2R49A

Mutational and structural studies of e85i reveal the flexible loops of fibrobacter succinogenes 1,3-1,4-beta-d-glucanaseglucanase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
SAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSIKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title Mutational and Structural Studies of E85I Reveal the Flexible Loops on Truncated Fibrobacter succinogenes 1,3-1,4-beta-D-Glucanase
rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
total genus 59
structure length 241
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2007-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r49A00
4PF5A 1KRIA 5CNAA 3C2UA 3BODA 2YY1A 4NOTA 4XYXA 5GZEA 1V6LA 4RL7A 5T5LA 2GNBA 3MPPG 4YGBA 2DURA 3AFKA 3W58A 1S1AA 1GBGA 2YMZA 4GKXA 1DGLA 1LOBA 3OPZA 2YZ4A 4XBQA 2R1BA 5JOYA 5DUUA 5GLZA 1LOEA 1V6OA 2EXIA 3UJQA 1HQLA 3ZYRA 2DVBA 4YZ1A 5JLVA 3AZYA 4FOVA 2D6PA 2ZGRA 1QDCA 1XQNA 2ZGTA 5DZGA 3V0BB 5T5JA 2OVUA 4XZPA 3NV2A 3V64A 5GALA 2WSUA 2D6NA 4YM0A 4R9BA 1A8DA 2P3JA 2ZGUA 5F5QA 2WKKA 2YROA 2A75A 2R0FA 2UU8A 2Z42A 4Q27A 4Y26A 3WCRA 2EF6A 3LCPA 1UZYA 2A3YA 3AZZA 3OYWA 5JMCA 4XMAA 1A78A 1N1TA 3JU9A 4XJWA 4JRAA 1JHNA 3A0NA 4GWNA 3AJZA 1W6QB 3I4IA 3ZVXA 1F5FA 2PHTA 5T55A 1WUVA 2ERFA 1LEMA 1LGBA 2AREA 1LODA 3ZSMA 3WG1A 1IS5A 1Z0HA 4K21A 2ZA9A 2WJSA 3AXEA 2DUOA 4FP2A 4K1YA 5GLVA 5GM0A 2EXKA 2CWMA 1F9KA 5E89A 3LSDA 1S0DA 3PVEA 4YW3A 3WG2A 4P9WA 1IS3A 2YXSA 3B69A 5DUVA 1LULA 3USUB 4ZKTB 4Y20B 4Y22B 2DYCA 3DGTA 5FREA 3WUCA 1AX0A 4FPCA 2WT2A 3T1LA 2JKBA 4YGDA 4FPOB 1R1ZA 1DQ2A 5CBLA 1QNYA 2UURA 2ZABA 2ZACA 3LSEA 2GDFA 4YM3A 4AWDA 2C9AA 3QLQA 1TEIA 4BM8A 2VW0A 1ULDA 1AXYA 4LBOA 3POSA 4PBPA 4W65A 1GZWB 4M3CF 1SCRA 1BJQA 4ZXKA 1OKQA 2VU9A 3WDTA 1LOFA 4Z8BA 4Q1PA 2ENRA 2I2SA 1RINA 4M3CB 1KQRA 1W6OA 4YGCA 1NLSA 4FOWA 2SLIA 3SNMA 1WBFA 5T5OA 3WDUA 1SLCA 2VW1A 3N35A 1LJ7A 1O4ZA 1DQ5A 4YG0A 2GMEA 5H9PA 1S0BA 5L73A 1KJLA 1DBNA 2ZMKA 1YRZA 1V6MA 1UZZA 2VUAA 2E7QA 4GWMA 2XB6C 3GNEA 4F83A 1JW6A 1MS0A 4FVVA 5T50A 2EALA 3IM0A 5DXDA 3AJYA 4P14A 3ZYPA 2WT0A 2V5YA 3HR9A 2PHFA 2NMNA 3AP5A 3UJOA 2NM1A 4GALA 2B7YA 3AP4A 5KXCA 1YYNA 1S0IA 1UMZA 2A3WA 5GZDA 5T5PA 4TYSA 3WG3A 4BLJA 4FPLA 2LALA 2UWBA 3M3CA 3IN9A 1Q8VA 5EXOA 3VKFC 1DFQA 2WSVA 1NXD1 2ZGQA 2XG3A 2NZ9A 1ENQA 1QOSA 2EXHA 2D7FA 2AUYA 2ZGKA 4FOYA 2A6YA 2DVGA 4U2AA 1A3KA 1ULCA 1CONA 2ZGPA 3N7JA 1SFYA 2E6VA 2GMPA 2JDZA 2ZZJA 1JBCA 1N3OA 1W6NB 2YV8A 3A0KA 1GV9A 1W0OA 1DQ0A 3N36A 1ULEA 1ZA4A 1LOGA 2JE9A 4XJZA 2EXJA 1KDKA 2D43A 4Y1YA 3N3HA 5DZEA 1I3HA 1KITA 1S0CA 2ZGMA 4I30A 4AGVA 2A70A 3B3QE 4K20A 2NP0A 1WD4A 2ZKNA 3O0WA 1BQPA 1MS9A 5CA6A 3I8TA 2OUHA 4M00A 3ZXEA 1MACA 4LBQA 4SLIA 5IT6A 1BYHA 2D3PA 2FHRA 2P2KA 5T52A 5KXBA 2ZGOA 3D6EA 3AX4A 5GJ6A 3BTAA 5DUXA 1HKDA 2WQZC 3PJQA 4LBQD 2A6WA 1MS1A 5JOZA 1BXHA 1LOFC 1AF9A 2A3XA 2WT1A 4XHBA 5LK5A 2E51A 4DPNA 2ZBJA 2P37A 3N7KA 4BOWA 1HQWA 4ATEA 1LGCA 1W6PA 1ZM1A 2D6OX 1JYCA 4XJAA 3ENRA 1GYKA 1SLTA 1X50A 2DTYA 3UK9A 3AXDA 4FQZA 5IK4A 2PHUA 3HMYA 1MS5A 2A6VA 2JE7A 1PZ7A 2AENA 2CTVA 2P3KA 4WZFA 5E88A 3ZXJA 1C1LA 2C5DA 1PZ8A 1CR7A 2FMDA 3CNAA 3NV1A 1JUIA 5T54A 4XJ9A 3O0VA 3ZSJA 5IK7A 1Q56A 2ZGSA 3DUIA 3VKOA 1SBEA 3PVNA 1LGNA 1SLBA 1AXZA 1UPSA 1QDOA 4XJUA 4BMBA 2HYKA 2AR6A 4ISQA 2W08A 1IKQA 1Q8PA 1JXNA 2ZHKA 3BOPA 4WV8A 4R9AA 2ZGNA 3TAYA 1FNZA 1N1VA 4C1XA 3SH5A 4FPFA 2SBAA 5KXDA 4JCKA 2EAKA 4Q1RA 5H9RA 1D2SA 2VY0A 3M3QA 3N7LA 1D0HA 5BYNA 4KBBA 2GALA 3GALA 3ILNA 4PBOA 4YW4A 1CVNA 4ATFA 3V0AB 1ONAA 4R9CA 3D5OA 2CY6A 2NMOA 2WNEA 2A6XA 2D3RA 2ZHLA 2DUPA 5IK5A 2A6ZA 4R9DA 4Y1VA 1ENSA 1S0GA 3NWKA 3OJBA 1WLCA 5EWSA 3V0BA 1LOCA 1WLDA 1WBLA 5HCFA 4WVWA 1GSLA 2GMMA 1MR5A 4AVVA 1CN1A 1FV3A 5F9TA 2W68A 4OZXA 1Y7BA 1LENA 2CYFA 2DUQA 3FFZA 4GKYA 4K1ZA 3JUUA 1MZ5A 2DV9A 4LBJA 4UW4A 1W6MB 1SBDA 2PELA 3ZSLA 1SCSA 1Z78A 1WW6A 2JJ6A 4LBMA 1WW5A 2WLQA 3BIWE 2E7TA 4XBLA 2PHXA 3WUDA 1RITA 1W6QA 3IMNA 2KM2A 4XE9A 1KJRA 2GNDA 1S0JA 3SITA 4YM1A 1DQ1A 4C1WA 3VUOA 5GZFA 3V65A 2V73A 1G86A 1Q8OA 4XXPA 4BLIA 1CPNA 3IPVB 4HL0A 1HDKA 4ASMB 4ITCA 1U0AA 1CQ9A 1LTEA 3VV1A 1FYUA 3USUA 4Y20A 4Y22A 4AVTA 3WDWA 4DQAA 4AGRA 3OY8B 3WG4A 4WVVA 1SLAA 1UX6A 1LOAA 3RG0A 2G4IA 4YZ4A 1SACA 3AP6A 1MVQA 1I1EA 1AVBA 3ILFA 5H9SA 1GZCA 1OFSA 1QF3A 1IS4A 1GICA 1AZDA 1UN1A 3WHUA 4XTPA 1N47A 4XXAA 1GZWA 1MZ6A 1QGLA 1YIFA 3Q9OA 2BQPA 4AGGA 1F31A 1AXKA 3QCWA 3KQRA 4M3CA 1LEDA 3POWA 3O5SA 1AX2A 3ILRA 2R49A 4FPKA 3VKMA 3T1MA 1BKZA 1B09A 1WW7A 5IK8A 2ZGLA 3WZ1A 1LHUA 3SH3A 4BQ1A 5JVVA 3RMYA 2E53A 3H0OA 2DTWA 1S0EA 1C1FA 4GA9A 1UL9A 3MEPA 4YLZA 3UL2A 2JECA 1CPMA 5GLTA 1GNHA 3MW4A 1GNZA 4XJ8A 4XILA 4DRRA 4M01A 4YW2A 1JN2P 1G9AA 4FPHA 1QMJA 4XIOA 3OGGA 4Y24A 2UWAA 4YZ5A 3FUOA 2H0BA 2A7AA 2CL2A 1CIWA 3ZXFA 3M1HA 1YXWA 3WNXA 2ZHNA 4UW6A 1URXA 2R0HA 3AZXA 3VKLA 4P9XA 3OYWB 3TB0A 5HCAA 3U4XA 3POYA 1C57A 1H30A 1YI7A 4XOGA 3RSJA 2GN7A 4YZ2A 5H9QA 4FP3A 5HCBA 1N3PA 4FPGA 4IQPA 1GLHA 4XDQA 3AZVA 5DUWA 5AVAA 3WDVA 3OBTA 1EPWA 2PHRA 1G9BA 1QU0A 1LU2A 2AYHA 2DVDA 3WCSA 5JDBA 1RIRA 4XTMA 4CZSA 1DIWA 3PMEA 2W52A 1J1TA 3RRDA 3WOGA 1G9FA 1W6NA 4XHXA 3AYCA 3WHTA 4PCRA 2R16A 4YW1A 3WLUA 1APNA 2DU1A 3FLRA 1O4YA 1S0FA 4Y1ZA 2ARBA 2DVAA 4FPEA 3OBRA 4DRVA 2EIGA 2ZMNA 3ASIA 3NV3A 5EYXA 3VKNA 3WV6A 3T2TA 1AJKA 1DHKB 2AH2A 2CNAA 1FV2A 2TEPA 2DVFA 3R4SA 1HLCA 1MS3A 1V6NA 4BMEA 5CB7A 1VLNA 3APBA 4YFZA 1V00A 1VALA 1N1YA 1WLWA 4YW5A 2ES3A 5GLUA 1C4RA 2RHPA 3M3EA 3W59A 3NV4A 1MVEA 4ISRA 4BPZA 4AVSA 5JOXA 2VH9A 1VAVA 1YO8A 4PQ9A 1W6OB 3A4UA 1BZWA 5KXEA 1UKGA 1FAYA 1SLIA 4Q8KA 2ARXA 1QOTA 3AP7A 1G9CA 1G7YA 4UW5A 4JC1A 1MS8A 1OQ1A 5IUQA 2OW4A 1V6JA 3WDXA 3AZWA 4YZ3A 2ZMLA 4L8QA 5DZFA 2D6KA 1ENRA 1CJPA 1LHVA 1V6KA 1WD3A 3HN1A 1FX5A 3MW2A 1VIWB 2P34A 1LU1A 4P9YA 4TZDA 2D6MA 3M3OA 3WVJA 4XBNA 4FOQA 4XMIA 1Q8QA 2UWCA 4FQ4A 3RS6A 4YGEA 2OUJA 2R1DA 5GLWA 4Q8LA 1AJOA 1LESA 1FNYA 3INAA 2ZHMA 4RA0A 3AK0A 4DFSA 1GZ9A 3KM5A 4CTEA 1GKBA 4DS0A 2NN8A 3ZXKA 3M2MA 3V0AA 1UAIA 1DYPA 4Q2FA 5DG1A 3AYEA 2PHWA 3O12A 2D6LX 1DYKA 3ATGA 3ZSKA 4D69A 1H9PA 1MS4A 1WCSA 3B9CA 2LTNA 3AYAA 2ZAAA 4MYEA 1N1SA 1IS6A 1H9WA 1LCLA 3L2YA 4YM2A 1WW4A 5FRAA 2DU0A 5JOWA 2AGSA 2VXRA 2CWSA 4YG3A 3ZXLA 3O0XA 3D4KA 2D3SA 4XIKA 2NYYA 1V6IA 5GZGA 1PZ9A 1N3QA 1QOOA 4H55A 3B01A 1DQ4A 1W6MA 1G9DA 4LBLA 2Q5TA 1LHWA 4LBQB 3N7MA 1KDMA 2GNTA 3FLPA 2GNMA 4NO4A 1QKQA 3FLTA 1SLLA 5DG2A 4Y1UA 2JD4A 1DQ6A 2DWRA 1SBFA 1ULGA 4M3CE 2W39A 2P3IA 3RQ0A 4Q26A 1IOAA 1Q8SA 2A5ZA 3ZPYA 1CESA 3PVOA 4LBKA 1LHOA 3IPVA 1W6PB 2GN3A 4U36A 3R05A 4LBNA 1GANA 4YFWA 1QNWA 3WDYA 1JOJA 1W0PA 3FUQA 3IKWA 1DZQA 1LECA 3AYDA 3B00A 1AX1A 1VAMA 5SV8A 2VW2A 5GZCA 1JYIA 3OY8A 4FPJA 4Y1XA 3SLIA 3AP9A 5CAZA 1G8WA 1IKPA 4GXLA 2A71A 4AYUA 3SH4A 1FATA 4YG6A 3R4UA 2D44A 1LHNA 1ULFA 4FPYA 5E8AA 4UW3A 3RMXA 3SISA 4CRQA 3MW3A 3FBYA 1DLLA 5EYYA 4HANA
chains in the Genus database with same CATH superfamily
3I97A 1H4HA 2IFRA 2YY1A 1XSRA 1YUDA 4IE4A 3LDKA 5GZEA 2XXZA 5T5LA 1YJKA 4MSVA 5FP9A 5L19A 1M06G 2JG8A 4KGGA 1ALYA 4LA3A 2CGPA 2KD7A 3PJYA 1UX7A 4CXXA 1LOBA 2XHKA 2CAUA 2JDYA 2VD7A 5FMOS 4HSJA 5ACA2 2FBEA 2EXIA 2XH6A 2XVKA 1HQLA 3SKJE 3UJQA 1BBT1 5JLVA 4PF1A 5FZGA 4NHYA 2VZSA 1K12A 5IWFA 4CEWC 2YC0A 3BPSA 1X82A 2ZGTA 3TEWA 5I8TA 1Y43B 3A22A 3V0BB 1L7RA 5A3LA 1SDWA 2OVUA 1J58A 3WNPA 1J3QA 1PK6B 3CJIA 3V64A 4XAEA 2WSUA 3T4VA 5A3MA 2YGLA 3RFRA 2A75A 2UU8A 3C7FA 2WO7A 3RI9A 2CGNA 2EF6A 2JDAA 5FY8A 3LCPA 3DYOA 2A3YA 3OYWA 3AZZA 4JGYB 4WZCA 4CE8A 3Q8EA 1HN1A 1UIKA 3HNYM 4CPBA 2R062 3TNPB 3WNOA 4B8EA 4GWIA 4PLOA 1NG0A 5I8SA 3M4FA 3I4IA 1O3QA 4LPLA 5FKBA 1F5FA 5FZ3A 3ZVXA 1WUVA 4DUWA 5F5IA 1LEMA 3MLKA 4OHWA 1LGBA 3GXUA 1VBD1 2ZS6B 2XJSA 3ZSMA 3LEMA 1IS5A 4K21A 3WG1A 3S6PA 3CU7A 3ZFFB 4FP2A 1OXCA 2A73B 4K1YA 5GLVA 4IUGA 2CWMA 5IVYA 3R4DB 4K3UA 3IDEA 1S0DA 1W9SA 2F4LA 2Y33A 3USUB 1QQP2 1ZZBA 2HWD2 2ZX1A 1HXS1 3ZM8A 2CDOA 4J1WA 3WUCA 4Q0VA 4FPCA 4IEUA 3J8F2 2FDGA 5C4WC 1S4CA 5J09A 3EJKA 1EV11 3O14A 4FPOB 1DQ2A 4LXLA 2ZACA 4RHV2 2BRTA 4BM8A 4KG0A 5FMCA 5C8CB 1TMF2 4M3CF 5L9RA 1BJQA 2JG8C 4BK4A 2VU9A 3LIGA 4K40A 3RI8A 3L2HA 4QDQA 1LOFA 1F4AA 4M3CB 1R092 3KS7A 1XJAA 4A3XA 2SLIA 3W9AA 3SNMA 5T5OA 3E5XA 3EHKA 5F8PA 4CU7A 2W1WA 4YG0A 2XBO1 3FWEA 4S2HA 1WWYA 1DBNA 1YRZA 1RUE1 1UZZA 1O8PA 2VUAA 4R4XA 4CEYA 1VBC1 2P3YA 2XB6C 3K3OA 3MF6A 4P9GA 4W8JA 2RR11 2WZR2 3TWIA 3ZR6A 4BQ5A 2XKOA 1GMMA 3WW2A 2FCUA 3ZN5A 5DXDA 4A7KA 3EBRA 2WT0A 4QQLA 5LA9A 3E6CC 4LT5A 4DIQA 3O1UA 3U10A 4XDPA 2NM1A 3CMGA 3WF4A 1UPIA 5KXCA 2VG9A 4HT1T 4N7UA 4UAPA 2X05A 3PUAA 1VRH1 2VQAA 5DDJ1 5GZDA 3VBOB 4E2SA 3SHRA 1FMD3 3MDPA 3VHOA 4GB32 4JV4A 2LALA 3GBWA 2JDHA 5EXOA 2WSVA 1NXD1 1NY71 2LROA 1QOSA 1OPOA 2C1FA 2WFPA 1IG0A 1S2EA 4HKWA 4QDRA 4OMDA 4R4ZA 2AUYA 2DCJA 4DMIA 2DVGA 2P1BA 3BGAA 3WP4A 1CONA 2GC2A 1PO21 4NE9A 5CU1A 1H8VA 1E5IA 3B93A 1BLZA 1RHI2 1C3HA 1W6NB 2J1VA 2YV8A 3A0KA 3TEZA 2YBKA 2B8MA 2BP6A 1LOGA 3H1YA 2EXJA 1W2TA 3DPRA 4Y1YA 1F4HA 5CKMA 1I3HA 1KITA 4AQ2A 5FWEA 1JYNA 3T2QA 3B3QE 2NP0A 3E6BA 1WD4A 4V1PA 1BQPA 1COV2 4NRQA 3I8TA 5FXZA 3MUY1 1STMA 3POGA 2PXJA 4OI0A 4I3GA 1RXGA 3K4ZA 3TN92 2HKXA 1AR83 1RL3A 3I54A 3KF3A 4I0AA 5A3PA 5J48A 5JXHA 3ZIXA 3CF6E 2O8OA 4URTA 2OX0A 3QOPA 1HKDA 1RUI2 4LHSA 4LHNA 2ZEYA 1BXHA 1LOFC 1AF9A 3POBA 2WT1A 2E51A 1DYOA 2ZBJA 4BOWA 2E63A 4I3PA 1ZRRA 4XJAA 1X50A 1NCQB 5FOJB 1VAKA 4Q4V1 4JDNA 3ZYIB 4B4QA 4CU9A 5BNNC 4CEYC 2VZQA 3VBHB 1ULPA 2K46A 1C1LA 3CKHA 3C8XA 1CR7A 2FMDA 3CNAA 3NV1A 4NRMA 2XJQA 5IK7A 2CGOA 3O1VA 4XQWA 4LIUA 2ET1A 4LEJA 4EN6B 3B5LB 3I2IA 2VBPA 2HYKA 3UKNA 3VD9A 3NNLA 1IKQA 4JHTA 5CISA 4W6WA 4WV8A 1DCSA 4AOCA 2AC1A 1JMUB 2RM23 3H3LA 1WGPA 1N1VA 2WNOA 4IEVA 1GOFA 4NHMA 4V2WA 4DXTA 5LWBA 1VBA2 2F6BA 3T2PA 5H9RA 1Q43A 1Y9QA 2VY0A 3KV5A 2IXLA 3N7LA 3DF0A 3U0ZA 1XNDA 1CVNA 4QU2A 5KHJA 4QHOA 1OURA 1ONAA 2Q8CA 2RS53 5J96B 4R9CA 2VZ3A 3WF1A 2QQKA 3CJXA 3E97A 2HLEA 3IBMA 2QBXA 1FPN2 2HWD1 2VQUA 3OJBA 4XAAA 4Y1VA 4UFKA 4X8NA 3SXWA 1WLCA 1TZOA 2H6BA 2JG9B 3J8F1 4CEWB 3ZN6B 1SEFA 2VMDA 3I59B 1X9PA 5HCFA 2GMMA 4RHV1 3HAGA 1W8ZA 4OZXA 1Y7BA 2J1RA 5FYYA 4K1ZA 4A7ZA 3BIEA 3JUUA 4LBJA 5K7PA 4FFIA 1WMDA 4UW4A 3ZSLA 4A42A 2JJ6A 1Z78A 1TMF1 4JQTA 2NLRA 2RS32 1HRV3 3KQ4B 2WLQA 2W87A 2VZPA 5EPAA 2YFUA 4ZPIA 5EV7A 3G6JB 4I01A 3U07A 2D97A 4DXRA 5T3NA 3IMNA 1WMXA 2XJVA 1AYN1 2KM2A 1CAWB 4XE9A 1KJRA 1S0JA 1X8MA 2MHFA 3E5QA 3NNFA 1K5JA 4LKFA 4QB2A 3VBRC 1W28A 4KG8A 4IEPA 4XUTA 4CCJA 3VUOA 4RGAA 4NJ4A 1Q8OA 1OKOA 4Y5SA 5IVBA 3WQBA 4A45A 2UY8A 4ASMB 4EZ4A 4CVUA 1U0AA 1MEC3 4NAOA 4AF9A 1UY4A 4CUGA 5LA1A 1LTEA 2R073 2BOIA 1CAUB 4GMP1 1FYUA 1Y3TA 3VD7A 2ADDA 3KV6A 3J7LA 4NWWA 2ARCA 2YPJA 4HZFA 3WDWA 4GIQA 4DY5A 1Y9MA 2JIJA 3WG4A 4WVVA 1SLAA 5JPMB 3BU0A 1LOAA 3RG0A 2G4IA 4Q0PA 4ZU5A 4GB31 2G1MA 2HWE1 2LS6A 4E2QA 2BYVE 4JTOA 5C4WB 4LO5B 5H9SA 1RVF1 4Y5TA 1OFSA 1QF3A 4KU8A 3VBUA 3ZFGB 4AFMA 1UXXX 1AZDA 1N47A 1RUF2 4C8DA 4D3WA 1GZWA 3Q9OA 3DV8A 5I0TA 2BQPA 4AGGA 3T09A 1F31A 4ES9A 4MG2A 1UCXA 2JD9A 2JG8B 5BV6A 2RVAA 3ILRA 4O61A 1RHI1 3P3PA 1RUE3 4HOOA 1BKZA 4N90A 3T1MA 2RE9A 2ZGLA 2WYSA 4SBVA 1JHJA 2X29A 3QH7A 4Q4W3 4QPGA 5F5CA 3RMYA 2DTWA 1OD3A 1S0EA 1ZBE3 4EE2A 3ZFEA 2ZX0A 2HBUA 1O7FA 3MEPA 4GA9A 4YLZA 5LEKA 1BCXA 2VBDA 3AM2A 5GLTA 1GNZA 3UKVA 4FPHA 4RS5C 3I3MA 3TN91 2IZWA 2CU5A 2CSGA 1R083 1OOPA 3OGGA 4IEZA 4N7IA 3ROUA 2G9ZA 4AK3A 5IFTA 4YZ5A 3CJIB 2H0BA 5IVFA 2A7AA 1NZCA 4GMP0 2WWSA 1RUI1 3WNXA 2WNUC 3VKLA 1URXA 5D8AA 3OYWB 4R52A 4XOGA 1FOD3 5FZLA 1CWPA 3T0AA 1HN0A 1PVC3 3Q8FA 4FPGA 2JENA 2ATFA 4KWKA 5HXVA 3AZVA 4AFCA 5AVAA 1O3RA 1CJDA 3OBTA 1JZ6A 1EPWA 1RXFA 1ZBA3 2Y26A 2Z4FA 3TYJA 3WCSA 4BDVB 4XACA 4O9GA 5JDBA 1WCKA 4IEWA 4ASLA 4CZSA 4Z92B 4AW7A 3LIHA 3NL1A 4XHXA 3AYCA 1Y4WA 2Q8DA 2R16A 4YW1A 1IHMA 1AYM1 3WY6A 3FX3A 4FPEA 4PDWC 5LB6A 3OBRA 4LA2A 4DRVA 2EA7A 4HG6B 4NMIA 1YFUA 3PLQA 4QX2A 2AH2A 1YIPA 4AEKA 5FZMA 3RDIA 2HWC1 2YG0A 1W8NA 1VBA1 3J7HA 5CKNA 4ZS2A 1VLNA 3APBA 3N9PA 1SG3A 1MQTC 5FXWA 2P5BA 4QMAA 1K42A 1X33A 2ES3A 4NIIA 3TOJA 3JBG2 5DPNA 5JAXA 5IW0A 2RHPA 5FMOL 5BUVA 4ZU7A 3N9NA 3RWNA 1XB9A 4AVSA 1JOPA 3MGUA 4E9KA 1D4M1 1FPN1 3PU8A 2PTMA 3KT1A 1SLIA 2VL4A 4UYBA 3DECA 2ARXA 3AP7A 4J25A 1G7YA 2ZX3A 4KGQA 5FAXA 2YPDA 5IUQA 4CEYB 2OW4A 2JKXA 3ACGA 4RN5A 2JDUA 4B7KA 4L8QA 3VBFC 2D6KA 1LHVA 1UF2C 1F15A 2WZEA 1V6KA 1WD3A 4AVBA 4W6YA 3ABZA 4KQ7A 1VIWB 1OA2A 2P34A 4I02A 4AVAA 5B4NA 5F39A 3ON7A 3M3OA 2PYTA 4FOQA 5D8AC 1Q8QA 5L7OA 3MYXA 3UV9A 1H0BA 2WO3A 3MIGA 2R1DA 3H8RA 1QXPA 4KWUA 3GZEA 4ZONA 2VZ1A 4Q8LA 2W2IA 4QDSA 1AJOA 1LESA 4I09A 2WO1A 4DFSA 1FMD2 4QGMA 4UI9L 3TNQA 2VJXA 2YGMA 3ZXKA 3V0AA 4IDZA 5CEHA 4I2OA 5FYIA 5DG1A 3FHQA 1DYKA 2RMU3 3RZLA 1WCSA 2VTXJ 2PAMA 2ZAAA 3CHXA 5FLIA 2FDKA 2Q8OA 5FRAA 5JOWA 2QQNA 3VHPA 3ZXDA 4IV3A 2BW8A 3DPRB 3ZXLA 4A2UA 3I3EA 4LTAA 2NYYA 4CSWA 3ZYGA 4TSVA 3OB8A 1HQNA 3B01A 4E2GA 1NLQA 2UYAA 1RUF1 2Q5TA 3VDDC 1JYWA 3GCXA 2VCMA 1KDMA 2WZ8A 2QJVA 2GNMA 4XFIA 1QKQA 4Q0UA 5DG2A 3KHCA 2JD4A 2DWRA 4QX7A 3WNMA 2CV6A 1DGWX 1SBFA 4M3CE 1AR82 2P3IA 1RUJ3 2W39A 4XEZA 3VBRB 1A34A 2Z79A 1NXMA 5CFDC 3R6SA 3QD6A 2L9LA 5FMDA 5FYTA 4IW3A 5C3PA 2GN3A 5LY1A 3ZMOA 4MGZE 2W1SA 4XUOA 3MV01 1OLME 2OS2A 1JOJA 3KV4A 1W0PA 3WDYA 2ORZA 2R043 3IKWA 1DZQA 1LECA 3AYDA 2WZPP 4D8MA 4YRDA 4CCDA 3B00A 4B4RA 4OUSA 5GZCA 4W6XA 4CP9B 1BEV3 5CAZA 1GP4A 1VBE3 4AYUA 3GCWA 4HXCA 4DEQA 4CA9A 3H1WA 1UIJA 5LATA 3RMXA 4XUQA 3SISA 3FBYA 1DLLA 3IDAA 4P9IA 2YDEA 5FYVA 2TBVA 4HANA 4PF5A 4DO0A 5CNAA 1KRIA 1M4WA 5DQ0A 4HN0A 1ND3A 4X6RB 3TEYA 4QHBA 4E4DX 5EFUA 5IVEA 3LQCA 1V6LA 4FFFA 2C26A 4JGZC 2WBKA 4TN7A 1QJFA 2RM22 2DURA 1PVXA 1S1AA 1GBGA 2YMZA 1XYPA 2YZ4A 5LRSA 5LK7B 2R1BA 2YU1A 1HRI3 5GLZA 4D0QA 5BXXA 4JQRA 4NIDA 4QB6A 1ST8A 2VCAA 3AZYA 5JI9A 3OG2A 1H2LA 5JIAA 4NIAA 4ZXEA 4FOVA 5FP7A 2D6PA 2IXCA 1MPXA 4A41A 5HXMA 1XQNA 2W94A 5DZGA 2Q1FA 5K0UA 4BQXA 2BTVC 1C8NA 5DAVA 2VR4A 4B3NA 1QY4A 3HNBM 1J3RA 3FE5A 4BYYA 2WC2A 1MZEA 4L97A 5GALA 5LCWL 1WKYA 3MIDA 4NVPA 3N9QA 2VTXA 2WKKA 2HWB3 2R0FA 2Z42A 2EAAA 4Y26A 3RJ2X 1RYYA 4UFLA 2JE8A 1UZYA 2GC1A 1U5XA 2JDKA 3OGSA 4D94A 5A6QA 1N1TA 1XE0A 5J98B 1HB3A 1TQ5A 1JHNA 2PMWB 3A0NA 2E32A 1GNYA 1BHGA 4CUAA 1OD5A 4AAPA 5FIXA 2ERFA 4BA6A 4IGQA 2VE1A 4CPBD 4D6RA 5FP8A 3N4MA 4KBZA 4W50A 2WJSA 4OYUA 3AXEA 4COZA 2DUOA 5B4XA 5KC5A 3VDBA 1REFA 5IAXA 4AHYA 2HBTA 4P9WA 3IIIA 4XCBA 5IAVA 4A3ZA 1LULA 5F6KA 1W8FA 1HXS2 4RQPA 5FREA 4OI1A 3RGBA 4GULA 3SMHA 1EV12 4YGDA 2BBVA 2G19A 1UMHA 1JYTA 1R1ZA 1QNYA 3H1MA 4H3WA 5A7OA 2JICA 3WP5A 4BXSV 3MZHA 2C9AA 3QLQA 3FBMA 1TEIA 5LBBA 1ZZCA 1FMD1 3VBUB 1QJX3 2VNOA 3B94A 4PBPA 4MHUA 1GZWB 4W65A 1SCRA 2BUKA 4ZXKA 5I8YA 3WDTA 2D93A 2BNNA 1QHDA 2W3JA 4QXBA 2I2SA 3O7OA 3THCA 3HWJA 1PIV3 3AKPA 1NLSA 3VDAA 2VOWA 3H8OA 3HJRA 3RZKA 1SLCA 4IE5A 1LJ7A 1DQ5A 2XBO2 1GQGA 1JU3A 1SQ4A 2GMEA 1S0BA 3MBWA 4MHRA 4QPGB 3FHIB 1KJLA 1RUE2 3PUHA 1DZRA 4JDMA 5L73A 1VBC2 4JKMA 3ZFEB 1UYPA 4BQ4A 4GWMA 4XVHA 2RR12 4DOUA 5K0UC 3WR0A 1UZWA 4Y33A 4AEJA 2H6CA 4LHKA 5A6XA 2EIEA 4FVVA 3W20A 2WS93 3IM0A 4LOTA 2ZZQA 2V5YA 1W90A 1OOPB 2BEOA 3DL3A 4IV1C 2OKXA 2XVGA 3PTRB 1YYNA 5I93A 3FHAA 4MGYE 1R082 5KHIA 1AR81 4P9JA 3VD3A 1XOYA 1IG3A 3ZMNA 3MI8A 4L99A 4META 5D8AB 1PMJX 4IEYA 3WXPA 4FPLA 4BLJA 2LUWA 2UWBA 4P9LA 4KL1A 1XU1A 1DFQA 2XGXA 3O1OA 1NY72 2BJSA 2V4VA 2ZGQA 1SPPA 4QU1A 1ENQA 2EXHA 3BOWA 1W9FA 1FOD2 2D7FA 1US2A 2C0ZA 3JD73 4YWAA 2ZGKA 1PVC2 3K4DA 4U2AA 3K48A 1E5HA 1PO22 3USSA 2Y0IA 1XPWA 5FO9B 1ZBA2 3PL0A 2Y0OA 4UWDA 1JBCA 5FY5A 4DY3A 3D8CA 4XW3A 1ND2C 1ULEA 2O0OA 4S2GA 5JZGC 2Z2SB 1CGPA 1UYXA 1KS5A 1W0NA 2ZEWA 3GHMA 3GJBA 4LUKA 4OUEA 1PO13 1YHFA 4HK9A 4MO3M 4JDOA 1GWKA 2MNGA 4LJHA 4Z82A 1MS9A 2OUHA 4A7YA 3TBDA 1YQ6A 3W5NA 1LR5A 5G04L 1BYHA 2QNKA 2W9XA 5C71A 5FYBA 2RDRA 2IXHA 4RYDA 2RM21 2ZPXA 5GJ6A 3O1TA 2AACA 1D2QA 1YEWA 2WQZC 3I3BA 3GYDA 2A6WA 3PJQA 5E1RA 1MS1A 3ECQA 5AFEA 1LRHA 1UYZA 2MEV3 5J3UA 4Q0QA 3T0DA 2D6OX 4WVZA 2RS51 2VZRA 3N9LA 1YC61 2IVIB 3AXDA 4Q4V2 1W05A 3RZHA 5K8SA 5LZ6A 4UOJA 2A6VA 3WF2A 2AENA 2CTVA 2W0XA 5E88A 3ZXJA 1HJGA 2C5DA 2GP5A 1PZ8A 3JZVA 4OHXA 4URAA 2XJPA 1W8TA 3ZKYA 3ZSJA 2ZGSA 4QPYA 2CHHA 3VKOA 1SBEA 4YVWA 1LGNA 4OVEA 1ODNA 4HVQA 1UPSA 1QDOA 4ASKA 3AKQA 4NHXA 3A7QA 4BMBA 2AR6A 3H42B 5L9VA 2XKPA 4UF0A 2ZGNA 3KGLA 3TAYA 4E4SA 5KWRA 1HRV1 1FNZA 3KB5A 4KWJA 1SFNA 1D7PM 4QPIA 3SCHA 5L7OB 3UGHA 4C1XA 3OGJA 3SCGA 2SBAA 2W91A 2VMHA 4PHZA 3SH5A 4Q1RA 2AEYA 3VGIA 5M0TA 1YFXA 1D0HA 5BYNA 4MGTA 4AL9A 1X7NA 1SMVA 3NNMA 3ILNA 4PBOA 3VDCA 5JMOA 4AI2A 4DNYA 3V0AB 1SFPA 1PMHX 3ZYBA 4QXHA 2A6XA 5C6CA 1RTVA 1YI9A 1KS4A 2YC2A 3M8LA 4IEOA 1JZ5A 1MEC1 3GDBA 3UGGA 1S0GA 3NWKA 2R071 4D6SA 4FBFA 3O1RA 2VECA 1LOCA 1WLDA 2QQUA 1L7QA 3KVBA 3POEA 4IV3B 4AVVA 2IXJA 1FV3A 5FZ0A 2HEYF 2JWPA 2W68A 3FFZA 2DUQA 1QJY3 1MZ5A 4AI3A 2PELA 2Y6GA 1SCSA 2J1AA 5A7PA 1DGRA 1IGOA 3AB0A 1I9RA 3BIWE 4G4FA 2E7TA 4FCAA 3MIHA 1C5HA 5KBFA 5E16A 3KVAA 5C9AA 1AYN2 1RITA 2UYBA 1UOGA 1EY2A 1S2BA 2Y8KA 3SITA 4XC9A 3T08A 4AQSA 3OEAA 3KZ4C 3V65A 4DUVA 1JZ8A 4PLNA 1RUJ2 3FZ3A 3PHMA 1G86A 1ZZ9A 1PNFA 4N53C 4D7TA 2DCKA 5FPBA 2LW8A 4Q4W1 1UQXA 1HDKA 4WM8C 1ZBE1 4BQ3A 4LHLA 1PGSA 4IEQA 4Q4X3 3PDQA 2DDUA 3LF7A 2VZOA 4Y22A 4Z2WA 4DQAA 4YVWC 1AR93 1R081 3DCQA 3HN3A 5GKAC 1UX6A 3PNAA 1BK0A 1IZ3A 4IXLA 2Y6KA 1RUG3 2HWE2 4YZ4A 3WEZA 1BEV2 4BCUA 1AVBA 5HBAA 1RVF2 1VBE2 2VNGA 2ZOEB 3ILFA 1GZCA 4QPIC 1GICA 3SEEA 1AUYA 3WHUA 4XTPA 4XXAA 1UO9A 1MZ6A 1ND3B 1FOD1 1QGLA 1W9YA 2DFCA 3BU7A 3K75B 1PVC1 5FZFA 1AXKA 4R8HA 3ALQA 4EN9B 1LEDA 2B9UA 4A4AA 1W2NA 1ZBA1 1AX2A 2KXLA 4FPKA 4QQHA 1UZVA 2D98A 4CCMA 3WQ1A 4BQ1A 5JVVA 5FY4A 1C1FA 4LE3A 3WW4A 4IETA 5JWPA 5FZBA 3MLJA 4XUNA 1CAXA 2TUNA 4LKEA 1CPMA 4DRRA 3MW4A 1G9AA 4XJ8A 3UYJA 5K0UB 2D5FA 3ZLIA 4HK8A 2J1UA 1NA1A 2ZX2A 4DUXA 3FUOA 2X5IC 3I3DA 4N9IA 1AL23 5FY0A 1CIWA 3ZXFA 4W4ZA 4EROA 1WCDJ 4GAZA 5DAPA 1YXWA 3U75A 4UBHA 1KD7A 4UFMA 1ZRDA 3BCWA 3AZXA 3VBRA 3HPNA 5HCAA 3FC0A 2HWB2 1JOBA 5C9AC 3POYA 1C57A 1H6XA 1ZZ7A 3ZKUA 4NPLA 5FZIA 2QKDA 5FJHA 4XDQA 5DUWA 4CYDA 2Y6JA 4WBBA 2PHRA 2DVDA 1LU2A 2AYHA 3RPQA 3UGFA 1SZBA 4MV2A 2X10A 4XTMA 3PUQA 3JQXA 5BNQA 1JTZX 1RUH3 4QQOA 3WOGA 1J1TA 4BB3A 5A1AA 5EIYB 2ZKLA 4CP9A 5DAQA 3WHTA 3W5MA 2C9KA 1RUOA 4QT6A 3LZZA 1AYM2 2DU1A 4FAGA 3HT2A 1Q5OA 1XSQA 1VR3A 1O4YA 1S0FA 3NQHA 3VKNA 2BVBA 4AVCA 2VMFA 4RQPB 5AFBA 3T2TA 5FZ9A 2JDNA 1AJKA 2TEPA 2HWC2 2DVFA 3H8UA 1QJU3 3R4SA 4GWJA 4F7ZA 5I0SA 1MS3A 5FK7A 4WM7A 1PMIA 1O3SA 3HOBA 4XQ4A 1XU2A 2TNFA 1V00A 5BNPA 1NT0A 3WNLA 3NO8A 3ACFA 4F3JA 1U5YA 4MUVA 4QWNA 3W59A 4AEDC 1QJX2 4ISRA 4QGNA 3P3NA 2HYXA 3Q8BA 1D4M2 4FXGB 2E26A 2YYOA 2VZVA 4HSLA 1UKGA 2RMU1 4QKFA 4OULA 1OMIA 2Q0AA 4HFSA 5A1LA 4RS5A 2IUWA 1QOTA 4HBNA 3HQXA 1GWLA 4UW5A 4HVRA 4JC1A 1PX3A 4GZ9A 4M0NA 4N8MA 5FQ0A 3S5AA 3K3NA 1LAJA 4YZ3A 1IPSA 2VGDA 3BPZA 4XDOA 1NA1C 5JIUA 3HN1A 2WNUA 1YFYA 2B5HA 2NPIA 1LU1A 4P5YA 2D6MA 4AI0A 2B45X 3D3AA 3WVJA 4GH4A 4EWDA 3HQUA 3FJSA 1QXJA 2UWCA 1CAVA 5FZ4A 3CL1A 3RS6A 5F3EA 1UNBA 2AZ5A 2OUJA 4QX0A 5GLWA 1OLQA 2XLFA 1RUJ1 3INAA 1EP0A 1GZ9A 4K8RB 3ES1A 1SPPB 1GKBA 4HKLA 4J1XA 5FK8A 1TG7A 3M2MA 1UAIA 3CEWA 3T2OA 3ZR5A 2E9QA 3C7OA 3O12A 5AC91 3ATGA 4OZOA 2RV9A 2WR9A 1H9PA 1MS4A 3NJXA 5A80A 4K9SA 4PDWA 2LTNA 4MYEA 1H4GA 4C90A 2R041 2XVLA 1WW4A 2IWGB 3I3QA 2G9FA 2CWSA 4HONA 3ACIA 4D7YA 2WFF3 2D3SA 1BEV1 5EQUA 3S5QA 1PGW1 1V6IA 3VHRA 1VBE1 1QOOA 5JXJA 2JB8A 4YW7A 3X29B 1MQTA 1KEXA 3AL6A 4QXKA 1G9DA 4OQ8A 2XJRA 5D21A 5FZ7A 1PO12 2JIGA 4WM7C 3NRUA 4G3YC 5B2GB 2BGCA 4LO4B 3DKWA 1SLLA 2B39A 4DB5A 1O3TA 5BNPC 3H9AA 5J37A 5ANNA 1UW8A 3OTFA 3WQ7A 3U14A 4CDWC 3KD4A 1Q8SA 1CESA 2WUHA 4C0BA 2KA3A 4HPKA 3MV11 3PUIA 1HRI1 3LFIA 5IATA 4H7LA 1ULOA 1RGSA 4LBNA 2VMCA 3THTA 4LITA 2RJ2A 4N53B 3I7DA 3VBFA 4EZHA 1QNWA 3GZUC 3K77A 2BNMA 2FQPA 3N9OA 5DN2A 2VW2A 2V09A 1JYXA 3OY8A 4FPJA 1G8WA 1IKPA 5CG8A 2A71A 3K51A 4LUMA 1Y9GA 1FATA 2O1QA 4A6OA 4YVWB 3GF6A 3M70A 4YG6A 3I49A 3WF3A 1ZREA 1K5MA 2HWB1 1ULFA 1W99A 3N9MA 4FPYA 4OLLA 4CU8A 3CBNA 3KWVA 3N36A 4GH4C 4Y1UA 4UF0B 4E8CA 3C2UA 5KHKA 3D0JA 4QPIB 4NOTA 5A6YA 2GU9A 1CX1A 1HB2A 3MPPG 4FTSA 2WYFA 1C8M3 4GKXA 1DGLA 3OPZA 4BU2A 1LOEA 1E5RA 2HEWF 1UY2A 3ZYRA 3PIGA 4YZ1A 3WD5A 3WP3A 3AMPA 4YNIA 5FPVA 5APAA 1ZRIA 2EIDA 1QDCA 2YFZA 1UU5A 4YVSA 3WW1A 3T30A 3VDDA 5J36A 2WNVA 3J7NA 2QFEA 3MHZA 1W8HA 2BU9A 4OUMA 2QQMA 4YM0A 3VL8A 4LLFA 2RS13 4R9BA 2P3JA 5HV0A 2P17A 1QJZA 5F5QA 2N7GA 4Q27A 2R6QA 3WCRA 1ZNPA 4LKDA 3POIA 4MOAA 4Z2AA 5LW9A 1SHWB 3AMNA 1A78A 1D0GA 1GWMA 1NCRA 3OD4A 1QJY2 4XJWA 1QJX1 4NHLA 3WP6A 1NYWA 2Q8EA 5C33A 3NKTA 5CFDA 5JUVA 5C9AB 3AJZA 3LFMA 3V56A 2ZEXA 5T55A 3H3ZA 3ZPOA 3IB3A 3IDCB 1C5IA 1LODA 1PIV1 5FKCA 3HD8B 5F2WA 5ACA3 2XJUA 3A21A 1CX4A 3UETA 4LK7A 3VZJA 5EJZB 4L2NA 4LK6A 1CZSA 1F9KA 3THDA 4ORFA 3LSDA 3WG2A 2YXSA 3VZLA 1GUIA 5DUVA 4L92A 4ES8A 3SEPA 4ZKTB 4Y22B 2WS91 4IE6A 2W95A 2DYCA 5IVVA 3KMHA 2J1EA 3MIEA 2WT2A 3ZSEA 5FPLA 5FY7A 1XRUA 1K5MC 3JB4C 1ZRFA 5FLJA 2D40A 5KHHA 3NSTA 5L9BA 4OI2A 4L9BA 4KU7A 4TWTA 3LSEA 2ZABA 3DN7A 4YM3A 5CBLA 4JGZA 4AWDA 2IXKA 4AI1A 3FL7A 1ULDA 2RDQA 3LE0A 5FYHA 1RUG2 1AXYA 2R063 2W5FA 1NLRA 2XONA 3POSA 5CFCC 1DGWA 1W3XA 1ZX5A 3H3UA 2GZWA 4OHVA 4Q4Y3 4Z8BA 1YQ2A 2ENRA 3AC0A 3MFCA 3RYKA 1RINA 4MZUA 3JD71 1KQRA 4FT8A 4PQQA 1W6OA 3ME2A 4PJYA 2ORXA 3F2ZA 2FCVA 1WBFA 1JH5A 3J4UH 3WDUA 3OPTA 3N35A 2ZAHA 2IVJA 1O4ZA 1IQAA 5H9PA 3Q8CA 2ZMKA 1V6MA 2DBNA 5JCTA 1QEXA 4LULA 1CAXB 3GNEA 4YVSC 1QH7A 1X9TA 3UNPA 2EALA 2IC1A 2WNVC 2BGPA 1PO11 4P14A 2PFWA 4Y4YA 3HR9A 1VB4A 1NA1B 2PHFA 2NMNA 4PIYA 4DZGA 2XJTA 5C3OA 3I2OA 2B7YA 2VNRA 1UMZA 1FT9A 4AEMA 2A3WA 3P1IA 3BI3A 1NCRC 4TYSA 3WG3A 1AL22 1W3VA 3BYWA 1CD3G 3IN9A 4QKBA 2E7AA 5LASA 4BE3A 4M4RA 2NZ9A 2JEMA 5AC93 2MEV1 5J1XA 1ACCA 3FMGA 5FZAA 4FOYA 3VZKA 1IPKA 1B35A 3WNKA 1R093 5A3UA 1A3KA 2ZGPA 3N7JA 5EHDA 3WINE 5J7MA 2GMPA 2ZZJA 4QPWA 3KT7A 5FUPA 1GV9A 1DQ0A 4PI2A 1RB8G 1VP6A 2OZ6A 5BNOA 2JE9A 1HB1A 1ZA4A 4MXVA 1KDKA 4XFCA 2WZR3 2G9GA 3N3HA 4JX0A 1RJ8A 2WWJA 4P08A 1GQHA 2ZGMA 1DDLA 3GHNA 4AE2A 4AGVA 5FY9A 5KHGA 4HMZA 2ZKNA 3DYPA 5CA6A 2QQOA 1OLMA 3ZXEA 1MACA 4LBQA 1PK6C 4SLIA 2QTWB 5FZHA 1EAH3 5T52A 2VPVA 5KXBA 4WM7B 2EVXA 2ZGOA 4GD4A 3BTAA 4LOSA 5DUXA 4NWVA 3BUCA 1QJU2 1UMIA 4JGYC 4XUPA 4BHPA 4XF4A 5BNPB 2FDIA 5JOZA 3ES4A 1AHSA 2NQYA 1R1A3 1V9U3 2BV4A 4LR4A 4DPNA 1OC1A 1TME3 3N7KA 3BN6A 1W6PA 1ZM1A 1JYCA 2RS52 3ENRA 2J22A 1U5ZA 3U1XA 1SLTA 4P5HA 2DTYA 3UK9A 4FQZA 2XLAA 2XOMA 5IYYA 5IT6A 2J1TA 5FZCA 4S2DA 4RS5B 2FZ1A 2QQPA 5C8WA 5T54A 2OZJA 3K46A 4IV1A 4XJ9A 5FQ0B 4A44A 1Q56A 4B1MA 2FDHA 4NR1A 2BGOA 1PX4A 2WO2A 1REEA 3GM8A 3PVNA 3ETPA 4FTEA 2K2SA 2WNUB 4LNVA 1COV3 3J7MA 4XJUA 4GQ7A 3ZXAC 1JZ4A 1QJY1 3HVDA 1Q8PA 1R64A 1RMU3 3LA2A 2KR2A 4R9AA 3MLLA 1HRV2 2BWCA 4GH4B 1H6YA 1RUD3 1CAVB 1UOBA 3EB7A 5KXDA 4Q0SA 3M3QA 4P02B 3OOXA 2WQ8A 4KBBA 5C8CC 1WA6X 2GALA 3L9JT 3T0BA 1T6BX 1B35C 4ATFA 1V0AA 5ISLA 1US3A 3P5BA 1ND2A 2RJKA 1JZ2A 2J1SA 3UKTA 4RD7A 2WNEA 5JZGA 1WMEA 2D3RA 1F2NA 4BJ0A 3GBGA 5LRRA 2DUPA 5IK5A 1MEC2 4HLTA 5A7SA 1IQDC 2R072 5BNOC 1ENSA 5A7NA 4CCEA 4Q4X1 4PDWB 4E8DA 4XURA 1QWRA 4CDUA 5HV4A 3ETQA 1W04A 1NX9A 1GSLA 1AR91 2CAVA 1OT5A 5F9TA 5I91A 5CYYA 1KGYA 4NPMA 5A3WA 2ZTNA 1ZZ6A 1LENA 3P6BA 4GKYA 5CZKA 1W8WA 4IL7A 5LBFA 1RUG1 5A70A 5C70A 2LRPA 1MQTB 4HN1A 1WW6A 3LA7A 3RZMA 4O9EA 2GC3A 4RR3A 5LBEA 1OFNA 4J6GA 2PHXA 3PMSA 4XBLA 5FBZA 1W6QA 4XF3A 2QE3A 3VBOC 5LA0A 4B4PA 2BPA2 2GNDA 1S55A 5JXGA 2BFUS 4RFT0 4OFGA 2YU2A 3RJRA 4C1WA 2B9VA 1VJ2A 4FSJA 4JHZA 4HPKB 5I0UA 4XXPA 4K7JA 4Q4W2 4BLIA 1AR73 3F95A 1POV0 1YLLA 5ANQA 4NIGA 1ZBE2 2ZEZA 3I2JA 5D2AA 2O14A 1T2XA 4MGIE 4XF9A 1OUXA 2DCYA 1S2KA 3EQEA 5LA2A 3VBFB 1OF3A 1E5SA 4JKLA 5FZEA 4L0PA 4Y20A 4AVTA 3PVBB 4COUA 3OY8B 4FFHA 3BALA 1PGL2 1WZXA 1FI2A 4OHZA 1EYBA 1AL21 3AP6A 2BOJA 2IFWA 1K5MB 4PT6A 4LLOA 2VNVA 3QBQA 3WX5A 5A6ZA 1H1IA 1YIFA 3MIBA 2B46X 5FTTC 3H8XA 3CIHA 3QCWA 2GH8A 3POWA 4XZUG 3O5SA 2P6CA 1B09A 2I74A 1H1AA 1RUH1 4MADA 3SH3A 5EZWA 4PI0A 2E53A 3BB6A 3H7JA 4NAMA 3PURA 4CUCA 4BIOA 1UWWA 3UL2A 4B1LA 5FPUA 2PAKA 1UY3A 4CDUC 4INDA 5CVRA 5FXXA 4TXWA 4M01A 3VBHC 3HQRA 4XIOA 1XNTA 4YVSB 5FZOA 2QVSB 4XCAA 4Y24A 3LEGA 1REDA 5EP9A 3IT8A 3VDDB 1JZ3A 2WNVB 2FCTA 2CL2A 2Y64A 3HT1A 4IE0A 3POJA 2LM3A 1QJU1 2ZHNA 4RR3C 2RS12 1Z7S3 2DFBA 4P9XA 1AL0G 3U4XA 1W9TA 4JVAA 1NCRB 1YI7A 1W06A 2GN7A 2VQ0A 3B7MA 1N3PA 4ZHNA 5CFDB 1RUC3 3WDVA 3JXSA 3BVCA 4N53A 3RNSA 1G9BA 3MPBA 2Y6LA 4QGLA 3O1MA 5F5AA 3NNJA 4WM8A 4I0BA 1DIWA 2CDPA 2W52A 3RRDA 2J7MA 2A1XA 3CZUA 3HIFA 4QX8A 3EO6A 4PCRA 1HJFA 5F37A 3WLUA 2ZCWA 1H8TA 5FO8B 1AR63 5DAXA 1DP0A 2GSYA 5F32A 2VUCA 3K2OA 4Y1ZA 2ARBA 2ARAA 2DVAA 3VD5A 2QQLA 1YCIA 3KLSA 2EIGA 1DLCA 2JG9C 2ET7A 3ASIA 3NV3A 1QXRA 1C28A 1GOHA 1VRBA 1T6GC 2WN2A 1OHFA 2DCTA 3KF5A 2VULA 3AMQA 4BMEA 3ITQA 4JGZB 1HIXA 4QX5A 5I0DA 3OUIA 1N1YA 4QQ2A 3J26N 5F1RA 1BMV2 1NUKA 1O5LA 1MZFA 1F35A 2R7EB 1XNAA 3PTYA 1C4RA 4OI4A 3M3EA 3EYPA 4O7XA 4OMCA 3NV4A 4L11A 3RZJA 1MVEA 2Z69A 4BPZA 5JOXA 1VAVA 1UXZA 1YO8A 1W6OB 4IGOA 3A4UA 1NOVA 2OQ7A 2RMU2 2GC0A 4Q4Y2 3M3IA 4UFIA 3U78A 3NAPA 1GQPA 4CUBA 2ETEA 3WW3A 1G9CA 3BTZA 3GJAA 3GGLA 1XE8A 1YFWA 1OQ1A 4AQTA 2WN3A 2V5DA 3J9SA 5TSWA 1A8MA 2X5IA 5DZFA 2W46A 4IERA 3LOBA 4OHYA 2WFF1 5JPNB 2IXIA 4CDXA 1VBB3 1CZTA 4O65A 3MW2A 1NE6A 2OYZA 5A3TA 4PLMA 3B02A 2WA3A 4P9YA 4ZS3A 4TZDA 4XF0A 1DGRN 3UESA 3C7HA 1POV3 3R0RA 4XMIA 5C5TA 3KGZA 4FAHA 4FQ4A 2OXBA 4QX1A 4ZZ8A 4YGEA 3LAGA 4BWOA 3ZFGC 1ZRCA 1G6NA 4COYA 2PLV3 2Q30A 2JXAA 4WVMB 1NQJA 1FNYA 2WAOA 2ZHMA 3KV9A 3AK0A 3JBG3 4RA0A 5E6HA 3VN4A 4DXSA 4DS0A 2NN8A 3LEKA 1XYNA 1J59A 4Q2FA 2QUOA 4CCNA 3AL5A 3AYEA 5EJ1B 5AC92 3GZAA 1B35B 1EUUA 2D6LX 1VPHA 3GZTB 1ASJ1 4BIFA 3ZSKA 4IE7A 3B9CA 1H8TC 3PUSA 1N1SA 1IS6A 2R042 3ZIWA 1EPZA 1H9WA 1OUSA 4YM2A 5BNOB 2DU0A 4XFAA 2WQ4A 4JTNA 3HEIA 4CCOA 1OVSA 1PNGA 1PGW2 1VMHA 3D4KA 5F6LB 5I0RA 3S57A 2Y60A 4XABA 1ZYBA 1HV1A 1JI6A 2VC9A 3OBAA 4AI9A 1W6MA 4DXZA 4LBLA 1TVGA 3IWZA 4LBQB 3CJIC 2FDJA 3N7MA 2XL7A 3FLPA 2EIBA 3FLTA 2E33A 1UOFA 1IPJA 1DQ6A 1O5UA 1TNFA 2VTFA 3I2GA 4MVTA 4XFBA 4A6SA 4AEDA 4DINB 5C7GA 1EAH2 1OA4A 4MXWA 4Q26A 5HI0A 5IJRA 1C8M1 1W8UA 2XWBB 1HRI2 3PVOA 1LHOA 3IPVA 1W6PB 5FUNA 1R1A2 1V9U2 2HJIA 3NAPC 1TME2 4U36A 4CU6A 5A7QA 2YUEA 1GANA 3GBFA 3ACHA 3OPWA 4AFBA 5F7UA 3FUQA 1PGL1 2HWF3 1O91A 1WLTA 1ENXA 1J1LA 3ZOIA 1JYIA 5C3QA 2W1QA 4H14A 4IV1B 3SLIA 3IIAA 5FPAA 1ZZ8A 4CDXC 3SH4A 2Z5WA 2RS11 3BKZA 2D44A 2WL1A 1NKGA 5E8AA 4UT5A 4CRQA 3MW3A 3U4SA 4ET7A 1UU4A 2K0GA 5C3RA 3Q8AA 5CFCA 3BODA 4N9HA 4KH9A 4XYXA 1RMU2 3KCYA 3POFA 4RL7A 2GNBA 4YGBA 2XPJA 3AFKA 3W58A 3RVHA 1RUD2 3ORJA 2XUEA 2PQSA 4XBQA 5A33A 5JOYA 2XR4A 1GR3A 5DUUA 1V6OA 5ACA1 5ABJA 1ND2B 2DVBA 3IDBB 5IFPA 5JZGB 2Q1MA 1UZ0A 1U12A 4D7SA 3S7IA 2ZGRA 4UFJA 2OPWA 4MH0E 1LB2A 1XNCA 3JCIA 3C3VA 3K4AA 4AFDA 2YC4A 5T5JA 3UT0A 3ZYFA 4AHWA 1XE7A 4CDUB 2X09A 4XZPA 3NV2A 2D6NA 4YPJA 3THPA 1A8DA 2PAEA 2ZGUA 3EXUA 4MX3A 1VE0A 4EWEA 4QQPA 2YROA 5IHRA 2OA2A 4CDWA 5JMCA 4Y5Z0 1BMV1 4XMAA 2VCCA 1DZTA 3JU9A 5FXVA 4RR3B 2R061 2RDSA 4FO9A 4JRAA 5A7WA 1O6UA 2PHLA 4GWNA 4AR2A 1W6QB 4CDQA 2BVVA 2F17A 2PHTA 4LO6B 1QIQA 4Q4Y1 2BWAA 4QKDA 1PIV2 2AREA 2QCSB 1GZTA 1Z0HA 3LPGA 2BNOA 4MGQA 2ZA9A 4CCKA 5IVCA 1BBT3 2ADEA 3PIJA 5GM0A 2EXKA 4LQRA 5E89A 3ELNA 3WNNA 3PVEA 2PA7A 1AR72 4YW3A 4E27A 1IS3A 3B69A 4MLOA 5DMYA 3MFAA 1D4VB 5FJKA 2WS92 3KCCA 3EMRA 4Y20B 1QQP1 3DGTA 5A3OA 5F3IA 1W2OA 5F3CA 1AX0A 1YJLA 1EUTA 3DPRC 2W1UA 5FFOC 3E1F1 4LE4A 2JKBA 3T1LA 4COVA 2VBBA 4QX3A 3TEXA 2UURA 3WSOA 2GDFA 2P4EA 3OF1A 5D1IA 5BY5A 2VW0A 4ZU4A 4FTBA 4E4ZA 4LBOA 2OT7A 4IEXA 4ARYA 4Z1VA 1OKQA 2YHJA 4IGPA 4XFGA 4Q1PA 3AFGA 4COWA 1OPMA 1U5IA 3JD72 4Y4RA 1VBD3 4YGCA 3LKJA 4F8AA 4FOWA 1R091 5ABJC 2VW1A 3IMMA 4AFAA 3VBSA 4HKOA 3AVRA 4Q29A 5FP3A 4EN0A 4EN8B 1JZ7A 4LKSA 2E7QA 4BZ4A 4F83A 1JW6A 1CIYA 1MS0A 3U37A 2WZR1 4N43A 5T50A 1HXS3 1I5ZA 2XUMA 3AJYA 1LNSA 3ZYPA 1O59A 1W03A 2QDNA 5FZOB 1JU4A 1XC6A 2JDMA 5FYCA 4AQ6A 1A6CA 3AP5A 3UJOA 4QHZA 1EV13 4GALA 3AP4A 3RZGA 2XL9A 1S0IA 1DG6A 2V72A 1EAH1 2WLPA 3CQOA 4ONUA 5T5PA 2W92A 3URFA 5F2SA 3T3YA 1TE1B 2BFUL 2O8QA 2WWUA 1Q8VA 2VMGA 3M3CA 3VKFC 4CDQC 3QACA 5BNNA 2Q1ZB 2Y38A 4I0WB 2XG3A 4LIVA 1OA3A 1Z7S2 3C7EA 1ASJ3 2MEV2 3QH6A 1R1A1 1V9U1 4C0HA 3OUHA 4MGKE 1TME1 3I2KA 3BTYA 2A6YA 1ULCA 4WM8B 1RUC2 2YBSA 1SFYA 2E6VA 3H7YA 3KHBA 2JDZA 3MUZ1 3PU3A 2WIIB 3HBKA 1N3OA 2XBO3 5A32A 1YWKA 1W0OA 5KR7A 1VBC3 4K6BA 4XJZA 3VZNA 3WF0A 2RR13 1H8TB 2D43A 5FZ1A 5IVJA 3LDRA 4X6QB 5DZEA 5FUIA 2OQ6A 3AKTA 1S0CA 2BZDA 4Q5OA 5BPXA 4I30A 2A70A 1O8SA 4K20A 4QM8A 1AR62 3O0WA 3MICA 5FBJA 1COV1 4M00A 3WT3A 3S0MA 2OIIA 2JX9A 1RMU1 2QQVA 3I2DA 2D3PA 3OEBA 4NN0A 1VRH3 2FHRA 2P2KA 5DDJ3 4EQVA 2UY9A 1W2AX 4CP2A 4TLGA 3D6EA 3AX4A 1RUD1 3NJZA 3AMMA 4LBQD 3BTXA 3G7DA 4EYUA 1W8OA 4AHXA 3LGRA 2A3XA 5FPXA 4XHBA 4XF1A 5LK5A 5SV5A 2P37A 1HQWA 3NKGA 4C91A 4ATEA 1LGCA 3IAPA 5JXIA 4BQWA 4DEVA 1PO23 1GYKA 5A3NA 3ST7A 5IK4A 3VBSC 4RGKA 2ZJCA 2PHUA 3HMYA 1JUHA 1MS5A 2X8KA 2JE7A 2YB7A 3NAPB 1PZ7A 2P3KA 4JZRA 4WZFA 4AAXA 1H2NA 1JUIA 4N43C 4ZZ5A 1KFUL 3O0VA 2Q4SA 1DF0A 2C24A 3DUIA 2X5IB 2VXJA 3ZYJB 5HPOA 1SLBA 4CDXB 1AXZA 1CZVA 4AG4A 2J42A 4XETA 2ILMA 4ISQA 4NROA 2RJLA 2W08A 1JXNA 1WMFA 2ZHKA 4ARXA 3BOPA 1VBB2 2VMEA 2FD8A 4X8PA 3D82A 2WA4A 2PN5A 5FYMA 2R32A 3TRSB 2VVFA 4BK5A 4MGSA 2PHDA 3OBZA 1GOGA 4FPFA 3HNMA 2EAKA 3DEMA 4JCKA 2BDRA 1D2SA 3NW4A 3RWKX 4PIZA 3VBUC 4EJRA 4YARA 4KNCA 5FYSA 1I6XA 3O1PA 1QH6A 4ZY9A 3GALA 4YW4A 4BQ2A 2PLV2 1W39A 3I2HA 4IESA 5K9YA 3I2FA 2W47A 2HH9A 4BISA 3D5OA 4XQDA 4E4HA 2CY6A 2NMOA 2P6HA 1AR71 2AEZA 1H2KA 2ZHLA 4Q4V3 4G9SB 1NZIA 3DXTA 2A6ZA 2QDRA 3AKRA 4LO8A 4Q4X2 4R9DA 4EWAA 3NMBA 5EWSA 5FYUA 5DAWA 3AMHA 3V0BA 4QPGC 2FDFA 2X53S 1WBLA 1UKRA 1PK6A 1TNRA 3ZFEC 1AR92 4WVWA 3ZO0B 1MR5A 2Y6HA 1CN1A 3U11A 5KC6A 2I07B 2CYFA 2GP3A 5C3SA 2DV9A 2VMIA 4FI9A 3IZOA 3E6DA 1SBDA 1OOPC 1W6MB 4JGYA 4LORA 4RFRB 2XQRA 4LBMA 4CCCA 1WW5A 1UOJA 3O1SA 2RS31 3E5UA 3WUDA 2WINB 1K45A 4AEDB 2WRAA 3ACLA 1YQ8A 2VQTA 4YM1A 1DQ1A 4MXWB 5JR2A 5CG9A 4JAAA 1YQ5A 5L36A 3LOIA 5FV3A 5GZFA 3WQ0A 3OGVA 2E31A 1J83A 1ODMA 2V73A 4PIXA 2DF7A 1RUNA 2PQQA 2K9ZA 4KWLA 3ZFFA 1CPNA 2QZ2A 3IPVB 4HL0A 1WCUA 5FZDA 4ITCA 3ZX7A 4BH9A 1QQP3 1CQ9A 2HWD3 3VZMA 3FN9A 3SC7X 3VV1A 1RJ7A 4HETA 2XLGA 3J8F3 4NPRA 4CCLA 3USUA 2VAUA 3IAQA 4JRLA 4AGRA 3OGRA 4RHV3 4QXCA 1HW5A 1GP6A 2GH2A 2HWF2 4H2AA 1W9WA 1YQCA 2WDBA 4KI5M 5FCCA 1XYOA 2QZ3A 4BQYA 1SACA 3CZJA 1MVQA 3NVCA 4UBGA 4WVMA 1I1EA 4CXWA 1TMF3 1JODA 1IS4A 2VUJA 1UN1A 1Z7S1 1UY0A 1LKNA 5C8CA 1AYN3 3OUJA 2C4XA 2ZXQA 1JS9A 5FPZA 3KQRA 1RUC1 4M3CA 1XXNA 3DKQA 2VM9A 5AVPA 1OI6A 2R49A 3VKMA 5FWJA 1WCQA 1L3JA 2RG4A 1WW7A 1POQA 1RUH2 5A33B 5IK8A 4NIHA 4XPVA 3WZ1A 1LHUA 3SKVA 4OQ9A 3H0OA 5ABJB 1DU3D 1OSGA 3VB9A 1UL9A 3ZDVA 2JECA 3M7AA 5A1FA 4GMP3 1AR61 2VOXA 1GNHA 5ERLA 4XILA 4YW2A 1JN2P 1QMJA 2VOKA 4LMFA 4TTGA 5FR3A 3CLPA 4CP1A 2UWAA 1NQDA 2XWJB 4GB33 2HWE3 1UU6A 1KFXL 3M1HA 4K8FA 1F8VA 2ZX4A 1HX6A 3VBOA 1RVF3 5JSOA 1FXZA 2WABA 4UW6A 4AXOA 2R0HA 1E57A 4JKKA 4AHZA 4CDWB 1W2UA 3TB0A 3ZXGA 3RSJA 2RDNA 1H30A 1KXGA 5FZ8A 3C7GA 5FZKA 5H9QA 4FP3A 5HCBA 4YZ2A 5A7WB 5FDBA 5L7OC 4LO7A 4IQPA 1GLHA 4NRPA 4CDQB 1L7LA 5LY2A 1UY1A 1QU0A 4CP0A 1OQEA 1VMFA 1RHI3 5C5UA 1HV0A 1RIRA 3VLBB 3ZFFC 3RZZA 3PMEA 1XNKA 2XDVA 3KSCA 1G9FA 2F4PA 1W6NA 2VOTA 3DYMA 4QB1A 1J3PA 4B7EA 1NAEA 3LPFA 1OH3A 5JSPA 1APNA 3FFQA 3FLRA 1BBT2 1X36A 3JQWA 5CKQA 3TN93 3VD4A 5EJ3A 4QM9A 2ZMNA 5FZ6A 5EYXA 3WV6A 1GP5A 1BVVA 1VBB1 2VUDA 4RSUA 3LD8A 3MF9A 1DHKB 1H2MA 4IV3C 2CNAA 1FV2A 2BBAA 1P8JA 1RUI3 4S2FA 1HLCA 1PM4A 1POV1 1V6NA 3NNGA 3LA3A 5CB7A 1SDDB 5LBCA 4YFZA 1BVP1 4QKNA 2JDPA 1VALA 1WLWA 3H50A 4YW5A 2VVDA 3KT4A 2PLV1 1UYYA 2H0VA 5GLUA 4XFFA 3JBG1 5HCHA 1F5JA 3SQOA 2QQJA 2VH9A 4PQ9A 4B29A 1NCQA 5KXEA 1BZWA 1XBFA 3RYPA 4BXFA 1FAYA 1HB4A 1VBD2 4Q8KA 5JSRA 4UXAA 3VBHA 4OCTA 3VBSB 3A23A 3B9IA 1GU3A 2QQWA 4RGGA 1AYM3 3S7EA 4EV0A 1MS8A 5JI7A 2XQXA 4NHKA 1V6JA 5FO7B 3WDXA 3MO4A 2DBIA 3AZWA 2ZMLA 2WFF2 4QD2A 1VB2A 1ENRA 1CJPA 1OVPA 4N43B 5FYZA 2WAAA 1NE4A 1FX5A 1BK1A 2V4AA 2B42B 3ZDSA 4TLFA 2VZTA 5LEJA 2B4KA 2HWC3 1I5PA 1VBA3 2VZUA 3HBZA 4FXKB 4XBNA 1O4TA 3MIFA 3S30A 3NJYA 4AZZA 4HVOA 2XHNA 2VVEA 2C6SA 4P00B 2FZ2A 2OPKA 3VHNA 5CADA 1ND3C 5FLHA 4NUBA 5BNNB 3KM5A 4CTEA 3W21A 1PHMA 2VOVA 1X8EA 1ZA7A 2GAUA 2VO5A 4EN7B 4YSFA 1DYPA 4GJZA 1D4M3 1FPN3 3D0SA 4M0HA 2PHWA 1ASJ2 4FFGA 4YW6A 2ID4A 1ZVFA 5FP4A 4D69A 3AYAA 5A32B 1V70A 3OD0A 2JG9A 2HWF1 4CEWA 3L2YA 1LCLA 1XNBA 1RC6A 3I59A 3ZN6A 3JB8A 2AGSA 2VXRA 4YG3A 3OCPA 3O0XA 4XIKA 5GZGA 1PZ9A 1N3QA 1PM7A 1OLRA 2RS33 4H55A 1DQ4A 3VL9A 3T4HB 2I45A 1LHWA 3AVSA 4Y3OA 1K3IA 2GNTA 3SCFA 5CFCB 1OQDA 4NO4A 2Y6FA 3AKSA 2EICA 2JB4A 5JR7B 4QAWA 3VZOA 5FMBA 2BERA 3CDZB 1H1MA 1JYVA 1CAWA 1VMJA 2HEVF 1ULGA 1VRH2 5DDJ2 3RQ0A 2XMLA 4XFHA 1IOAA 1C8M2 2A5ZA 3ZYHA 3ZPYA 3LB9A 2QQIA 2YBPA 1OH4A 3LEIA 5DABA 3DXUA 3OSDA 1WA4A 4LBKA 1NCQC 1UD1A 2D5HA 2DCZA 3KCXA 3ZN4A 4CXYA 1Q3EA 3R05A 2R30A 2FMYA 1QJEA 5FY1A 4YFWA 4AI8A 4H7MA 1CAUA 2MPFA 5F3GA 3NJVA 4UFHA 5FOBB 3LDBA 4D6QA 3RYRA 1GFF2 1AX1A 1VAMA 5SV8A 1YNAA 4Y1XA 3AP9A 4YYOA 4KMQA 4GXLA 1OF4A 1J84A 1OBNA 3LWCA 3CO2A 3R4UA 2VCBA 2Y34A 4M4PA 4V2VA 1LHNA 1RUF3 5C4WA 5K4LA 4RQPC 4UW3A 5CIRA 4GJYA 5G05L 4Z07A 3ZFGA 5EYYA
chains in the Genus database with same CATH topology
1H4HA 2IFRA 2YY1A 1YUDA 5GZEA 5T5LA 1YJKA 4MSVA 5L19A 1M06G 2JG8A 4KGGA 1ALYA 4LA3A 2CGPA 3PJYA 1LOBA 2XHKA 2CAUA 5FMOS 4HSJA 5ACA2 2FBEA 2EXIA 2XH6A 2XVKA 1HQLA 3UJQA 1BBT1 5JLVA 4CEWC 2YC0A 1X82A 2ZGTA 5I8TA 1Y43B 3V0BB 5A3LA 1SDWA 2OVUA 1J58A 1J3QA 1PK6B 3CJIA 3V64A 5A3MA 2WSUA 2YGLA 2A75A 2UU8A 3RI9A 2CGNA 2EF6A 3LCPA 2A3YA 3OYWA 3AZZA 4JGYB 4WZCA 1UIKA 2R062 3TNPB 4B8EA 4PLOA 1NG0A 5I8SA 3M4FA 3I4IA 1O3QA 3ZVXA 1F5FA 1WUVA 1LEMA 3MLKA 4OHWA 1LGBA 1VBD1 2ZS6B 2XJSA 3ZSMA 3WG1A 1IS5A 4K21A 3S6PA 3CU7A 3ZFFB 4FP2A 4K1YA 2A73B 5GLVA 2CWMA 3R4DB 4K3UA 3IDEA 1S0DA 3USUB 1QQP2 1ZZBA 2HWD2 2ZX1A 1HXS1 4J1WA 3WUCA 4Q0VA 4FPCA 4IEUA 3J8F2 5C4WC 5J09A 3EJKA 1EV11 3O14A 4FPOB 1DQ2A 2ZACA 4RHV2 4BM8A 4KG0A 5C8CB 1TMF2 4M3CF 1BJQA 2JG8C 2VU9A 4K40A 3RI8A 3L2HA 1LOFA 4M3CB 1R092 3KS7A 4A3XA 2SLIA 3W9AA 3SNMA 5T5OA 3E5XA 3EHKA 4YG0A 2XBO1 3FWEA 4S2HA 1DBNA 1YRZA 1RUE1 1UZZA 4CEYA 2VUAA 4R4XA 1VBC1 3MF6A 2XB6C 4P9GA 3TWIA 2RR11 2WZR2 2XKOA 3WW2A 3ZN5A 5DXDA 4A7KA 3EBRA 2WT0A 4QQLA 3E6CC 4LT5A 3U10A 2NM1A 1UPIA 5KXCA 2VG9A 4HT1T 4N7UA 1VRH1 2VQAA 5DDJ1 5GZDA 3VBOB 4E2SA 3SHRA 1FMD3 3MDPA 3VHOA 4GB32 4JV4A 2LALA 3GBWA 5EXOA 2WSVA 1NXD1 1NY71 1QOSA 1OPOA 2C1FA 2WFPA 4R4ZA 4HKWA 2AUYA 2DCJA 4DMIA 2DVGA 3WP4A 1CONA 2GC2A 1PO21 5CU1A 1H8VA 3B93A 1RHI2 1C3HA 1W6NB 2YV8A 3A0KA 2B8MA 1LOGA 3H1YA 2EXJA 3DPRA 4Y1YA 1I3HA 1KITA 4AQ2A 3B3QE 2NP0A 3E6BA 1WD4A 4V1PA 1BQPA 1COV2 3I8TA 4OI0A 4I3GA 3TN92 2HKXA 1AR83 1RL3A 3I54A 4I0AA 5J48A 3ZIXA 3CF6E 2O8OA 4URTA 3QOPA 1HKDA 1RUI2 4LHNA 1BXHA 1LOFC 1AF9A 2WT1A 2E51A 2ZBJA 4BOWA 2E63A 4I3PA 1ZRRA 4XJAA 1X50A 1NCQB 5FOJB 1VAKA 4Q4V1 4JDNA 3ZYIB 4B4QA 4CEYC 3VBHB 1C1LA 1CR7A 2FMDA 3CNAA 3NV1A 2XJQA 5IK7A 2CGOA 4XQWA 2ET1A 4LEJA 4EN6B 3B5LB 2HYKA 3UKNA 1IKQA 4W6WA 4WV8A 2RM23 1WGPA 1N1VA 4IEVA 4NHMA 1VBA2 2F6BA 5H9RA 1Q43A 1Y9QA 2VY0A 2IXLA 3N7LA 3DF0A 3U0ZA 1XNDA 1CVNA 4QU2A 5KHJA 5J96B 1ONAA 2RS53 4R9CA 3CJXA 3E97A 3IBMA 4AFAA 1FPN2 2HWD1 3OJBA 4Y1VA 3SXWA 4X8NA 1WLCA 2H6BA 2JG9B 3J8F1 4CEWB 3ZN6B 1SEFA 3I59B 5HCFA 2GMMA 4RHV1 3HAGA 4OZXA 1Y7BA 4A7ZA 4K1ZA 3JUUA 4LBJA 5K7PA 4UW4A 1WMDA 3ZSLA 2JJ6A 1Z78A 1TMF1 2NLRA 2RS32 1HRV3 2WLQA 5EV7A 3G6JB 4I01A 3U07A 2D97A 5T3NA 3IMNA 2XJVA 1AYN1 2KM2A 1CAWB 4XE9A 1KJRA 1S0JA 1X8MA 2MHFA 3E5QA 3VBRC 4KG8A 4IEPA 3VUOA 4RGAA 1Q8OA 2UY8A 4ASMB 1U0AA 1MEC3 4AF9A 1LTEA 2R073 1CAUB 4GMP1 1FYUA 1Y3TA 4NWWA 2YPJA 4HZFA 3WDWA 4GIQA 4DY5A 3WG4A 4WVVA 1SLAA 5JPMB 1LOAA 3RG0A 2G4IA 4Q0PA 4ZU5A 4GB31 2HWE1 4E2QA 2BYVE 4JTOA 5C4WB 4LO5B 5H9SA 1RVF1 3VBUA 1OFSA 1QF3A 4KU8A 3ZFGB 4AFMA 1AZDA 1N47A 1RUF2 4D3WA 1GZWA 3Q9OA 3DV8A 5I0TA 2BQPA 4AGGA 1F31A 4ES9A 1UCXA 2JG8B 5BV6A 3ILRA 1RHI1 3P3PA 1RUE3 4N90A 1BKZA 3T1MA 2RE9A 2ZGLA 4SBVA 2X29A 3QH7A 4Q4W3 4QPGA 3RMYA 2DTWA 1S0EA 1ZBE3 3ZFEA 2ZX0A 3MEPA 1O7FA 4GA9A 4YLZA 5LEKA 1BCXA 3AM2A 5GLTA 1GNZA 3UKVA 4FPHA 4RS5C 3TN91 2IZWA 3OGGA 4IEZA 1R083 1OOPA 4N7IA 3ROUA 4AK3A 5JWPA 4YZ5A 3CJIB 2H0BA 2A7AA 1NZCA 4GMP0 2WWSA 1RUI1 3WNXA 2WNUC 3VKLA 1URXA 5D8AA 3OYWB 4R52A 4XOGA 1FOD3 1PVC3 4FPGA 2JENA 2ATFA 4KWKA 5HXVA 3AZVA 4AFCA 5AVAA 1O3RA 1CJDA 3OBTA 1EPWA 1ZBA3 2Y26A 3TYJA 3WCSA 5JDBA 4O9GA 1WCKA 4IEWA 4ASLA 4CZSA 4Z92B 4AW7A 3NL1A 4XHXA 3AYCA 2R16A 4YW1A 1IHMA 1AYM1 3WY6A 3FX3A 4FPEA 4PDWC 3OBRA 4LA2A 4DRVA 2EA7A 1YFUA 3PLQA 2AH2A 1YIPA 4AEKA 3RDIA 2HWC1 1VBA1 1VLNA 3APBA 1MQTC 4QMAA 1X33A 2ES3A 3TOJA 3JBG2 5JAXA 2RHPA 5FMOL 5BUVA 4ZU7A 3RWNA 4AVSA 3MGUA 4E9KA 1D4M1 1FPN1 2PTMA 3KT1A 1SLIA 2ARXA 3AP7A 1G7YA 2ZX3A 4KGQA 5FAXA 5IUQA 4CEYB 2OW4A 4B7KA 4L8QA 3VBFC 2D6KA 1LHVA 1UF2C 1V6KA 1WD3A 4AVBA 4W6YA 4KQ7A 1VIWB 1OA2A 2P34A 4I02A 4AVAA 3M3OA 2PYTA 4FOQA 5D8AC 1Q8QA 5L7OA 3MYXA 3UV9A 1H0BA 3MIGA 2R1DA 1QXPA 4Q8LA 1AJOA 1LESA 4I09A 1FMD2 4QGMA 3TNQA 2YGMA 3ZXKA 3V0AA 4I2OA 5DG1A 1DYKA 2RMU3 1WCSA 2PAMA 2ZAAA 5FLIA 2Q8OA 5FRAA 5JOWA 3ZXDA 3VHPA 4IV3A 2BW8A 3DPRB 3ZXLA 4A2UA 4LTAA 2NYYA 3ZYGA 4TSVA 1HQNA 3B01A 4E2GA 2UYAA 1RUF1 2Q5TA 3VDDC 1KDMA 2QJVA 2GNMA 4XFIA 1QKQA 4Q0UA 5DG2A 2JD4A 2DWRA 2CV6A 1DGWX 1SBFA 4M3CE 1AR82 2P3IA 1RUJ3 2W39A 4XEZA 3VBRB 2Z79A 1NXMA 5CFDC 3R6SA 3QD6A 2GN3A 3ZMOA 4MGZE 3WDYA 1JOJA 1W0PA 2R043 3IKWA 1DZQA 1LECA 3AYDA 2WZPP 4YRDA 3B00A 4B4RA 4OUSA 5GZCA 4W6XA 5CAZA 1BEV3 1VBE3 4AYUA 3H1WA 1UIJA 3RMXA 3SISA 3FBYA 1DLLA 4P9IA 2YDEA 2TBVA 4HANA 4PF5A 1KRIA 5CNAA 1M4WA 4HN0A 1ND3A 4X6RB 4QHBA 4E4DX 5EFUA 1V6LA 4JGZC 2RM22 2DURA 1PVXA 1S1AA 1GBGA 2YMZA 1XYPA 2YZ4A 5LRSA 5LK7B 2R1BA 1HRI3 5GLZA 5BXXA 4JQRA 3AZYA 5JI9A 1H2LA 5JIAA 4FOVA 2D6PA 2IXCA 1XQNA 5DZGA 5K0UA 2BTVC 1C8NA 4B3NA 1QY4A 1J3RA 3FE5A 4BYYA 2WC2A 1MZEA 4L97A 5GALA 3MIDA 4NVPA 2WKKA 2HWB3 2R0FA 2Z42A 2EAAA 4Y26A 3RJ2X 1UZYA 2GC1A 1U5XA 4D94A 1N1TA 5J98B 1TQ5A 1JHNA 3A0NA 1OD5A 2ERFA 4BA6A 3N4MA 2WJSA 4COZA 3AXEA 2DUOA 5KC5A 1REFA 4AHYA 4P9WA 1LULA 5F6KA 1HXS2 4RQPA 5FREA 4OI1A 4GULA 3SMHA 1EV12 4YGDA 2BBVA 1R1ZA 1QNYA 3H1MA 4H3WA 3WP5A 2JICA 3MZHA 2C9AA 3QLQA 3FBMA 1TEIA 3VBUB 1ZZCA 1FMD1 1QJX3 2VNOA 3B94A 4PBPA 4W65A 1GZWB 1SCRA 2BUKA 4ZXKA 5I8YA 3WDTA 2D93A 2BNNA 1QHDA 2I2SA 3O7OA 3HWJA 1PIV3 3AKPA 1NLSA 2VOWA 1SLCA 1LJ7A 1DQ5A 2XBO2 1GQGA 1SQ4A 2GMEA 1S0BA 4QPGB 5L73A 3FHIB 1KJLA 1RUE2 4JDMA 1DZRA 5KC6A 4DOUA 1VBC2 3ZFEB 4GWMA 2RR12 5K0UC 3WR0A 4AEJA 2H6CA 4LHKA 4FVVA 2WS93 3IM0A 2ZZQA 2V5YA 1OOPB 2BEOA 3DL3A 4IV1C 2XVGA 1YYNA 5I93A 4MGYE 1R082 5KHIA 1AR81 4P9JA 3ZMNA 3MI8A 4L99A 4META 5D8AB 4IEYA 3WXPA 4BLJA 4FPLA 2LUWA 2UWBA 4P9LA 4KL1A 1XU1A 2XGXA 1DFQA 1NY72 2ZGQA 1ENQA 2EXHA 3BOWA 2D7FA 1FOD2 3JD73 2C0ZA 2ZGKA 1PVC2 4U2AA 3K48A 1PO22 3USSA 2Y0IA 5FO9B 1ZBA2 2Y0OA 1JBCA 4DY3A 3D8CA 4XW3A 1ND2C 1ULEA 2O0OA 4S2GA 5JZGC 2Z2SB 1CGPA 1KS5A 3GHMA 4LUKA 1PO13 1YHFA 4HK9A 4JDOA 2MNGA 4Z82A 1MS9A 2OUHA 4A7YA 3TBDA 1LR5A 1BYHA 2QNKA 2IXHA 2RM21 2ZPXA 5GJ6A 1D2QA 2WQZC 3PJQA 3GYDA 2A6WA 5E1RA 1MS1A 3ECQA 5AFEA 1LRHA 2MEV3 5J3UA 4Q0QA 2D6OX 4WVZA 2RS51 3AXDA 4Q4V2 5K8SA 2A6VA 2AENA 2CTVA 2W0XA 5E88A 3ZXJA 2C5DA 3JZVA 1PZ8A 4OHXA 2XJPA 3ZSJA 2ZGSA 4QPYA 3VKOA 1SBEA 4YVWA 1LGNA 4OVEA 4HVQA 1UPSA 1QDOA 3AKQA 4BMBA 2AR6A 2XKPA 2ZGNA 3KGLA 3TAYA 4E4SA 5KWRA 1HRV1 1FNZA 3KB5A 4KWJA 1SFNA 4QPIA 3SCHA 5L7OB 4C1XA 3OGJA 3SCGA 2SBAA 3SH5A 2VMHA 3VGIA 4Q1RA 1YFXA 1D0HA 5BYNA 1X7NA 1SMVA 3ILNA 4PBOA 4AI2A 4DNYA 3V0AB 2A6XA 5C6CA 1RTVA 1YI9A 1KS4A 3M8LA 4IEOA 1MEC1 1S0GA 3NWKA 2R071 4FBFA 2VECA 1LOCA 1WLDA 4IV3B 4AVVA 2IXJA 1FV3A 2HEYF 2W68A 3FFZA 2DUQA 1QJY3 1MZ5A 4AI3A 2PELA 1SCSA 1DGRA 1IGOA 3AB0A 1I9RA 3BIWE 4G4FA 2E7TA 4FCAA 3MIHA 1C5HA 5KBFA 5E16A 5C9AA 1AYN2 1RITA 2UYBA 1EY2A 1S2BA 3SITA 4AQSA 3KZ4C 3V65A 4PLNA 1RUJ2 3FZ3A 3PHMA 1G86A 1ZZ9A 1PNFA 4N53C 4D7TA 2DCKA 4Q4W1 1HDKA 4WM8C 1ZBE1 4LHLA 1PGSA 4IEQA 4Q4X3 4Y22A 4Z2WA 4DQAA 4YVWC 1AR93 1R081 5GKAC 1UX6A 3PNAA 1IZ3A 4IXLA 4YZ4A 1RUG3 2HWE2 4BCUA 1BEV2 5HBAA 1AVBA 1RVF2 1VBE2 2VNGA 2ZOEB 3ILFA 1GZCA 4QPIC 1GICA 1AUYA 3WHUA 4XTPA 4XXAA 1MZ6A 1ND3B 1FOD1 1QGLA 3BU7A 2DFCA 1PVC1 1AXKA 4R8HA 3ALQA 4EN9B 1LEDA 2B9UA 1ZBA1 1AX2A 2KXLA 4FPKA 4QQHA 2D98A 3WQ1A 4BQ1A 5JVVA 1C1FA 4LE3A 3WW4A 4IETA 3MLJA 1CAXA 2TUNA 1CPMA 4DRRA 3MW4A 1G9AA 4XJ8A 5K0UB 2D5FA 4HK8A 1NA1A 2ZX2A 3FUOA 2X5IC 4N9IA 1AL23 3ZXFA 1CIWA 4EROA 1WCDJ 1YXWA 4UBHA 1KD7A 1ZRDA 3BCWA 3AZXA 3VBRA 5HCAA 3FC0A 2HWB2 5C9AC 3POYA 1C57A 1ZZ7A 2QKDA 4CYDA 4XDQA 5DUWA 4WBBA 2PHRA 2DVDA 1LU2A 2AYHA 3RPQA 4MV2A 4XTMA 5BNQA 3JQXA 1JTZX 1RUH3 4QQOA 3WOGA 1J1TA 2ZKLA 3WHTA 1RUOA 4QT6A 3LZZA 1AYM2 2DU1A 4FAGA 3HT2A 1Q5OA 1VR3A 1O4YA 1S0FA 3VKNA 2BVBA 4AVCA 4RQPB 5AFBA 3T2TA 1AJKA 2TEPA 2HWC2 2DVFA 3H8UA 1QJU3 3R4SA 4F7ZA 5I0SA 1MS3A 4WM7A 1PMIA 1O3SA 4XQ4A 1XU2A 2TNFA 1V00A 5BNPA 3NO8A 4F3JA 1U5YA 4MUVA 3W59A 4AEDC 1QJX2 4ISRA 4QGNA 3P3NA 1D4M2 4FXGB 2YYOA