA 3BU7A 4AFDA 3MPBA 1SDWA 2LUWA 3HN1A 2QCSB 2DV9A 4P9YA 3LKJA 3PVEA 4YFWA 1G8WA 2HWC1 3LAGA 3ZN6B 1ZBE1 4AFBA 1S0DA 2R073 1Q56A 3WNXA 3DKWA 2ZHKA 2JEMA 4FO9A 4HKWA 3RMYA 2PAEA 2OIIA 3PJQA 4HVQA 4QPGC 3ALQA 4AI3A 5E8AA 4H7LA 1FI2A 4HVRA 1XNBA 1VR3A 4EWAA 3VBFA 1YXWA 1Q5OA 5JSPA 3JCIA 2NN8A 1LESA 3KT1A 2XL7A 4F7ZA 1SACA 1WMEA 1A3KA 2GC0A 1M06G 3IKWA 2QUOA 1RMU3 4XBQA 2VMIA 3WV6A 4OI1A 2Y0IA 1HQLA 1QWRA 2ZGRA 3WXPA 2EAAA 2O1QA 1ULFA 1CAWA 2UWCA 3ROUA 2FZ2A 2WS91 4YZ5A 3RRDA 4GIQA 2HWD2 3FLTA 2K2SA 4FPCA 4BHPA 2C1FA 1EYBA 1Z7S3 2ZMKA 3D0SA 5JMCA 4XDQA 2ZKNA 5C8WA 2FZ1A 2QJVA 4CDUC 3JU9A 4YSFA 4HK8A 4PDWA 2ATFA 1W6NB 4IQPA 1NQDA 1WCKA 3AXDA 1DU3D 1ZZBA 1RHI1 3ENRA 3LA3A 3NAPC 2ZS6B 4YW5A 5L73A 1AXZA 4FPGA 3W58A 2CTVA 5K7PA 1LR5A 1AR81 4IEYA 3ZSMA 3LZZA 2TEPA 4UW5A 1AYM2 1O4ZA 1RINA 2XH6A 3RJ2X 5GZFA 5C33A 2VOVA 4KU8A 1RIRA 4DQAA 2TNFA 1KDKA 3WP4A 2GNMA 2WA4A 1S0JA 4GXLA 5BNPA 4INDA 1CAWB 1QH6A 1NA1C 4AEJA 1H8TC 1V9U3 4WM7A 5FO7B 3TN92 1MS4A 5JR7B 5LK5A 4N43B 1KQRA 4AHXA 2QQPA 2DF7A 4KGQA 1GLHA 1VBD2 1YIFA 1F8VA 1D4M1 1N1VA 4C90A 4CDWB 1FOD1 4HT1T 1CD3G 1URXA 2WNVB 4AGVA 1RUH3 4RR3B 4CDUB 1RUG3 1WBFA 2XUMA 3QD6A 1Q3EA 1PGW2 2XBO1 1LGNA 4LO7A 1PO21 3POYA 4LLOA 3OD4A 4BWOA 4QU2A 4MZUA 1PIV1 1UMZA 1AYN2 4FPJA 4HBNA 4BCUA 2BVVA 4PQ9A 3BPZA 1RUH2 2BUKA 1W2UA 1FPN3 3VBRC 3NO8A 4K7JA 1RUC1 2RHPA 3WW4A 1AX1A 1O4YA 1G9CA 3RI9A 1RUNA 1MS8A 4AFMA 2ZGPA 3WVJA 3FLRA 3WDXA 3KB5A 3IDBB 4HK9A 1R1ZA 2QVSB 2D3RA 2R49A 2UY8A 2VVEA 3I59B 1LOFC 4XFAA 2VOWA 3PHMA 4N43C 1S0IA 2VULA 4FCAA 3IMNA 4XFCA 4AYUA 4PDWC 3PVBB 4CP0A 1WW5A 4NVPA 1AR93 1JYCA 3AKTA 3LA2A 2WS93 2VOXA 4RD7A 4N90A 5CVRA 1O91A 2E7AA 5F6LB 3JD72 4J1WA 4XETA 1AL23 2NPIA 4JC1A 4RHV1 3BOWA 1OHFA 4FXKB 2JG9B 4FPFA 2XJSA 3N7LA 5JLVA 1KS5A 2B46X 4OULA 1RMU1 4L92A 5IT6A 4AEKA 4D3WA 2MEV1 3NV3A 4IEQA 2YMZA 1VBD3 2DCTA 2ZCWA 1CJDA 2LTNA 2HWD1 1OPOA 4AEDA 2R042 4CEYB 2BNNA 2R063 2RMU3 4CZSA 4I09A 4I0BA 1MS3A 1LKNA 3VBRB 1U12A 4JGYB 3VHNA 4WM7C 3ZYJB 4AW7A 1Z7S2 5C4WC 5JSRA 1RUF1 2A6XA 1VAKA 4GALA 2A5ZA 1HRV2 3ACLA 3BOPA 2B5HA 4LO6B 1LHVA 3AZVA 1C5HA 4XQWA 1NLRA 4AI8A 2NMNA 4S2HA 4XF4A 5FPXA 1CIWA 5CFCC 3ZXEA 3FJSA 1RUI1 3AX4A 1OKQA 3OBRA 2I2SA 1X36A 4GMP1 3WUCA 4CDXB 1F5FA 4KWKA 1WW6A 2RS52 2WSUA 1QJU2 5FQ0B 3CJIB 4XIKA 4XFIA 1H2MA 1VBA2 1K5MC 2JE9A 3OBTA 1AHSA 5FRAA 2HJIA 1QOSA 2VVFA 4K3UA 3ZFEB 1WBLA 5T5LA 3RS6A 2MNGA 2HEYF 4Q4X3 2HWB1 4IEWA 3ZSLA 2PHTA 5L19A 1XXNA 2R1DA 5CFCA 4PLNA 4KG8A 1D4M3 3VBSB 3AKPA 4OLLA 1DLLA 4RS5C 2DVFA 1H2KA 2DVBA 2CWMA 2R062 2R043 3ZXAC 3R05A 4KQ7A 4WVVA 1HRI2 3RPQA 5I0RA 4RL7A 2BBVA 4BIFA 4HL0A 1W6QA 5JWPA 5AFEA 1EV13 2JKBA 1NXMA 1VBE3 1TMF1 3ATGA 3N7KA 3A0KA 3FFZA 4QM9A 4AHZA 4AQSA 2AYHA 3OTFA 1RUD3 2BFUS 3K51A 2HEVF 1QDCA 1ND2A 2ZHMA 3KM5A 3VBSA 4BM8A 2GSYA 3LCPA 5FTTC 4HETA 3VBFB 1AR71 4XF0A 3RYKA 2DCJA 2VW0A 4AI2A 3U07A 2DTWA 2CL2A 3NW4A 3AZXA 4DS0A 3M3IA 2DWRA 2RS53 3TOJA 2RS13 4GKXA 4OHZA 3CJXA 1TNRA 5SV5A 2WT0A 2PELA 3RG0A 4META 3OCPA 5BNNB 3ZPYA 5EWSA 1R083 4E2GA 3MF9A 4BLIA 4B8EA 1UKRA 1PGL2 3HIFA 5GZEA 3IN9A 3D6EA 4P9WA 3SHRA 1S0EA 2NM1A 3WW1A 5FO8B 3ZVXA 3T1MA 2D93A 5FOJB 5J3UA 3LSDA 1EAH3 1VP6A 2IFRA 5JDBA 4R8HA 1YFWA 3QACA 1VBB3 1H8VA 1I5ZA 1ZBA2 3U10A 1MZFA 1MACA