2R49A

Mutational and structural studies of e85i reveal the flexible loops of fibrobacter succinogenes 1,3-1,4-beta-d-glucanaseglucanase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
b'SAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSIKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title Mutational and Structural Studies of E85I Reveal the Flexible Loops on Truncated Fibrobacter succinogenes 1,3-1,4-beta-D-Glucanase
rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
total genus 59
structure length 241
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2007-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r49A00
2JD4A 3I8TA 4NO4A 3PVOA 3IPVB 2GNTA 2ZGNA 3WUDA 3M3QA 4XBNA 2A71A 2A6YA 2VY0A 4ITCA 4XHBA 2FMDA 1FV2A 1DQ1A 2PHRA 1SBDA 3WCRA 1DQ6A 3O12A 4FPCA 4LBLA 4YGEA 4UW3A 1JBCA 2ZKNA 1DQ2A 2D6OX 5GZEA 1LHOA 4Q8KA 1BJQA 5GM0A 3FUOA 3Q9OA 1UX6A 1X50A 3QCWA 1SLCA 4P9XA 4Q8LA 3WDUA 3U4XA 3BTAA 1MACA 1SLLA 3C2UA 1AJKA 3ZXFA 2ZHNA 5GLWA 4CRQA 4Y24A 2P3KA 1AX0A 5DUXA 4CZSA 3MW2A 5JOZA 5F5QA 2CTVA 2ZMLA 1MZ6A 2ZACA 2OUJA 3APBA 3R05A 2A6VA 1URXA 3NV3A 1FAYA 1DYKA 1QF3A 2WQZC 2AGSA 4IQPA 3FLPA 2YXSA 1CVNA 1DHKB 4R9BA 1ONAA 5GLVA 4YZ2A 4XJ9A 5H9QA 2LTNA 3PVNA 1PZ8A 3IPVA 3WHUA 3N3HA 5JLVA 3UJOA 4PBPA 4K1ZA 1LECA 2D43A 3AYDA 4YGCA 4XMIA 3DGTA 5H9RA 1D0HA 2ZGUA 2ZGOA 2R0FA 4KBBA 2ZA9A 2P2KA 2DUOA 2ARBA 3UK9A 3ZPYA 1F9KA 5DG1A 2D6NA 3PVEA 5E8AA 3FBYA 3M1HA 1AXKA 4M3CE 1GZWB 4YW3A 2JJ6A 5T55A 4GWMA 2AENA 4H55A 1OQ1A 1CJPA 1IS4A 1MS4A 4ATFA 1IKPA 2Q5TA 2A75A 4M3CF 4RL7A 5GLZA 1LGNA 3LSEA 1SBEA 4Q2FA 4FOQA 3RMYA 4BMEA 4YLZA 2VXRA 4Y1UA 3V65A 3RMXA 3IM0A 1LENA 2DVGA 4XTPA 4FOVA 2AH2A 2NMOA 3A0KA 4JRAA 1LU2A 2WNEA 2EXIA 1KQRA 4AYUA 2DU1A 1IKQA 2D44A 5AVAA 2VUAA 4AWDA 4XXPA 5T50A 4BM8A 1Y7BA 1CN1A 1ULCA 2D3PA 4UW6A 1JN2P 5DG2A 2DVFA 4WVVA 2UWCA 4HANA 5BYNA 1GYKA 4YZ5A 1WW7A 4RA0A 4FQZA 4FPOB 5HCAA 1GZWA 2R0HA 3ZYPA 1GBGA 2EXJA 1W6MB 4U36A 4M01A 3ZXJA 1LOEA 1G8WA 5T54A 1CIWA 4BLIA 2NP0A 5LK5A 3SLIA 2SLIA 5GZFA 4K20A 3N7KA 2I2SA 3AYAA 1GSLA 3W59A 4FP2A 4XDQA 1O4ZA 2OVUA 4LBKA 4YGDA 4K21A 1Z78A 3KM5A 4R9AA 3WVJA 4FPKA 5EYYA 1AF9A 2AREA 4LBQB 1J1TA 2GNBA 2YROA 3AJZA 2E6VA 5JVVA 1FV3A 1JYIA 5IT6A 2PHXA 1JYCA 4AGVA 2CL2A 2OW4A 3AZVA 1RITA 1DQ4A 1DQ5A 1GICA 5CA6A 4GKYA 1S0FA 2V5YA 2C9AA 4Y1VA 5KXCA 1MS1A 3WG2A 5GZGA 1LOAA 4U2AA 3AZXA 2ZGSA 1RIRA 4P14A 1BZWA 3RQ0A 5JMCA 1WBFA 1W6MA 1NLSA 2ZGPA 3HR9A 2H0BA 1G7YA 1YXWA 2PHTA 3MW3A 1Z0HA 1ULGA 1MZ5A 3RS6A 2KM2A 4XBLA 4C1WA 1ENRA 1UPSA 4LBJA 3ILFA 2DUQA 2NM1A 2ZGKA 5EYXA 5GZCA 1QMJA 3BOPA 5CNAA 1AX1A 4LBQA 1MS5A 2JKBA 5KXDA 2ZHLA 1BYHA 4TZDA 1IS5A 4MYEA 4FOYA 3M3EA 1I1EA 2D6MA 2DVDA 3ZSLA 3O0XA 1JOJA 1V00A 3V0AB 2BQPA 3IKWA 4YW2A 2XG3A 3WUCA 1G9FA 1UMZA 2JECA 2D3SA 3UJQA 2DYCA 4DFSA 1UL9A 2E7TA 2ZZJA 1DGLA 3N36A 4Y20B 4F83A 1KJLA 1D2SA 2VW1A 3IMNA 4LBMA 1CQ9A 4YG0A 1F5FA 3RSJA 3OYWB 2P34A 1N1SA 3FLRA 3I4IA 3RRDA 5IUQA 1ENQA 1G9BA 2E53A 1JXNA 1V6MA 3SH4A 4BMBA 3HN1A 5DZGA 1GNHA 1QOTA 2ARXA 4WVWA 1YIFA 3VKNA 4FPYA 3ZSMA 3FFZA 4XE9A 4YM0A 1LHNA 4YFWA 1DBNA 2DWRA 1FYUA 2PHFA 1Q8OA 4K1YA 1ENSA 4ZKTB 1R1ZA 3WOGA 2A6ZA 1F31A 2CWSA 5FRAA 3NV1A 3T1LA 1VAMA 3ZVXA 1LCLA 3V64A 1SCRA 1VALA 5CBLA 1G9AA 3TAYA 1APNA 3V0AA 3H0OA 3OPZA 4TYSA 1AX2A 5DUVA 3ZXLA 3LCPA 4YFZA 2XB6C 4Y20A 3WHTA 3B00A 1U0AA 1S0IA 4JCKA 1KJRA 1CPNA 3N7LA 1DIWA 1UN1A 2A3XA 2GNDA 3CNAA 3NV2A 4FPLA 2B7YA 3BIWE 5DUUA 2OUHA 2ZMNA 3AP6A 5CAZA 2ZGMA 4XTMA 1QDCA 4FOWA 5DUWA 1LHUA 3WV6A 5IK7A 3SITA 3AXDA 3AZWA 2DV9A 2EALA 2UU8A 2VU9A 1O4YA 1AXYA 1VAVA 2TEPA 1N3OA 4XJ8A 1QOOA 1VIWB 2D6PA 4LBNA 2D7FA 3WNXA 4FPHA 5GZDA 5T52A 4C1XA 4YG3A 4DRVA 1MVQA 4BOWA 2EAKA 3N7MA 3A0NA 1IS3A 1H9WA 1S0BA 1B09A 2JE7A 3PMEA 5GALA 2WSUA 1H30A 4BLJA 1A8DA 1N47A 4FQ4A 1MS0A 5DXDA 3OBRA 4ISRA 2YMZA 2E7QA 2R16A 4Y1YA 1UAIA 4AVSA 1SFYA 1SACA 3SNMA 4BQ1A 4XILA 2FHRA 2D6KA 3M3OA 2EIGA 4GWNA 3AYEA 3USUB 2DTYA 3PJQA 5EXOA 2EXHA 1LHVA 1N1YA 2YY1A 4PQ9A 1SLBA 3VKLA 2AR6A 1JW6A 1HQWA 1ULEA 1IS6A 1AVBA 1S0EA 4GXLA 1S0JA 3WDVA 3RG0A 1DFQA 3V0BB 4GA9A 1GKBA 2DVBA 3NWKA 1OKQA 5SV8A 5JOWA 5DZFA 2A6WA 3ZSKA 2VH9A 4XJAA 2CWMA 1QOSA 4FVVA 4PBOA 4FPGA 1LGCA 1S1AA 4AVVA 5T5OA 3AP9A 2R49A 1C57A 1KRIA 3FUQA 4Q27A 2P37A 4Y1XA 2ENRA 2NZ9A 1LHWA 1GANA 3AP5A 3OGGA 5T5JA 1WCSA 4YM2A 5KXBA 4LBQD 1Q8SA 5T5LA 3MEPA 5JDBA 3AX4A 1HDKA 1ZM1A 1XQNA 2ZGTA 2GMMA 2AUYA 1Q8PA 3IN9A 4YW4A 3MW4A 1SLIA 5IK4A 1CPMA 1SLAA 2GMPA 3A4UA 2UWBA 1I3HA 2Z42A 1LOGA 1FNZA 1V6OA 1YO8A 2WT1A 1KITA 3OBTA 3POSA 1W6QB 1KDMA 1AJOA 2GMEA 3B01A 1HKDA 1V6IA 4FP3A 1FATA 2NYYA 2W52A 3WDTA 3L2YA 5T5PA 1AZDA 3W58A 4XXAA 4P9WA 3O0WA 3R4UA 1S0DA 5IK8A 2NN8A 1WBLA 4DS0A 1ZA4A 1RINA 2ZGQA 1CESA 3B9CA 2A5ZA 1SBFA 1N1TA 1UZZA 3AZZA 2WSVA 5FREA 1WD3A 4XIOA 1QDOA 3HMYA 1LESA 2WLQA 4XIKA 2A3YA 4Q1PA 3VUOA 3D6EA 1JUIA 2PHUA 3AXEA 3ILNA 3POWA 5HCFA 1QNWA 2C5DA 4XYXA 2JDZA 4YW1A 3AP4A 2WT0A 1IOAA 2JE9A 1N1VA 3FLTA 4GKXA 3NV4A 1WLDA 2W08A 4M3CB 2D6LX 2ZGLA 2LALA 1MS9A 1QNYA 2ES3A 4Y1ZA 1W6QA 2A7AA 2EXKA 4YZ4A 2WKKA 5F9TA 4BPZA 1OFSA 1Q8VA 3D5OA 4JC1A 1AXZA 1LU1A 3WDYA 1HLCA 4ISQA 1V6JA 1LOFA 1MR5A 2WT2A 1LOBA 2ZBJA 3AJYA 1GLHA 1LGBA 2R1BA 2HYKA 1GZ9A 1Q56A 4XZPA 3N7JA 3GNEA 2R1DA 3AP7A 2G4IA 1YI7A 1PZ9A 2CY6A 1LODA 3OY8B 1WW6A 3OYWA 4XJZA 4XMAA 1N3PA 1QKQA 1WW4A 1KDKA 3QLQA 1LTEA 4FPJA 4XOGA 3N35A 4YM1A 2CYFA 4SLIA 2ERFA 1UKGA 4YG6A 3OJBA 2D3RA 2P3IA 4AGRA 1V6LA 2DVAA 2YZ4A 1WW5A 4M3CA 5GLTA 2GN3A 1CONA 1G9DA 3B69A 1WLWA 2UURA 1C4RA 4CTEA 1LJ7A 3VKFC 3WLUA 5DZEA 4AGGA 1S0CA 1WD4A 2DU0A 3AZYA 3WG3A 2PELA 4YGBA 3KQRA 1V6KA 2DUPA 3D4KA 3VV1A 1CR7A 2E51A 1NXD1 1DLLA 1A3KA 1BKZA 1Q8QA 5CB7A 1MS8A 2VW0A 5JOXA 4YM3A 3WG1A 4FPEA 3OY8A 2YV8A 2GDFA 2ZHKA 4DQAA 3TB0A 4Z8BA 2ZAAA 2ZABA 2EF6A 2ZHMA 4WZFA 1PZ7A 1YYNA 1BXHA 2GNMA 2ZGRA 5EWSA 1ULFA 2GN7A 1V6NA 2AYHA 4HL0A 3R4SA 4XJWA 4Y22B 1YRZA 1WUVA 5E89A 1LULA 4YW5A 4M00A 4AVTA 1W6NB 4L8QA 1DYPA 2DURA 2V73A 4NOTA 1WLCA 3SH5A 1W6OB 3ZXEA 4GALA 4FPFA 3ZSJA 2NMNA 1A78A 4P9YA 1HQLA 4R9DA 4XJUA 3DUIA 2DTWA 4ZXKA 5KXEA 1W0PA 2SBAA 1SCSA 1ULDA 1GNZA 1VLNA 2P3JA 3BODA 4PCRA 1QU0A 4PF5A 4UW5A 5HCBA 3SH3A 2VW2A 1LEMA 1DQ0A 4DPNA 3UL2A 3VKMA 4XHXA 3T1MA 2RHPA 3AFKA 2A70A 1QGLA 1C1LA 1SLTA 1W6PB 3INAA 4LBOA 4YZ1A 5IK5A 4YZ3A 2W68A 3O5SA 5GLUA 3O0VA 3USUA 5JOYA 3ASIA 1N3QA 1LOFC 3AYCA 3ATGA 4OZXA 5H9PA 1LEDA 4D69A 2PHWA 3MPPG 4Y22A 1H9PA 1MS3A 3ILRA 4W65A 3SISA 1W6NA 5GJ6A 3V0BA 5H9SA 1MVEA 4ASMB 2GALA 3WG4A 1JHNA 1W6OA 3ZYRA 1FNYA 2A3WA 3POYA 2A6XA 4DRRA 3GALA 3AK0A 4I30A 1DZQA 1TEIA 3M3CA 3WDWA 3WDXA 3LSDA 2WJSA 1BQPA 1W0OA 2W39A 1C1FA 4XBQA 5E88A 3B3QE 3M2MA 1W6PA 2UWAA 4Q26A 3ZXKA 1S0GA 3VKOA 1LOCA 1GV9A 4ATEA 3ENRA 2ZMKA 4Q1RA 4UW4A 4WV8A 3JU9A 1UZYA 5L73A 3WZ1A 2CNAA 4Y26A 4R9CA 1GZCA 1G86A 1EPWA 3JUUA 1G9CA 1FX5A 3WCSA 3T2TA
chains in the Genus database with same CATH superfamily
2P1BA 2GNTA 4GMP0 5FK8A 1I6XA 1ND3A 2A71A 2KR2A 2LS6A 3NAPC 4URTA 5BNNB 1FV2A 4NIGA 1W28A 2QQWA 1DQ6A 4LBLA 2YC4A 2ADEA 2ZEXA 2JWPA 4ZS3A 3LD8A 5GZEA 5GM0A 5FYSA 3FUOA 4CDQB 2WINB 1UX6A 3QCWA 1RUI3 5F8PA 2FDIA 2UYBA 3VBFB 3BTAA 2QUOA 3WW2A 4DXRA 3C2UA 2WNVB 3WR0A 2P3KA 2IVJA 4DNYA 5JOZA 3AKRA 5FZ6A 3PU3A 5FO9B 2GP5A 1F5JA 1VR3A 3B94A 3ZKYA 3WF0A 2ZAHA 2EA7A 5IJRA 1UU4A 4WVMB 1QJY2 1FAYA 3P1IA 4LJHA 2XVLA 2TUNA 2WQZC 4LHLA 3WD5A 4K8FA 1ONAA 4R9BA 5GLVA 3VBHA 4AFAA 1PZ8A 3IPVA 4PQQA 3N3HA 3T08A 5FPBA 3IT8A 1EV11 4PBPA 1JOBA 1H2KA 4K1ZA 1LECA 4IGOA 1JZ4A 4XMIA 3DGTA 2ZGOA 4KBBA 4BK4A 2P2KA 4IEXA 3KQ4B 1R1A3 1PGL2 2J7MA 4LHNA 4YW3A 1C8NA 1ZRCA 2NQYA 2AENA 3VBOA 3UESA 4H55A 5KXCA 3HQRA 1VBA2 3ZDVA 4ATFA 4QQHA 1IKPA 5FP3A 2Q5TA 2A75A 2OKXA 3LSEA 5KHJA 5F6LB 3VBFC 2WS93 1LAJA 2ORXA 2WYSA 4QM8A 5ACA1 3SHRA 1ZRFA 4BZ4A 2R7EB 3RMXA 2QVSB 3KGZA 3ZFFB 4ZZ5A 5FZOA 4OUSA 4JAAA 5B4NA 3SKVA 4JRAA 3UGGA 4IV3C 1LU2A 2WNUC 5CYYA 1YUDA 2WFF2 1VRH2 5F32A 4AFBA 4AWDA 1F2NA 5ANQA 4JGZA 1CN1A 1SFNA 1U5IA 1ULCA 2Q0AA 1XYOA 1J84A 1YQ6A 5FR3A 3FC0A 1JN2P 1R092 1GUIA 1ND2C 1W2OA 2JD9A 4WVVA 3TYJA 4R8HA 5BYNA 1IG0A 1AYN3 5FKCA 1YQ2A 3WNKA 2VCMA 1K42A 1GZWA 4A3XA 1S2BA 2PLV1 4K40A 4U36A 4PDWC 5FY4A 1LOEA 3WQ1A 3ZXJA 4Z2AA 3ITQA 1G8WA 4BLIA 1CIWA 2J22A 1YNAA 4PLMA 2NP0A 1JH5A 1E5SA 3SLIA 4OZOA 3KS7A 1KXGA 2IFWA 3AYAA 3W59A 3TEZA 1S55A 1VBD3 4FP2A 1O4ZA 4LHKA 1X36A 2VMGA 4EE2A 3MIGA 4JZRA 4R9AA 4L9BA 3O1TA 3ON7A 4OHXA 5EYYA 4CUAA 1J1TA 3JB8A 3ROUA 3AJZA 2ZJCA 1ALYA 4Q0QA 4ARXA 5L9VA 1FV3A 2MEV3 2PTMA 3OD4A 1DGWA 2PHXA 3VHRA 4PLOA 3S57A 1EUUA 2OW4A 4YW7A 1D0GA 1DQ4A 3ELNA 2GP3A 4QQ2A 1NCRA 2WYFA 3I2HA 3POIA 1RUC3 3WG2A 4A41A 4A7ZA 2N7GA 5JIUA 4V1PA 1SDDB 2DCTA 2HKXA 2Y6GA 3VHOA 3U07A 2ZGSA 1RHI2 2XL9A 1BZWA 2BBAA 2MPFA 2VUDA 4XAAA 4YRDA 2FDGA 2H0BA 1SHWB 1RGSA 3MFCA 1YXWA 1X7NA 3MUZ1 1NCQC 3F95A 2QNKA 3KT4A 4XQ4A 4QAWA 1MZ5A 2X5IC 4XBLA 2R6QA 1UPSA 1EAH2 5FOBB 3QD6A 3ILFA 4LO8A 2DUQA 2ZGKA 2UY8A 4WVZA 5EYXA 4E4HA 3UNPA 1FT9A 2ZX4A 1ZRIA 1MS5A 2QQUA 4JDMA 4LBQA 3VD7A 4N53C 3PHMA 3B5LB 3ZFGC 4EN9B 2RM23 1ZBE2 3M3EA 4QPIA 3JBG1 1I1EA 1SQ4A 3V56A 1VBC1 4BDVB 4FXKB 2OT7A 4LNVA 2FCTA 3KWVA 3NJZA 1UMZA 5L9BA 3ZN4A 3LKJA 3KLSA 3MHZA 1OOPB 2CAVA 4EV0A 3U14A 1VE0A 4RS5A 4N7UA 4NPLA 1DGLA 5FUPA 5BNOA 3OBZA 3D3AA 1RB8G 2VW1A 4PJYA 2HWB3 5A7PA 1ZBA3 2V5DA 1F5FA 1PK6C 1RXFA 4N43C 5D8AC 3RSJA 4FAHA 5BNQA 3FLRA 4CCLA 1PO13 4S2DA 4QB1A 2Q8DA 4PI0A 5C9AC 2DDUA 2BFUL 3LEMA 3ORJA 3SH4A 5DZGA 1QOTA 2EVXA 1YQ8A 4LO7A 2BOIA 2BP6A 2ZX2A 3QH6A 3PUHA 1FOD3 3OB8A 2VJXA 4XE9A 1DBNA 1IHMA 4HOOA 4RQPC 4FFHA 2PHFA 4ZKTB 1CWPA 3KT1A 4XVHA 4AHXA 2Q4SA 4JKLA 1CAVA 1J3PA 5ABJB 2LRPA 4S2GA 1UOGA 3ZMOA 2QCSB 1NLRA 2YPDA 4BQ2A 1RUE3 3LPFA 3TAYA 1RL3A 4CYDA 1VJ2A 4COWA 2RV9A 5CBLA 1RMU1 2BUKA 4JGYB 3S7IA 4CP0A 1BEV3 1AL23 1O59A 1W8WA 5B2GB 2HLEA 1EV12 2DFBA 4GH4C 4TYSA 5K0UC 5DUVA 1B35B 2FBEA 1UYYA 4JX0A 2XB6C 3TEYA 3KMHA 3B00A 5A32A 1S0IA 1HRV3 3N7LA 1CX4A 4HN0A 1PVC3 1UN1A 2A3XA 2GNDA 4B7EA 3RVHA 5C8CC 3I2JA 1ZX5A 4XQWA 1JI6A 5C4WC 2ZGMA 4XTMA 4ET7A 5DMYA 4HK8A 5J36A 5DUWA 3EXUA 4I0AA 3JQXA 1GMMA 2DV9A 2VU9A 2TEPA 1DZRA 1VIWB 4LBNA 3WNXA 1OH4A 2D7FA 5ACA2 2IZWA 1OVSA 4XURA 2W5FA 5T52A 1NX9A 1PMHX 1Y9GA 2Q30A 2XJVA 4YG3A 4R4XA 4NWVA 3ZYIB 2EAKA 2JKXA 4EN7B 2X05A 4IE0A 4LK7A 4IE4A 4BLJA 4IV1C 1MEC1 5BNPA 5L36A 1ZZ7A 1W8UA 5DXDA 1KEXA 5A80A 2R16A 1UAIA 2Y34A 1TME3 3IB3A 5FXVA 1CX1A 3ZFEC 5C33A 4QX1A 4AHWA 3BIEA 4XETA 1POQA 2ARAA 2WFPA 3LEGA 2PLV2 4HVRA 2JDYA 5EXOA 5J09A 4NR1A 2VMEA 3H7YA 4CU6A 5BXXA 1ZRRA 4PQ9A 4OULA 2H6BA 1AVBA 1S0EA 4GXLA 1AR81 1W8FA 3C7HA 1X9TA 4MGKE 1DFQA 3CJIB 3TNQA 4LIUA 4W8JA 4YARA 4FAGA 4Q4V3 5HV0A 2RMU3 4LT5A 2VVEA 4UFLA 3E1F1 4XJAA 1BBT3 2CWMA 5EJ3A 4FVVA 4AVVA 1LGCA 1S1AA 1W2NA 5FWEA 1KRIA 1UU6A 3ACFA 4Y1XA 4BE3A 3P5BA 5SV5A 2GC0A 3PMSA 5FMDA 5JIAA 4YM2A 2KXLA 5JZGB 5KXBA 1NOVA 3RJRA 4MX3A 1IG3A 5T5LA 3VBHC 1POV3 4I2OA 2VPVA 1XQNA 5DDJ3 3BALA 1ZRDA 4QKNA 5F39A 2VAUA 4K3UA 4AEJA 1CPMA 3DEMA 4HVQA 4CP9A 2GMPA 2QQOA 4LULA 2AC1A 2YFUA 2JG9A 2VM9A 2CGNA 3A4UA 1I5PA 2UWBA 1I3HA 1PO21 2E63A 4CDXA 4INDA 1ND3B 3NNFA 5JSOA 4NIDA 2C1FA 3OBTA 4Y5SA 4PIXA 3VBOC 3TN93 5LEKA 5HXMA 3JBG2 4LKSA 5J3UA 4V2WA 5FZ9A 1AZDA 1VBC2 3W58A 4XXAA 4P9WA 5EIYB 2MEV1 1S0DA 5FYBA 5L7OB 2NN8A 5FYHA 1ZA4A 2ZGQA 1NY71 2VQTA 3LDRA 4EWEA 3AZZA 1N1TA 1WA6X 5IW0A 4ARYA 3AC0A 4DEVA 4WM7A 5FV3A 1Y9MA 3P3PA 2WLQA 4C0HA 4OHYA 3CZJA 1L7LA 2R063 1DF0A 3D6EA 3AXEA 3AMNA 4MUVA 1PNFA 2C9KA 1IPKA 4ZU4A 1QNWA 2R043 4HPKA 3AP4A 3MICA 1J58A 5C3OA 2IXCA 2WIIB 3IDEA 3HPNA 1O6UA 3N9NA 4XFFA 5FMOS 4QX5A 4AVBA 2ZGLA 4LUKA 1EUTA 5BPXA 4Y1ZA 1QQP3 4BU2A 5A70A 2ARCA 2EXKA 1RUH3 2VBBA 3BGAA 4JC1A 1CAXA 2OX0A 4PF1A 1AXZA 1HLCA 1AR63 1SFPA 2RM21 2W3JA 4XUOA 5C3PA 2WT2A 2XGXA 3CKHA 4MGQA 3VL8A 1RMU2 3B9IA 2RS11 3EHKA 2O8OA 2VXJA 4L97A 4NAMA 1LODA 2BVBA 1WW4A 3OGJA 3R0RA 3AMMA 1SZBA 1ZBA1 4G4FA 1H1AA 3QACA 4COUA 2W46A 3SCFA 4MADA 1PO11 2DVAA 5LBBA 4HG6B 1WW5A 2VMDA 5A7OA 2OYZA 1FOD1 1WLWA 3GDBA 4CDUB 5LY2A 2OPWA 1LJ7A 1NE6A 2BJSA 2QDNA 3VDDC 3ZYHA 4UT5A 4DOUA 2O1QA 3WLUA 3ZYJB 4MGYE 1H6XA 1S0CA 1WD4A 5FZ7A 3AZYA 3A23A 3TWIA 3O7OA 1JYWA 3T30A 1RUE1 3OGSA 1JU3A 5JXGA 4BJ0A 3BU7A 1MEC2 1BEV1 1A3KA 4B4RA 1BKZA 2Q1ZB 3U1XA 5IVBA 3I2OA 1MS8A 4XFGA 1X82A 4YM3A 4OMDA 4FPEA 3OY8A 3T2PA 3NAPA 1W3XA 2FMYA 1OA3A 4D7SA 1AL0G 4LO6B 4NPRA 4MVTA 4WZFA 1FMD2 3T0AA 1YYNA 3WX5A 2O8QA 4D6RA 2GN7A 4M0HA 3ETQA 4Y22B 1UWWA 2PFWA 1WUVA 4KI5M 5FJHA 3BPSA 4RS5C 4XCAA 3K75B 1XNKA 5K4LA 4BQYA 1AR82 3DYMA 1DYPA 3NNJA 3S6PA 3SH5A 4K8RB 1W6OB 3ZXEA 4CCOA 1HRI1 2BEOA 1NCRB 1PGW1 2WBKA 4FPFA 4MV2A 5A3PA 5A3WA 1IQDC 2E32A 4ZXKA 1ULDA 2OA2A 4UW5A 2BNOA 4CCMA 2VW2A 4JTOA 3DPRC 1DQ0A 1ZNPA 4DPNA 2BRTA 3WW3A 1YWKA 4XHXA 1GWKA 4AOCA 1RUD2 1J59A 1H8TC 5KC5A 5KHKA 4BXSV 2KD7A 3O5SA 5GLUA 3O0VA 2PQSA 3USUA 2W1WA 1Z7S1 1N3QA 1TME1 2P6HA 2W1UA 1QY4A 5HXVA 3ATGA 3NRUA 1CAWA 1UPIA 3MPPG 4JTNA 3TBDA 1SMVA 4CCEA 2XXZA 4EYUA 4QQPA 1H9PA 5KHIA 2QE3A 1ULOA 2YGMA 1W6NA 3PLQA 3SISA 1Q5OA 4K7JA 5GJ6A 4LPLA 3VBUA 1OD3A 2CSGA 2VCCA 1QJX2 4C91A 4CSWA 1PO22 2RR13 3TEWA 1FNYA 3DV8A 4YSFA 3POYA 3VBFA 1MQTC 2W2IA 3N9LA 3M3CA 2P4EA 4I0BA 1TNRA 1A8MA 2K2SA 1ASJ1 2LUWA 2RMU1 3JZVA 4HK9A 4Q4V1 3WDXA 5A33A 3C3VA 1BBT1 1W0OA 2VL4A 3MLKA 2J1RA 1C1FA 2W39A 2WNUA 4AI2A 1G6NA 5E88A 1NY72 3LF7A 1W6PA 2UWAA 1DGRA 2F17A 2JENA 3DXTA 1XRUA 4Q1RA 4MHRA 4ZZ8A 5LWBA 1UZYA 3UV9A 3O1RA 4R9CA 1POV1 1G86A 1MZFA 2VOVA 4RN5A 5BNPC 1FX5A 1JU4A 2PXJA 3WCSA 4FTBA 4PDWA 2JD4A 3T2TA 3PVOA 5JUVA 4A42A 2IXHA 4IEWA 4AVCA 2VY0A 4ITCA 4P9GA 2VMCA 1H2MA 1DQ1A 3QH7A 4QPYA 4AQ2A 3WCRA 1JYTA 1NYWA 2BNNA 3K4AA 3O12A 4FPCA 1JHJA 4JHZA 4UW3A 4YGEA 2ZKNA 1DQ2A 3TNPB 1LHOA 4Q8KA 1UY4A 1BJQA 2DCYA 2RM22 4E4SA 3AMQA 4Q8LA 4P9XA 1JODA 1JTZX 5IHRA 1OKOA 4XDPA 5IVCA 4CRQA 4CZSA 2ZHNA 3HQXA 5GLWA 4GMP1 4IUGA 3MW2A 4LORA 2WN2A 2RS12 4A6SA 4AEDC 3BKZA 2ZMLA 1MZ6A 2ZACA 3M8LA 5CU1A 1IPJA 2E33A 2MHFA 3I2FA 1BMV1 2VBPA 3W21A 3KD4A 1HQNA 1D4M3 1QF3A 3E5UA 4XFCA 4N7IA 4DY3A 1CVNA 3LIHA 1XXNA 1ZBA2 4YZ2A 5TSWA 2VOKA 5DN2A 5H9QA 2LTNA 1TVGA 1PO12 2RS33 1NCQA 5JLVA 1HX6A 4XUTA 1SDWA 2VECA 2X5IA 3OGVA 3SMHA 2ZX0A 2PYTA 4DUVA 2ZGUA 2R0FA 1FOD2 1NQDA 3RI8A 2ARBA 5DABA 3UK9A 2JEMA 1F9KA 3ZPYA 3PVEA 4B4QA 1M06G 2QQLA 5T3NA 1AXKA 2YBPA 1OVPA 3ZFGA 2JJ6A 4N53A 1JS9A 1VMHA 4GWMA 4AR2A 1AR61 1COV3 1GFF2 3W5MA 2VOTA 3PVBB 4BQXA 1CJPA 1RUE2 3PJYA 2VVDA 1O8SA 1BEV2 1UIKA 2QTWB 5GLZA 1LGNA 1PX4A 2LM3A 1NE4A 4XPVA 2GC1A 1WKYA 1AR93 1ST8A 4EJRA 4Y1UA 3V65A 2VTXJ 4KU7A 3IM0A 2VMIA 1LENA 3P3NA 3ZYFA 2K9ZA 2Y33A 3A0KA 3GZTB 4Q0SA 2WNEA 4N43A 1PK6A 3VBRB 1ZA7A 5JXJA 2FCUA 3EYPA 2PAMA 3NO8A 3AL6A 5C9AA 1W9YA 1S2EA 1Y7BA 4BM8A 3IIAA 3LDBA 4OYUA 2D3PA 4UW6A 3G6JB 2DVFA 2VZSA 2YU1A 3OPTA 2DBNA 1HRI2 2FD8A 1PGW2 4RQPA 4DUWA 4CEYC 1GBGA 1OMIA 4KMQA 2VNGA 3Q8BA 4DIQA 4OUEA 5T54A 4Z1VA 4JRLA 3ZPOA 5GZFA 2AEYA 3N7KA 1GSLA 3H8RA 2RDNA 4O61A 3ZN6B 3GCXA 4IL7A 2OVUA 4GH4A 4YGDA 5IAXA 4K21A 5K0UA 1Z78A 2B42B 3KM5A 5I0UA 2XLFA 2VCBA 4FPKA 3H8XA 1AF9A 2MNGA 1Z7S2 3ZXGA 3EBRA 1NZCA 2B45X 3K2OA 3H9AA 4COYA 5C8CA 2VQUA 2D5HA 4QPGC 4AI8A 4PLNA 2CL2A 2I74A 5EQUA 2Y0OA 5FY8A 2WO3A 3JD73 2C9AA 1RUJ1 4Y1VA 3VDBA 5CISA 3LOIA 3AVSA 4IEZA 1BK1A 2XDVA 3ZOIA 3I2IA 4GB33 3AZXA 1POV0 1CD3G 1RIRA 3C7OA 4G3YC 2QQMA 2AEZA 2QZ2A 3KCXA 1W6MA 4QPWA 4Q4V2 1ASJ2 1G7YA 1XNBA 3NJYA 1CAUA 4R4ZA 1IPSA 5L9RA 2W92A 1QEXA 3T1LA 3ZVXA 4Y3OA 4UI9L 1ULGA 5BNNC 1OA4A 3AFGA 4FO9A 2OIIA 4IEUA 2ZTNA 4QDSA 2X29A 4XF9A 4IV1A 5G04L 1OXCA 2VTXA 3PUQA 1YCIA 2XBO3 4H3WA 3BOPA 5GZCA 4O9EA 1AX1A 2XJQA 4TWTA 5K8SA 3ACLA 4BYYA 5KXDA 3JXSA 2W91A 3PU8A 4BHPA 1IS5A 1STMA 3ZFEA 5FMOL 3NKTA 1CAXB 3MV11 1K3IA 4O9GA 3U78A 2WNVC 3ZSLA 1I5ZA 1RYYA 2DBIA 5AFBA 2BQPA 3HJRA 1DLCA 4OCTA 5IYYA 4OUMA 1UL9A 2E7TA 4Q5OA 4JKKA 3LFIA 2WA4A 1I9RA 5A7SA 4Y20B 2ET1A 3MIDA 1D2SA 1IGOA 4CXYA 4DMIA 3DL3A 1N1SA 2Q1MA 4IERA 4OHVA 5IUQA 3RRDA 4BCUA 1G9BA 1XYNA 4MG2A 2WLPA 3H1WA 1V6MA 1HB2A 1LKNA 5A6QA 3DCQA 1GNHA 2ARXA 3VKNA 4LE3A 4IEYA 2DWRA 4LOSA 3GGLA 1Q8OA 4K1YA 1ENSA 1W03A 5A6YA 1EYBA 3T2QA 1L7RA 3EB7A 4TTGA 4Q4W3 1US2A 4A45A 4HT1T 3MO4A 1PMIA 4GD4A 4PT6A 1VALA 3IAPA 4X6QB 3V0AA 2XKOA 4URAA 4NJ4A 3H42B 4AE2A 1WA4A 5CIRA 3POFA 1W2TA 3ZFFC 1UOBA 1YLLA 1VBB3 4YFZA 1OLMA 4LMFA 4QKFA 4NIHA 3ES4A 3OBAA 4JCKA 1KJRA 3PNAA 3U4XA 1DIWA 3RG0A 3NV2A 5A3TA 1T6BX 5DUUA 3VGIA 3OTFA 2AACA 3AMPA 1QDCA 1AR62 3VBUC 2VO5A 1LHUA 4E4DX 1NXMA 5IK7A 1ZZ6A 3I3MA 2JG8B 3SITA 4UBHA 5FKBA 3AZWA 4B1MA 1HJGA 4MGIE 2EALA 5KHHA 4N8MA 1VAVA 5FO7B 3HBKA 1JUHA 5HV4A 1QOOA 4KBZA 4MGTA 2D6PA 5FP4A 2K0GA 3OUIA 3RGBA 2WZR2 4E2GA 3OPWA 4EWDA 2JB8A 2HWE2 4AFCA 1AHSA 1CZTA 3E97A 3POBA 4AHZA 1D4M1 4BWOA 1REDA 2R071 4YVWB 3A0NA 3QBQA 3NJXA 1H2NA 3T4VA 2WSUA 3H7JA 4MH0E 2RS31 1TMF1 3FE5A 5FFOC 1MS0A 5FY1A 3SQOA 1SPPA 1SFYA 1K5JA 3S7EA 4Q4Y3 3SNMA 3HEIA 2FHRA 2DCKA 3FHIB 3M3OA 1UIJA 1VRBA 4QGMA 5GKAC 4LKEA 4GAZA 3USUB 2EXHA 2C0ZA 3EMRA 2OPKA 4DEQA 1CAWB 5J7MA 2YUEA 2VTFA 5APAA 2BW8A 5LW9A 1IS6A 4X6RB 2PHDA 3M4FA 1HXS3 4E2QA 4FFFA 2JICA 5FY7A 5FPVA 1T2XA 5IVVA 4Q0PA 2HWC1 2KA3A 1AR91 2DVBA 4IEQA 1GOFA 1W39A 5DZFA 5FMBA 3GJBA 1KD7A 5SV8A 1RVF3 1R083 3ZSKA 3RZMA 2IUWA 4FPGA 4KU8A 5T5OA 3AP9A 2R49A 1C57A 4C8DA 3IDAA 4Q27A 2P37A 3CMGA 1TNFA 3Q8FA 4IV3B 5DAXA 3W9AA 2XOMA 3J8F3 3AM2A 4D8MA 1RUJ2 3AKSA 1WCSA 1ODMA 4JKMA 2XH6A 4LBQD 2VGDA 3VDDA 5DAVA 3GBFA 2GMMA 1ND2B 1U12A 1NA1B 4CDWB 4YW4A 1SLIA 4M4PA 1OOPC 4Q29A 1AYM3 2IXIA 4QX0A 4XDOA 1L7QA 5LBCA 1RJ7A 1FNZA 1YO8A 2WL1A 3D0SA 3POSA 1W6QB 1OQDA 1AJOA 2G1MA 1V9U1 4IEPA 1HKDA 2JDMA 3ME2A 5LCWL 1V6IA 2RJ2A 3KVAA 1UX7A 1NKGA 2G9FA 1FATA 1XB9A 1YFWA 1UO9A 2ZOEB 3L2YA 4FP3A 5LRRA 5T5PA 4GJYA 3DF0A 5IK8A 2Q8CA 4DS0A 1SBFA 2C26A 2XJUA 3MIBA 3ZX7A 3KV6A 2B39A 2P5BA 2WSVA 4RHV1 2Y26A 1HIXA 3C8XA 4XIOA 1HB4A 1QDOA 5FZFA 2Y6LA 4D6QA 3VUOA 3DXUA 4CCCA 5I93A 2RDSA 5HCFA 4NMIA 3UKNA 5F7UA 3U10A 2JDZA 2RJLA 2PQQA 3MIEA 1J83A 5ANNA 2O0OA 5AC93 1B35C 1N1VA 2WO1A 1XU2A 1WMFA 3JQWA 3NV4A 5A1FA 3DPRA 2W08A 4M3CB 3LB9A 1QJEA 2LALA 1QNYA 2DF7A 2X5IB 1H8TA 4A6OA 5CFCB 4BPZA 1OFSA 4BB3A 1LU1A 3RI9A 1VBE3 5EJZB 4LK6A 5FZ3A 1MR5A 2ZBJA 1GLHA 4N53B 2TBVA 1GZ9A 4FXGB 2AZ5A 1A6CA 1EY2A 4P9LA 1Q56A 1HN1A 3N7JA 4XZPA 5J96B 1NUKA 4OFGA 2BWCA 2EAAA 1U5XA 1YI7A 2YB7A 4HXCA 5EJ1B 4AI1A 1W8OA 3HWJA 5FLJA 4XAEA 3O1MA 3OYWA 4I3GA 2W9XA 1N3PA 1QKQA 3H50A 4XJZA 4YVSB 4DZGA 3QLQA 2PAEA 1MQTA 4FPJA 3VN4A 3C7GA 5HBAA 2W94A 4XF4A 4YM1A 2CYFA 4SLIA 2FCVA 4OHZA 1H0BA 5LASA 1RUI1 4AGRA 5D8AB 1VMFA 2HBUA 4RSUA 5GLTA 4IETA 3EQEA 2GN3A 4NRQA 5KBFA 3LA3A 1RUG3 4H14A 2WWUA 4S2FA 4CTEA 5I0DA 5CFDB 2IFRA 4P9JA 2VZPA 1X9PA 5F5CA 1E57A 4RQPB 2VZRA 3UYJA 2DU0A 2R072 4CCKA 4C0BA 3NNGA 4YGBA 3I59B 2ILMA 1CR7A 1UMIA 2E51A 3CJIC 5FYTA 5FQ0A 4UF0B 2RS32 1TMF2 3THPA 3WQBA 3F2ZA 3GZEA 4IE6A 3WG1A 3ZR6A 3MBWA 2PAKA 1JZ2A 2YV8A 4Z8BA 1NAEA 4CP2A 1VBB1 4GH4B 4KL1A 2FQPA 2B9VA 5LA2A 2ZHMA 5E1RA 1R1A1 4N9HA 5IVEA 2BGOA 5FBJA 2VQAA 2GNMA 1BXHA 1S4CA 5EWSA 1YQCA 2QDRA 1ULFA 4W6WA 1EP0A 1O5UA 2AYHA 4HL0A 3W20A 3HT2A 4QHOA 4XJWA 3S5QA 2JDAA 4AL9A 4YW5A 4AI3A 5C8CB 1MZEA 4QB2A 4LEJA 4AVTA 4CPBD 2IC1A 5A7WA 5JZGC 2WABA 4L8QA 1WLCA 2QKDA 2WS91 3FBMA 3KV5A 4AEDA 1W9WA 4GALA 2V4VA 2HWC2 3X29B 4XJUA 1AR92 4R9DA 4NAOA 4XF1A 3DUIA 3RNSA 1W0PA 1RTVA 1X33A 4MXVA 1GNZA 2HWF3 3BODA 4PCRA 4PF5A 3SH3A 3MGUA 1CZSA 5FZBA 3LE0A 1CAUB 1C5IA 2HBTA 2WZEA 1QJZA 3AFKA 2VULA 3INAA 4LBOA 4MXWB 5FZHA 4BH9A 1HV0A 5CG8A 3LIGA 5JOYA 4GULA 2JB4A 3ASIA 1AYN1 3U37A 4Q4Y1 3E6CC 3IBMA 2XVKA 1LOFC 3AYCA 4MGZE 5H9PA 1RUF3 4A44A 1QJFA 2JDHA 1W9TA 4N90A 3WP6A 2GC3A 3T09A 3ILRA 4CEWA 1BLZA 4W65A 4EN8B 4DO0A 4NHYA 3RYPA 1YQ5A 3RFRA 4B7KA 1VBD1 1YJKA 2GALA 3HN3A 3ZYRA 1D2QA 5FZKA 2CDPA 3VZMA 3I54A 1PHMA 1WCKA 2NPIA 4DRRA 4DXZA 4I30A 3ZYGA 1TEIA 3I7DA 3WDWA 1V9U2 3WNMA 4Z2WA 3LSDA 2BBVA 1BQPA 4XZUG 3GBGA 2UYAA 5FZDA 4XBQA 1QIQA 1FXZA 3B3QE 4IESA 3M2MA 5C5UA 1T6GC 1S0GA 3VKOA 4RHV2 2JDUA 4GQ7A 1RUC1 1GV9A 3J8F1 4ONUA 5J1XA 2J1TA 2ZMKA 3K4ZA 4E27A 4HONA 5FPXA 3FWEA 1W99A 5ISLA 4Y26A 4HN1A 3M7AA 2FZ2A 2BGCA 1EPWA 5F3IA 4CEYA 3N9QA 1RC6A 3J7NA 4JQRA 3I8TA 4NO4A 3VBHB 3HNYM 3IPVB 2ZGNA 2VZ3A 4O7XA 3M3QA 5FBZA 5LZ6A 4HVOA 2ZX3A 2A6YA 4BQWA 3WF1A 5F37A 5EHDA 2ATFA 2VCAA 2PHRA 3IWZA 2XL7A 2CDOA 5FXXA 1OH3A 4G9SB 4UFKA 4UWDA 2WC2A 2TNFA 1Q3EA 4QHZA 5FPAA 2BZDA 4EZHA 3NKGA 1OPMA 3N9PA 4HBNA 5F5IA 1X50A 2J1SA 3FJSA 3VBOB 1SLLA 3LEIA 4K9SA 5CZKA 3ZXFA 4IGPA 4QPGA 4Y24A 1AX0A 5DUXA 4LLOA 3H8OA 1PVXA 3MYXA 4RGGA 2WA3A 3LPGA 2OUJA 2F4LA 4RR3C 5A7NA 2WN3A 2W87A 1URXA 4UFHA 1DYKA 3PDQA 2HWB1 5FZOB 5FWJA 3FHQA 1DHKB 3ZN5A 5C8WA 2F6BA 3GZUC 4XJ9A 2H0VA 2J42A 3MIHA 1RUI2 3EJKA 3WHUA 4XEZA 4ES8A 5AC91 4AQTA 3AB0A 5BNNA 3MUY1 4B29A 4JGZB 4B4PA 3RZZA 4YGCA 3RYRA 3USSA 5H9RA 1D0HA 4HKOA 2XJPA 3LDKA 2ZA9A 2WWJA 4NUBA 5DG1A 4FT8A 5E8AA 3FBYA 3M1HA 4M3CE 2VC9A 1GZWB 4CDQA 3ETPA 4COZA 2WFF3 2FZ1A 4GJZA 1XE8A 3WQ7A 4BQ3A 1OQ1A 2WNVA 4WM8C 5LEJA 4I09A 1IS4A 1MS4A 1AL21 4LE4A 4EN0A 4M3CF 2Y6HA 2Y60A 4Q2FA 1R093 2XJTA 3OCPA 4HLTA 4FTEA 1U5YA 1W2UA 1CIYA 4P5HA 2BYVE 1VBB2 4KNCA 1HRV1 2EICA 2DVGA 4A3ZA 1PVC1 1R1A2 3BYWA 2NMOA 4FOVA 3RZHA 2EXIA 4AW7A 1KQRA 2YC0A 4AYUA 2DU1A 5DPNA 5AVAA 5I8YA 2VUAA 1W8HA 4AZZA 4XXPA 4C90A 1FPN3 5IVYA 4CE8A 5DG2A 2HJIA 4XFIA 2WS92 4HANA 3VZKA 5HI0A 5KC6A 4RA0A 1JYNA 1LB2A 2A73B 3ZYPA 2XR4A 2EXJA 2V4AA 4M01A 5JXHA 3GCWA 1VMJA 4IE7A 1KS5A 2QBXA 2SLIA 3GBWA 4K20A 2I2SA 4H2AA 3ZMNA 2PHLA 4CP1A 4A2UA 4XDQA 5K9YA 4QXKA 2VNOA 1BCXA 1YIPA 4LBKA 5FTTC 2OZJA 3CQOA 3ZFFA 1REEA 1RHI3 3AVRA 3Q8AA 4LA3A 4DUXA 1DYOA 1AYN2 2VNVA 3IMMA 4FFGA 2GNBA 2YROA 4LBQB 4Q4Y2 2E6VA 5FPZA 3MF9A 4QPIB 1JYIA 3WNNA 4F8AA 2X53S 3I3BA 1EAH3 3N9MA 2OZ6A 4MOAA 4Y5TA 1GICA 4SBVA 2J1VA 1VBD2 1MS1A 3IZOA 2HWD3 4RS5B 5BNOB 5FYCA 1W3VA 1WBFA 1Y4WA 1ZBE3 2ZGPA 3HR9A 3LA7A 4KWUA 4QX8A 5EPAA 3SXWA 4CU9A 1REFA 1JZ3A 1UY3A 2MEV2 3MW3A 5A6XA 3OF1A 4LO5B 1ENXA 3RS6A 2WWSA 4C1WA 1UQXA 4P9IA 4AAPA 4F3JA 1GQGA 2NM1A 2E31A 4W4ZA 3DPRB 1RUC2 5CNAA 2XUMA 3J8F2 2B8MA 5F2WA 2VZVA 4XCBA 3R4DB 3BTZA 3WW1A 5LA9A 1CAVB 2HEVF 3K4DA 5DDJ1 3O0XA 1V00A 4BK5A 4D6SA 2B46X 3IKWA 1RUOA 3WUCA 4OHWA 1F8VA 1GR3A 3UJQA 2DYCA 4DFSA 2QQKA 3PTYA 2DCZA 4P08A 2WQ4A 1UW8A 2ZZJA 4X8NA 1R64A 1KJLA 3IMNA 4OI4A 3SCGA 5A32B 4LBMA 4CCNA 4F83A 1ZZBA 4YG0A 3TN91 3OYWB 5FY0A 1YI9A 1ENQA 3O1OA 1QJU3 5FYMA 2BERA 4ZY9A 2XLAA 3HN1A 3U4SA 1O3SA 1EV13 2QQJA 4WVWA 1EPZA 2ET7A 4FPYA 3ZSMA 4FTSA 4YM0A 4YFWA 1LHNA 5DQ0A 1VB4A 3PUSA 1UU5A 1UXXX 2E9QA 2HH9A 3WP5A 1R1ZA 1XC6A 5LY1A 3L2HA 2R061 1F31A 2YU2A 2CU5A 2HWB2 2QZ3A 3A7QA 1F15A 1UMHA 1VAMA 1LCLA 3D0JA 1SCRA 3LWCA 4M0NA 2R041 1G9AA 3B7MA 4FSJA 3UKTA 4IXLA 1W9SA 1W8ZA 2XVGA 3C7EA 4KGGA 4HKWA 5AC92 3D82A 5BNPB 5CVRA 1OOPA 1H8VA 3ZXLA 1OT5A 5JR2A 2P3YA 5ACA3 5I91A 1QQP1 2VOWA 2WQ8A 3I49A 1RUH1 3OEAA 2WDBA 2XQRA 1CPNA 3CNAA 5EP9A 4CEWC 4P00B 2OUHA 2ZMNA 5CAZA 5FZMA 2HEYF 2VBDA 4FFIA 4KG8A 5FYYA 3LOBA 4FOWA 3U11A 3DYOA 5FZAA 2JE8A 2YHJA 3WV6A 3ABZA 1AL22 1SEFA 1YFXA 3AXDA 3CZUA 1QWRA 1WCQA 2UU8A 1O4YA 1AXYA 3KB5A 1QXPA 3RZGA 1YEWA 3E6DA 3LZZA 5ABJA 4AEDB 5GZDA 5CEHA 1HRV2 4KWKA 4QXHA 1PVC2 3MZHA 4C1XA 2PLV3 3D8CA 5FPLA 4DRVA 5FDBA 1PGL1 4JDOA 3PL0A 2JE7A 1B09A 4I3PA 5JR7B 1ULPA 1A8DA 1N47A 4QD2A 4W6YA 2WR9A 3PIGA 4M4RA 1B35A 1NZIA 3K51A 3OBRA 2FDKA 4QQOA 2YMZA 2E7QA 3IDCB 4Y1YA 5FY5A 1SACA 4QMAA 4RD7A 5IWFA 2Y6FA 5FK7A 4BQ1A 2YC2A 4XILA 4D3WA 4FI9A 1QH7A 2EIGA 4GWNA 1E5HA 4OI0A 3H8UA 2DTYA 3DKWA 1FI2A 3PJQA 4ES9A 1LHVA 1N1YA 4QKBA 5FZCA 5FZGA 4OQ8A 3T3YA 3HOBA 2AR6A 1HQWA 4IEVA 3VD5A 4CP9B 2XJSA 2JG9B 3AKPA 1K5MC 3WDVA 1H1MA 1JYVA 4GA9A 1R091 4MO3M 4CDXB 5C70A 3THCA 2ADDA 3DYPA 3NVCA 1TME2 3CHXA 3CLPA 3VBSC 5JOWA 2R32A 5F1RA 5EV7A 3VZNA 2VH9A 4CU7A 1S2KA 1QOSA 2YPJA 3FUQA 4CCDA 4AEKA 2ENRA 2NZ9A 3WINE 3BPZA 1NLQA 1OURA 3P6BA 2EIBA 2HYXA 1FPN1 3RJ2X 3LGRA 1GANA 4BIOA 3OGGA 2GZWA 3GM8A 2D98A 4WM7B 3E6BA 5DAPA 3FFQA 3UKVA 5JDBA 1HDKA 2RMU2 4MGSA 2XHNA 1ZM1A 2ZGTA 3JBG3 5FMCA 2AUYA 1BBT2 1VBC3 3FHAA 3S0MA 1OC1A 3RZKA 3MIFA 4HPKB 3MW4A 4CEYB 1DG6A 4QGLA 4J25A 3POEA 4W6XA 1RUNA 1H4GA 5FLIA 3TRSB 4OVEA 2LROA 4ASLA 4EN6B 3CJIA 2F4PA 3WNLA 1LOGA 1V6OA 4EROA 4CDQC 1OHFA 2H6CA 4NRMA 3H1YA 2VMHA 4ZU5A 1KDMA 2GMEA 5EZWA 5FOJB 3H3UA 3CBNA 2YBSA 3WDTA 4D7TA 5DDJ2 3I3DA 4E4ZA 2RE9A 4Z82A 2PN5A 3WXPA 3N4MA 2RDRA 3R4UA 3BTYA 5D1IA 1WMDA 5FP9A 3KT7A 4NIIA 4AFMA 2XPJA 3B9CA 5HPOA 2VQ0A 1HJFA 2B9UA 2WZPP 1Y9QA 2E26A 2VUJA 1PM7A 1OD5A 2RR11 4NHKA 2XJRA 5JZGA 4XIKA 1LESA 3B02A 2A3YA 3K3OA 3HNBM 1OUSA 3NJVA 4HZFA 5J98B 1JUIA 3SC7X 2HWD1 3POWA 3VZOA 1BVVA 1US3A 3OD0A 3TN92 4W50A 2XQXA 4XYXA 4CUCA 1KGYA 4X8PA 5KWRA 5F6KA 1RMU3 2WT0A 1IOAA 2JE9A 3BB6A 5LATA 2JXAA 2QQIA 4GIQA 4QGNA 4Q4X3 1DZTA 1GNYA 2B5HA 2K46A 4KG0A 1WLDA 2D6LX 3WF2A 1D7PM 1MS9A 4YNIA 4I01A 5FIXA 5A3OA 1BMV2 4YZ4A 3DECA 5F9TA 4LXLA 1Q8VA 3AKTA 3D5OA 2R062 3ACHA 1O7FA 2WO7A 4ISQA 4CXWA 1UY2A 1V6JA 1LOFA 2JDKA 2JG8C 2R042 3KV9A 3AJYA 3VHNA 1LGBA 1W04A 2R1BA 2HYKA 1YFUA 1VAKA 2RJKA 2RS53 2R1DA 1PNGA 1GP6A 3OOXA 3AP7A 2G4IA 2L9LA 4QHBA 5F3EA 5CKNA 4FCAA 3K77A 4NHLA 1PZ9A 3O1PA 1QQP2 3G7DA 3OY8B 3NAPB 4DINB 1RUH2 2BPA2 5FZ8A 5F3GA 4YVWC 3I2GA 1LTEA 2FDJA 1H6YA 4XQDA 3N35A 1P8JA 4XOGA 4BIFA 4UFMA 4YG6A 2BDRA 3OJBA 1QJU1 1V6LA 1MEC3 2YZ4A 3ZKUA 4F7ZA 5LB6A 1CONA 1TG7A 3B69A 1G9DA 1OSGA 3WF3A 4CXXA 2VZ1A 4I0WB 3VKFC 2D5FA 5FZLA 1FMD3 3CJXA 5FZ1A 3T2OA 4LLFA 4QU1A 4AGGA 5JSRA 1HN0A 3WG3A 2PMWB 3KQRA 1V6KA 2C4XA 2V09A 1XJAA 3GHNA 1XNDA 3KVBA 5FO8B 1OFNA 3OG2A 1NXD1 1DLLA 1Q8QA 1AR83 5FZEA 5FP8A 5C71A 5JOXA 4LTAA 4DXSA 3AKQA 2RG4A 1DGRN 2GDFA 3N9OA 4DQAA 3TB0A 4META 5FZIA 4UYBA 3NMBA 1PZ7A 3IAQA 2D97A 2ZGRA 1UZ0A 2VMFA 3K46A 1XSQA 2OQ6A 3Q8CA 5A3NA 5LK7B 1COV1 2VG9A 4QT6A 1LULA 1RUD3 1HW5A 3B93A 1W6NB 4NIAA 4AXOA 5F3CA 5JSPA 2DURA 1NG0A 2V73A 3VBUB 4CDUA 5CG9A 2BU9A 1UOFA 4RR3A 3ZSJA 1ZREA 3RWKX 1HQLA 1NA1C 2ETEA 1C8M3 4QB6A 4YW6A 4ZXEA 4LOTA 1QXJA 4MZUA 4CDWC 2SBAA 1HV1A 3MF6A 5HCBA 1QU0A 4TXWA 2CV6A 5A33B 2Q8OA 1LEMA 3PUIA 1XNAA 2WNUB 3UL2A 5L7OC 1U5ZA 1W90A 2Y8KA 2VR4A 1QJX3 5BV6A 2Z4FA 3T1MA 1PO23 1PX3A 2RHPA 1FPN2 1KFXL 1O91A 1QGLA 1W6PB 1UY1A 2A70A 2RVAA 3IDBB 5FAXA 4E8CA 4HKLA 2VZOA 3NL1A 2J1EA 5I0TA 3UGFA 2BTVC 4OZXA 4TLGA 2G9GA 5ERLA 3VB9A 4A4AA 4J6GA 4CCJA 4BXFA 2IVIB 4E8DA 1WMXA 4EZ4A 4Y22A 1O3QA 2ZKLA 3UETA 4PDWB 4JDNA 4WZCA 3V0BA 4WM8A 5H9SA 4ASMB 2G19A 4Y4YA 1W6OA 2YBKA 5L19A 1C5HA 1UYPA 5FXWA 4QWNA 1HB3A 5BUVA 4JQTA 4D0QA 4KH9A 4UOJA 3ST7A 1GP5A 2WJSA 3CEWA 3CU7A 4NRPA 1F4AA 3HIFA 4D94A 4RGAA 3WEZA 2ZCWA 3KV4A 2QQNA 5F5AA 1O3TA 1NQJA 3GF6A 2XKPA 4LKDA 4NE9A 2ZX1A 3ZXKA 5CFCC 3JD71 5ABJC 4H7LA 2WUHA 4XF3A 1E5IA 5M0TA 2RR12 4LQRA 3BCWA 4WV8A 3A22A 4UW4A 4ATEA 4GB31 2OQ7A 4CUBA 5L73A 2VZUA 4JGYC 4QDQA 2CNAA 3RWNA 2HWD2 2YFZA 2ZS6B 1GZCA 1W8TA 5C3RA 1JZ8A 1G9CA 4NN0A 4Y4RA 5A1AA 4RFT0 4YPJA 4ZS2A 3WUDA 5FLHA 1NCQB 4XF0A 3I3QA 4XBNA 2RS13 4QX2A 3O14A 3PURA 4XHBA 1XE7A 2IXLA 2J1UA 2FMDA 3THTA 4CUGA 4J1WA 4YVSC 5JAXA 2XBO1 1SBDA 5I0RA 2IWGB 3KZ4C 1JBCA 3J7HA 1JZ5A 2D6OX 5IVFA 3ZFGB 3Q9OA 4B1LA 2YDEA 1UYXA 1SLCA 3WDUA 1Y43B 1MACA 1L3JA 3WNPA 1AJKA 4L99A 4QDRA 4Y5Z0 5BY5A 1NT0A 3POGA 5F5QA 2CTVA 5CFDC 2Z69A 1GP4A 3APBA 3R05A 1QH6A 2A6VA 3NV3A 4IQPA 2AGSA 3FLPA 3GHMA 2WRAA 2YXSA 2VD7A 5B4XA 4BA6A 1OPOA 2ZEZA 4BQ4A 2FDFA 5F2SA 3PVNA 4N43B 1PK6B 2VZTA 3UJOA 1QJU2 5KR7A 3C7FA 5C9AB 3J4UH 3CDZB 2GH8A 3CL1A 3OEBA 2D43A 3AYDA 2D93A 4Q4X1 2Y64A 5JXIA 1JOPA 1OLRA 2ZEYA 2D40A 2DUOA 2BVVA 5FYUA 2GU9A 5IFTA 2D6NA 3SCHA 4ORFA 5FYVA 4Q4W1 4HFSA 2QQPA 1D4M2 2LW8A 1XPWA 5T55A 3VL9A 2BNMA 3HD8B 2Y6KA 1Y3TA 4AI0A 1ZYBA 2W95A 3NSTA 4NROA 4OI2A 3UGHA 1V70A 4IE5A 4RL7A 2NLRA 4TLFA 1SBEA 2RS51 4FOQA 4UFJA 3RMYA 4BMEA 2FDHA 4YLZA 4ZU7A 1HRI3 2VXRA 5K0UB 3ALQA 3KSCA 1H1IA 1W9FA 3GXUA 2WZ8A 1UOJA 5JPNB 3ACIA 4XTPA 2VVFA 2AH2A 5FUNA 4UBGA 4IGQA 3RPQA 1IKQA 2D44A 1COV2 3M70A 1QXRA 1W0NA 4NWWA 5T50A 1RXGA 3KHCA 2ZXQA 4Z92B 4GZ9A 1F4HA 3H3LA 1UYZA 3ZR5A 5C7GA 1AR73 3O1VA 4K6BA 2UWCA 1GWLA 1J1LA 1GYKA 4YZ5A 1WW7A 1Z7S3 4FQZA 3J7LA 4FPOB 2C24A 2R0HA 4IEOA 1LR5A 3WP4A 1FMD1 5HCAA 1W6MB 4V2VA 1O3RA 3H1MA 5LK5A 2BV4A 3FMGA 1ND3C 3KF3A 2P17A 4CVUA 3K48A 4MLOA 1WMEA 3KCCA 4ASKA 4IV1B 5A1LA 5D21A 3MLLA 3RDIA 3WVJA 1W8NA 1WZXA 5LBFA 1E5RA 2I45A 2AREA 1ASJ3 3VHPA 4FBFA 5JVVA 3VBRA 3ZFEB 1DP0A 1CJDA 5IT6A 1JYCA 3VLBB 1YHFA 3AZVA 4AGVA 1RITA 3K3NA 1DQ5A 4CPBA 5CA6A 1LRHA 1HXS1 1S0FA 1RUD1 2V5YA 2XMLA 4GKYA 4I02A 2CGOA 3TOJA 4DB5A 5GZGA 1LOAA 4U2AA 1WCDJ 4LA2A 4P14A 3RQ0A 2HEWF 3MV01 3ZYBA 4Q0VA 5A3LA 1PIV3 5JMCA 4ZHNA 1NLSA 1XU1A 1RVF1 1R081 1C8M1 1PM4A 2O14A 2Z79A 2PHTA 3E5QA 4WBBA 5IAVA 3EO6A 5FP7A 1ZZ9A 1Z0HA 2XWBB 5I0SA 2EIDA 2XHKA 2E7AA 2OS2A 2KM2A 2ZPXA 3NNLA 1ENRA 4OQ9A 3E5XA 2VOXA 3ZN6A 1VP6A 3S30A 4LBJA 1YC61 3JD72 1XOYA 1QJX1 4AF9A 3LQCA 4AAXA 4LIVA 1QMJA 4MSVA 4GB32 2JKBA 4NHMA 2ZHLA 1BYHA 4TZDA 2RDQA 2VZQA 3HQUA 2VUCA 4MYEA 4FOYA 3WW4A 4XC9A 3MPBA 2D6MA 2DVDA 4YYOA 5IATA 2JIJA 1JOJA 3WT3A 3V0AB 3VD3A 1OLQA 4YW2A 2XG3A 4GMP3 1HB1A 1G9FA 1H2LA 1XNCA 2JECA 3ZIWA 5JWPA 3BU0A 1AYM1 2D3SA 5A3MA 1X8MA 1QJY3 2XBO2 1K5MA 2WO2A 3N36A 3WY6A 4Y33A 1CQ9A 2P34A 4GWJA 3VBSA 3I4IA 3FL7A 1OF4A 4Z07A 2E53A 5HCHA 1JXNA 1K12A 4JGZC 4BMBA 3I2KA 4A7KA 3UT0A 4CDUC 1UKRA 1AUYA 1MPXA 4XW3A 1YIFA 1TE1B 3FFZA 3ES1A 3ECQA 1FYUA 3I2DA 3OUHA 4IDZA 3WOGA 2A6ZA 3ZM8A 2CWSA 2GH2A 4YWAA 2DCJA 5FRAA 3NV1A 3O1UA 3V64A 3AL5A 4DXTA 2QJVA 1VBA3 1APNA 1Q43A 2Y6JA 1GQHA 2W1QA 3L9JT 3H0OA 1D4VB 3OPZA 1AX2A 2JDNA 3LAGA 4UAPA 2EIEA 2DFCA 4Q4X2 2QFEA 3LCPA 1XSRA 4Y20A 1SPPB 2WZR3 3WHTA 3ZLIA 1OA2A 1U0AA 2HWE3 3NQHA 3VDAA 4D7YA 1XYPA 4FPLA 1WCUA 4AFDA 4LO4B 4Q4W2 2B7YA 3BIWE 5KXEA 1VRH3 2XUEA 3AP6A 1VBE1 2VE1A 3JCIA 4LKFA 5J37A 4L2NA 4XACA 4XFHA 3NW4A 1NCRC 3HVDA 5IVJA 4NPMA 3TEXA 4AHYA 2QQVA 4XJ8A 4TN7A 1N3OA 2RS52 4WVMA 5FXZA 1GWMA 5IFPA 3VD9A 4FPHA 2ZEWA 5E16A 3OSDA 3BOWA 1DU3D 4RR3B 1MVQA 2I07B 1WGPA 3I3EA 4N9IA 4BOWA 4EWAA 3N7MA 1IS3A 1H9WA 1S0BA 3MDPA 3PMEA 5FUIA 1UNBA 5GALA 1H30A 4ZONA 1UZWA 1WLTA 3FX3A 3FN9A 4FQ4A 3DN7A 4ISRA 4AQSA 3U75A 2ID4A 3T0DA 4XUPA 4QKDA 4XFBA 1RUG1 2VNRA 3MLJA 3Q8EA 4XUNA 4AVSA 1W2AX 3LFMA 4B8EA 2XONA 3CO2A 4QPIC 2D6KA 4PIZA 4CU8A 2CHHA 1JZ7A 1UXZA 3AYEA 2Z5WA 3VDDB 5K7PA 3H3ZA 5CKQA 5LA0A 1OQEA 2JG8A 1SLBA 2YY1A 4AK3A 3VKLA 3HAGA 1JW6A 1O4TA 4AEMA 1ULEA 2XLGA 4OMCA 2WAOA 5FYZA 1ODNA 1VB2A 1QHDA 1RUJ3 1S0JA 1XBFA 5BNOC 3V0BB 4IW3A 3IIIA 1DGWX 1F35A 1W06A 4L11A 4WM8B 5DAQA 5G05L 5A7QA 1GKBA 2XWJB 5FPUA 5JMOA 3W5NA 3NWKA 1OKQA 2A6WA 4YVWA 4PBOA 2WAAA 1BK0A 3CF6E 1YFYA 3BTXA 4LUMA 4Q0UA 4A7YA 5I8TA 1LHWA 1UCXA 3AMHA 5A3UA 4JV4A 1OBNA 1HXS2 3AP5A 4PHZA 5T5JA 4L0PA 3FZ3A 1AR71 3M3IA 5E6HA 1Q8SA 5D2AA 3MEPA 3WQ0A 3AX4A 2W1SA 1RVF2 1R082 1C8M2 1Q8PA 3IN9A 1ZVFA 2HWF1 3ZXDA 4TSVA 1C3HA 5CADA 5IK4A 3SKJE 2ORZA 1SLAA 4QXBA 4P02B 5FCCA 4XUQA 4MHUA 2Z42A 1TZOA 1UZVA 2WT1A 1KITA 3HT1A 3ZIXA 3NNMA 1H8TB 2JIGA 3B01A 4H7MA 4ZPIA 3OUJA 1RUF1 4PIYA 2NYYA 2W52A 4KWJA 1CGPA 3GJAA 5AFEA 1PMJX 3PUAA 3O0WA 4NVPA 4IV3A 1WBLA 3S5AA 1RINA 1CESA 2A5ZA 3MI8A 1UZZA 1GU3A 3GZAA 1AYM2 5FREA 1WD3A 4GWIA 3ZDSA 3HMYA 3ACGA 4Q1PA 2PHUA 3ILNA 1LNSA 1ND2A 1PIV1 2C5DA 1NA1A 3DKQA 3HNMA 1MQTB 2A1XA 3CIHA 4YW1A 5JI7A 2YYOA 4CDWA 5JPMB 5LA1A 1KS4A 1A34A 4QX7A 3FLTA 4LITA 2ZZQA 4GKXA 3RYKA 4YZ1A 4HSLA 5JI9A 5L7OA 5C4WA 3PIJA 2ES3A 4OI1A 1VPHA 1W6QA 2A7AA 2PA7A 2V72A 5FY9A 2WKKA 2R30A 3WDYA 2J1AA 4HSJA 1C28A 4XFAA 1DCSA 4AG4A 3VD4A 1KFUL 2W47A 1LOBA 3BVCA 5LRSA 4L92A 5KHGA 1M4WA 1CZVA 4AVAA 4DY5A 1V0AA 1UY0A 5FQ0B 1DDLA 3GNEA 3VDCA 4BISA 1J3QA 2BFUS 2CY6A 1QJY1 1WW6A 3VBRC 4XMAA 2Y0IA 5JCTA 1KDKA 1O5LA 1X8EA 4PI2A 2JDPA 2R073 3JB4C 3WF4A 1VBE2 1IZ3A 2BOJA 1OLME 4BQ5A 2ERFA 1UKGA 3KCYA 2D3RA 2P3IA 1BVP1 2X8KA 5CKMA 3ZSEA 1TMF3 2YG0A 4M3CA 4S2HA 2YGLA 4QM9A 3QOPA 5A7WB 2CAUA 4R52A 2UURA 1C4RA 5CFCA 4COVA 2IXKA 5DZEA 3WSOA 3BI3A 1OF3A 4JGYA 4LHSA 1O8PA 2PELA 4NHXA 2DUPA 4E9KA 1VBA1 2JG9C 2UY9A 3D4KA 3VV1A 5FZ0A 1JYXA 2CGPA 4CDXC 5CB7A 3RZJA 5C6CA 2OXBA 2VW0A 1UD1A 2GAUA 2Q1FA 4QQLA 1GOHA 1RJ8A 4UXAA 1RUG2 4HMZA 2ZHKA 2HWC3 4YVSA 2ZAAA 2ZABA 5I8SA 2EF6A 1OI6A 2BWAA 2WZR1 4AQ6A 2G9ZA 4QXCA 2HWE1 3SEPA 1UF2C 1IQAA 1H4HA 2WFF1 1VRH1 1ZZ8A 3T4HB 3U0ZA 1ACCA 1V6NA 5C3QA 1JZ6A 3R4SA 3VZLA 5D8AA 4CEWB 1YRZA 4KQ7A 1GZTA 5E89A 1ZZCA 4M00A 1PGSA 2WNOA 4KGQA 4WM7C 3URFA 1XNTA 4O65A 3THDA 4NOTA 5AVPA 1XE0A 3POJA 5CFDA 3J7MA 5FZ4A 5J48A 2NMNA 1A78A 4P9YA 3MFAA 1GQPA 4CA9A 2DTWA 3KGLA 3LEKA 4E2SA 3SEEA 1YJLA 3HBZA 1SCSA 2P3JA 4UFIA 1VLNA 3I59A 3BUCA 3BN6A 1TQ5A 2X10A 1K45A 4UF0A 3VKMA 4AI9A 2C6SA 4B3NA 3ZXAC 2P6CA 1C1LA 1SLTA 4RFRB 5IK5A 1W05A 1WWYA 4RYDA 1JMUB 2W68A 3J9SA 3KF5A 4HETA 4YZ3A 5C4WB 1AR72 2W0XA 1V9U3 1LEDA 5LBEA 4D69A 2PHWA 2JX9A 4JVAA 2Z2SB 2HWF2 3PTRB 1MS3A 4XABA 3WP3A 5C5TA 4RGKA 3T0BA 5FJKA 4QX3A 1MVEA 4RHV3 4P5YA 3WG4A 1JHNA 4JHTA 1SG3A 3GYDA 3A21A 5FYIA 2A3WA 4OLLA 1RHI1 2A6XA 3J26N 3R6SA 3GALA 3RZLA 3AK0A 1DZQA 1K5MB 1BHGA 2GSYA 5A6ZA 4EQVA 3O1SA 1RUF2 2B4KA 4LR4A 3I97A 4KWLA 3LA2A 3VBSB 2X09A 1EAH1 1J3RA 1GOGA 2BGPA 3VZJA 4Q26A 4QPGB 4J1XA 4MXWA 3KHBA 2Q8EA 1LOCA 3ENRA 3JU9A 2IXJA 3WZ1A 2Y38A 2GC2A 1ZBE1 3OGRA 3WNOA 3ZO0B 1OUXA 1PIV2 3JUUA 4QU2A 5C3SA 5DAWA 5EFUA
chains in the Genus database with same CATH topology
2GNTA 4GMP0 1I6XA 1ND3A 2A71A 4URTA 3NAPC 5BNNB 1FV2A 1DQ6A 4LBLA 5GZEA 5GM0A 3FUOA 4CDQB 2WINB 1UX6A 3QCWA 1RUI3 2UYBA 3BTAA 2QUOA 3WW2A 3C2UA 2WNVB 3WR0A 2P3KA 4DNYA 5JOZA 3AKRA 5FO9B 1F5JA 1VR3A 3B94A 2ZAHA 2EA7A 1UU4A 4WVMB 1QJY2 1FAYA 2XVLA 2TUNA 2WQZC 4LHLA 3WD5A 4K8FA 1ONAA 4R9BA 5GLVA 3VBHA 4AFAA 1PZ8A 3IPVA 3N3HA 3IT8A 1EV11 4PBPA 1H2KA 4K1ZA 1LECA 4XMIA 3DGTA 2ZGOA 4KBBA 2P2KA 4IEXA 1R1A3 1PGL2 4LHNA 4YW3A 1C8NA 1ZRCA 2NQYA 2AENA 3VBOA 4H55A 1VBA2 4ATFA 4QQHA 1IKPA 2Q5TA 2A75A 3LSEA 5KHJA 5F6LB 3VBFC 2WS93 4QM8A 5ACA1 3SHRA 1ZRFA 4BZ4A 3RMXA 3ZFFB 2QVSB 3KGZA 4OUSA 4JAAA 4JRAA 4IV3C 1LU2A 2WNUC 1YUDA 2WFF2 1VRH2 4AFBA 4AWDA 1F2NA 4JGZA 1CN1A 1SFNA 1U5IA 1ULCA 2Q0AA 1XYOA 3FC0A 1JN2P 1R092 1ND2C 4WVVA 3TYJA 4R8HA 5BYNA 1AYN3 1GZWA 4A3XA 1S2BA 2PLV1 4K40A 4U36A 4PDWC 3WQ1A 1LOEA 3ZXJA 1G8WA 4BLIA 1CIWA 1YNAA 4PLMA 2NP0A 1JH5A 3SLIA 3KS7A 1KXGA 2IFWA 3AYAA 3W59A 1S55A 1VBD3 4FP2A 1O4ZA 4LHKA 1X36A 2VMGA 3MIGA 4R9AA 4L9BA 4OHXA 5EYYA 1J1TA 3JB8A 3ROUA 3AJZA 2ZJCA 1ALYA 4Q0QA 1FV3A 2MEV3 2PTMA 3OD4A 1DGWA 2PHXA 3VHRA 4PLOA 2OW4A 1D0GA 1DQ4A 3ELNA 4QQ2A 1NCRA 4A7ZA 1RUC3 3WG2A 5JIUA 2N7GA 4V1PA 2DCTA 3VHOA 2HKXA 3U07A 2ZGSA 2XL9A 1RHI2 1BZWA 2MPFA 4YRDA 2H0BA 1RGSA 3MFCA 1YXWA 1X7NA 1NCQC 2QNKA 3KT4A 4XQ4A 1MZ5A 2X5IC 4XBLA 2R6QA 1UPSA 1EAH2 5FOBB 3QD6A 3ILFA 4LO8A 2DUQA 2ZGKA 2UY8A 4WVZA 5EYXA 1FT9A 2ZX4A 4LBQA 1MS5A 5C4WB 4JDMA 3ZFGC 4EN9B 4N53C 3PHMA 3B5LB 2RM23 1ZBE2 3M3EA 4QPIA 3JBG1 1I1EA 1SQ4A 3V56A 1VBC1 4FXKB 4LNVA 3NJZA 1UMZA 3ZN4A 3LKJA 3KLSA 1OOPB 2CAVA 4EV0A 4RS5A 4N7UA 5BNOA 1DGLA 1RB8G 2VW1A 4PJYA 2HWB3 1ZBA3 4N43C 1F5FA 1PK6C 3RSJA 5D8AC 4FAHA 5BNQA 3FLRA 1PO13 4S2DA 5C9AC 2BFUL 3SH4A 5DZGA 1QOTA 2EVXA 4LO7A 2ZX2A 3QH6A 1FOD3 4XE9A 1DBNA 1IHMA 4RQPC 2PHFA 4ZKTB 3KT1A 4AHXA 2Q4SA 1CAVA 1J3PA 5ABJB 4S2GA 3ZMOA 2QCSB 1NLRA 5CBLA 1RUE3 3TAYA 1RL3A 4CYDA 1VJ2A 4COWA 1RMU1 2BUKA 4JGYB 3S7IA 4CP0A 1BEV3 1AL23 5B2GB 1EV12 2DFBA 4GH4C 4TYSA 5K0UC 5DUVA 1B35B 2FBEA 2XB6C 3KMHA 3B00A 5A32A 1S0IA 1HRV3 3N7LA 1CX4A 4HN0A 1PVC3 1UN1A 2A3XA 2GNDA 4B7EA 5C8CC 1ZX5A 4XQWA 2ZGMA 4XTMA 5J36A 4HK8A 5DUWA 3EXUA 4I0AA 3JQXA 2DV9A 2VU9A 2TEPA 1DZRA 1VIWB 4LBNA 3WNXA 2D7FA 5ACA2 2IZWA 5T52A 2Q30A 2XJVA 4YG3A 4R4XA 4NWVA 3ZYIB 2EAKA 4EN7B 4BLJA 4IV1C 1MEC1 5BNPA 5L36A 1ZZ7A 5DXDA 2R16A 1UAIA 1TME3 3ZFEC 5C33A 4AHWA 4XETA 2WFPA 2PLV2 4HVRA 5EXOA 5J09A 4NR1A 3H7YA 5BXXA 1ZRRA 4PQ9A 4OULA 2H6BA 1AVBA 1S0EA 4GXLA 1AR81 4MGKE 3TNQA 1DFQA 3CJIB 4YARA 4FAGA 4Q4V3 2RMU3 2VVEA 5EJ3A 4XJAA 1BBT3 2CWMA 4FVVA 4AVVA 1LGCA 1S1AA 1KRIA 1UU6A 4Y1XA 4BE3A 5SV5A 2GC0A 3PMSA 5JIAA 4YM2A 2KXLA 5JZGB 5KXBA 1NOVA 3RJRA 4MX3A 5T5LA 3VBHC 1POV3 4I2OA 2VPVA 1XQNA 5DDJ3 3BALA 1ZRDA 4K3UA 4AEJA 1CPMA 4HVQA 2GMPA 4LULA 2JG9A 2CGNA 3A4UA 2UWBA 1I3HA 1PO21 2E63A 4CDXA 4INDA 1ND3B 5JSOA 2C1FA 3OBTA 4PIXA 3VBOC 3TN93 5LEKA 3JBG2 5J3UA 1AZDA 1VBC2 3W58A 4XXAA 4P9WA 2MEV1 1S0DA 5L7OB 2NN8A 1ZA4A 2ZGQA 1NY71 4EWEA 3AZZA 1N1TA 4WM7A 3P3PA 2WLQA 4C0HA 4OHYA 2R063 1DF0A 3D6EA 3AXEA 3AMNA 4MUVA 1PNFA 4ZU4A 1IPKA 1QNWA 2R043 4HPKA 3AP4A 1J58A 2IXCA 2WIIB 3IDEA 4XFFA 5FMOS 4QX5A 4AVBA 2ZGLA 4LUKA 5BPXA 4Y1ZA 1QQP3 2EXKA 1RUH3 4JC1A 1CAXA 1AXZA 1HLCA 1AR63 2RM21 2WT2A 2XGXA 3VL8A 1RMU2 3B9IA 2RS11 3EHKA 2O8OA 4L97A 1LODA 2BVBA 1WW4A 3OGJA 3R0RA 3AMMA 1ZBA1 4G4FA 1H1AA 3QACA 4COUA 3SCFA 1PO11 2DVAA 1WW5A 2OYZA 1FOD1 1WLWA 4CDUB 1O3QA 1LJ7A 1NE6A 2QDNA 3VDDC 4DOUA 2O1QA 3WLUA 3ZYJB 4MGYE 1S0CA 1WD4A 3AZYA 3TWIA 3O7OA 1RUE1 3BU7A 1MEC2 1BEV1 1A3KA 4B4RA 1BKZA 2Q1ZB 1MS8A 4XFGA 1X82A 4YM3A 4FPEA 3OY8A 3NAPA 2FMYA 1OA3A 4D7SA 1AL0G 4LO6B 4NPRA 4MVTA 4WZFA 1FMD2 1YYNA 3WX5A 2O8QA 2GN7A 4M0HA 3ETQA 4Y22B 2PFWA 1WUVA 4RS5C 1XNKA 1AR82 3S6PA 1DYPA 3SH5A 1W6OB 3ZXEA 1HRI1 2BEOA 1NCRB 1PGW1 4FPFA 4MV2A 4ZXKA 1ULDA 2OA2A 4UW5A 2BNOA 2VW2A 4JTOA 3DPRC 1DQ0A 1ZNPA 4DPNA 3WW3A 1YWKA 4XHXA 1RUD2 1J59A 1H8TC 5KC5A 5KHKA 3O5SA 5GLUA 3O0VA 3USUA 1Z7S1 1N3QA 1TME1 1QY4A 5HXVA 3ATGA 1CAWA 1UPIA 3MPPG 4JTNA 1SMVA 4QQPA 1H9PA 5KHIA 2QE3A 2YGMA 3SISA 1W6NA 3PLQA 1Q5OA 4K7JA 5GJ6A 3VBUA 1QJX2 4C91A 1PO22 2RR13 1FNYA 3DV8A 4YSFA 3POYA 3VBFA 1MQTC 4I0BA 3M3CA 1TNRA 1A8MA 2K2SA 1ASJ1 2LUWA 2RMU1 3JZVA 4HK9A 4Q4V1 3WDXA 5A33A 3C3VA 1BBT1 1W0OA 3MLKA 2W39A 1C1FA 2WNUA 4AI2A 1G6NA 5E88A 1NY72 1W6PA 2UWAA 1DGRA 2JENA 1XRUA 4Q1RA 1UZYA 3UV9A 4R9CA 1POV1 1G86A 1MZFA 2VOVA 5BNPC 1FX5A 3WCSA 4FTBA 4PDWA 2JD4A 3T2TA 3PVOA 2IXHA 4IEWA 4AVCA 2VY0A 4ITCA 4P9GA 1H2MA 1DQ1A 3QH7A 4QPYA 4AQ2A 3WCRA 1NYWA 2BNNA 3O12A 4FPCA 4YGEA 4UW3A 2ZKNA 1DQ2A 3TNPB 1LHOA 4Q8KA 1BJQA 2DCYA 2RM22 4E4SA 3AMQA 4Q8LA 4P9XA 1JTZX 4CRQA 4CZSA 2ZHNA 3HQXA 5GLWA 4GMP1 3MW2A 4AEDC 2RS12 2ZMLA 1MZ6A 2ZACA 3M8LA 5CU1A 1IPJA 2MHFA 1BMV1 3KD4A 1HQNA 1D4M3 1QF3A 3E5UA 4XFCA 4N7IA 4DY3A 1CVNA 1XXNA 1ZBA2 4YZ2A 5TSWA 2VOKA 5H9QA 2LTNA 1PO12 2RS33 1NCQA 5JLVA 1HX6A 1SDWA 2VECA 2X5IA 3SMHA 2ZX0A 2PYTA 2ZGUA 2R0FA 1FOD2 1NQDA 3RI8A 2ARBA 3UK9A 3ZPYA 2JEMA 1F9KA 4B4QA 3PVEA 1M06G 5T3NA 1AXKA 3ZFGA 2JJ6A 4N53A 4GWMA 1AR61 1COV3 1GFF2 3PVBB 1CJPA 1RUE2 3PJYA 2VVDA 1BEV2 1UIKA 5GLZA 1LGNA 2LM3A 1NE4A 4XPVA 2GC1A 4EJRA 1AR93 4Y1UA 3V65A 4KU7A 3IM0A 2VMIA 1LENA 3P3NA 2K9ZA 3A0KA 3GZTB 4Q0SA 2WNEA 4N43A 1PK6A 3VBRB 2PAMA 3NO8A 5C9AA 4BM8A 1Y7BA 3IIAA 2D3PA 4UW6A 3G6JB 2DVFA 1HRI2 1PGW2 4RQPA 4CEYC 1GBGA 1OMIA 2VNGA 5T54A 4Z1VA 4JRLA 5GZFA 3N7KA 1GSLA 3ZN6B 4IL7A 2OVUA 4GH4A 4YGDA 4K21A 5K0UA 1Z78A 2B42B 3KM5A 5I0UA 2XLFA 4FPKA 1AF9A 2MNGA 1Z7S2 3ZXGA 3EBRA 1NZCA 2B45X 3H9AA 4COYA 5C8CA 2D5HA 4QPGC 4AI8A 4PLNA 2CL2A 2I74A 2Y0OA 3JD73 2C9AA 1RUJ1 4Y1VA 3LOIA 4IEZA 1BK1A 4GB33 3AZXA 1POV0 1CD3G 1RIRA 4G3YC 4OFGA 2QZ2A 3KCXA 1W6MA 4Q4V2 1ASJ2 1G7YA 1XNBA 1CAUA 4R4ZA 5BNNC 1ULGA 1OA4A 3AFGA 4FO9A 2OIIA 4IEUA 2ZTNA 4XF9A 2X29A 4IV1A 1YCIA 2XBO3 4H3WA 3BOPA 5GZCA 4O9EA 1AX1A 2XJQA 4TWTA 5K8SA 3ACLA 4BYYA 5KXDA 4BHPA 1IS5A 3ZFEA 5FMOL 3NKTA 1CAXB 4O9GA 3ZSLA 2WNVC 1I5ZA 5AFBA 2BQPA 4OUMA 1UL9A 2E7TA 2WA4A 1I9RA 4Y20B 2ET1A 3MIDA 1D2SA 1IGOA 4DMIA 3DL3A 1N1SA 2Q1MA 4IERA 4OHVA 5IUQA 3RRDA 4BCUA 1G9BA 1XYNA 2WLPA 3H1WA 1V6MA 1LKNA 1GNHA 2ARXA 3VKNA 4LE3A 4IEYA 2DWRA 1Q8OA 4K1YA 1ENSA 1EYBA 4Q4W3 4HT1T 1PMIA 1VALA 4X6QB 3V0AA 2XKOA 4AE2A 1WA4A 5CIRA 3ZFFC 1YLLA 1VBB3 4YFZA 3ES4A 4JCKA 1KJRA 3PNAA 3U4XA 1DIWA 3RG0A 3NV2A 5DUUA 3VGIA 3OTFA 3AMPA 1QDCA 1AR62 3VBUC 1LHUA 4E4DX 1NXMA 5IK7A 1ZZ6A 2JG8B 3SITA 4UBHA 3AZWA 4MGIE 2EALA 5KHHA 1VAVA 5FO7B 1JUHA 1QOOA 2D6PA 2K0GA 4E2GA 4EWDA 2WZR2 2HWE2 4AFCA 1AHSA 3E97A 4AHZA 1D4M1 4BWOA 1REDA 2R071 4YVWB 3A0NA 3QBQA 1H2NA 2WSUA 3H7JA 4MH0E 2RS31 1TMF1 3FE5A 5FFOC 1MS0A 1SFYA 3S7EA 4Q4Y3 3SNMA 2FHRA 2DCKA 3FHIB 3M3OA 1UIJA 4QGMA 5GKAC 3USUB 2EXHA 2C0ZA 2OPKA 5J7MA 1CAWB 2YUEA 2BW8A 1IS6A 4X6RB 2PHDA 3M4FA 1HXS3 4E2QA 2JICA 4Q0PA 2HWC1 2KA3A 1AR91 2DVBA 4IEQA 1W39A 5SV8A 5DZFA 3ZSKA 1KD7A 1RVF3 1R083 4FPGA 4KU8A 5T5OA 3AP9A 2R49A 1C57A 4Q27A 2P37A 1TNFA 4IV3B 3W9AA 3J8F3 3AM2A 1RUJ2 3AKSA 1WCSA 2XH6A 4LBQD 2VGDA 3VDDA 3GBFA 2GMMA 1ND2B 1U12A 1NA1B 4CDWB 4YW4A 1SLIA 1OOPC 4Q29A 1AYM3 2IXIA 1RJ7A 1FNZA 1YO8A 2WL1A 3D0SA 3POSA 1W6QB 1OQDA 1AJOA 4IEPA 1V9U1 1HKDA 3ME2A 1V6IA 3UKVA 2G9FA 4FP3A 1FATA 1YFWA 2ZOEB 5LRRA 3L2YA 5T5PA 3DF0A 5IK8A 4DS0A 1SBFA 2XJUA 3MIBA 3ZX7A 2B39A 2WSVA 4RHV1 2Y26A 1HIXA 4XIOA 1QDOA 3VUOA 5I93A 5HCFA 3UKNA 3U10A 2JDZA 2RJLA 2PQQA 3MIEA 2O0OA 5AC93 1B35C 1N1VA 1XU2A 1WMFA 3JQWA 3NV4A 3DPRA 2W08A 4M3CB 3LB9A 2LALA 1QNYA 2DF7A 2X5IB 1H8TA 5CFCB 4BPZA 1OFSA 1LU1A 3RI9A 1VBE3 1MR5A 2ZBJA 1GLHA 4N53B 2TBVA 1GZ9A 4FXGB 2AZ5A 1A6CA 1EY2A 4P9LA 1Q56A 4XZPA 3N7JA 5J96B 2BWCA 2EAAA 1U5XA 1YI7A 4AI1A 3HWJA 5FLJA 3OYWA 4I3GA 4XJZA 1N3PA 1QKQA 3H50A 4YVSB 4DZGA 3QLQA 2PAEA 1MQTA 4FPJA 3VN4A 5HBAA 4XF4A