2R49A

Mutational and structural studies of e85i reveal the flexible loops of fibrobacter succinogenes 1,3-1,4-beta-d-glucanaseglucanase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
SAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSIKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and Structural Studies of E85I Reveal the Flexible Loops on Truncated Fibrobacter succinogenes 1,3-1,4-beta-D-Glucanase
rcsb
molecule keywords Beta-glucanase
molecule tags Hydrolase
source organism Fibrobacter succinogenes
total genus 59
structure length 241
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2007-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r49A00
1FNZA 1RIRA 1S0EA 4AVTA 3V0AB 1FV3A 1DYKA 3H0OA 4FOQA 4PCRA 4GWNA 5T5OA 1G9AA 4C1XA 1S0IA 2D3PA 3IPVA 3B69A 2E51A 1HQWA 4JRAA 5GALA 1BKZA 3LSEA 4Q1RA 3RS6A 1YRZA 4Y24A 1S0JA 4ATEA 1SACA 4OZXA 3HMYA 4Y1VA 1D2SA 4ISRA 4WV8A 4LBKA 2YV8A 2OW4A 4XIOA 2UWBA 1G9CA 1YO8A 3ZSMA 1WW7A 5E88A 3USUA 1X50A 5DUUA 2A6ZA 5T52A 2XB6C 1F5FA 4Q26A 5IK8A 3AP4A 4FPKA 4WVWA 1ULGA 1V6IA 1W6OA 4JC1A 2CNAA 3WCRA 3R4UA 4ATFA 5GZGA 1S0DA 1AX1A 2D6LX 2VXRA 4Y20A 2A6VA 3VKMA 4YZ2A 1LTEA 5KXDA 1FX5A 1KJLA 2AH2A 3R4SA 2DVAA 4P9YA 1MVEA 4WVVA 2WQZC 2DVBA 2NMOA 1AX2A 2GNTA 4Q27A 3V64A 1LGBA 3NV3A 1N3OA 1PZ9A 3AP6A 1N3QA 1KJRA 2PHTA 3B9CA 2Z42A 2JKBA 1WD4A 1HQLA 1JHNA 3FUQA 3SH3A 5T55A 2VW1A 3OBRA 4XILA 3DGTA 5GZFA 1V00A 3B01A 1A8DA 2R16A 3APBA 2C5DA 1BXHA 1LHVA 1OKQA 4U2AA 2GNDA 4FPYA 5FRAA 2NM1A 2EIGA 2WKKA 2ZHKA 1SFYA 1U0AA 2VW2A 3ZXEA 3AYCA 3RMYA 1QOTA 2DUQA 4KBBA 1LESA 2OUJA 2A75A 1LEMA 2AREA 4M00A 4FQZA 1YXWA 5JOYA 3AZVA 3OJBA 3KQRA 4XDQA 4XMIA 2G4IA 2W39A 2A6WA 4YGDA 2YZ4A 3MW3A 2E7QA 1LHOA 5BYNA 3OGGA 1MS1A 1QMJA 2PHFA 1GV9A 2JD4A 1W0PA 3AYDA 3POSA 4XBLA 1DQ4A 1D0HA 1NLSA 3N36A 2A6XA 1QU0A 2DWRA 2H0BA 3B3QE 3IM0A 4Y26A 5DG1A 3OY8B 4XXPA 1LOFC 1DQ6A 2ZZJA 3NV4A 5T5LA 2AYHA 4K1ZA 5GZCA 3RG0A 2ARBA 1UMZA 2ZGQA 4UW6A 1URXA 4Q8LA 2ARXA 1I3HA 2DURA 1C57A 4Y1XA 4ZXKA 4FPCA 1CQ9A 2ENRA 1GZWB 2ZMNA 4M3CA 3AJZA 1LULA 2R49A 2YROA 4ISQA 3AZZA 1LOGA 2ZABA 3FLPA 3L2YA 2P37A 1IKPA 1Z0HA 3D6EA 1SLCA 5AVAA 4M3CE 1S1AA 4WZFA 5CNAA 2GN3A 4YGCA 3VUOA 4JCKA 4XJZA 3WUDA 4FPEA 4BM8A 4U36A 2GALA 2D43A 3AZYA 1LEDA 5KXCA 2JE7A 3O0VA 4ASMB 1CR7A 2EXHA 1SBFA 4Y1YA 1FATA 1MZ5A 1ONAA 2EXKA 2P34A 3PVNA 1LHNA 1UL9A 5CAZA 1Y7BA 1W6NA 2PHXA 4FP2A 1J1TA 4Q2FA 2NYYA 3WG1A 4YZ4A 1Q56A 1HKDA 2D6KA 2R1BA 3IPVB 1BZWA 1LJ7A 2UURA 3V65A 4W65A 4YZ1A 2DVDA 2V73A 1AXZA 5HCBA 1O4YA 1Q8PA 4FPLA 1ENQA 4FPHA 2D44A 4R9CA 2ZGLA 1Q8QA 3B00A 4AGRA 1UPSA 1N1SA 2ZHNA 3PVEA 2ZGKA 3WDUA 1PZ8A 1MS3A 5DUXA 4XJWA 4GXLA 3N3HA 3AP7A 1LGCA 1QF3A 4YM2A 5L73A 3USUB 4LBQA 2DUOA 1A78A 1CJPA 1DHKB 2BQPA 3FFZA 2ZKNA 5JDBA 3T2TA 1BYHA 1W6OB 1CIWA 2CWMA 4P9XA 4AGVA 2WT0A 4UW3A 4XBNA 4R9BA 5JLVA 1JUIA 2ZGOA 1SBDA 2ZACA 2CWSA 3WDWA 1RITA 4BLIA 5GLUA 5EYXA 1MS0A 2FMDA 4GA9A 4LBMA 2WLQA 3OPZA 1GZCA 1IS5A 1KDKA 2R0HA 1G9BA 1DFQA 4F83A 1Q8VA 1LOBA 3N35A 3N7JA 1WW6A 3A0KA 4K20A 4LBOA 2VW0A 3ZSKA 1DQ0A 1F9KA 2VY0A 3ZYRA 1N1TA 4CTEA 2ERFA 2ZHLA 1ENSA 5DXDA 1H9WA 5IUQA 1IS4A 1CESA 4YW4A 3D4KA 3WDYA 1AVBA 1JXNA 4PF5A 1GZ9A 2JE9A 1G7YA 1YI7A 3WLUA 1DYPA 1KDMA 2D6PA 2ZGSA 4DS0A 1FYUA 1IKQA 2A3YA 3SITA 3PJQA 2R0FA 4M3CF 1AXYA 4YM0A 3N7KA 1DZQA 5GJ6A 1S0BA 1GICA 1QOOA 4YZ5A 3AJYA 4FOVA 3SISA 3M3OA 4YFZA 3DUIA 1OFSA 4BPZA 1ULEA 5GLVA 2A7AA 1IS6A 1CVNA 1ULCA 3AZWA 4GALA 3LCPA 1OQ1A 2E7TA 3V0AA 1FAYA 3MW2A 3IKWA 1CPMA 1RINA 3AYAA 3UL2A 1DGLA 1V6MA 3POYA 3VKLA 2AGSA 3WDXA 3BODA 2FHRA 3ZSLA 5KXBA 1LECA 3WZ1A 3ZSJA 2GDFA 3T1MA 1R1ZA 1GSLA 2VH9A 2W52A 2W68A 3WHTA 3FBYA 3W59A 4Z8BA 1WW4A 4Y1UA 1CONA 4M3CB 1AJOA 4FQ4A 1WBLA 1G86A 2ZMKA 2D3RA 4Q8KA 5GLWA 1SBEA 1QDCA 2AENA 4ITCA 4YW2A 3GALA 2B7YA 4XE9A 4YW5A 2EF6A 1LCLA 1N1VA 1VAVA 2NN8A 3NV1A 1LOFA 4NOTA 1GKBA 4PBOA 5E8AA 1W6MA 2DU0A 4FVVA 1ULDA 2SLIA 2V5YA 4YGEA 1KITA 1XQNA 2UWAA 2WSVA 1DLLA 3ENRA 4YW3A 2DVGA 1LOCA 5CBLA 3ILFA 5H9RA 1W6NB 3WDTA 4BQ1A 1W6QA 5H9PA 2JJ6A 2ZGNA 4TZDA 4CRQA 3WG4A 2DUPA 2LTNA 3M2MA 5DUVA 3WNXA 1QGLA 4XHBA 2A5ZA 2ZAAA 1N1YA 4FPGA 3AP5A 3AP9A 4LBQD 2ZBJA 2OVUA 5GLZA 4HL0A 3CNAA 2EALA 1UKGA 1WLWA 1UZZA 4K21A 3VKNA 3MW4A 1GLHA 1I1EA 5F9TA 5GZEA 1UN1A 3PVOA 4R9AA 5KXEA 2D7FA 3NWKA 1S0GA 1DBNA 4LBQB 5JMCA 3OBTA 2AR6A 2UU8A 2DV9A 1MZ6A 4BLJA 1GNZA 5JOWA 2DVFA 3V0BA 3WCSA 1MS4A 4DFSA 5GM0A 4LBLA 3N7LA 3UK9A 4YGBA 3SNMA 1C1LA 1SLIA 5JOXA 4RA0A 1SCSA 1C4RA 4Q1PA 1WLDA 2EXJA 2GMMA 3OYWA 5DG2A 1AF9A 4Y22A 2A70A 3VKOA 1HLCA 2D6OX 4FPJA 1VLNA 4UW4A 1JN2P 1QNWA 2WSUA 2GNBA 1QDOA 3WHUA 3SLIA 1VALA 1N47A 4Y20B 2OUHA 1MACA 4XBQA 4XXAA 1W6PA 4FOYA 4IQPA 2P3JA 2R1DA 2JDZA 4MYEA 1DQ2A 3WV6A 1Q8OA 1V6JA 1WUVA 3M3QA 3RQ0A 3AFKA 4FP3A 3VKFC 1W0OA 5IT6A 4P9WA 4LBJA 3AZXA 3RMXA 1JYCA 2DYCA 3W58A 1AZDA 2NMNA 3M1HA 1ZM1A 3ZYPA 4XZPA 4D69A 2PHWA 1SLTA 5FREA 4XTMA 4YM1A 5DZGA 1AXKA 3AXEA 2C9AA 1C1FA 1BQPA 2AUYA 2WNEA 1QKQA 3ATGA 2E53A 1SLAA 2GMPA 3ILNA 4I30A 1V6OA 2UWCA 4SLIA 1IS3A 4GKXA 5DZFA 3WUCA 2P3KA 2WT2A 4XIKA 4AWDA 3AYEA 2NZ9A 2SBAA 1S0CA 1VAMA 1ZA4A 3AX4A 4XJ9A 3WG3A 4AVSA 3M3EA 1NXD1 4K1YA 3TB0A 3FLTA 3IN9A 2YXSA 1GANA 1FV2A 2P2KA 1JBCA 4HANA 5H9SA 3ZXLA 3IMNA 2D3SA 1ULFA 3ZPYA 1LGNA 1H30A 2GMEA 3MPPG 2P3IA 1N3PA 1MVQA 1V6LA 1W6MB 5DUWA 3QCWA 2GNMA 4Y1ZA 3C2UA 4RL7A 4YG3A 5HCFA 1GBGA 1A3KA 3ZXKA 1Q8SA 4YM3A 1JW6A 4P14A 1APNA 1LOAA 2EAKA 2ZMLA 2NP0A 1TEIA 3O0XA 1WD3A 3D5OA 3ILRA 4FOWA 5SV8A 1W6QB 3VV1A 3FUOA 3WDVA 2E6VA 2XG3A 1SCRA 5T54A 2CY6A 4DQAA 4YZ3A 3O12A 3BTAA 1B09A 1YIFA 4R9DA 3WVJA 3KM5A 4XMAA 1LHUA 5F5QA 3QLQA 1S0FA 1UZYA 1QNYA 1DQ5A 3FLRA 2TEPA 3JUUA 3WOGA 5T5PA 2A6YA 2PELA 4YFWA 2YY1A 4XYXA 1F31A 2LALA 5IK7A 2I2SA 3NV2A 2DU1A 3M3CA 1AX0A 2GN7A 1FNYA 1LHWA 1MS5A 2ZGTA 3TAYA 4DRRA 4AYUA 2A71A 4XOGA 1JYIA 1KRIA 3BOPA 1LU1A 1WW5A 3I4IA 3UJOA 1G9FA 2A3WA 1V6NA 1IOAA 1GYKA 3V0BB 3O0WA 1SLLA 3ASIA 2PHUA 4M01A 4CZSA 1ENRA 4DPNA 3UJQA 2ZGPA 3JU9A 3R05A 5H9QA 2Q5TA 1MR5A 4DRVA 5EWSA 3SH5A 5GZDA 1DQ1A 5E89A 4UW5A 3Q9OA 4ZKTB 3O5SA 4XTPA 1LENA 3A0NA 3OYWB 4YG0A 4TYSA 4AVVA 1WLCA 2EXIA 4GWMA 4BMEA 4Y22B 1CPNA 1DIWA 1Z78A 4FPFA 2VUAA 2ZGUA 4L8QA 3GNEA 1BJQA 3RSJA 1MS9A 4AGGA 1H9PA 4LBNA 4YG6A 1YYNA 4PQ9A 3A4UA 3WG2A 5JOZA 2PHRA 2YMZA 3RRDA 2KM2A 4BOWA 1WCSA 4XJAA 4H55A 3LSDA 1JOJA 1W6PB 1UX6A 3BIWE 2DTWA 3I8TA 5EYYA 4BMBA 3PMEA 5CA6A 1HDKA 2D6MA 3SH4A 2ZHMA 5HCAA 1G9DA 3U4XA 2DTYA 1LOEA 3OY8A 3AXDA 5EXOA 2VU9A 3INAA 2ZA9A 2D6NA 3N7MA 1UAIA 1WBFA 4YW1A 5IK4A 2CL2A 4YLZA 4C1WA 2CYFA 4XJ8A 1V6KA 1GZWA 1KQRA 2ZGMA 3HN1A 3ZVXA 3POWA 2WJSA 3ZXJA 2CTVA 2JECA 5GLTA 5IK5A 1G8WA 4NO4A 5DZEA 1LU2A 4GKYA 2A3XA 1CN1A 2ZGRA 4XHXA 3T1LA 1O4ZA 3AK0A 1QOSA 5JVVA 1EPWA 3ZXFA 1LODA 3MEPA 4FPOB 1VIWB 1MS8A 3HR9A 5T50A 1GNHA 2W08A 5LK5A 2RHPA 2WT1A 1AJKA 4XJUA 2ES3A 5CB7A 1PZ7A 2HYKA 5T5JA 4PBPA 1SLBA
chains in the Genus database with same CATH superfamily
1FNZA 3FN9A 1S55A 2BEOA 5A3LA 2Z79A 3J7NA 5LASA 3V0AB 4QKFA 3SEEA 3OTFA 4FFHA 3H0OA 4FOQA 4HK8A 4PCRA 4GWNA 5T5OA 4PIYA 3T2OA 5BNPB 4DZGA 1HXS2 4XF3A 3E97A 5GALA 2BWAA 4O7XA 3VBRC 1QWRA 4C90A 4EN0A 2J1VA 4QWNA 2CGOA 3NJVA 4Y24A 2Q4SA 2GC3A 4I3PA 1D2SA 2IWGB 4ISRA 2XJUA 4LBKA 1UKRA 4Z07A 3WP5A 5C8CB 1G9CA 1YO8A 3UKVA 1WW7A 3VBSA 4BISA 4NIAA 1XSQA 4QPYA 3OSDA 1F4HA 2YU2A 4Q26A 1B35B 1T6BX 4ZONA 3AVRA 1FI2A 1W8HA 2CNAA 3E5UA 4ATFA 4J6GA 4D6QA 1OF4A 4Y20A 5A7WA 3CJIB 3VKMA 3UV9A 1LTEA 3DV8A 3WW2A 1FX5A 4HVRA 3ZKYA 1KJLA 2AH2A 5ABJA 3R4SA 4OI2A 4WVVA 1MVEA 5FZ1A 1FOD2 5BNOB 2YBKA 5FYMA 4CU6A 2XXZA 2VD7A 2XH6A 3MIBA 1XC6A 2WC2A 5D8AA 4Z2AA 5L36A 1OMIA 1ZRDA 1N3QA 1KJRA 3B9CA 4CSWA 1UIJA 3U14A 1I6XA 5FP9A 3TEYA 5FZOB 3SH3A 4WM8A 5T55A 1E5SA 1F8VA 4NAMA 4XILA 1Z7S3 5GZFA 1BVVA 2JB4A 1LHVA 5C5TA 4TLFA 2ZX3A 4RSUA 1NT0A 3VBHB 1YHFA 2XJTA 2ZHKA 4IDZA 3OUIA 1SFYA 3ZFEB 4COZA 4X6QB 3J26N 3ZXEA 5FPUA 1QOTA 2DUQA 2JXAA 4KBBA 4AAPA 4QX2A 1LESA 2RS12 2A75A 2AREA 4FQZA 3AZVA 3OJBA 3KQRA 1YNAA 2EIEA 1RUC3 4CEYC 1CIYA 2JDHA 2CGNA 1BEV3 5FXVA 5F32A 4YWAA 4B7KA 2E7QA 3C7GA 1LHOA 1X36A 1MS1A 2JD4A 3AYDA 3MUY1 5C6CA 5FCCA 1NLSA 1V9U3 2DWRA 1Z7S2 2H0BA 2PXJA 3K75B 2R6QA 3RZGA 4XXPA 5JXIA 3AMHA 5LRSA 3AKSA 1DQ6A 3NV4A 5T5LA 2AYHA 2VZOA 1HJFA 2ARBA 2ZGQA 1AL22 4B3NA 4ZXKA 1QJZA 4CCCA 1COV3 2ZMNA 1REDA 4M3CA 3AJZA 5F5AA 1GFF2 4MXVA 4QGNA 3GHNA 5BUVA 1NCRB 4AOCA 2ZABA 2ZAHA 3FFQA 3L2YA 5DMYA 4YVSC 4IEOA 2J1AA 4N53B 3HIFA 4M3CE 5AVAA 5J3UA 1GOGA 2EICA 2B39A 2PHLA 3J4UH 4HOOA 3WQ1A 4CEWB 4JRLA 3H1YA 2R061 4CCNA 1CAWA 4FPEA 4XQDA 4JQTA 3AZYA 1W05A 4N8MA 3QH6A 1Q5OA 2PQSA 1QIQA 5A3NA 4EV0A 4NROA 3O1SA 1CZSA 4XCAA 4Z82A 2VZPA 1W6NA 3ACHA 3C7HA 1J1TA 4Q2FA 4XAAA 4YZ4A 4CUGA 2DCKA 4O61A 4P9LA 3TNQA 1ZBA2 4BZ4A 3IPVB 4TWTA 2WS92 4R52A 4FFGA 1D4M2 4AI8A 3D0SA 1W2TA 1C5IA 1G6NA 4JV4A 4M0HA 3B02A 4FPHA 3U11A 1QXJA 1H6XA 3AVSA 1GP5A 1PMJX 2ZGLA 1W9WA 3B00A 1O6UA 3LOBA 1N1SA 1IHMA 2ZHNA 3PVEA 5FP3A 1TMF1 4BQ2A 5FKCA 1VP6A 4EN8B 3I7DA 4LUMA 4QPIA 5C4WB 2BGCA 2CSGA 4JGZC 3USUB 4LBQA 3FFZA 4UFIA 2E9QA 1BYHA 1W6OB 4COVA 1UMIA 4XBNA 4R9BA 3DN7A 3WY6A 1WCKA 4PLNA 3KS7A 4BWOA 5JI9A 2OT7A 2VMIA 2ZGOA 3HNBM 5LK7B 4LULA 3WDWA 5GLUA 5EYXA 1MS0A 4QPGA 3LKJA 4W8JA 1JYWA 4QHZA 4GA9A 2VCCA 3RZLA 4FTBA 3OPZA 3T2QA 3J8F1 5A3UA 5D21A 2D98A 2Q1FA 2PLV2 4JGYC 1WW6A 3A0KA 3ZSKA 3C7OA 1F9KA 2VY0A 3ZYRA 1N1TA 4CTEA 1ENSA 2VQTA 3WDYA 3JBG1 3F95A 3DYPA 1UO9A 5FXWA 1WMFA 1AVBA 1JXNA 3VBOB 5E1RA 2BW8A 4XF0A 2OYZA 1GZ9A 4L11A 1DYPA 1NA1A 4DS0A 3OBZA 1HV1A 2A3YA 2C0ZA 2ID4A 2KA3A 4LKEA 4YM0A 5D2AA 2YU1A 1DZQA 5HI0A 2XQRA 3IDBB 4Z2WA 1CZVA 3AFGA 4FOVA 3SCHA 3M3OA 5JZGB 4BU2A 3DUIA 4EZ4A 1XYPA 1W04A 1NLQA 2OPWA 3LCPA 3V0AA 1FAYA 3DF0A 3AYAA 4UI9L 3UL2A 3POYA 4UF0A 5BNPA 2GC0A 1ND3A 4GJYA 1QJU1 2VTXJ 3ZSLA 4XVHA 5FBZA 3WX5A 5A3TA 2XJVA 3CZUA 1R1ZA 2V5DA 3I2JA 4QQHA 2Y6HA 4LHKA 2WL1A 2ARAA 1O59A 5C3SA 3I2OA 3W59A 1K45A 3D8CA 5IVFA 4Y1UA 1CONA 1AJOA 3KMHA 2VCAA 3IMMA 4FQ4A 5FY5A 3THDA 2D3RA 3AB0A 4Y5TA 1SFNA 2B7YA 5FZFA 1K5JA 4EJRA 5BNQA 5K7PA 2J1SA 1LCLA 1N1VA 1VAVA 2NN8A 4CCMA 2YPJA 3LDBA 3EB7A 4NOTA 1GKBA 1OD5A 4L97A 4NWVA 4BYYA 2L9LA 3CJIA 1W6MA 3BOWA 2DU0A 4H7LA 1ULDA 2YGLA 1GZTA 2DCZA 1XBFA 4HK9A 3KCCA 1SG3A 3MGUA 4CE8A 5BNOA 2XJRA 1OOPB 1F4AA 2DVGA 2QBXA 2VM9A 2IXLA 4ZS2A 1RXGA 1RVF1 1JYNA 1W8FA 1F35A 4BQ1A 2Y34A 5EP9A 5H9PA 2JJ6A 2ZGNA 1MZFA 2IFWA 2R063 3H50A 5F6LB 3WQ7A 2PYTA 3WG4A 1QH6A 2DUPA 2LTNA 2Y38A 3DEMA 3M2MA 4G9SB 2A5ZA 4IV3B 4PDWC 4QT6A 1DDLA 4A6SA 4ZHNA 4FPGA 1OA2A 1ZZBA 2XBO1 3JB8A 4G4FA 2JG8C 4GQ7A 1H2LA 3OD4A 3VBHA 1US2A 1UKGA 1WLWA 2EALA 2QQWA 4MLOA 4RD7A 3T09A 3WNLA 3ZFEA 3O1MA 4YW6A 5F9TA 5KXEA 4R9AA 1HRV2 2IZWA 4BXFA 3WF4A 4E2QA 5CZKA 2OXBA 4Q4V1 1MQTC 2WZ8A 4IEQA 4NRQA 4P5HA 1MPXA 1PNGA 1GQGA 4W4ZA 4A45A 4XUPA 3UYJA 1JU3A 1JU4A 1MZ6A 5C70A 1TMF3 2XKPA 5JOWA 1VBE1 2DVFA 2HBTA 3WCSA 3ZM8A 5GM0A 3NSTA 1OD3A 3AKRA 4LBLA 5CKMA 4B1MA 3MIGA 4JKKA 3UK9A 4MGSA 2ARCA 1YQ6A 1SEFA 4QQ2A 4BA6A 1GMMA 2HWE1 4RA0A 5LA1A 2PA7A 3JD71 3ZFGA 3FX3A 4AQ6A 2OX0A 3OYWA 5DG2A 4ZS3A 2J1UA 3VHPA 3GYDA 5EJ1B 2A70A 1QQP2 2BBVA 5A1LA 2PTMA 1HQNA 5LY2A 3RYPA 1RUE1 5FZLA 2WO1A 1A34A 3IT8A 4FSJA 1CWPA 2OZ6A 2VZSA 4JQRA 2GNBA 2Y6JA 3J8F3 5LRRA 1XYNA 4YVWB 2DF7A 3KB5A 3IAQA 4N53A 1ZRRA 2X5IB 4XXAA 4FOYA 2P3JA 2R1DA 4RR3A 2JDZA 3OBAA 1Q8OA 5A32A 3I2IA 2ZOEB 3JBG3 4ASKA 3ES4A 3M3QA 4GB32 3H8RA 3VKFC 5I0DA 5C3QA 1W0OA 5JPMB 1W28A 1O4TA 3N9LA 1JHJA 4IGQA 2ZKLA 2DYCA 3MIHA 4DXZA 1AZDA 2NMNA 5IFPA 1OBNA 1ZM1A 4XZPA 2E31A 1SLTA 2PHWA 4LQRA 4XTMA 4YM1A 5DZGA 4Y4YA 1OLQA 4GWJA 4AL9A 2G9ZA 4NMIA 3HAGA 1UD1A 4FFIA 3HT2A 3TYJA 4QB1A 1POQA 1YFWA 5FZCA 4AZZA 3LEIA 2VVDA 2UWCA 4SLIA 1UW8A 2WA4A 4RN5A 1IS3A 4ONUA 5DZFA 3S30A 2VMGA 2WT2A 3WW4A 4AWDA 1U5YA 3ZDVA 1VAMA 3I2HA 4O9GA 3AX4A 3WG3A 4ARYA 2Y0IA 3M3EA 1Y9QA 5JSPA 1QJU3 4K1YA 3TB0A 4RHV1 3BPSA 3FLTA 1GP4A 2YXSA 3AMMA 2OZJA 3A7QA 4KGGA 2WA3A 1FV2A 4LUKA 4QX3A 1W9TA 3VBSC 2HEYF 4IETA 5DABA 5A7QA 3IMNA 1O91A 1OPOA 1ULFA 2W9XA 2VO5A 1N3PA 3GBWA 2JDYA 3SCGA 3OPTA 5HCFA 5JIAA 2Q30A 5FMOS 1A3KA 4YM3A 5ABJC 2FZ1A 2QQUA 1W9YA 1APNA 1LOAA 2WAAA 2ZMLA 2NP0A 4AFAA 5HV0A 4IE4A 3O0XA 3POJA 3IDEA 3D5OA 3VV1A 2Y0OA 3LA3A 4FOWA 5SV8A 3WDVA 2YDEA 5D8AC 4GH4B 1HJGA 2WN3A 4H2AA 4Y4RA 4DQAA 2VC9A 3TNPB 3O12A 1B09A 3NNFA 4AVCA 4E4DX 1H4HA 5CADA 4D7TA 3ZYIB 1YWKA 5L9BA 4DY3A 4WM8C 5DDJ1 2QDNA 3TN91 3VBUB 3VDCA 5JWPA 2QVSB 1RVF3 1WWYA 2AACA 2VCMA 2VZUA 2J42A 2WZR1 1BMV1 1VMJA 3THTA 1DGWA 2YY1A 1POV1 5FYSA 1VBC2 4AI3A 1M4WA 5APAA 2GN7A 2ZCWA 1MS5A 2QQVA 4DRRA 4RGAA 1UU4A 3UT0A 4XOGA 1JYIA 4IE7A 2XBO3 4KU8A 3GDBA 3SKVA 1WW5A 4PHZA 2J1RA 5JZGA 4J1XA 3T4VA 3UJOA 1LB2A 2E63A 2CDPA 2BPA2 1GYKA 1OA3A 3PTYA 1EV11 3LF7A 1AR92 2RMU2 2HH9A 4XEZA 4F7ZA 2QUOA 1Q3EA 2LW8A 4Q4V3 3JU9A 3R05A 4HSJA 1PGW2 5LBFA 4L0PA 4Q4Y1 1H8TB 1RVF2 2TBVA 3IDCB 4GWIA 5FY4A 1DQ1A 1RMU1 2CU5A 4UW5A 5E89A 2W46A 1VBE3 4BMEA 1JODA 1XOYA 4GWMA 3IIAA 3BGAA 1CPNA 3MV01 1PVC1 1AR82 1XE7A 4FPFA 4UFJA 1O3SA 2DFBA 3WF1A 1H2NA 1BJQA 2Q8CA 1E5RA 1NG0A 1H0BA 4LBNA 1YYNA 1OH4A 2HWE3 1TME1 3PU8A 4JKMA 4PQ9A 4AR2A 1KS5A 3JD73 2PHRA 3WG2A 3ES1A 3KSCA 2LRPA 1JOJA 1W6PB 1UX6A 3BIWE 5EYYA 4MSVA 5CA6A 1E57A 5FOJB 4CDWA 3C7EA 2CHHA 1RUE3 1OF3A 1W99A 2DTYA 1LOEA 3OY8A 3PU3A 4HXCA 4QB2A 5DN2A 5FPBA 5J1XA 4A7ZA 1AR72 3N7MA 5IK4A 4MH0E 2VUCA 2ZJCA 4YLZA 3G7DA 2HEVF 2HWD2 4XJ8A 1GZWA 1RC6A 5IAXA 1S2EA 1DYOA 3ZVXA 5A6ZA 3RI9A 3D82A 2WJSA 4JAAA 4XUQA 2JECA 3TOJA 4NO4A 5FAXA 1LU2A 3T08A 4XHXA 1QXPA 2BFUL 5JVVA 3SXWA 4YPJA 3T1LA 2X09A 1ZBE1 1WMDA 3HR9A 4I02A 2WZPP 1RUJ1 2Y64A 5LK5A 3GF6A 5EV7A 1WCUA 5T5JA 2CV6A 4PBPA 1NY72 1RIRA 1VBA1 1S0EA 1YCIA 2O8QA 4META 4QPIC 2LS6A 2JDNA 1R091 1GU3A 1FPN2 1FV3A 1DYKA 5LBEA 4NPLA 4I01A 4P00B 1G9AA 1KD7A 4C1XA 2QTWB 3S0MA 1CGPA 1OXCA 2NLRA 3KV6A 5J36A 1AR62 5FR3A 4LO4B 1V70A 3U37A 4RHV3 5F39A 2Y60A 1HIXA 4MADA 4AEDB 1BKZA 4Q1RA 3RS6A 4QPGC 4XDPA 2GH8A 1YFYA 5FP4A 1A6CA 4Y1VA 5FTTC 2I07B 2O8OA 2OW4A 3JQXA 4LR4A 2HWF2 3A21A 2UWBA 1Q43A 4IV1B 4OYUA 2WFF1 3RWNA 4AF9A 5DUUA 1H1IA 2HYXA 4XQ4A 4FBFA 5FZGA 2P6CA 1SPPB 2QCSB 2FDIA 2Z2SB 4FPKA 4WVWA 1R082 4JC1A 1ND2B 1S0DA 2VXRA 2BVBA 2JB8A 2K2SA 4YZ2A 3VN4A 3LEKA 5F7UA 2DVAA 2Y26A 4P9YA 4P02B 4V2WA 3NJXA 3NQHA 4IGOA 3WQ0A 3WW1A 3ZN5A 3ELNA 2Q1MA 2ZX4A 2GNTA 4Q27A 1D7PM 4QDSA 5DDJ3 4CU8A 3TN93 4MXWA 5F8PA 1WCDJ 3EO6A 2W1WA 3ZX7A 2Z42A 2VZ3A 2WZR3 2JIGA 2XUMA 1HQLA 4NRPA 5FPLA 2Z4FA 3NRUA 2VW1A 1POV3 1IPKA 1FXZA 1PIV2 4URTA 3B01A 4BQ3A 1VBB1 2QQLA 1BXHA 4NIGA 4JHZA 3J7LA 4K8FA 3TRSB 5FQ0B 2WKKA 3A23A 1ND3C 3AKQA 1XE0A 3AYCA 3N4MA 3RMYA 1OVPA 2XWJB 4AHXA 4B4QA 2OUJA 1EV13 4M00A 4E2GA 2WYSA 4D6SA 3RZJA 1SFPA 4BQ4A 3MHZA 3MIEA 2W39A 1HB4A 4Q4Y3 3GZUC 1ZNPA 5FK7A 1RMU3 4IERA 1SZBA 3ZFFB 3WNOA 4E8CA 5BYNA 1JYVA 2PHFA 4NIDA 3KV5A 3RI8A 1DQ4A 3NNMA 4XFIA 4HN1A 1QU0A 4EN7B 1PVC3 3B3QE 5CYYA 2BYVE 3IM0A 4Y26A 1KFXL 3TBDA 5A3MA 5F3CA 3O1OA 3RZMA 2PAKA 2VXJA 4TLGA 3RPQA 4AK3A 4CXXA 1TME3 1JTZX 3MBWA 4UW6A 4Y1XA 4Q8LA 4OCTA 4N43B 5BNOC 3P5BA 1YLLA 3ST7A 1DZRA 3DYOA 4OUSA 2XL7A 4ES8A 5FPAA 1GNYA 4MX3A 1LOGA 1EUUA 5JSRA 4BCUA 2XDVA 3GJBA 1PM4A 3K3OA 3CKHA 2P37A 2VUDA 4EE2A 5FYIA 1BBT1 1W8TA 1Z0HA 1SLCA 3NAPB 3C3VA 3WP4A 4WZFA 5CNAA 3VBUA 1W8UA 3T2PA 4IEUA 3KT7A 1K5MA 2RS31 2V4VA 4JCKA 1R1A1 2GALA 3VBHC 2VUJA 2ZX2A 2D43A 3CLPA 3GBFA 5KXCA 4ASMB 3O0VA 4P9GA 1OQDA 1CR7A 3ZFEC 2XPJA 4Y1YA 1SBFA 3PVNA 2FD8A 1QJFA 4AXOA 1UL9A 5CAZA 1X8MA 4XUNA 4MOAA 1W2NA 3NJYA 2ZTNA 5KHGA 1ZBE3 2NYYA 5BXXA 3WG1A 4BK4A 1AYM1 4BQ5A 3O1TA 1CD3G 3THCA 4N90A 1HKDA 2R1BA 3GCWA 3VBFA 2UURA 1LJ7A 1RXFA 2VZVA 3V65A 4BXSV 1RUD2 2K46A 1AXZA 2R071 4FPLA 1VBA3 4FXGB 1TZOA 4AGRA 2ZEXA 2GP5A 1CAVA 1R093 4DMIA 3DXUA 3VHOA 4E8DA 3ZN6B 4A6OA 3WDUA 3GHMA 3OEBA 4A3ZA 5IHRA 1MS3A 5DUXA 3N3HA 2VOKA 3ZFGC 5FLIA 1LGCA 1QF3A 5L73A 2FMYA 1SMVA 1DHKB 1S2KA 2RM21 1JYTA 1VE0A 2CWMA 3MI8A 4P9XA 2Q1ZB 1RUOA 4IE5A 2RS52 2WT0A 4RS5B 1ZBE2 4DOUA 5IVJA 4EYUA 4QGLA 5JLVA 2OQ7A 1JUIA 4CP9B 2D5HA 3LDKA 3BKZA 3CQOA 3VDDB 1X9TA 2XGXA 4BLIA 4COUA 5I0TA 2PN5A 2WFF3 4IL7A 4N53C 3BUCA 4ZU5A 2ET1A 2WNUB 4QDRA 1SHWB 2Z5WA 2WLQA 4RR3C 1NCQB 5FWEA 1IS5A 4P08A 1WMEA 3KF5A 1L7RA 1LOBA 1Q8VA 2HEWF 5CG8A 4LBOA 4UFLA 3AL6A 4COWA 1DQ0A 3OGSA 2BNOA 5BPXA 2ERFA 5DXDA 1WMXA 1VRBA 3EMRA 1NZIA 5JXGA 1JZ6A 5A3PA 2BOIA 2HWC1 3I3DA 5FZEA 4B8EA 1KDMA 1IG3A 2ZGSA 4OI0A 5FZ8A 1FYUA 2WWJA 3ETPA 1IKQA 3UGFA 1NXMA 2VMCA 2BGOA 2IXCA 3N7KA 3I49A 1QHDA 5GJ6A 1VBB3 1QOOA 4FI9A 4UFMA 3SISA 1VMFA 2VECA 5AC91 2WINB 2P17A 5KHIA 3ECQA 5GLVA 2GU9A 4W6XA 1CVNA 1RJ7A 3NVCA 5JI7A 5FV3A 2E7TA 5FMBA 3B5LB 4DNYA 2EIBA 1CPMA 1DGLA 1V6MA 1W8ZA 4AEMA 1YQCA 5K0UB 3BODA 5HV4A 4QD2A 1LECA 4RFRB 3WZ1A 1L7QA 3ZSJA 2GDFA 4UT5A 5KWRA 3KVAA 4CDQB 2VE1A 4B7EA 1US3A 2BJSA 3H1WA 2W68A 4HVQA 3DPRB 1UOJA 4ZY9A 4ARXA 3FBYA 4AQTA 4Z8BA 4OZOA 5CFCC 3QH7A 4DEVA 5KHHA 3VZNA 1DG6A 1XE8A 4RQPA 4B4RA 4FAHA 1VBB2 1G86A 2ZMKA 3VHNA 3FZ3A 2BERA 1FMD1 2WNOA 5GLWA 1JOPA 3GZTB 3PMSA 4ITCA 4YW2A 4WVMA 1SPPA 5BV6A 4XE9A 4YW5A 1CX1A 2JDPA 2GH2A 1MEC1 2FDGA 1RHI1 4R8HA 2JKXA 3MIDA 3LFMA 4GMP1 5FPXA 3UNPA 3H8OA 1HB3A 2V5YA 1KITA 1ZZ9A 1V0AA 4HKWA 1YUDA 4LIVA 4QPWA 1DLLA 5FP7A 4FTSA 1XNAA 1BBT3 4K3UA 3UETA 5CBLA 5A7SA 2Y33A 3JXSA 4DIQA 5FLJA 3RVHA 2W95A 1RUC2 2RS33 4CRQA 1R1A3 4HPKB 1H1MA 1GUIA 4Q0VA 1UWWA 1BLZA 1JS9A 1BEV2 1QGLA 1ULPA 3I2DA 1H4GA 1GQHA 4XACA 3BALA 3ZR5A 5A6YA 1N1YA 4UOJA 4LORA 2WWSA 3P3PA 2FDFA 1OUXA 2F4LA 1DGRN 1VRH1 3AP5A 4M0NA 4DUWA 2OVUA 2Y8KA 1V9U2 5FQ0A 4AQSA 3BU7A 1J83A 2QQNA 5FIXA 4K21A 1AYM3 3VKNA 2EAAA 1I1EA 3MFAA 3GM8A 1H6YA 3FHAA 3PVOA 4O65A 2OKXA 2V09A 3NKTA 4ZU7A 1W90A 2D7FA 3KVBA 3NWKA 4NAOA 1S0GA 2R073 4MGTA 1W0NA 4MUVA 1J3QA 4LO7A 4R4XA 2KD7A 3W20A 1COV2 4CP1A 4BLJA 3ORJA 2WNVB 2ORZA 3HT1A 3ZFFA 4K7JA 4OVEA 3VBRB 2WABA 2YBSA 3N7LA 4BE3A 2RM23 1C1LA 1SLIA 1K12A 1VMHA 3OEAA 4HONA 3POEA 1F5JA 1VB4A 4CDWC 4RGKA 3CJXA 5B4XA 4Q1PA 2TUNA 3NL1A 2ZEZA 1ZVFA 4W50A 1AF9A 4Y22A 3V56A 5FUIA 3HEIA 1LAJA 1VLNA 4R4ZA 4UW4A 1QNWA 2B42B 5B2GB 3SLIA 2C24A 3KHCA 4HVOA 3RZHA 2VGDA 1MACA 4XBQA 3O14A 3CHXA 4BK5A 2VVFA 3EQEA 3DYMA 2RM22 3ROUA 4KWLA 5D1IA 1BK0A 3RQ0A 2HWC3 3NMBA 5IT6A 4LBJA 3AZXA 2IUWA 2XVGA 1QH7A 3GCXA 5LEJA 3HOBA 1XXNA 4P5YA 2H6BA 2RR11 3ZYPA 3BPZA 4D69A 2X05A 1DGWX 4DINB 5F5IA 1AXKA 3B94A 3AXEA 1QXRA 1O8SA 5FBJA 1QKQA 1RYYA 2E53A 4XPVA 1PMHX 5FY0A 3RFRA 3RZKA 4Q4W1 3ALQA 3ZMOA 5AC93 1KXGA 2MPFA 3RJRA 4CXYA 3VZMA 1EAH1 3ILNA 3PTRB 2W47A 4CEYB 3NKGA 2IXHA 3AYEA 3VGIA 2VNGA 2IVJA 2WQ4A 2NZ9A 3EHKA 1DZTA 5CISA 1IZ3A 1ZA4A 3JQWA 4GJZA 4LLFA 2JG9B 5JMOA 1OURA 1X82A 4AI1A 1NAEA 2W1UA 3MPBA 4UBGA 3ZLIA 2XLGA 3ZXLA 2B5HA 3KF3A 1X7NA 3ZPYA 2GC1A 1H30A 2GMEA 1CAUB 3WR0A 1MVQA 5FMOL 4I2OA 5DUWA 1CJDA 5HPOA 2Y6LA 4Y1ZA 3ZXKA 1TVGA 4I0AA 1Q8SA 1FMD3 2ORXA 4LPLA 4NWWA 5C3OA 4TXWA 2VG9A 2G9GA 1OLRA 4LOTA 3WP6A 3BTXA 1TEIA 3DL3A 1JZ2A 1WD3A 1LKNA 1MEC3 1W6QB 2GSYA 3SKJE 3VD3A 4CCJA 1OH3A 5T54A 1RHI3 3KGLA 4YVSB 3AMPA 5C8CA 4GMP3 1O3TA 1PX4A 4ASLA 3WNNA 3AM2A 3NO8A 1YIFA 5A6QA 1B35A 4Q4X1 5FZ3A 2Y6GA 1XNCA 3QLQA 3S6PA 1PO11 5DAXA 3LDRA 1YI9A 2TEPA 3FLRA 3WOGA 2DFCA 2A6YA 5LATA 3T3YA 4XYXA 4CDUC 1F31A 2LALA 3N9QA 5A1FA 4OMCA 3KHBA 1AX0A 2QJVA 4P9IA 3OF1A 1LHWA 1VRH3 3FHIB 3I4IA 1YQ5A 2ZEYA 1X9PA 4JTOA 3PNAA 2YFUA 3V0BB 5FZOA 1SLLA 3ASIA 3K77A 4LKDA 5J09A 4KL1A 2H0VA 4DXTA 1ENRA 1ENXA 3ON7A 5FZ7A 4C91A 1XNTA 2FQPA 3MF6A 4ZZ8A 5E16A 1SDWA 2ZGPA 1D0GA 4HFSA 5K0UA 4DRVA 5EWSA 4XFAA 3AMNA 3SH5A 4AI9A 2B9UA 5A1AA 4MG2A 4JGZB 1UY4A 4ZKTB 4YG0A 1W8OA 2EVXA 5DPNA 3WQBA 4AVVA 2D97A 4CDQA 5I0UA 3DPRA 5JSOA 1K42A 1DIWA 1Z78A 4D7YA 1QJY1 5C8WA 2VUAA 3MYXA 4L8QA 4S2DA 4D6RA 4AHZA 3LPGA 3MLKA 1MS9A 4YG6A 3N9NA 2D40A 4JDOA 2CDOA 1OI6A 1RUG1 3A22A 3W5MA 3BYWA 2R062 3R4DB 3WNPA 2BBAA 2DTWA 5F3IA 3T0BA 4BMBA 3PMEA 2F6BA 2FCVA 3OB8A 4LK6A 3K48A 1J1LA 1YQ8A 4YNIA 3VBUC 4BH9A 5HCAA 3I3MA 4JGYB 1O3QA 2J22A 5FZ4A 3INAA 1K5MC 5FJKA 4H14A 5I8YA 4G3YC 1UAIA 3OPWA 4MZUA 4YW1A 3RZZA 5L9VA 2CL2A 2RDNA 5K4LA 2CYFA 3WF3A 2WN2A 1V6KA 1JZ4A 1QJX1 2LM3A 4HT1T 3G6JB 5LBBA 3SCFA 2J1EA 4QX5A 3RJ2X 1ASJ1 5E6HA 4ZZ5A 1NCRA 5GLTA 3SEPA 2BRTA 3NNLA 5FZKA 2R7EB 4L99A 5DZEA 1ZZCA 4HBNA 3W5NA 1CN1A 1TMF2 2ZGRA 4CU9A 1O4ZA 3DKQA 3VBFC 3KCYA 1ZYBA 4EN9B 4Q0SA 3ZXFA 2RR13 3ZOIA 4CEWA 4PJYA 1AUYA 1VIWB 1NZCA 2JDUA 1MS8A 4FPOB 4PF1A 5FY7A 3WNKA 5BY5A 4XJUA 1HB2A 2VVEA 1JZ8A 1PK6C 2IXJA 4Q4W3 5HCHA 5FWJA 2BWCA 2VMHA 4LMFA 4CUAA 3ZDSA 1EAH3 3I59B 4IEYA 2ZX0A 4LOSA 2BOJA 3CL1A 3NNGA 4AHYA 1HRI1 2QQIA 1S4CA 2DBIA 2WNVA 3U10A 1S0IA 2D3PA 2MHFA 1UOBA 3IPVA 3J8F2 1PO21 4OMDA 4W6YA 2JX9A 1JZ5A 1HQWA 1PX3A 2JE8A 2R32A 4A4AA 4QKBA 1VJ2A 2E33A 4MV2A 1SACA 1H2KA 2NQYA 3L2HA 2W91A 1PNFA 2HWB1 2JDKA 3LEMA 2YV8A 2ET7A 4XIOA 3JBG2 3LA2A 3ZYJB 2ZPXA 4OI1A 1UZVA 2W1QA 5C4WA 5E88A 3USUA 2A6ZA 5JR2A 2CAVA 1AYN1 2P1BA 4S2HA 3AKTA 3UKNA 4QM9A 5IK8A 4QQLA 1W6OA 1V6IA 4Q0UA 3R4UA 4D3WA 3O1RA 3KZ4C 4XF9A 5C9AB 3MO4A 2A6VA 5KXDA 2BDRA 4PI2A 2H6CA 2YC4A 2YB7A 2W94A 2WQZC 4E4ZA 3LIHA 2NMOA 4IESA 1IPJA 4EN6B 3KWVA 3V64A 4Q4X3 4DB5A 1AL0G 1PZ9A 3AP6A 2WAOA 4PDWB 4M4PA 1PO13 5L19A 1VBD1 5C33A 5JUVA 1JHNA 1WKYA 3FUQA 4HN0A 1QJU2 2X8KA 3HD8B 2JG8B 3DGTA 1RUI1 1V00A 1A8DA 2R16A 1W8WA 2C5DA 2HKXA 2RJKA 3VBOA 4AHWA 3J7HA 4EROA 2GNDA 4XURA 4OHVA 2NM1A 3ZMNA 1OKOA 2VW2A 2ILMA 3K4DA 2FBEA 3ZXAC 3O1UA 3CZJA 1MQTB 2B45X 4XABA 5EFUA 3SC7X 1YXWA 4YYOA 3TEXA 1XNKA 3O1VA 4XDQA 3ZXGA 2VMDA 4YGDA 5F1RA 2PAMA 2YZ4A 4Q4X2 5FO7B 1O7FA 2JG9A 4Q29A 5CG9A 1POV0 2ZS6B 2AEYA 4RQPC 3MW3A 4MGQA 3VZOA 1GV9A 1WA4A 1UY0A 3POSA 1CAXB 2VCBA 4OQ9A 4AVAA 4CP0A 1QJY3 5J48A 3WINE 5DG1A 3L9JT 4X8PA 3S5QA 1RUF1 1Y3TA 2WIIB 5I0RA 4K9SA 1XSRA 2ZZJA 3VDBA 3K3NA 1REEA 2YBPA 1RUG3 1UMZA 2PMWB 1XU1A 1C57A 1IG0A 3I3BA 4DEQA 2ZX1A 1H2MA 4UYBA 1UU5A 4A3XA 4B4PA 1LULA 2R49A 2YROA 3T0DA 2XBO2 3J9SA 4IE0A 4IUGA 4SBVA 3DCQA 4UFKA 4YVSA 4KQ7A 3FLPA 4PI0A 1IKPA 3BTZA 1O8PA 3D6EA 2Z69A 1S1AA 4XZUG 4KWKA 4BB3A 4Y5SA 2GN3A 1PGL1 4YGCA 1QJX3 2WYFA 4Q4V2 5LZ6A 4IEWA 1ASJ3 1LEDA 4HZFA 4PLMA 4CPBD 2EXHA 5A70A 1ONAA 1OOPA 1EY2A 1LHNA 1VBE2 5JXJA 2PHXA 3R0RA 5BNNB 1UX7A 4FP2A 3VZKA 5F6KA 3TEWA 1KFUL 2Q0AA 5FPZA 2V72A 2WLPA 4IV3A 2HWE2 4W65A 3ZIXA 1ODMA 3JD72 2JDMA 3BU0A 1Q8PA 1ZZ8A 4B29A 1XU2A 1U5XA 1GR3A 2D44A 2XWBB 3NJZA 2VQUA 3W21A 5J98B 5G04L 5EHDA 1U12A 5FXXA 1RUE2 2MEV1 5FZAA 4KI5M 1HRI3 1OLMA 5ERLA 5FYBA 5AFEA 4FTEA 4H7MA 1ASJ2 1AHSA 3CBNA 4YM2A 1PO23 4UXAA 3VBSB 2DUOA 3LPFA 1CJPA 4AEJA 4BIOA 2ZKNA 3QD6A 3H3ZA 5LA2A 5JDBA 4AGVA 4UW3A 4PT6A 2VNOA 4IXLA 2HWB3 4FFFA 5A7WB 3U75A 3RDIA 1XB9A 4CYDA 1SBDA 3W9AA 2XONA 1M06G 2B9VA 4OHYA 2VQAA 1RITA 3POFA 4CCKA 3BB6A 4Q5OA 1AYN3 4LBMA 3RYKA 1BHGA 4QKDA 3H8UA 5D8AB 1G9BA 2WFPA 2ZEWA 4LHNA 4FXKB 4K20A 1BCXA 2VW0A 4HMZA 3LEGA 4A44A 1S2BA 3KD4A 4WM8B 2ZHLA 1H9WA 5GKAC 1IS4A 1CESA 1PO22 5ACA1 1D2QA 2JD9A 4AI0A 4F3JA 1ZRIA 3OCPA 4DY5A 5FUPA 2JE9A 2QFEA 1YFXA 1FT9A 1G7YA 2P5BA 4YVWA 4JZRA 3U78A 3D3AA 1VBD3 3H8XA 1X33A 2X5IA 4UAPA 3EXUA 1NA1C 2R0FA 4M3CF 4RHV2 4XFCA 2RJLA 1RUI3 1NOVA 1GICA 1S0BA 1UMHA 3AJYA 3U07A 4YZ5A 1FOD1 1U5IA 4BPZA 1ULEA 2FDKA 1IS6A 2A7AA 1ULCA 4I0BA 4LIUA 3I59A 2UY8A 3WT3A 3MW2A 3IKWA 4LE3A 4A2UA 1RINA 2XHKA 4AFCA 1XJAA 4LTAA 4NPRA 5CKNA 3TEZA 2AGSA 3WDXA 3MLLA 5BNPC 5KXBA 4C8DA 4PQQA 4XETA 3KT1A 3T1MA 3JCIA 1GSLA 4E27A 2VH9A 3IBMA 3WHTA 3IB3A 4K6BA 1WW4A 2QZ3A 3PURA 3JB4C 4M3CB 4YW7A 3VD5A 1JZ7A 1WBLA 5DDJ2 1RUF3 2RS11 1ODNA 3TN92 3R6SA 3LFIA 5C8CC 2WZR2 3T0AA 5HXVA 1BMV2 2JENA 4DO0A 5FYCA 4NRMA 1DGRA 2UYBA 4XF1A 5EPAA 2EF6A 3UKTA 1W2UA 1LOFA 1B35C 2JDAA 4Q0QA 5C9AA 3PUAA 2Q8OA 4PBOA 2RG4A 5FZMA 4BQYA 5HBAA 2SLIA 3LAGA 2DDUA 2D93A 5CU1A 3CJIC 3NW4A 2UWAA 2WSVA 3ENRA 4O9EA 4YW3A 5FYTA 4GIQA 1EUTA 1LOCA 1W2OA 3ILFA 1W6NB 3WDTA 1EV12 2QQPA 1XNDA 2RV9A 3PL0A 3PUQA 4PDWA 5I8SA 1UNBA 5FDBA 4OHXA 1AL21 4GH4A 4QGMA 4XAEA 3WNXA 1C5HA 1RUF2 1WA6X 4N9HA 4Q4Y2 2ZAAA 4CVUA 2FZ2A 1UCXA 5DAVA 1RMU2 4CCLA 3F2ZA 2OPKA 3FWEA 3AP9A 3LGRA 1UYPA 4LBQD 2ZBJA 4N7IA 2OIIA 4HL0A 3BVCA 3CNAA 4IEVA 5IVBA 1PVC2 1UZZA 5C3PA 5K0UC 3CIHA 3MW4A 3OD0A 5GZEA 4QPIB 2YC0A 3AKPA 3OUHA 5K8SA 1TME2 2O14A 3PDQA 1DBNA 4LBQB 3GBGA 4UWDA 3OBTA 2AR6A 4EWDA 2UU8A 4IE6A 4NVPA 4XFBA 5ANQA 2YHJA 2W92A 4I09A 3WD5A 5FLHA 5L7OB 3U0ZA 2VZTA 1RUJ3 1GNZA 1MZEA 1W8NA 1ZZ7A 2XOMA 3IIIA 2MEV3 4DFSA 4HKOA 1DU3D 1NE6A 4QXHA 4QPGB 1CAXA 4CUBA 1ULOA 3OOXA 1ZBA1 3SNMA 5KBFA 1IQDC 2LROA 1H8TA 2B8MA 2WS91 1D4M1 4NHLA 4D94A 5JOXA 1SCSA 5A7OA 2GAUA 5G05L 4ET7A 1WLDA 2FCTA 2EXJA 2GMMA 2Y6KA 3MICA 4NUBA 3ZPOA 3VKOA 4FPJA 4CP2A 3I3EA 2K9ZA 3OGRA 2BU9A 4QKNA 3SHRA 3C7FA 1QDOA 1TG7A 4NN0A 1JYXA 1VALA 3LOIA 5EJZB 5LEKA 1RUJ2 2VZQA 1NCRC 4XW3A 4E9KA 2VULA 1DP0A 4RFT0 1W6PA 2W87A 4QU2A 2V4AA 3MDPA 4JX0A 4QDQA 4Y33A 1VBA2 3VL9A 5ACA3 4CEWC 1WUVA 1GWMA 3E1F1 4INDA 2X10A 4FP3A 1R092 3RMXA 4AG4A 1W3VA 5LW9A 1K3IA 4FO9A 3W58A 3HNYM 2C26A 5SV5A 4CA9A 4S2GA 4I0WB 2PLV1 5BNNA 2XVKA 2C9AA 2GC2A 1C1FA 2VL4A 2AUYA 4UF0B 5CFDB 3SMHA 1ND3B 5JXHA 4CPBA 3MIFA 3H42B 2KXLA 4KWUA 1SLAA 3N9MA 3LZZA 2WNVC 1FOD3 4I30A 4CXWA 2CAUA 1V6OA 3GZAA 5F3GA 3T4HB 4NIIA 2P3KA 1BK1A 2WFF2 2W1SA 3ACIA 3CF6E 4WM7B 1S0CA 4C0BA 4TTGA 4XJ9A 5ACA2 2Y6FA 1UZ0A 4LO5B 1UY3A 1UOGA 1GANA 4HG6B 5C4WC 1HN1A 5KHKA 1RUNA 1TNRA 2D3SA 3OGVA 2VOXA 3ZYGA 2YFZA 3MPPG 2P3IA 2UY9A 1W6MB 1V6LA 3K46A 3B93A 3BN6A 2WWUA 4LEJA 3QCWA 2GNMA 2RS13 3C2UA 4YG3A 4X6RB 3AC0A 4TN7A 5CKQA 3E6CC 1JW6A 4P14A 4AEDA 1YJLA 2EAKA 2EIDA 5FZ9A 3I2FA 3HBZA 2D5FA 2RJ2A 4CDXB 2NPIA 4ZXEA 4AEKA 1W06A 4XCBA 1CZTA 1OSGA 3FUOA 3K2OA 4A41A 1PMIA 2E6VA 5IAVA 3VD7A 2CY6A 1O3RA 4YZ3A 4IV1A 2VAUA 2G9FA 5FYYA 5FUNA 3JZVA 5L9RA 4XMAA 1LHUA 3O1PA 1ZREA 1KEXA 3KV9A 1ND2A 3Q8FA 1UZYA 3CO2A 1QNYA 1DQ5A 3JUUA 3VBOC 3E5XA 3PUSA 1QY4A 3WP3A 2PELA 1AL23 4LXLA 4YFWA 1YC61 4IEPA 3NV2A 5IK7A 3DECA 3MUZ1 4D0QA 3GZEA 4AYUA 2A71A 4EQVA 1UYYA 1XNBA 5F2SA 1KRIA 3S5AA 1T6GC 3CDZB 3BOPA 1LU1A 5FYUA 1UYZA 4GMP0 3KV4A 3K51A 4J25A 2A3WA 1V6NA 3LIGA 2JG9C 3ACFA 3O0WA 4KG8A 5JZGC 4MHRA 2PHUA 4CZSA 2I74A 1J84A 4EWAA 2ZZQA 3IZOA 2IVIB 4L2NA 1UYXA 5IJRA 3HVDA 5JR7B 1WGPA 1Y4WA 2Q5TA 3OGJA 5A7NA 3M4FA 3P6BA 5EZWA 1HB1A 3ZFGB 4IW3A 3ZYFA 4EZHA 2C6SA 3O5SA 4XTPA 1LENA 3OYWB 2KR2A 2EXIA 2A1XA 3Q8BA 5DAPA 5KC5A 4QXBA 3WF2A 2ZGUA 1A8MA 1BBT2 1ZBA3 1KGYA 1HRV1 3U4SA 1H9PA 2P3YA 1I9RA 2WS93 1D4M3 2BV4A 5JOZA 5FFOC 2YMZA 2RS32 1WCSA 1R1A2 4H55A 1UIKA 1VPHA 3LSDA 3I8TA 2DCYA 4EWEA 4RR3B 4UBHA 4LNVA 5J37A 1HDKA 3PJYA 3SH4A 2ZHMA 2BGPA 5A32B 1G9DA 2VBDA 3LD8A 3S7IA 3U4XA 2IC1A 4LA3A 5FMCA 5AFBA 2VU9A 2ZA9A 3EYPA 4GZ9A 2D6NA 2YG0A 3Q8EA 5A3WA 1AYM2 1GQPA 4OI4A 3VL8A 3K4AA 2VQ0A 1QEXA 5FZ6A 1HN0A 2P6HA 3ETQA 3M3IA 4Z92B 1X8EA 3OUJA 4N43A 4A7KA 1OOPC 1NUKA 2R072 2QNKA 4QHBA 3CEWA 3POWA 1ZZ6A 4IEXA 3ZXJA 1L3JA 2ZXQA 1JZ3A 2WR9A 4CU7A 1GP6A 1QQP1 5IK5A 1G8WA 3ZIWA 5IWFA 4GKYA 2A3XA 4LKFA 5EJ3A 3NAPA 4IV3C 3AK0A 1QOSA 4LHLA 4BQXA 2TNFA 4QQPA 4YRDA 5I93A 1LODA 4NE9A 3FJSA 2PLV3 2XVLA 2P4EA 2RVAA 2RHPA 2WT1A 1WCQA 1OUSA 5CB7A 3KGZA 4OLLA 4TSVA 1RGSA 4AVTA 3P1IA 4QX8A 3RWKX 4GB31 5LA9A 4LKSA 3S57A 5L7OA 1OT5A 2XQXA 5FYVA 3CU7A 3MZHA 4LHSA 3WW3A 4A42A 3X29B 3IAPA 3WSOA 4I3GA 3MF9A 3B69A 2E51A 4JRAA 4JHTA 5FYZA 3HN3A 2R30A 3VZJA 5C3RA 5CFCB 4MHUA 3BI3A 1UF2C 3LSEA 2QDRA 1YRZA 1S0JA 3KT4A 4ATEA 4OZXA 3HMYA 4QX1A 4OUMA 4D7SA 3ZN6A 4WV8A 1WLTA 4LE4A 5FY8A 4J1WA 1E5HA 4E2SA 1PGSA 3N9PA 1LNSA 3ZSMA 2HWC2 1DF0A 1X50A 3J7MA 3PIGA 5T52A 3HQUA 1J58A 4FT8A 2XB6C 4QX7A 1F5FA 3AP4A 4YFZA 2VNVA 1ULGA 3IDAA 4NR1A 5FZ0A 3WCRA 5GZGA 2XJPA 1NQJA 1HW5A 2XKOA 1AX1A 2D6LX 4RS5A 2VOTA 5FKBA 4PIZA 3ZYBA 4CP9A 3UGGA 3VDDA 4YVWC 4D8MA 3ZXDA 5I0SA 5KR7A 5AC92 2DCJA 1YJKA 1R64A 2DVBA 2X5IC 3I54A 2WNUA 5A6XA 1AX2A 1NCQA 1LGBA 3Q8CA 2RE9A 3NV3A 4OHZA 1C3HA 1N3OA 4C0HA 5C71A 2PHTA 1ST8A 1YFUA 2JKBA 5ANNA 5JAXA 1GWKA 1WD4A 1YIPA 3OBRA 2C9KA 4V1PA 3WXPA 3ZO0B 5CFDA 3APBA 2F4PA 3VD9A 1OKQA 4U2AA 2GZWA 1ZX5A 3OG2A 4FPYA 5FRAA 2EIGA 3I2GA 2CGPA 1U0AA 4AVBA 1GWLA 3QBQA 4HKLA 1NE4A 3VD4A 4CCDA 2WZEA 1LEMA 2XHNA 1FMD2 2XR4A 5JOYA 4WM7A 3ITQA 4XMIA 3BTYA 2G4IA 1SQ4A 2A6WA 3VHRA 1VBC1 1JI6A 1NYWA 4GAZA 4IEZA 1MEC2 4XDOA 4NHXA 1RHI2 2HJIA 3OGGA 1QMJA 4QMAA 3PIJA 1W0PA 2UYAA 4QU1A 4XBLA 1D0HA 3I3QA 2A6XA 3N36A 4CDWB 1IGOA 4JDNA 3VLBB 2HBUA 3OY8B 1IPSA 4PIXA 4MO3M 4E4HA 1LOFC 2WO2A 1HRV3 1AR91 2RMU1 5DQ0A 5B4NA 5C9AC 5FO9B 4LO6B 2VOWA 5I8TA 4K1ZA 2X29A 5GZCA 4WBBA 3RG0A 1L7LA 1URXA 1PGW1 1I3HA 2ARXA 2DURA 1Y9MA 2ADDA 2YYOA 4BJ0A 4FPCA 1CQ9A 1LR5A 2ENRA 1GZWB 1VB2A 2XLAA 4CDXA 3ZR6A 4ISQA 1VRH2 3AZZA 4MGIE 1T2XA 5DAQA 2VTFA 3MV11 1AR81 2YPDA 4GH4C 1J59A 2RDQA 2BNNA 4JDMA 2BP6A 2A73B 4JKLA 4QM8A 3VUOA 1O5UA 4XJZA 3WUDA 4KMQA 4GD4A 4LITA 4BM8A 4U36A 3E5QA 3AMQA 2QQKA 3FHQA 2JE7A 1QQP3 4COYA 2OA2A 2IXIA 1FATA 1MZ5A 1UXXX 2EXKA 2P34A 5FO8B 1Y7BA 2W5FA 3HBKA 1AR71 5IVEA 3T30A 1Q56A 3URFA 1F2NA 4HPKA 4H3WA 4N9IA 2D6KA 3USSA 5IW0A 1BZWA 2HWD1 3RGBA 4YZ1A 2DVDA 5K9YA 2V73A 2QKDA 3UESA 5HCBA 1O4YA 2JIJA 1ENQA 2XUEA 3PUIA 5IVYA 1RB8G 5FZHA 4GB33 3H9AA 1QJEA 1Q8QA 4HETA 2B46X 4LK7A 1UPSA 3I97A 4OFGA 4R9CA 2ZGKA 4MGYE 1PZ8A 2VMEA 1H8TC 5CEHA 1UY1A 4XJWA 4GXLA 3AP7A 1C8M1 1UZWA 4QB6A 2DCTA 1A78A 2BQPA 2RDSA 4LA2A 2E7AA 2VPVA 3T2TA 2QQMA 5T3NA 1CIWA 3ACGA 4B1LA 4FAGA 1NY71 4AW7A 3PHMA 3NNJA 2O0OA 3EJKA 1UXZA 3H7JA 2ZACA 4XF4A 3VBRA 1FPN1 2CWSA 4Q0PA 3KQ4B 2G19A 2IFRA 2JWPA 3WF0A 4BHPA 2FMDA 1ZRFA 3FL7A 4NJ4A 2ADEA 1GZCA 2R0HA 1KDKA 2RR12 1AR61 4MVTA 1DFQA 4MXWB 4F83A 3N35A 3N7JA 4KGQA 1OVSA 4FCAA 3C8XA 4Y3OA 3KLSA 4Q4W2 5FJHA 5IUQA 4YW4A 3D4KA 4ZU4A 2HWF1 1EAH2 3HQRA 5BNNC 2Q8EA 5FZIA 4PF5A 1ALYA 4KWJA 5A3OA 4CDUB 1YI7A 3WLUA 1XYOA 2D6PA 2HLEA 2VZRA 1W9FA 4LJHA 4URAA 1R081 4QHOA 3U1XA 3SITA 5FYHA 2VBBA 1NX9A 3PJQA 4XFGA 1RJ8A 1AXYA 3POIA 4JTNA 4YARA 1W2AX 4QQOA 2FCUA 4KH9A 3WNMA 4L9BA 5LWBA 3B7MA 2XMLA 1OFSA 4ZPIA 4OUEA 5IFTA 1OHFA 3AZWA 4GALA 5IVVA 1OQ1A 4M4RA 4BDVB 1HV0A 5JIUA 5M0TA 1RUH1 3FE5A 4PLOA 3FMGA 3VKLA 2XJQA 2FHRA 1VBC3 1PIV1 4NHYA 4P9JA 2PAEA 5CFCA 4WZCA 5HXMA 3M8LA 2B4KA 2VR4A 5A33B 2W52A 4CEYA 3LE0A 1C8NA 4S2FA 4AEDC 4QXCA 2AC1A 2EA7A 1O5LA 1AR93 2RMU3 2VTXA 4Q8KA 1PO12 1SBEA 1QDCA 2AENA 2BNMA 2WDBA 4XC9A 2LUWA 3GALA 4IV1C 5LBCA 4RYDA 3HJRA 2W0XA 4Y5Z0 1JH5A 3N9OA 3NV1A 3GJAA 1K5MB 3QOPA 1CAUA 5E8AA 1ND2C 4DUXA 4FVVA 5ISLA 4YGEA 1XQNA 4DXRA 1AR83 4GULA 1OPMA 2R041 1BVP1 3POBA 5FZBA 1W03A 2O1QA 3MFCA 5H9RA 2VBPA 5FY1A 4E4SA 5DAWA 1W6QA 5A80A 3ZKUA 1EPZA 4TZDA 2WO7A 2K0GA 3ME2A 1UY2A 5DUVA 4LT5A 4XHBA 3VBFB 4DXSA 2PQQA 1NQDA 1CX4A 1U5ZA 4YSFA 5GLZA 5TSWA 4NIHA 1CAVB 1EYBA 1REFA 1QJY2 1AR73 1PK6B 2DBNA 1GLHA 2VNRA 2OS2A 1UN1A 2HWD3 2JICA 4IGPA 1RUG2 5JMCA 1XPWA 2AEZA 1ACCA 1RTVA 2IXKA 4RGGA 2DV9A 4V2VA 5KC6A 3HNMA 1VR3A 3POGA 3B9IA 1J3PA 3E6DA 3V0BA 1MS4A 5FPVA 1C8M3 2VZ1A 5FY9A 3ZFFC 4YGBA 2VMFA 1TNFA 2J7MA 4BIFA 4AI2A 3DXTA 2W3JA 3IWZA 1PVXA 5FXZA 3VDAA 1RUD1 4W6WA 3THPA 1C4RA 1QJX2 2GP3A 4OHWA 4JGZA 5F3EA 2XLFA 4KG0A 1FPN3 2MNGA 3H1MA 1HLCA 4BQWA 2D6OX 4N43C 3CMGA 2JEMA 3LWCA 2VJXA 4X8NA 4AQ2A 3GXUA 1JN2P 1OLME 3HPNA 2WSUA 4LO8A 2E26A 1EP0A 4L92A 1AR63 3WHUA 2QQOA 1N47A 2PFWA 4Y20B 2OUHA 4KBZA 1VAKA 5FOBB 3PLQA 5ABJB 5EIYB 4IQPA 3PUHA 2RS51 1GOHA 3NAPC 1C8M2 4MYEA 1DQ2A 4MGKE 3ACLA 3WV6A 4DUVA 1HXS1 4JGYA 2HWF3 1V6JA 4WVZA 4AFMA 3AFKA 5I91A 1Y9GA 2N7GA 3P3NA 5FK8A 4P9WA 5F37A 2QZ2A 2WBKA 2FDHA 1JYCA 1HRI2 1UU6A 3M1HA 4AAXA 1GOFA 1R083 1TQ5A 1OQEA 5FREA 1STMA 4CUCA 4ES9A 3QACA 1KS4A 1W9SA 2I45A 1I5ZA 2WNEA 1BQPA 1ZA7A 2AZ5A 4AE2A 5JCTA 5L7OC 3ATGA 1P8JA 3E6BA 2WQ8A 5C5UA 4OQ8A 2GMPA 5FZDA 2HWB2 2C4XA 3I2KA 4K40A 3Q8AA 4GKXA 4AFDA 3WUCA 1DCSA 4XIKA 1RUH3 1AYN2 1TE1B 2SBAA 1UOFA 2WUHA 4RQPB 4AVSA 2XJSA 1NXD1 1LRHA 4XUTA 1UPIA 1PIV3 3IN9A 3LB9A 4HANA 2P2KA 1JBCA 4WVMB 1E5IA 5H9SA 3MLJA 4CCEA 3K4ZA 1H8VA 2Q8DA 2W2IA 1OFNA 1LGNA 2G1MA 1W39A 4RS5C 5IYYA 4RL7A 1GBGA 1J3RA 3FBMA 3SQOA 3VDDC 1VBD2 4QXKA 3RYRA 2X53S 4CCOA 4JVAA 2WNUC 2YC2A 3ILRA 3ZN4A 1NCQC 1RUH2 4AFBA 1RUI2 3H3UA 2XG3A 1SCRA 3ABZA 1WZXA 5LA0A 3BTAA 2RDRA 3BCWA 3H7YA 1H1AA 4R9DA 3WVJA 3KCXA 3KM5A 2R043 4QX0A 4KU7A 3O7OA 4OULA 5F5QA 3LQCA 1S0FA 4XFHA 2F17A 5F5CA 5A7PA 4Z1VA 3AL5A 5CFDC 4CDUA 1CAWB 5T5PA 1JUHA 2BTVC 2I2SA 4KNCA 5FMDA 2DU1A 1Z7S1 2ETEA 2YUEA 3M3CA 3M7AA 4NHKA 4UFHA 3WEZA 1FNYA 4XUOA 5IATA 2ZGTA 3TAYA 1PHMA 3BIEA 4NHMA 4HLTA 2BUKA 1NLRA 4K8RB 4ORFA 1D4VB 4XFFA 4WM7C 1C28A 1G9FA 2J1TA 1IOAA 5LY1A 4HSLA 3ZYHA 4M01A 4DPNA 3UGHA 3UJQA 2JG8A 3HWJA 1RUC1 1I5PA 5H9QA 2R042 1MR5A 1BEV1 2BVVA 2WRAA 3TWIA 3S7EA 1ZRCA 1OC1A 5GZDA 1YEWA 3Q9OA 2OQ6A 5KHJA 2WO3A 2FDJA 3A0NA 5EQUA 1MQTA 4TYSA 1WLCA 5A33A 3EBRA 4Y22B 1V9U1 3M70A 4CDQC 3PVBB 1IQAA 3DPRC 3GNEA 4N7UA 1OA4A 3RSJA 4AGGA 4LLOA 4CDXC 3FC0A 2VOVA 1RL3A 1PGL2 3A4UA 1RUD3 2ATFA 3RRDA 4BOWA 2KM2A 4XJAA 3ZSEA 5FP8A 5J96B 3H3LA 2PHDA 1COV1 1W3XA 2XL9A 5C7GA 2D6MA 5CIRA 3DKWA 3RNSA 3VB9A 5EXOA 3AXDA 4A7YA 2YGMA 1JMUB 4F8AA 2C1FA 5IVCA 1WBFA 5LCWL 4MGZE 1NKGA 1UQXA 5F2WA 5LB6A 4C1WA 2QQJA 5AVPA 2E32A 2RS53 1DLCA 1KQRA 1HX6A 2ZGMA 3HN1A 1SDDB 5J7MA 1HXS3 1F15A 2CTVA 5CVRA 5JPNB 2QE3A 1YQ2A 3LA7A 3HQXA 2BZDA 4QAWA 1NA1B 2MEV2 3VZLA 1XRUA 1PM7A 1EPWA 1Y43B 2BFUS 3MEPA 5T50A 1GNHA 2W08A 4NPMA 1PK6A 1AJKA 2ES3A 4XQWA 1JOBA 1PZ7A 2HYKA 3GGLA 3D0JA 1SLBA
chains in the Genus database with same CATH topology
1FNZA 1S55A 2BEOA 5A3LA 2Z79A 3V0AB 3OTFA 3H0OA 4FOQA 4HK8A 4PCRA 4GWNA 5T5OA 4PIYA 5BNPB 4DZGA 1HXS2 4XF3A 3E97A 5GALA 2BWAA 3VBRC 1QWRA 4C90A 4EN0A 2CGOA 4Y24A 2Q4SA 2GC3A 4I3PA 1D2SA 2IWGB 4ISRA 2XJUA 4LBKA 1UKRA 4Z07A 3WP5A 5C8CB 1G9CA 1YO8A 3UKVA 1WW7A 3VBSA 4QPYA 4Q26A 1B35B 1FI2A 2CNAA 3E5UA 4ATFA 4J6GA 3WW2A 4Y20A 3CJIB 3VKMA 3UV9A 1LTEA 3DV8A 1FX5A 4HVRA 5ABJA 1KJLA 2AH2A 3R4SA 4OI2A 4WVVA 1MVEA 1FOD2 5BNOB 3MIBA 2XH6A 2WC2A 5D8AA 5L36A 1OMIA 1ZRDA 1N3QA 1KJRA 3B9CA 1UIJA 1I6XA 3SH3A 4WM8A 5T55A 1F8VA 4XILA 1Z7S3 5GZFA 1BVVA 1LHVA 4TLFA 2ZX3A 4RSUA 3VBHB 1YHFA 2XJTA 2ZHKA 1SFYA 3ZFEB 4COZA 4X6QB 3J26N 3ZXEA 1QOTA 2DUQA 2JXAA 4KBBA 1LESA 2RS12 2A75A 2AREA 4FQZA 3AZVA 3OJBA 3KQRA 1YNAA 1RUC3 4CEYC 2CGNA 1BEV3 4B7KA 2E7QA 1LHOA 1X36A 1MS1A 2JD4A 3AYDA 5C6CA 5FCCA 1NLSA 1V9U3 2DWRA 1Z7S2 2H0BA 2R6QA 4XXPA 3AMHA 5LRSA 3AKSA 1DQ6A 3NV4A 5T5LA 2AYHA 2ARBA 2ZGQA 1AL22 4B3NA 4ZXKA 1QJZA 1COV3 2ZMNA 1REDA 4M3CA 3AJZA 1GFF2 4MXVA 4QGNA 3GHNA 5BUVA 1NCRB 2ZABA 2ZAHA 3FFQA 3L2YA 4YVSC 4IEOA 4N53B 3HIFA 4M3CE 5AVAA 5J3UA 2B39A 2PHLA 3J4UH 3WQ1A 4CEWB 4JRLA 3H1YA 2R061 1CAWA 4FPEA 4XQDA 3AZYA 3QH6A 1Q5OA 4EV0A 4Z82A 1W6NA 1J1TA 4Q2FA 4YZ4A 2DCKA 4P9LA 3TNQA 1ZBA2 4BZ4A 3IPVB 4TWTA 2WS92 4R52A 4AI8A 1D4M2 3D0SA 1C5IA 1G6NA 4JV4A 4M0HA 3B02A 4FPHA 3U11A 1QXJA 2ZGLA 3B00A 3LOBA 1N1SA 1IHMA 2ZHNA 3PVEA 1TMF1 1VP6A 4EN8B 3I7DA 4LUMA 4QPIA 5C4WB 2BGCA 4JGZC 3USUB 4LBQA 3FFZA 2E9QA 1BYHA 1W6OB 4COVA 4XBNA 4R9BA 3DN7A 3WY6A 1WCKA 4PLNA 3KS7A 4BWOA 5JI9A 2VMIA 2ZGOA 5LK7B 4LULA 3WDWA 5GLUA 5EYXA 1MS0A 4QPGA 3LKJA 4GA9A 4FTBA 3OPZA 3J8F1 2D98A 2PLV2 4JGYC 1WW6A 3A0KA 3ZSKA 1F9KA 2VY0A 3ZYRA 1N1TA 4CTEA 1ENSA 3WDYA 3JBG1 1WMFA 1AVBA 1JXNA 3VBOB 5E1RA 2BW8A 4XF0A 2OYZA 1GZ9A 4L11A 1DYPA 1NA1A 4DS0A 1HV1A 2A3YA 2C0ZA 2KA3A 4YM0A 1DZQA 5HI0A 4Z2WA 3IDBB 3AFGA 4FOVA 3SCHA 3M3OA 5JZGB 3DUIA 1XYPA 3LCPA 3V0AA 1FAYA 3DF0A 3AYAA 3UL2A 3POYA 5BNPA 2GC0A 1ND3A 1QJU1 3ZSLA 5FBZA 3WX5A 2XJVA 1R1ZA 4QQHA 4LHKA 2WL1A 3W59A 3D8CA 4Y1UA 1CONA 1AJOA 3KMHA 4FQ4A 2D3RA 3AB0A 1SFNA 2B7YA 4EJRA 5BNQA 5K7PA 1LCLA 1N1VA 1VAVA 2NN8A 2YPJA 4NOTA 1GKBA 1OD5A 4L97A 4NWVA 4BYYA 3CJIA 1W6MA 3BOWA 2DU0A 4H7LA 1ULDA 2YGLA 2DCZA 4HK9A 3KCCA 3MGUA 5BNOA 2XJRA 1OOPB 2DVGA 2IXLA 1RVF1 4BQ1A 5H9PA 2JJ6A 2ZGNA 1MZFA 2IFWA 2R063 3H50A 5F6LB 3WQ7A 2PYTA 3WG4A 1QH6A 2DUPA 2LTNA 2Y38A 3M2MA 4G9SB 4IV3B 2A5ZA 4PDWC 4QT6A 1DDLA 4FPGA 1OA2A 1ZZBA 2XBO1 3JB8A 4G4FA 2JG8C 4GQ7A 1H2LA 3OD4A 3VBHA 2EALA 1UKGA 1WLWA 4MLOA 4RD7A 3ZFEA 5F9TA 5KXEA 4R9AA 1HRV2 2IZWA 4E2QA 4Q4V1 1MQTC 4IEQA 4P5HA 1PNGA 1GQGA 1MZ6A 1TMF3 2XKPA 5JOWA 1VBE1 2DVFA 3WCSA 5GM0A 3NSTA 4LBLA 3AKRA 3MIGA 3UK9A 1SEFA 4QQ2A 4BA6A 2HWE1 4RA0A 2PA7A 3JD71 3ZFGA 3FX3A 4AQ6A 3OYWA 5DG2A 3VHPA 3GYDA 2A70A 1QQP2 2BBVA 2PTMA 1HQNA 3RYPA 1RUE1 3IT8A 4FSJA 2OZ6A 4JQRA 2GNBA 3J8F3 5LRRA 1XYNA 4YVWB 2DF7A 3KB5A 4N53A 1ZRRA 2X5IB 4XXAA 4FOYA 2P3JA 2R1DA 4RR3A 2JDZA 1Q8OA 5A32A 2ZOEB 3JBG3 3ES4A 3M3QA 4GB32 3VKFC 1W0OA 1O4TA 5JPMB 4DXZA 2ZKLA 2DYCA 3MIHA 1AZDA 2NMNA 1ZM1A 4XZPA 2PHWA 1SLTA 4XTMA 4YM1A 5DZGA 4Y4YA 1OLQA 3HAGA 1UD1A 3HT2A 3TYJA 1YFWA 2VVDA 2UWCA 4SLIA 1UW8A 2WA4A 1IS3A 4ONUA 5DZFA 3S30A 2VMGA 2WT2A 3WW4A 4AWDA 1U5YA 1VAMA 4O9GA 3AX4A 3WG3A 2Y0IA 3M3EA 1Y9QA 5JSPA 1QJU3 4K1YA 3TB0A 4RHV1 3FLTA 4LUKA 2YXSA 3AMMA 2OZJA 4KGGA 2WA3A 1FV2A 3VBSC 2HEYF 4IETA 3IMNA 1O91A 1OPOA 1ULFA 1N3PA 3GBWA 3SCGA 5HCFA 5JIAA 2Q30A 5FMOS 1A3KA 4YM3A 5ABJC 2FZ1A 1APNA 1LOAA 2ZMLA 2NP0A 4AFAA 3O0XA 3IDEA 3D5OA 3VV1A 2Y0OA 3LA3A 4FOWA 5SV8A 3WDVA 2YDEA 5D8AC 4GH4B 4DQAA 3TNPB 3O12A 1B09A 4AVCA 4E4DX 1H4HA 5CADA 4D7TA 3ZYIB 1YWKA 4DY3A 4WM8C 5DDJ1 2QDNA 3TN91 3VBUB 5JWPA 2QVSB 1RVF3 2WZR1 1BMV1 3THTA 1DGWA 2YY1A 1POV1 1VBC2 4AI3A 1M4WA 2GN7A 2ZCWA 1MS5A 4DRRA 4RGAA 1UU4A 4XOGA 1JYIA 4KU8A 2XBO3 1WW5A 5JZGA 4J1XA 3UJOA 1LB2A 2E63A 2BPA2 1GYKA 1OA3A 3PTYA 1EV11 1AR92 2RMU2 4XEZA 4F7ZA 2QUOA 1Q3EA 4Q4V3 3JU9A 3R05A 4HSJA 1PGW2 4Q4Y1 1H8TB 1RVF2 2TBVA 3IDCB 1DQ1A 1RMU1 4UW5A 5E89A 1VBE3 4BMEA 4GWMA 3IIAA 1CPNA 1PVC1 1AR82 1XE7A 4FPFA 1O3SA 2DFBA 1H2NA 1BJQA 1NG0A 1H0BA 4LBNA 1YYNA 2HWE3 1TME1 4PQ9A 1KS5A 3JD73 2PHRA 3WG2A 3ES1A 3KSCA 1JOJA 1W6PB 1UX6A 3BIWE 5EYYA 4MSVA 5CA6A 1E57A 5FOJB 4CDWA 1RUE3 2DTYA 1LOEA 3OY8A 4A7ZA 1AR72 3N7MA 5IK4A 4MH0E 2ZJCA 4YLZA 3G7DA 2HEVF 2HWD2 4XJ8A 1GZWA 1RC6A 3ZVXA 3RI9A 3D82A 2WJSA 4JAAA 2JECA 3TOJA 4NO4A 5FAXA 1LU2A 4XHXA 1QXPA 2BFUL 5JVVA 3SXWA 3T1LA 1ZBE1 1WMDA 3HR9A 4I02A 2WZPP 1RUJ1 5LK5A 3GF6A 5EV7A 5T5JA 2CV6A 4PBPA 1NY72 1RIRA 1VBA1 1S0EA 1YCIA 2O8QA 4META 4QPIC 1R091 1FPN2 1FV3A 1DYKA 4I01A 1G9AA 1KD7A 4C1XA 1CGPA 3S0MA 2NLRA 5J36A 1AR62 4LO4B 1V70A 4RHV3 1HIXA 4AEDB 1BKZA 4Q1RA 3RS6A 4QPGC 2GH8A 1YFYA 1A6CA 4Y1VA 5FTTC 2I07B 2O8OA 2OW4A 3JQXA 4LR4A 2HWF2 2UWBA 1Q43A 4IV1B 2WFF1 3RWNA 4AF9A 5DUUA 1H1IA 4XQ4A 4FBFA 2QCSB 2Z2SB 4FPKA 4WVWA 1R082 4JC1A 1ND2B 1S0DA 2VXRA 2BVBA 2K2SA 4YZ2A 3VN4A 2DVAA 2Y26A 4P9YA 3WQ0A 3WW1A 3ZN5A 3ELNA 2Q1MA 2ZX4A 2GNTA 4Q27A 5DDJ3 3TN93 4MXWA 1WCDJ 3EO6A 3ZX7A 2Z42A 2WZR3 2XUMA 1HQLA 2VW1A 1POV3 1IPKA 1FXZA 1PIV2 4URTA 3B01A 1VBB1 1BXHA 4K8FA 3TRSB 5FQ0B 2WKKA 1ND3C 3AKQA 3AYCA 3N4MA 3RMYA 2XWJB 4AHXA 4B4QA 2OUJA 1EV13 4M00A 4E2GA 3MIEA 2W39A 4Q4Y3 3GZUC 1ZNPA 1RMU3 4IERA 3ZFFB 5BYNA 2PHFA 3RI8A 1DQ4A 4XFIA 4HN1A 1QU0A 4EN7B 1PVC3 3B3QE 2BYVE 3IM0A 4Y26A 1KFXL 3TBDA 5A3MA 2PAKA 3RPQA 4AK3A 1TME3 1JTZX 4UW6A 4Y1XA 4Q8LA 4N43B 5BNOC 1YLLA 3ST7A 1DZRA 4OUSA 2XL7A 4ES8A 4MX3A 1LOGA 5JSRA 4BCUA 2P37A 3WP4A 1BBT1 1Z0HA 3NAPB 1SLCA 3C3VA 4WZFA 5CNAA 3VBUA 4IEUA 3KT7A 1K5MA 2RS31 4JCKA 1R1A1 2GALA 3VBHC 2VUJA 2ZX2A 2D43A 3CLPA 3GBFA 5KXCA 4ASMB 3O0VA 4P9GA 1OQDA 1CR7A 3ZFEC 2XPJA 4Y1YA 1SBFA 3PVNA 4AXOA 1UL9A 5CAZA 1X8MA 2ZTNA 5KHGA 1ZBE3 2NYYA 5BXXA 3WG1A 1AYM1 1CD3G 4N90A 1HKDA 2R1BA 3VBFA 2UURA 1LJ7A 3V65A 1RUD2 2R071 1AXZA 4FPLA 1VBA3 4FXGB 4AGRA 1R093 1CAVA 4DMIA 3VHOA 3ZN6B 3WDUA 3GHMA 1MS3A 5DUXA 3N3HA 2VOKA 3ZFGC 5FLIA 1LGCA 1QF3A 5L73A 2FMYA 1SMVA 1DHKB 1S2KA 2RM21 2CWMA 3MI8A 4P9XA 2Q1ZB 1RUOA 2RS52 2WT0A 4RS5B 1ZBE2 4DOUA 4QGLA 5JLVA 1JUIA 2D5HA 3VDDB 2XGXA 4BLIA 4COUA 5I0TA 2PN5A 2WFF3 4IL7A 4N53C 4ZU5A 2ET1A 2WNUB 2Z5WA 4RR3C 2WLQA 1NCQB 1IS5A 1WMEA 1Q8VA 1LOBA 2HEWF 5CG8A 4LBOA 4COWA 1DQ0A 2BNOA 5BPXA 2ERFA 5DXDA 2HWC1 4B8EA 1KDMA 2ZGSA 4OI0A 1FYUA 1IKQA 1NXMA 2IXCA 3N7KA 1QHDA 5GJ6A 1VBB3 1QOOA 3SISA 2VECA 5AC91 2WINB 2P17A 5KHIA 3ECQA 5GLVA 2GU9A 4W6XA 1CVNA 1RJ7A 3NVCA 5JI7A 4DNYA 2E7TA 3B5LB 1CPMA 1DGLA 1V6MA 4AEMA 5K0UB 3BODA 4QD2A 1LECA 3WZ1A 3ZSJA 2GDFA 5KWRA 4CDQB 4B7EA 4HVQA 3H1WA 2W68A 3DPRB 5CFCC 3FBYA 4AQTA 4Z8BA 3QH7A 5KHHA 3VZNA 1DG6A 1XE8A 4RQPA 4B4RA 4FAHA 1VBB2 1G86A 2ZMKA 3VHNA 3FZ3A 1FMD1 5GLWA 3GZTB 3PMSA 4ITCA 4YW2A 4WVMA 5BV6A 4XE9A 4YW5A 2GH2A 1MEC1 1RHI1 4R8HA 3MIDA 4GMP1 5FPXA 2V5YA 1KITA 1ZZ9A 4FTSA 4HKWA 1YUDA 1DLLA 4K3UA 1BBT3 5CBLA 5FLJA 2RS33 1RUC2 4CRQA 1R1A3 4HPKB 1H1MA 4Q0VA 3I2DA 1BEV2 1QGLA 1H4GA 1GQHA 3BALA 1N1YA 2WWSA 3P3PA 1DGRN 1VRH1 3AP5A 4M0NA 2OVUA 1V9U2 5FQ0A 4AQSA 3BU7A 4K21A 1AYM3 3VKNA 2EAAA 1I1EA 3MFAA 3PVOA 2V09A 3NKTA 4ZU7A 2D7FA 3NWKA 1S0GA 2R073 4MUVA 1J3QA 4LO7A 4R4XA 1COV2 4CP1A 4BLJA 2WNVB 3HT1A 3ZFFA 4K7JA 4OVEA 3VBRB 3N7LA 4BE3A 2RM23 1C1LA 1SLIA 4CDWC 1F5JA 1VB4A 3CJXA 4Q1PA 2TUNA 3NL1A 1ZVFA 1AF9A 4Y22A 3V56A 1VLNA 4R4ZA 4UW4A 1QNWA 2B42B 5B2GB 3SLIA 4HVOA 2VGDA 1MACA 4XBQA 3O14A 2VVFA 3EQEA 2RM22 3ROUA 4KWLA 5D1IA 3RQ0A 2HWC3 5IT6A 4LBJA 3AZXA 2XVGA 1QH7A 5LEJA 1XXNA 2H6BA 2RR11 3ZYPA 3BPZA 4D69A 1DGWX 4DINB 1AXKA 3B94A 3AXEA 1QXRA 1QKQA 2E53A 4XPVA 4Q4W1 3ALQA 3ZMOA 5AC93 1KXGA 2MPFA 3RJRA 3VZMA 1EAH1 3ILNA 4CEYB 3NKGA 2IXHA 3AYEA 3VGIA 2VNGA 2WQ4A 2NZ9A 3EHKA 1DZTA 1IZ3A 1ZA4A 3JQWA 4LLFA 2JG9B </