2R49A

Mutational and structural studies of e85i reveal the flexible loops of fibrobacter succinogenes 1,3-1,4-beta-d-glucanaseglucanase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
SAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSIKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and Structural Studies of E85I Reveal the Flexible Loops on Truncated Fibrobacter succinogenes 1,3-1,4-beta-D-Glucanase
rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
molecule keywords Beta-glucanase
total genus 59
structure length 241
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2007-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r49A00
4XIKA 1V6KA 2ZGSA 2PHRA 1UMZA 3A0KA 3SITA 2DU0A 3WOGA 1DQ1A 2R49A 3ZXKA 4HANA 4OZXA 5KXBA 3GALA 2OW4A 1SLLA 1CN1A 1H30A 3FLTA 4XJAA 2RHPA 3R4UA 1V6OA 2WT1A 2YY1A 3VUOA 5IT6A 4FPYA 5GLTA 3ZSKA 1WLWA 4UW6A 1QF3A 1B09A 1AVBA 5IUQA 1Y7BA 5T5JA 3SH5A 4PBPA 1FNYA 1MZ5A 2ZAAA 3NV1A 3WCRA 4Y1UA 3WG3A 1ULDA 1Q8VA 3SH3A 2AYHA 2D6MA 4M3CB 3APBA 5FREA 3USUA 4ZKTB 1ULEA 5JMCA 2AH2A 5T55A 1LECA 1LJ7A 4CRQA 4PF5A 2HYKA 1WW4A 4Q1PA 3PVEA 1CPNA 1WW6A 2ZABA 5T5OA 1MVQA 3AYDA 1OQ1A 2KM2A 1LOFA 1MS1A 1JOJA 2PHUA 4XOGA 4BOWA 1JHNA 3A0NA 1LESA 3CNAA 2XG3A 3M3QA 1QOSA 1WBFA 4FP2A 3JUUA 4XZPA 5IK8A 1FX5A 1G9FA 1N1TA 4M3CE 4XMIA 3AZVA 4ISRA 1H9PA 1NLSA 2DWRA 4JC1A 1A78A 3FBYA 4XTMA 5T52A 4DS0A 3M1HA 3I8TA 2Z42A 2VXRA 4LBNA 3ZYPA 3ZXLA 3NV4A 3O0VA 2R1DA 2NYYA 4NOTA 1PZ8A 3PMEA 1F9KA 1LGCA 3WHTA 5CA6A 4YLZA 3B3QE 1O4YA 1WLDA 1HQWA 1WW5A 2ZGTA 2JECA 2ZKNA 3FLRA 3NWKA 2NN8A 4IQPA 4F83A 2R16A 1CQ9A 4XTPA 5CAZA 4FPOB 1TEIA 1SCRA 5F5QA 1DIWA 1N47A 2R0FA 3I4IA 1ONAA 2AGSA 2TEPA 4NO4A 4YW4A 3NV3A 4AVSA 2ZGLA 2C5DA 1YRZA 1FV3A 5E8AA 3V0BB 3BOPA 1LU2A 4XDQA 2DUOA 2W39A 2GDFA 5IK4A 1FAYA 2D6LX 4WVWA 5JDBA 1GZWB 5H9SA 1GNHA 1MS3A 3R4SA 5T5LA 5KXDA 1C1LA 3MPPG 1JUIA 4BQ1A 1S0EA 1KJLA 1QDCA 1A3KA 1Q56A 2DURA 4CZSA 2E53A 2WJSA 3HN1A 2I2SA 3IN9A 2UURA 1SLCA 3AJYA 5GLVA 3QCWA 2WSVA 4JCKA 5GZDA 1A8DA 2YV8A 3BODA 4TYSA 1N1SA 4FOYA 1DBNA 5E89A 5EWSA 1NXD1 1G9CA 3OYWB 2EALA 3T1LA 2P2KA 3MW2A 3ZXJA 1ENQA 3RG0A 2JE7A 3Q9OA 3WVJA 1FV2A 3AFKA 3ILRA 1U0AA 1YO8A 1MS4A 3N36A 3ZXEA 1AXKA 4LBQB 1CESA 4R9CA 5T54A 1RIRA 3QLQA 4FQ4A 2OUJA 2ZGPA 2FHRA 4LBJA 1GICA 1JXNA 3TAYA 1S0GA 2VW0A 5E88A 3M3EA 4M3CF 4Y1XA 1DYKA 4RA0A 3WDTA 1ULFA 1G9BA 3D4KA 4XILA 4XHXA 4AVTA 4Q8KA 1WLCA 2E51A 2YROA 4YGBA 2CL2A 1QGLA 2PHFA 2ZBJA 3V64A 2EXKA 2ZACA 2YZ4A 2AR6A 4Y20A 2W08A 1X50A 3UK9A 3N35A 4D69A 2GNMA 3ENRA 1GZ9A 5DUUA 1GSLA 3ZVXA 4Y1YA 1DQ0A 4FPCA 2D6KA 1MS8A 3WLUA 2JD4A 4YGDA 4YM0A 5EYYA 4DRRA 4DPNA 4HL0A 3B9CA 1QDOA 4BLIA 5HCAA 2ZA9A 1S0BA 3ILFA 3N7KA 4RL7A 2YXSA 1VAVA 4C1WA 3WUDA 1SLAA 2VU9A 4ITCA 4XXPA 4BPZA 2D3RA 1W6NB 5JOWA 3N3HA 2LALA 4BMBA 2CTVA 2DTWA 1GNZA 4GALA 4YZ4A 1WBLA 2YMZA 3U4XA 5CB7A 3SH4A 3T1MA 3WDUA 5GJ6A 1WW7A 2B7YA 5CNAA 2EXHA 4GA9A 3AXDA 1GZCA 2WLQA 4JRAA 1HDKA 4Q26A 1QOTA 2GMMA 2EIGA 4BMEA 3ZSMA 1RITA 2P3JA 1MS5A 1ZM1A 2NMNA 2UWCA 5DZGA 4U36A 1LOEA 1H9WA 4ATEA 2AENA 1W6QA 3VKFC 1W6MB 2UWAA 2R1BA 4YW3A 5H9QA 3WHUA 3PJQA 2WKKA 2SLIA 1AZDA 2CWSA 3OPZA 1Q8PA 3OGGA 1DGLA 4XBLA 2NZ9A 3WV6A 2ES3A 4FQZA 4GWNA 3AXEA 1IKPA 4R9AA 2GN7A 3RRDA 4XBQA 4XE9A 5KXEA 3W59A 1IS3A 3SISA 1QNYA 4MYEA 1V6JA 4YZ2A 1J1TA 3D6EA 1HQLA 3WZ1A 1MS9A 1F5FA 1LHUA 3DUIA 2ZMLA 1G9AA 1BJQA 2GMEA 1OKQA 1S0CA 3LSEA 4W65A 1VALA 5FRAA 1W6MA 1ENRA 4K1YA 3KM5A 4DRVA 1KDMA 1N3QA 2PHXA 3FFZA 4YGCA 1IKQA 1F31A 1AXZA 1MS0A 1W6OB 2NMOA 3IMNA 2DTYA 1UKGA 1UZYA 4Y1VA 2CY6A 1SBEA 1AJOA 5JVVA 1LEMA 4XJ9A 5BYNA 4FPJA 2H0BA 1DQ5A 4FOWA 1G86A 1APNA 2EAKA 2A3XA 5T5PA 1CONA 1IS5A 4AYUA 2A70A 3C2UA 4ASMB 3VKLA 1FNZA 1N3PA 2GMPA 2WNEA 2A6YA 4BLJA 2ZGOA 2CWMA 2EF6A 2LTNA 5HCFA 1FYUA 5JOZA 4UW3A 2VW1A 3B01A 3B69A 3RS6A 2DVDA 2VW2A 3WDYA 1JYIA 3D5OA 1HLCA 1DHKB 4CTEA 4K20A 3UJOA 1GKBA 4GKXA 2BQPA 2UWBA 4ISQA 1SLIA 3AP7A 1N1VA 3WDXA 1YI7A 2D3PA 2ERFA 3WG4A 2ZMKA 5GM0A 1G9DA 3LCPA 4XJWA 4XJ8A 1CR7A 1VIWB 3PVOA 1GLHA 4YG0A 4KBBA 4YZ5A 4FPFA 5EYXA 1UZZA 1BXHA 2CYFA 5F9TA 2ZHMA 1S0JA 1W6PB 1W6NA 2GNTA 1AX0A 4FPGA 2AUYA 1SACA 1ZA4A 1I1EA 4DQAA 2DUPA 1S0DA 3ILNA 3OBTA 1LOGA 2VUAA 1LULA 1ULGA 2ZMNA 2VH9A 3IPVA 4K1ZA 1IS4A 3AYCA 3N7LA 1JW6A 5HCBA 1KJRA 1JN2P 2G4IA 3M3OA 3H0OA 4YZ3A 1MACA 3AP9A 5L73A 2ARXA 5GLWA 3DGTA 4DFSA 4Z8BA 1DLLA 5JOYA 4Y20B 1WUVA 4YW1A 2P34A 3HR9A 2V73A 1LENA 1CJPA 1DZQA 1CPMA 2FMDA 1C4RA 5GZGA 2EXJA 2ZGUA 1AXYA 1Z0HA 1AF9A 2DVAA 1W6QB 2WSUA 1AX1A 4Y22B 4R9DA 3AX4A 4YZ1A 4Q2FA 1DQ2A 1EPWA 1QKQA 1PZ7A 3SLIA 3KQRA 2DV9A 2E6VA 1V00A 3RQ0A 3RSJA 1AX2A 3AK0A 4TZDA 1MZ6A 1SLBA 1KDKA 2PHWA 2UU8A 1OFSA 4Y1ZA 3ZSJA 4UW4A 3AJZA 2A7AA 1D2SA 2JKBA 3WG1A 1I3HA 4SLIA 4YFWA 5DXDA 4M01A 1LEDA 2JDZA 1UAIA 4LBQD 2DU1A 1LOFC 2E7TA 1G7YA 3FUOA 2A71A 3N7JA 4XJUA 4Y26A 4YM3A 1GANA 4AGRA 1GBGA 1V6IA 1S1AA 2W68A 4GWMA 5H9PA 2DVFA 3AP5A 4YW5A 1W0PA 3AZWA 1KRIA 1HKDA 5EXOA 3FLPA 4XJZA 1IOAA 3V0BA 4LBQA 1LHVA 3UL2A 2C9AA 4H55A 4P9WA 3WDWA 1ULCA 2GN3A 2JJ6A 3WCSA 3WDVA 3N7MA 1S0FA 1ENSA 4WVVA 2NP0A 3AYAA 1DYPA 1MVEA 2A5ZA 1YIFA 2ZGKA 2VY0A 2ZHKA 4GXLA 3A4UA 4PQ9A 5JLVA 2A6XA 1LOBA 3VKNA 3OY8B 4AGGA 5KXCA 1G8WA 1LCLA 3O5SA 3VKOA 5GLZA 2JE9A 1W6OA 2OUHA 2P37A 3SNMA 4GKYA 3UJQA 4PCRA 1Q8SA 1LGBA 4YM1A 1C1FA 1SBFA 3OJBA 1BKZA 1BQPA 4M3CA 1URXA 4Q8LA 4WV8A 2AREA 1YYNA 2DVBA 4XHBA 1CVNA 1UX6A 1VLNA 2CNAA 3ZSLA 2PHTA 2SBAA 3IM0A 3L2YA 4FVVA 1UN1A 3O0WA 3R05A 4XXAA 3M3CA 2PELA 3OBRA 3MEPA 4Q1RA 5DG2A 4P9XA 3TB0A 2WQZC 2D6OX 4YGEA 3WG2A 2DYCA 4XBNA 2P3IA 4L8QA 5DG1A 1D0HA 5DZFA 1LTEA 2D7FA 2W52A 3ZYRA 4ATFA 2A3WA 4XIOA 4FP3A 3T2TA 1QU0A 2ZGRA 4YM2A 1WCSA 2ZGQA 3ZPYA 2ZZJA 1VAMA 5JOXA 3V0AB 3IPVB 3AP4A 1XQNA 1WD4A 3BTAA 1LODA 4Y24A 3B00A 2A75A 3POYA 1BZWA 3POSA 3V65A 1JBCA 1IS6A 4FOVA 4FPKA 1JYCA 1V6NA 3WUCA 1GYKA 1W6PA 3POWA 4AVVA 4P9YA 5IK7A 3RMYA 1N3OA 3VV1A 3AZZA 2ZGNA 1KQRA 1DQ4A 1KITA 3O12A 3AP6A 1YXWA 1BYHA 4U2AA 4LBOA 3USUB 2Q5TA 2A6VA 1R1ZA 5AVAA 5GZEA 3LSDA 5CBLA 5DUVA 4ZXKA 3W58A 2D44A 1SCSA 3FUQA 3V0AA 1QOOA 4YW2A 4R9BA 1AJKA 1LHWA 1GZWA 2NM1A 2DUQA 4FPEA 4WZFA 3RMXA 3M2MA 4LBKA 4K21A 4P14A 3GNEA 1SBDA 3ATGA 1SLTA 3MW3A 2WT2A 2A3YA 2A6WA 1W0OA 4FPLA 5H9RA 4AGVA 2D6NA 4XMAA 1LHNA 3JU9A 2E7QA 1DFQA 1DQ6A 5SV8A 1QNWA 1LU1A 3VKMA 3HMYA 5DZEA 1O4ZA 1LOCA 3INAA 3PVNA 2ZGMA 5GALA 1MR5A 2XB6C 1UL9A 1Q8QA 3OYWA 4XYXA 4C1XA 4YG3A 2D6PA 4PBOA 5T50A 2EXIA 1SFYA 4BM8A 2ZHNA 5GZFA 4UW5A 5GLUA 5GZCA 5IK5A 3AZXA 4Y22A 4FOQA 2GNBA 2A6ZA 1GV9A 1CIWA 3WNXA 4AWDA 1FATA 5DUXA 3OY8A 1LHOA 2ARBA 1RINA 5LK5A 2WT0A 2R0HA 4Q27A 4I30A 2GNDA 1QMJA 1Q8OA 1S0IA 3AYEA 1WD3A 3BIWE 2D3SA 3NV2A 3ASIA 5DUWA 4YG6A 1LOAA 1PZ9A 2ENRA 3AZYA 1LGNA 1UPSA 4LBMA 1V6MA 2GALA 2P3KA 4YFZA 2V5YA 2ZHLA 3IKWA 4M00A 4LBLA 1N1YA 3O0XA 1C57A 1V6LA 2D43A 2OVUA 3ZXFA 4FPHA 1Z78A 3MW4A 2DVGA
chains in the Genus database with same CATH superfamily
3HIFA 5A70A 2PFWA 1UMZA 1OF4A 1GNYA 3NMBA 2DU0A 4I3PA 5DDJ3 3SITA 3ZFEB 1Y9MA 4S2DA 1IPKA 1IQAA 3BALA 3U10A 1ZZBA 1YFYA 3DYOA 1SLLA 3PU3A 3K4AA 1H30A 3KSCA 3WNNA 2RHPA 3R4UA 2IXHA 3OPWA 1UOFA 3ZSKA 5GLTA 2OYZA 1XBFA 1Y9QA 2E33A 2B9VA 2V72A 3K4ZA 1Y7BA 5IUQA 2PQQA 5DQ0A 5J37A 2ZAAA 5FYTA 3WCRA 2VXJA 4Y1UA 3OGVA 2XJPA 1Q8VA 3SH3A 1NQJA 4WM7B 3OTFA 4M3CB 3APBA 3USUA 1JODA 1FI2A 5GKAC 2AH2A 5T55A 1LECA 3S7EA 1NX9A 4PF5A 2HYKA 3WNPA 4GULA 1UYYA 2ZABA 3I59A 5T5OA 3I97A 1AUYA 4IEZA 1ZRCA 5FYSA 2DFCA 2YBKA 1J1LA 1JHNA 1HV1A 3M3QA 4QGMA 2ETEA 1OQDA 4XF9A 3ZFEC 4XZPA 1FX5A 4XMIA 5FMOL 2IC1A 2BVVA 4CXWA 3NNJA 2DWRA 4QX0A 4JC1A 4AQ2A 4XTMA 1NKGA 1U12A 3M1HA 4JKLA 4QU1A 2VXRA 1R083 1JUHA 1DGWA 1ZZ9A 4KL1A 2NYYA 4NOTA 3ETPA 3HEIA 3MF6A 1J59A 3PL0A 4XC9A 4IDZA 4MGYE 1UPIA 4LO7A 4YW6A 3B3QE 1O4YA 1F8VA 1W9TA 1HQWA 2ZGTA 3NWKA 3WXPA 2Y6JA 2LW8A 4HVRA 4IQPA 5FMDA 2R16A 1JZ2A 3UGFA 4FCAA 4GMP3 4XTPA 4RS5B 2ZOEB 1PNGA 1TEIA 4N8MA 5DAXA 5F5QA 5C4WC 4KU7A 1RUF3 2R6QA 1V9U3 4B1LA 2FDKA 4PHZA 5C3OA 3CF6E 2ZGLA 3ZO0B 1UY4A 3KVBA 3Q8FA 2DUOA 2W1SA 4MOAA 1M06G 2JDHA 2VMEA 5JDBA 1AR61 1WGPA 5KXDA 3GBFA 3POIA 1X8EA 4BQ1A 1AHSA 2WO1A 1S0EA 4BQ3A 5FCCA 5BNPA 4QM8A 1A3KA 4EN7B 1D4M2 5FZMA 3P6BA 3QH7A 1O8SA 5F39A 1PHMA 2YYOA 2DBNA 3QCWA 5C3QA 4X8PA 3WQ7A 1MEC1 1W9WA 2VQUA 2HEWF 4E2QA 2CSGA 1DBNA 1VJ2A 2QZ2A 1ZA7A 5E89A 4ASLA 4IEWA 1G9CA 3PUAA 3ZYFA 2EALA 1L7LA 1OA3A 1RUC1 3MW2A 4UF0A 3RG0A 3MFCA 3TN93 3ZYJB 3POJA 4JQRA 2R041 1HB3A 3AFKA 5FY7A 1J83A 1TG7A 2PLV1 1PO12 4HKWA 3N36A 1PIV2 5FYZA 1JS9A 4LXLA 4R9CA 1RMU1 4FQ4A 2ZGPA 1PMIA 3H3LA 1JXNA 3VGIA 3LWCA 1VBA1 5E88A 2WNUA 3M3EA 4RA0A 3GZAA 4ZY9A 2A1XA 4AEJA 1ULFA 1G9BA 4XILA 4Q8KA 1WLCA 1IZ3A 3VDDC 3SCHA 1QGLA 2PHFA 3OCPA 4P9JA 2Q8CA 3DKWA 4HONA 2J42A 4AI1A 3L2HA 4D69A 1DLCA 5IAXA 5DUUA 1ND3C 3VHNA 4Y1YA 1DQ0A 4JHTA 2XMLA 3WLUA 3MO4A 4TN7A 3MYXA 3LA7A 5BNNB 1ZBA1 2VCAA 1V9U1 1QDOA 2BNNA 3J4UH 4GH4C 4P9GA 1S0BA 3JBG1 2HWF2 1YJLA 4PLMA 4AQSA 2YHJA 1XOYA 3DXTA 4MUVA 4UXAA 2YXSA 4IEQA 5D8AB 5FZCA 4FTEA 4ITCA 2BGCA 4O65A 3WNLA 4PLOA 3FL7A 1NY71 2LALA 2CTVA 2JX9A 4HBNA 1GNZA 2QKDA 3POEA 5FZHA 3A7QA 5KBFA 2YMZA 3GZTB 4CDXC 2W95A 3BIEA 1QIQA 4MXWB 3T1MA 3MIGA 3I7DA 5FFOC 5A7WB 3WDUA 5L9VA 2B7YA 5CNAA 1YQ8A 4I09A 1TME2 4GA9A 4RS5A 1GZCA 1NT0A 4JRAA 2PN5A 5LZ6A 3VBSA 3WD5A 3ZSMA 4XF0A 2P3JA 2UWCA 2NMNA 4DINB 1ND3B 1Y4WA 4U36A 1LOEA 1IG3A 1H9WA 3BN6A 1W8NA 1CAUA 3VKFC 4XUTA 2UWAA 1YCIA 3VBUB 4IV3B 2WKKA 2GZWA 2SLIA 4ZU7A 1WA4A 3GZUC 2RR11 5FUNA 4LTAA 1VBD1 3PUQA 4CP2A 2W91A 4XBLA 2XVKA 3WV6A 2KXLA 4Y4YA 4ZU4A 1C8M1 5C5TA 4R9AA 4Z2WA 4XE9A 3RVHA 4YVSA 4KU8A 4BQ2A 1FMD3 1QNYA 1J1TA 3D6EA 4KH9A 1XNBA 4NIHA 2Y6LA 3WZ1A 1F5FA 1LHUA 1VBD2 2ZMLA 2XBO3 4HPKA 1YNAA 2GMEA 4N90A 2F17A 4AHYA 2F4LA 2ILMA 4O9GA 4OLLA 1RB8G 5FRAA 1IPSA 1BBT3 1ENRA 5KHHA 4DRVA 1KDMA 1N3QA 5JSOA 1RVF3 4YGCA 1F31A 2NMOA 1W6OB 3KV9A 1RUH1 2JENA 1AR93 2VMGA 4Y1VA 2ET7A 5FPVA 1GOGA 1RUI3 1XYPA 5JVVA 1R092 1LEMA 2P17A 1K5MC 4FPJA 3S5AA 3JD72 3THCA 2ORXA 2WWSA 1YHFA 1ND2C 1XB9A 1CONA 3PHMA 4BQYA 4XAAA 5FO8B 4NRMA 3I59B 2HWF3 4XUOA 2GMPA 4RHV1 1UU5A 3GYDA 3VKLA 4DMIA 3KCXA 2A6YA 2EICA 3M8LA 4X8NA 4DXRA 1W9FA 3S5QA 2BOJA 2VOVA 3E97A 3H42B 4P5YA 1E5IA 5JOZA 4UW3A 2I45A 2RDNA 3LB9A 3WDYA 5DAPA 1HLCA 2ZX1A 3UJOA 4Z2AA 4HOOA 1H8VA 4C90A 3AP7A 3WDXA 3WG4A 2ERFA 4W6XA 1BBT2 3LCPA 5BNOB 2BJSA 4LKSA 1CR7A 1VIWB 4R4ZA 4YG0A 1UZ0A 1NUKA 5FPLA 4FPFA 3O1PA 4KWLA 2ADEA 2CYFA 1CAWA 1W6PB 2JDPA 1OUSA 2Y6GA 2P4EA 2GNTA 1AX0A 1OVPA 5FK7A 4LOSA 1O7FA 1I1EA 4DQAA 5FZ6A 5LY1A 5FQ0B 2C4XA 2JD9A 2ADDA 4AG4A 4CU8A 1TNRA 2VH9A 2YU2A 3IPVA 3AYCA 3N7LA 1KEXA 1ODNA 1UYZA 4R8HA 4XAEA 1JOBA 1HQNA 5G05L 1R091 4WVMA 5EJ1B 1MACA 1ZZ6A 1W8HA 2J1AA 5FPBA 1QJFA 1UWWA 3RI9A 2G9FA 4PT6A 2R063 1DLLA 2VZQA 1U5ZA 2EA7A 1W8TA 1R1A2 1IPJA 3B94A 5AFEA 1QJY1 3KF5A 4JGYA 1CPMA 4Q5OA 3LOIA 4LHLA 2WLPA 3N9PA 5FY5A 5FO7B 2P6CA 2ZGUA 1AF9A 1KD7A 5C33A 4MG2A 2DVAA 1W6QB 2WSUA 2DCTA 4AL9A 5KC6A 1FPN2 2G9ZA 2RS12 3MZHA 1H2MA 3FX3A 3CKHA 5DAVA 3W20A 4XF1A 3KCCA 1ZREA 3T2PA 4GWIA 1US2A 2WZR3 3RSJA 3RZHA 3N9OA 1YC61 2UU8A 3ZKYA 2RJ2A 1XPWA 4Q4W1 3AJZA 1D2SA 3ES1A 3WG1A 1CZVA 3IIAA 4B4PA 1O3RA 2QVSB 4S2HA 4OHWA 4SLIA 4YFWA 4IGQA 4DNYA 3CL1A 4N53A 4NPRA 4OHYA 4LBQD 1LKNA 2J1UA 4QMAA 1LOFC 2VNGA 1S2EA 4XJUA 4LLFA 3HNMA 3OGRA 4NRQA 1GBGA 1V6IA 2Z79A 1F2NA 4GWMA 1T6BX 3NJVA 2JKXA 4LPLA 3W5MA 3THTA 3AP5A 3VB9A 3SMHA 2WAOA 2VBBA 1W0PA 3AZWA 4LHSA 5FMCA 5AC93 2R073 1CX4A 1VBE3 5FZ3A 1UYXA 1LHVA 4Z82A 3UV9A 1TQ5A 2XGXA 2GN3A 2JJ6A 3WDVA 1AR92 1NA1C 1S0FA 5LK7B 3ZN6B 1AR83 4Q0SA 4XCBA 1A8MA 4M0HA 3JBG2 4GXLA 5J96B 4CP1A 1KS5A 2XHKA 2A6XA 3K51A 2D93A 3ZDSA 4B3NA 3OY8B 4KGQA 5F37A 2WZ8A 1G8WA 1LCLA 1XU2A 4NUBA 4MGQA 1SFPA 1NCQB 1OD3A 1W6OA 2P37A 4SBVA 5FYUA 1UZWA 4X6QB 3UJQA 3RZMA 4COYA 4YM1A 1LGBA 2WR9A 1SBFA 5C9AA 2DCZA 2WC2A 4M3CA 5E6HA 2LRPA 3TYJA 4WV8A 1PK6A 3KHBA 4XACA 3VD4A 3GHNA 4HLTA 1VLNA 4YVWB 3U1XA 2QBXA 2SBAA 4BYYA 4FVVA 3G7DA 5ABJA 2VQAA 5CFDC 1UN1A 4B7KA 2JICA 1W8OA 2PELA 2XL7A 5F32A 1XE7A 1HN0A 3MEPA 1NZCA 4RGKA 3WW1A 4BQ4A 4CCJA 5C7GA 5JAXA 4XFIA 3NNMA 1S2KA 5DG1A 2XLAA 3VHRA 1WMXA 4ATFA 4XIOA 4LIUA 2IFRA 5D2AA 2WZPP 1QU0A 2ZGRA 2QDRA 3KB5A 4NIDA 4GMP0 2ZGQA 1QQP3 2RE9A 3T09A 4QPGA 1W28A 1QJZA 5GLZA 1PGW2 1NCQC 1XU1A 5JOXA 4KI5M 4NN0A 4B29A 1HB4A 4A41A 2NPIA 2A75A 3B00A 3M7AA 1BZWA 3POSA 3UGHA 4AQ6A 5BV6A 5EQUA 4JGZC 3VBSB 3TEWA 4FOVA 3POWA 4ONUA 4NVPA 5IK7A 2B4KA 4COVA 2D40A 1DGRA 2KA3A 2BDRA 3OEAA 3O12A 4BCUA 3AP6A 1YIPA 2RR13 1BYHA 2HWB3 1F15A 1ND2B 4LBOA 1LRHA 4CEYA 1EPZA 3TEZA 5A3MA 3DPRA 1REEA 5GZEA 4Y33A 3CU7A 5CBLA 1W99A 1W2NA 1HRI3 1SCSA 4HETA 1RUI2 4ZU5A 1POV0 1AJKA 1IHMA 4FPEA 3QD6A 2OPKA 3NW4A 5HI0A 4P14A 2WYFA 2BFUL 3ATGA 3GNEA 2OT7A 3MW3A 4I02A 4XFFA 1W0OA 4FPLA 1JHJA 3E1F1 2D6NA 4GWJA 1LHNA 2WO7A 2Z69A 4BXFA 1BBT1 5A6ZA 1DFQA 1SQ4A 1LU1A 1OA4A 3VBSC 5KC5A 3I49A 2EAAA 1LOCA 1RVF1 2QQLA 4GMP1 1RL3A 3PVNA 1PGSA 5EPAA 1MR5A 5K0UB 2BU9A 5DAWA 4OQ8A 1POV1 4XYXA 1DZRA 1VRH1 2F6BA 4TXWA 4YG3A 2Z4FA 5CVRA 4IETA 3FBMA 1SFYA 1XJAA 1W0NA 3UETA 4UW5A 3AZXA 4FOQA 3AVRA 1YUDA 4UFLA 2QQUA 1CIWA 4AHXA 3WNXA 1FATA 3E5XA 3HN3A 3T0AA 2Q8OA 4NIAA 1RINA 4QHOA 4BQXA 2WT0A 2R0HA 4Q27A 1DCSA 3ZXGA 4FFHA 1A34A 4EN6B 1SDDB 3VLBB 4OUEA 4XCAA 5A7SA 4QX3A 1GWKA 4Q0UA 1RJ7A 5DUWA 4IE4A 3CHXA 1PZ9A 4QWNA 3MICA 3VDDA 1MEC3 4LBMA 4AFAA 2GALA 4YFZA 4QU2A 5FZOA 2V5YA 3AMQA 1NCQA 4M00A 5L9RA 4A6OA 2Q0AA 2EVXA 5FPZA 5LWBA 1C57A 1V6LA 3FHIB 3J9SA 5A80A 2E7AA 3H8OA 4N43A 3TB0A 4B7EA 3O1OA 4XIKA 4I0BA 3WOGA 4I01A 4JV4A 2R49A 2FDJA 4HANA 4UBGA 5A3PA 3UKNA 5LY2A 3PU8A 1NAEA 4LE4A 4HVQA 5KXBA 2OW4A 4HN0A 2XXZA 4KWKA 4CDQC 4QX2A 5ACA1 5FBZA 3GZEA 4Q29A 1KFXL 3ZMNA 2VECA 1WLWA 3L9JT 3RJRA 1QF3A 3SH5A 4PI2A 4PBPA 1FNYA 1MZ5A 1VMJA 5FZEA 5KHIA 5FDBA 3ACGA 1WLTA 3WG3A 4XF4A 2VG9A 4QX7A 2D6MA 1UXXX 1BEV1 5FREA 3LKJA 4NHYA 1AR72 1ULEA 4ZKTB 4DY3A 3ACHA 1LJ7A 3D82A 1L7RA 1SDWA 2ZEZA 1VRH3 3LEGA 5F1RA 4N9HA 4Q1PA 3VBUA 5LEKA 3PVEA 1ULOA 1O6UA 1X82A 4BK4A 2YB7A 2KM2A 4JVAA 3RDIA 1QJX2 3GCXA 4QGNA 4HN1A 3A0NA 4BOWA 1WBFA 3JUUA 4AI2A 3ABZA 1W2TA 1NOVA 2HBUA 1G9FA 1OPOA 3EO6A 1XNAA 3ACLA 4N43B 4Q4X1 2JG8C 3AKQA 4ISRA 1F35A 2CV6A 1NLSA 1EAH1 2MHFA 4CCCA 4CPBD 4YW7A 4HMZA 1D4VB 3ZFGB 1JTZX 2RR12 2Z42A 3LPFA 2R1DA 2AEZA 1YFUA 3P3PA 1CIYA 4AI3A 4UYBA 1AYM1 5JPMB 1UZVA 3PMEA 1LGCA 3ZKUA 2YFZA 4AW7A 3WP3A 1WLDA 3SKVA 2JECA 4F83A 1QHDA 5B4XA 4C8DA 1AR73 2VULA 3SKJE 4AR2A 1RGSA 1CQ9A 1ND2A 2K2SA 1IQDC 2Y33A 3C7HA 3B9IA 4XFAA 4XDPA 5FZ8A 5CAZA 5BNNA 2UY9A 3SC7X 2OZJA 1DIWA 2D97A 1H1MA 1N47A 2R0FA 3I4IA 4FSJA 1S55A 3KV6A 4MGKE 2AGSA 4YW4A 3GXUA 2QQMA 4DOUA 3NV3A 1VBE1 4AVSA 4D6RA 2C5DA 1YRZA 2EIEA 2RVAA 1OSGA 4Y4RA 4F8AA 3LA2A 3FMGA 3V0BB 1WA6X 3ZFEA 2ZEWA 3KT1A 2W39A 2WO2A 5A7OA 3VBRB 4BE3A 2D6LX 4WVWA 1AL22 5H9SA 5FV3A 5G04L 1RJ8A 5A1FA 1GNHA 3ZLIA 3R4SA 3ZFGC 1E5RA 2PHLA 3IMMA 3J8F3 3Q8EA 1UX7A 3TRSB 3T4VA 4H2AA 3E6CC 2WIIB 2WFPA 2DURA 4NPMA 2YC0A 3HN1A 2I2SA 2UURA 1SLCA 2JG9A 4AEDA 4AEDB 5GZDA 2BW8A 1A8DA 1OOPB 1W9YA 2WBKA 4FOYA 3PUIA 5FZGA 5EWSA 3ST7A 1HN1A 1OUXA 4HFSA 3T1LA 2P2KA 1ENQA 4UBHA 2W5FA 2VZOA 2IWGB 2ZEXA 3VBFA 4BIOA 4MGIE 3JBG3 3ILRA 1MS4A 3O14A 2HWF1 4LBQB 4A45A 1CESA 1RIRA 3RNSA 2RS33 3TAYA 5C71A 2HWC2 1EAH3 4V2WA 2J7MA 3QH6A 3MHZA 1NYWA 4M3CF 4Y1XA 1CX1A 4UAPA 3O1UA 4JHZA 4KQ7A 2W87A 4NHKA 3AKSA 1NXMA 5K9YA 4JDOA 4P9LA 3V64A 2VVEA 5FZ1A 4L97A 1QJU2 4JGZA 1OLMA 1RTVA 1AR71 5C9AB 3ENRA 1WCQA 4O7XA 3HOBA 1GSLA 3ZVXA 1COV2 2YPJA 2VOWA 3CBNA 3VZLA 1MS8A 4AE2A 2BBVA 2IZWA 3ZXAC 3VBHA 3ZSEA 5FY4A 5HCAA 3JB8A 3I3MA 1O5UA 3IDEA 4ZZ8A 5JZGA 3N7KA 4P9IA 1I5PA 5FY9A 5A3NA 1LAJA 1JYTA 4CXXA 2IFWA 1SLAA 1ZZ8A 2RM23 3FN9A 3UKTA 3JQWA 4I2OA 3N3HA 5FYIA 2HWE3 2Q1ZB 2X5IC 3K4DA 4QT6A 5L19A 2C0ZA 2GSYA 4MSVA 3PIGA 2BOIA 3POGA 4TLFA 5CB7A 3SH4A 4DUXA 5DMYA 4WM8C 1QJU1 3DCQA 3AXDA 2WLQA 1HDKA 2GMMA 2EIGA 4BMEA 1RITA 5I8YA 5IATA 4N53B 1ZM1A 2VOXA 3J7MA 4E27A 3LPGA 4XQ4A 4AHWA 2J1RA 4ATEA 2AENA 2VMFA 3VBFC 4EWDA 1W6MB 4YW3A 4N7UA 5H9QA 3A23A 5IFPA 2W46A 5FKBA 3N9LA 2ZXQA 3OPZA 5IVFA 1NG0A 1Q8PA 4YVSC 2WZR2 1C8NA 5KHGA 1DGLA 2UYBA 2NZ9A 3MPBA 5FZLA 2ES3A 5CZKA 3CJIA 3AXEA 4Q0PA 3Q8BA 2GN7A 2QNKA 3RRDA 3RFRA 3SCFA 3W59A 1VRBA 3KT7A 3SISA 5A33A 3H3ZA 1V6JA 4JZRA 4WM8A 4EN9B 3BGAA 1HQLA 4Z1VA 2QQNA 2XUMA 2OQ6A 1UMHA 5L7OB 5KHJA 1OKQA 4KWUA 3E5UA 3FZ3A 3D0JA 4IE7A 2BEOA 4MXVA 5AVPA 3WNOA 4C91A 4C0BA 1ASJ3 3KM5A 3R4DB 1PX4A 3LDRA 3MIEA 4META 2PHXA 2C26A 3FFZA 4CDWC 4FFFA 2VZVA 3ZFFC 1NE4A 1UKGA 1RHI3 1RUG3 1SBEA 1HJGA 5A1AA 2ZEYA 1DQ5A 4HG6B 1VMHA 4YVWC 4MGSA 3TN91 5AC91 1CWPA 3GDBA 1APNA 1UCXA 2PLV3 3E6DA 2Q4SA 1R082 3O1VA 3I3QA 3OBZA 5F6LB 4ASMB 4MADA 1QY4A 4FO9A 4B1MA 3ALQA 1AR81 2HWB2 2EF6A 3U75A 1COV3 2VW1A 1XNKA 3HVDA 4IE5A 1RHI2 2DVDA 1RYYA 3HT2A 3D5OA 3OUJA 1DHKB 3OUIA 4K20A 5FYMA 2R30A 3NQHA 1AYN3 1LNSA 4GKXA 5I91A 2BQPA 4ISQA 5FK8A 1O4TA 2RG4A 1G9DA 1DDLA 4XJWA 1VE0A 4COZA 1RUH3 2K9ZA 4QKBA 2Q1MA 1UZZA 3AFGA 5A7NA 4OHXA 3N9QA 1TME1 4X6RB 5LB6A 5F9TA 2WUHA 4MVTA 2FDGA 3B5LB 3F2ZA 1ZA4A 2QE3A 3TN92 3AB0A 4D7YA 1S0DA 1L7QA 1JZ7A 4RHV3 4NAOA 5DDJ1 2LROA 4LKEA 3T0BA 1DF0A 2VUAA 2ZMNA 3HWJA 4K1ZA 1KS4A 4MX3A 4XEZA 4ARYA 1IS4A 4XVHA 2Y8KA 1Z7S2 2CDPA 4S2FA 1KJRA 4OI1A 4O9EA 5L7OA 1JN2P 3KGZA 5FZ9A 2XKOA 1UOBA 1R64A 3JQXA 4PJYA 3QOPA 1XYNA 2YPDA 2BZDA 4P08A 5BXXA 5JOYA 1OURA 2W9XA 4LA3A 4YW1A 1HV0A 4IGOA 1GP4A 1GQHA 2V4VA 4GZ9A 2PAMA 2VNRA 1R1A3 3J8F2 1PMHX 4YVWA 5C4WA 1RC6A 2GP5A 2RDSA 2VM9A 4PLNA 5FZBA 3GF6A 4RYDA 3AKTA 2C9KA 2O1QA 2XVGA 1Z0HA 1P8JA 2W3JA 3FHAA 3KQ4B 2XBO2 2B8MA 4ES8A 1AX1A 4R9DA 1EUUA 4YZ1A 2JXAA 1DQ2A 4Q2FA 3BU7A 3PUHA 3LDKA 5F3EA 2BWCA 2GC3A 2X5IB 2FDFA 1JZ8A 1H8TB 1FMD1 1V00A 2L9LA 1TVGA 4MH0E 2YGMA 1OLQA 5F7UA 4E8CA 4TZDA 1SLBA 1HRV3 4A3ZA 1OFSA 1PVC2 4UW4A 2A7AA 2R061 4OI4A 1I3HA 3VD5A 5C8CA 3FFQA 1VBA2 4JQTA 3H8UA 3J26N 5CKNA 4JDNA 2VGDA 3PJYA 4NWWA 1X9PA 3DF0A 5FZ0A 1G7YA 3U78A 1RMU2 2BBAA 3WSOA 2A73B 4AAXA 1YI9A 4P5HA 4LJHA 1S1AA 4HK9A 4HVOA 1PM4A 3ZXDA 1BCXA 1US3A 5F5IA 1NA1A 1WZXA 3C7FA 5EXOA 4IV1C 1K5MB 1GP5A 3B7MA 3R0RA 3W5NA 2RS13 1IOAA 4UOJA 4LBQA 4QHBA 2VNVA 2YU1A 1YQ2A 4H55A 2VTXA 1H2KA 2YBSA 1EV11 1ENSA 2AC1A 4WVVA 4FTBA 4NPLA 3U14A 5J7MA 4DUWA 3A4UA 5JLVA 2CGNA 3VKNA 4WVMB 2OPWA 3RYRA 5KXCA 3VKOA 1EUTA 2JE9A 3CJXA 3SNMA 4PCRA 1W8ZA 3SCGA 1Q8SA 2JG9B 2Y34A 3ACFA 3OJBA 4OFGA 3MV11 5A32A 5A7WA 1URXA 1JYNA 2GC0A 4QQ2A 5CU1A 4J25A 4I0AA 1R1A1 4NJ4A 4XHBA 3W21A 1UU6A 3CZJA 2PHTA 2QFEA 4K8FA 4XZUG 2ZJCA 4ZS2A 4YSFA 5FZIA 3VBFB 3M3CA 3ZX7A 5A1LA 2R043 1REDA 4Q1RA 2VMHA 4P9XA 3KZ4C 5DZFA 3AL6A 3RZLA 4LO5B 2W52A 2VMDA 3ZYRA 4S2GA 3MLKA 3EMRA 1DGWX 3ZPYA 2BGPA 2ZZJA 4YARA 2RDRA 1J58A 4Q4V2 1HRV1 1VBB1 4ET7A 3GJBA 2FDHA 3VL9A 4Y24A 1Y9GA 4FT8A 1UY0A 2C24A 1JBCA 1NCRC 3UYJA 2XPJA 1V6NA 1W6PA 4QKNA 4MZUA 2RM22 1D4M3 2ZGNA 1H6YA 1DQ4A 1K45A 3DL3A 4PIXA 4JAAA 1OFNA 1OOPA 4YWAA 3WY6A 3A21A 1QH7A 1YXWA 3K75B 5FLHA 1X8MA 4JTNA 4CCKA 3HNBM 5A33B 4AEMA 1OBNA 3HNYM 2VL4A 5DUVA 4IEVA 3CJIC 4Q4X3 3W58A 5CFCB 2D44A 1S4CA 4M4PA 2RJKA 5LRSA 3AM2A 1ZRIA 2Q8EA 4R9BA 1LHWA 3SQOA 4WZFA 5L7OC 4Z92B 1I5ZA 3M2MA 2XKPA 1L3JA 4C0HA 3ETQA 5FOJB 1SLTA 2ARCA 3K48A 1TMF3 4CU7A 3IZOA 4HSLA 1ASJ1 1DQ6A 4QXHA 5IVVA 5F5AA 4UWDA 2PQSA 4QDRA 5FPXA 1REFA 1NQDA 4URAA 1O59A 4ZPIA 2WDBA 4K6BA 2ZGMA 3B93A 4CDUA 1Q8QA 5KWRA 2BYVE 1W90A 3VZJA 3O7OA 4LUKA 3KD4A 3THPA 4PBOA 5T50A 5K4LA 1HXS1 4BM8A 2Z5WA 3OB8A 5IK5A 5GZCA 4Y22A 1UQXA 4XDOA 5CG9A 5I8SA 5CFCC 2W47A 1HRI1 4A7ZA 4Q4Y1 4AWDA 1GFF2 1JZ3A 4K9SA 2W0XA 3OY8A 4B4RA 1LHOA 4DEQA 4I30A 1F5JA 5B4NA 5F3CA 5JPNB 2XBO1 1R081 1JH5A 3BIWE 3DECA 1MQTC 4A6SA 1GOHA 1OC1A 2D3SA 3OG2A 5J1XA 1POQA 3K2OA 4YG6A 3AZYA 5LRRA 2ENRA 3BTXA 4Q4W2 1LGNA 1W8UA 3LFIA 2VMIA 3ZYHA 2BVBA 4IXLA 3IWZA 4DXTA 4WZCA 3DEMA 5FZKA 5KHKA 1AR82 4LBLA 1N1YA 4P02B 4QDSA 3ZIWA 2I74A 2QQKA 1SG3A 3RYPA 3SEPA 2DVGA 1FXZA 2ET1A 2ZGSA 2CAUA 2PHRA 1H1IA 1VAKA 4JRLA 5EJ3A 3HJRA 1DQ1A 3Q8AA 3ZXKA 1H8TC 1B35B 5FTTC 2PXJA 2Q8DA 4LMFA 1AR63 5DDJ2 3GALA 1CN1A 4MV2A 1RUD2 3NKTA 3KV5A 4XJAA 3VUOA 1V6OA 1C5HA 4FPYA 4UW6A 3NNFA 2QUOA 1AVBA 1SMVA 4W6YA 3I2DA 2BNMA 2JG9C 1BEV2 4I0WB 5FJHA 3U11A 4R52A 2G19A 4CUAA 5CADA 4NR1A 4L9BA 2GC1A 4CU6A 4QXKA 3JB4C 3MV01 3GBGA 5FWEA 4A3XA 4A42A 3BTYA 1GR3A 1UU4A 4RD7A 3TWIA 1OLRA 1MVQA 1RUJ2 3GM8A 1D0GA 1OQ1A 3HQUA 3LQCA 5DAQA 3T2QA 1LOFA 4FAGA 1JOJA 2PHUA 4XOGA 5EJZB 5FZ7A 4FBFA 3CNAA 1QOSA 5AFBA 4FP2A 3WF4A 5JCTA 4LK7A 5IK8A 1RMU3 4M3CE 5FY0A 3ROUA 2EIDA 1DU3D 4CP0A 1H9PA 3TEXA 4J1WA 1LR5A 2WNUB 3RZJA 1WMFA 3EBRA 4HKLA 3FE5A 5T52A 2HEYF 4DS0A 3I8TA 3ZDVA 3OD4A 2D5FA 1QJU3 3ZYPA 4QPIB 4QD2A 3ZXLA 3ZFFA 4LULA 1UF2C 2DCKA 2HYXA 1F9KA 4CP9B 3WHTA 3MGUA 4W50A 4YLZA 4K8RB 2LS6A 2I07B 2HBTA 5A7QA 5K0UC 5C3SA 1U5XA 4DXSA 1NLQA 4AK3A 1PVXA 4FPOB 4B8EA 3I54A 3MIDA 3JCIA 1POV3 5ANNA 3BPSA 4OHZA 4AXOA 1E5HA 1U5YA 2FZ1A 2TEPA 4NO4A 4MGTA 2C6SA 4FI9A 3NAPB 4OYUA 1FV3A 5E8AA 4BDVB 2MPFA 3T30A 4XDQA 1Y43B 5IWFA 4QXCA 2GDFA 2Y38A 1FAYA 3I2FA 4RFRB 1RXFA 2QQIA 3BUCA 1MS3A 5IVYA 4AZZA 1OVSA 1JUIA 2RS53 3MPPG 3OF1A 2VUJA 2CGOA 1VBC1 5IVJA 2XL9A 1KJLA 3VDBA 1Q56A 4CZSA 5GLVA 3AJYA 3AMPA 2AACA 1U5IA 4E4HA 2H6BA 4LNVA 2HEVF 2YV8A 5C3RA 3BODA 4TYSA 4UFHA 5L36A 1N1SA 4PIZA 4CEWB 2CU5A 4QB6A 1QXJA 4OZOA 3I2OA 1NXD1 4RQPA 3OYWB 5JMOA 2VPVA 3K3NA 1XSQA 2BV4A 5M0TA 2CGPA 5J3UA 2OA2A 3Q9OA 3WVJA 1OQEA 1VBD3 2WQ4A 4Y5TA 2JDKA 1U0AA 2R071 2TBVA 3OPTA 2VQTA 1O3QA 3I2HA 2B42B 1AXKA 5LCWL 2J22A 2VCMA 4AI9A 5T54A 3T4HB 3QLQA 2WN3A 1H4GA 2OUJA 4LBJA 4GB32 1GICA 3C7EA 4XUNA 1S0GA 2VW0A 3HAGA 4CDXA 4B4QA 4QKDA 4INDA 3OOXA 5FP4A 5FOBB 4D8MA 2ARAA 2WNVB 3D4KA 2X5IA 3RI8A 2E51A 3EB7A 2PAEA 2ZBJA 5FAXA 2YZ4A 2AR6A 4Y20A 2W08A 1ZRFA 2IVIB 2MEV3 1NCRA 3NRUA 3UK9A 4CCNA 3N35A 2GNMA 4M0NA 3PDQA 1GZ9A 3ME2A 4AFBA 4LIVA 2BTVC 2BWAA 2D6KA 3KMHA 4HK8A 4KG8A 1AL21 3S0MA 1PVC3 3EJKA 4DRRA 3LA3A 4UI9L 4CVUA 3T0DA 2B46X 4WM7A 1ND3A 1K12A 3WX5A 5B2GB 1QJX3 2WA3A 1VAVA 4C1WA 2HWC1 1XE0A 2VU9A 5JXGA 5A6QA 2D3RA 3ZR6A 1W6NB 5JOWA 2DF7A 4ES9A 2WNVA 1EAH2 3NKGA 3OGJA 1VPHA 3ZR5A 4QB2A 4GALA 4PF1A 4OMDA 4YZ4A 4D6SA 4QHZA 1UY3A 2VR4A 3U4XA 2DBIA 2WWJA 4KWJA 4QQHA 1Q5OA 4OVEA 1UD1A 5JWPA 1GQGA 1WW7A 3WT3A 1ULPA 1BMV1 5CEHA 3RWNA 1QOTA 2JDAA 3H50A 4PDWB 2IXIA 1MS5A 2E31A 3H7YA 3I2JA 5DZGA 2FMYA 5LBEA 3ZFFB 3H7JA 4FFIA 3AL5A 3VDCA 1W6QA 1OMIA 3GGLA 4LOTA 3VBUC 2R1BA 3WHUA 3PJQA 4V2VA 4Y5SA 3WW4A 4CDUC 1AZDA 2RMU2 4GJZA 1AL0G 1JYWA 3OGGA 3MUY1 4RFT0 3VD9A 3FJSA 5A6YA 1RUE2 5I8TA 1PO11 4FQZA 4GWNA 4L99A 4AAPA 5JSPA 1IKPA 2ZX0A 3C7GA 3M4FA 3OSDA 4IEOA 4OI0A 4XBQA 5KXEA 3DPRC 1CAVB 3DPRB 3E5QA 4MYEA 4BZ4A 3DYPA 4BH9A 1QXPA 1OHFA 3DUIA 1BJQA 1T2XA 2WO3A 2ZCWA 3NVCA 4BU2A 1S0CA 3LDBA 2FCVA 3BOWA 3LSEA 4YNIA 1VALA 2VZSA 5BUVA 3IT8A 4K1YA 2MEV1 3IB3A 3AKPA 1ZRDA 4AF9A 2J1VA 4D0QA 3N9NA 3IMNA 1CAXA 3AKRA 5CIRA 1T6GC 4JDMA 4DO0A 1OOPC 4BHPA 1PO21 4RN5A 1AJOA 2K0GA 4XJ9A 1S2BA 3I3BA 5IFTA 4LEJA 5K0UA 1GWLA 2R072 1CAVA 1X36A 2WNOA 2XWBB 4FOWA 2EAKA 5C70A 5T5PA 1IS5A 2RS11 2WAAA 1B35A 1O5LA 1N3PA 2WNEA 3AMHA 3DKQA 4IEPA 3KLSA 4TTGA 4BLJA 3GHMA 3IAPA 1UXZA 1WCUA 2QZ3A 1FYUA 1XNCA 3CMGA 3MBWA 1F4HA 1JZ6A 1OH4A 3B01A 3B69A 3WEZA 1JYIA 1OI6A 1X7NA 4CUCA 3HQXA 1W8FA 3J7NA 3MI8A 5K8SA 1PK6B 2XWJB 2C1FA 2UY8A 4XF3A 1N1VA 4JX0A 2V4AA 2D3PA 4TSVA 3VD7A 2ZMKA 3RWKX 5FPUA 2HKXA 2VD7A 4XUPA 1UO9A 3PLQA 1K3IA 4YZ5A 3K3OA 2YGLA 1NE6A 4QQLA 3HT1A 2TNFA 2AEYA 5FZ4A 1OKOA 3LD8A 1W6NA 5HCHA 1W05A 2O8OA 2AUYA 5E16A 1EYBA 1RUD3 3TEYA 3JXSA 2IUWA 5FUIA 3KF3A 2IXCA 3UNPA 5EP9A 5F3GA 1C8M3 3ECQA 2VUDA 1W2UA 1LOGA 2Y6FA 3ILNA 4L2NA 4V1PA 4ZS3A 5LBCA 3ZYBA 5HXMA 1ULGA 3O1TA 3C3VA 1COV1 3ZN5A 1JW6A 5HCBA 4XFBA 4XABA 1Q43A 1SZBA 5D1IA 2R062 2G4IA 5HV4A 2O8QA 1Q3EA 3AP9A 4N9IA 1H8TA 1RVF2 2ARXA 4DFSA 2XQXA 4RQPB 4Z8BA 4I3GA 2HWD2 2BFUS 4Y20B 1WUVA 4YYOA 2KR2A 4E4ZA 3ELNA 2P34A 1W39A 3HR9A 4MGZE 4N7IA 1BEV3 4CEWC 3WF0A 2VZUA 4K3UA 5BNNC 1JZ4A 3U0ZA 4BQWA 5ABJB 2QJVA 1X33A 4AOCA 3VBHC 2EXJA 1AXYA 1FT9A 1JMUB 2W92A 3K46A 1OD5A 3ACIA 3NJZA 4R4XA 3TNQA 4EE2A 2VVFA 4H14A 1A6CA 4NE9A 4Y22B 5J98B 4RR3C 2XHNA 4E9KA 1EPWA 2D5HA 4HPKB 1RUE3 3KT4A 2BPA2 3KQRA 2UYAA 2DV9A 2E6VA 3JD71 5A3LA 5BPXA 3RQ0A 2R32A 4LO6B 2E9QA 1GWMA 3PTYA 5I0TA 2X05A 2PHWA 4P00B 2JB4A 4EV0A 3VBOC 4CDWA 2JKBA 2VO5A 5EFUA 1O3SA 2ATFA 5DXDA 2LUWA 1W8WA 3GJAA 2JDZA 3NNGA 1UAIA 1NZIA 1CAUB 3LFMA 3BKZA 3FUOA 2A71A 3N7JA 4IESA 4G3YC 4LT5A 1GANA 4AGRA 3IAQA 1VMFA 2VCCA 3J7LA 4HXCA 1PMJX 4YW5A 4CE8A 2JG8A 1KRIA 5HV0A 3EXUA 4NIIA 4FXGB 2H6CA 5JSRA 2RS32 5FZDA 3UL2A 1H6XA 2VTXJ 4P9WA 5IHRA 4J1XA 3WCSA 4KBZA 3FHQA 3N7MA 4MO3M 2NP0A 3WF3A 3AYAA 1DYPA 2A5ZA 1YIFA 4DPNA 2VVDA 2VY0A 2P6HA 3J8F1 4CDQB 2QDNA 3H1WA 2VQ0A 1XSRA 4PQ9A 4CDQA 5FYHA 3VBOB 2O14A 1LOBA 3OBAA 5J36A 2OQ7A 2WABA 3O5SA 1MQTB 4EWEA 3I3DA 1VBB3 2OUHA 5EIYB 1MPXA 4GKYA 4BIFA 2VCBA 4A7KA 3C7OA 4PDWC 2FQPA 4ORFA 4QDQA 2XLFA 3KVAA 5A32B 1BKZA 4HT1T 4DUVA 4QPIA 2ZX3A 1W2OA 2DVBA 2ID4A 5LA1A 1CVNA 1UX6A 2B9UA 2CNAA 4F3JA 3L2YA 3IM0A 4IV3C 5IAVA 4Q4V3 5FXWA 3O0WA 4XXAA 2J1EA 1ZZCA 3OBRA 1FPN3 1PX3A 2W1UA 4IW3A 2XJSA 1B35C 3M70A 1JU3A 2WQZC 2D6OX 4GAZA 1C3HA 1V0AA 4GB31 2DYCA 2XVLA 2P3IA 4LLOA 3ZMOA 1D0HA 2WS91 1LTEA 2D7FA 1OLME 1EV13 3UKVA 4FP3A 1CZTA 2OIIA 1GU3A 2RS31 3ES4A 4N43C 3T2TA 1K5MA 1DGRN 1V9U2 2Y6HA 1MEC2 2RDQA 4YM2A 3WQ0A 4IEXA 4K7JA 1W06A 1VR3A 1XNDA 4ZHNA 1VAMA 5BNOA 3V0AB 3IPVB 4Q4W3 2XQRA 1KFUL 4E2SA 1TMF1 3BTAA 1ZYBA 1LODA 2OZ6A 3POYA 5LBFA 3I2KA 2Y26A 5C9AC 3V65A 4PDWA 4NIGA 4FPKA 1JYCA 3H3UA 3POFA 1GYKA 4JKKA 2VZTA 4D7SA 5FP8A 3WP4A 2DCYA 3RMYA 1XRUA 3IDBB 4GQ7A 2ZKLA 2VNOA 5JXJA 2CDOA 1KITA 2OXBA 5CG8A 3C8XA 4U2AA 1ZZ7A 2Q5TA 2A6VA 5JXHA 1QWRA 3CO2A 3LSDA 3AC0A 4Q0QA 4EZHA 5IYYA 4E2GA 3X29B 1DYOA 2RM21 2ZPXA 2XONA 2WWUA 3LEMA 3VBRC 1WCKA 2NM1A 3RMXA 3VL8A 2VZPA 1RUF2 5CISA 4G9SB 4LBKA 4K21A 1SBDA 5C8CB 1W04A 4OCTA 2A3YA 2A6WA 1RUC2 5IJRA 1DP0A 1VRH2 3RZZA 4XMAA 4AGVA 3JU9A 2JEMA 3OGSA 5HXVA 1YWKA 3OUHA 1QNWA 3EYPA 5FMBA 1NCRB 3VKMA 1O4ZA 4AEDC 3USSA 1STMA 2HWD1 3EQEA 5EV7A 3U07A 1UL9A 4A44A 2Q1FA 3OYWA 1FMD2 1UY2A 2QQWA 3NJYA 2YBPA 2DDUA 1K42A 2D6PA 2ZTNA 2EXIA 2W1QA 2WA4A 1FOD2 3IDAA 2ZHNA 5GZFA 5JR7B 5ABJC 2JB8A 4OMCA 2GNBA 2A6ZA 3RGBA 5FJKA 4KNCA 3GBWA 1F4AA 3D3AA 1RUOA 3KWVA 1HX6A 3ON7A 4OULA 2EIBA 5LK5A 4FFGA 3WF2A 1FOD1 1ZX5A 5APAA 2WINB 1C5IA 1QMJA 4CPBA 1I9RA 3WW2A 3KV4A 2XLGA 5FIXA 4TWTA 1BVVA 1Q8OA 3ZM8A 3FWEA 3AYEA 3OEBA 5BNQA 1WD3A 3Q8CA 4CEWA 2AZ5A 5IVBA 3ASIA 5FUPA 1H2NA 1YQ5A 1UIKA 3MUZ1 1QXRA 1QJY2 1UPSA 4MXWA 5BNOC 4HZFA 3VN4A 1ZBE2 1EV12 1YFXA 1YQCA 5TSWA 2PA7A 2B45X 3ZYIB 5C4WB 4IV3A 3CQOA 2VJXA 3LE0A 1HXS3 5LATA 2YFUA 5FMOS 4OUMA 3MIHA 4FPHA 1RUD1 1Z78A 1HB2A 3MW4A 3HD8B 4JGYC 2YC4A 4F7ZA 1V6KA 2KD7A 4E4DX 4ZZ5A 3A0KA 1MZEA 4Y3OA 2W94A 3EHKA 3WR0A 1SEFA 4AFCA 4OZXA 4CCDA 1SPPA 3UESA 3FLTA 4O61A 1OF3A 3WQBA 3BYWA 2WT1A 1E5SA 1SHWB 2YY1A 1YQ6A 1HIXA 1ZNPA 2VBPA 2WQ8A 5IT6A 4QPIC 2BERA 2E26A 1B09A 2HH9A 3CIHA 5T5JA 1AYN1 1CJDA 3MFAA 3T3YA 3NV1A 3TOJA 3CDZB 3P5BA 3HQRA 4XQWA 5EZWA 1W2AX 1ULDA 4Q0VA 2AYHA 3S6PA 1QJY3 2NLRA 2TUNA 2XR4A 3V56A 3W9AA 4CEYB 4CDWB 5JMCA 5L9BA 4CRQA 2XH6A 1WW4A 2DFBA 4UFMA 3GCWA 4W6WA 1CPNA 1WW6A 5J48A 4RR3B 3AYDA 4AFDA 4CCEA 3QACA 1MS1A 1RUJ3 4Q4X2 4WBBA 1LESA 1DZTA 2XG3A 3CJIB 2IXLA 4LR4A 4QKFA 4BK5A 3LZZA 4LKFA 3VBOA 1N1TA 1HRI2 3AZVA 4QM9A 4RHV2 1NY72 3ZIXA 2IXKA 3VZKA 5LA0A 1A78A 3SXWA 3FBYA 3ZFGA 2RS51 1GOFA 5KR7A 1YLLA 4LBNA 2MEV2 3NV4A 3O0VA 3R6SA 2WNVC 3IDCB 3VHOA 1DG6A 1PZ8A 2VZ3A 1KXGA 4XQDA 5CA6A 3PTRB 2XJRA 5EHDA 1WW5A 2ZKNA 3BVCA 3FLRA 3AMMA 2NN8A 5C3PA 2RS52 1BLZA 5A3OA 2VC9A 1SCRA 3DV8A 2XJUA 2P5BA 2WFF3 2YUEA 4DEVA 1RUC3 1UY1A 5CFDA 1ONAA 1UNBA 2W1WA 1ALYA 2PYTA 5JIAA 3WP6A 4CUGA 1VB4A 1PIV3 1JZ5A 3I2IA 4QX5A 2BNOA 4BB3A 1PO13 3ORJA 4D3WA 4AEKA 3BOPA 1LU2A 4DY5A 4CXYA 4W4ZA 4BQ5A 5F2SA 5IK4A 1M4WA 1GZWB 4EROA 5T5LA 2YG0A 1ZBA2 1C1LA 2OKXA 2DCJA 1BK1A 1WMDA 5ANQA 5FZFA 1QDCA 2PAKA 5FY8A 5DABA 2E53A 2WJSA 4DZGA 3IN9A 2ZX4A 1JYVA 1C28A 1AYN2 3G6JB 2WSVA 4JCKA 3BTZA 4GJYA 5CFDB 2X8KA 2Y60A 2Y6KA 2HLEA 2XDVA 2QCSB 4IE0A 1MZFA 1OPMA 3ZXJA 2WL1A 2XUEA 3IBMA 2JE7A 2H0VA 2RJLA 3K77A 1ZBA3 1FV2A 4L11A 4M4RA 1XC6A 2E32A 5HPOA 5I0DA 1ENXA 1YO8A 3ZXEA 2PLV2 4E8DA 4BWOA 1QJX1 2FHRA 2RV9A 5I0RA 3LF7A 2GU9A 4TLGA 2V5DA 5I0SA 1ZBE1 2GH2A 1DYKA 1H4HA 1VBC3 3MF9A 4AFMA 3WDTA 5JIUA 4XHXA 4AVTA 2R7EB 2ORZA 2YROA 4YGBA 4EJRA 2CL2A 5C8CC 5D21A 2EXKA 2VAUA 1WWYA 2ZACA 5F6KA 3H8XA 3LEKA 5HBAA 5FXXA 1X50A 2JIGA 1JOPA 4RR3A 2GP3A 1GUIA 1HB1A 3WINE 4FPCA 1XYOA 1RUG1 2JD4A 1AR62 4YGDA 4WM7C 2ZAHA 1GMMA 2P3YA 4YM0A 2WFF1 3KCYA 4HL0A 3B9CA 5EYYA 1G6NA 3N9MA 3PVBB 2VOKA 2XJTA 2ZA9A 4BLIA 3ILFA 4JGYB 3LAGA 3H9AA 4UFIA 4XETA 4RL7A 2YDEA 2HWE2 1OA2A 3WUDA 4G4FA 4XXPA 5FYCA 4BPZA 4BXSV 5C5UA 3O1RA 4BMBA 2D98A 4NAMA 1PO22 4IE6A 3PUSA 4A7YA 2DTWA 1PGL1 3BU0A 2QQPA 3H8RA 1BHGA 4EYUA 4IL7A 1WBLA 3KS7A 4LHNA 5JI7A 4AVCA 4BISA 4CU9A 5AC92 3NO8A 5FWJA 4GIQA 3F95A 2WNUC 2JWPA 5GJ6A 1PK6C 2EXHA 4L0PA 4WM8B 4D94A 1RXGA 1X9TA 3POBA 4Q26A 3T2OA 2QQVA 2E63A 2P1BA 4QAWA 4EN8B 1GP6A 5A6XA 1CZSA 1XNTA 3ITQA 3TNPB 4J6GA 5F3IA 4PIYA 3PIJA 1PGW1 1WMEA 1PO23 1D4M1 5T3NA 3T08A 3DYMA 3LIGA 1RUF1 2CWSA 4MHUA 3NAPC 4RSUA 5FO9B 3E6BA 4IERA 4AI8A 2RMU3 3A22A 3P1IA 1ST8A 2HWC3 2YC2A 2G1MA 4H3WA 2IVJA 4AVAA 4IGPA 4DXZA 2WRAA 4RGAA 2JG8B 1IS3A 1WKYA 4YZ2A 1UIJA 1FOD3 5FZAA 3N4MA 1MS9A 4D6QA 2WZR1 1G9AA 1NLRA 4QPGB 2FBEA 3SHRA 2WFF2 2O0OA 4W65A 3VBRA 4NWVA 4ZONA 3TBDA 2ZX2A 4MLOA 4QXBA 3FC0A 1W6MA 4NRPA 5FP7A 1TMF2 3J7HA 3NNLA 4AQTA 2JIJA 3VZNA 1IKQA 1MS0A 1AXZA 5J09A 1XE8A 1H2LA 2DTYA 1UZYA 4GH4A 2FD8A 4HKOA 2CY6A 3LGRA 3ZN4A 5BYNA 4CYDA 2H0BA 5FKCA 5F5CA 2HJIA 1G86A 2WS92 3MDPA 1VB2A 2VBDA 1W9SA 2A3XA 2BUKA 2VUCA 3I2GA 1LB2A 4AYUA 1UYPA 2A70A 3C2UA 3ZOIA 3KHCA 1FNZA 2Y0OA 1O3TA 2W2IA 3WW3A 1NA1B 2ZGOA 2CWMA 2LTNA 5HCFA 4NHXA 4QPGC 1VBA3 3RS6A 2VW2A 4XUQA 1VBE2 2CAVA 3NSTA 4UFKA 4CTEA 4JKMA 1R093 4NROA 2X53S 4EWAA 1GKBA 3CLPA 3ZN6A 4BA6A 3LOBA 1JI6A 1W03A 2UWBA 4YRDA 1SLIA 5IVEA 2MNGA 1YI7A 2IXJA 2VMCA 5GM0A 2OS2A 2X29A 4XJ8A 3BPZA 3VDDB 5I93A 2G9GA 3PVOA 3HPNA 1GLHA 4LUMA 4KBBA 3THDA 4JTOA 2VZ1A 5EYXA 3MIBA 5ACA2 5JR2A 1BXHA 4LO4B 1GQPA 2ZS6B 3DN7A 1AL23 4QX8A 2ZHMA 4K40A 2JDUA 1S0JA 2XJVA 5LA9A 4CA9A 4FPGA 4E4SA 1CAXB 1SACA 4QB1A 5FBJA 2RMU1 2Y64A 2DUPA 2GC2A 4ARXA 1QEXA 3OBTA 4OI2A 1LULA 5JZGB 2GAUA 2XOMA 3NAPA 3OD0A 3WF1A 3P3NA 2VTFA 4CDXB 1XXNA 3URFA 5ISLA 3M3OA 4YZ3A 3H0OA 4QX1A 1BMV2 4OHVA 1IG0A 4QGLA 4KGGA 4XFCA 1AYM3 5L73A 5GLWA 3DGTA 5ERLA 1UOGA 3D8CA 3S7IA 1CGPA 3IIIA 3UGGA 4AHZA 5FPAA 1HW5A 1GZTA 2V73A 2N7GA 1LENA 1CJPA 4GH4B 1DZQA 2FMDA 4H7MA 1C4RA 2QQJA 5IW0A 4UT5A 5GZGA 4NHMA 1IGOA 3S57A 4Q4Y2 3D0SA 2JDMA 2J1SA 1PIV1 5CKMA 5FY1A 1UMIA 4CUBA 1TE1B 3AX4A 4LITA 4MHRA 3VHPA 3WQ1A 3O1MA 2V09A 4LORA 1QKQA 1PZ7A 4PI0A 3SEEA 3SLIA 3PURA 5JUVA 4DB5A 4XW3A 3WP5A 5FXZA 1W3XA 1AX2A 4A2UA 3NJXA 3AK0A 1MZ6A 1KDKA 1V70A 4Y1ZA 3ZSJA 1SPPB 1JYXA 5LASA 2JDYA 3O1SA 2B5HA 1ZRRA 1E57A 4M01A 1LEDA 4URTA 1CD3G 2DU1A 2E7TA 2VOTA 1SFNA 4Y26A 4YM3A 3NL1A 1VBC2 1ACCA 3RYKA 4CCLA 1TME3 2F4PA 4PQQA 2W68A 1CAWB 1RUI1 4UF0B 5H9PA 2DVFA 4Q4V1 5E1RA 3KGLA 5A3WA 4W8JA 1HKDA 1FPN1 1ODMA 5FLIA 3FLPA 4XJZA 5CKQA 4Z07A 1I6XA 5C6CA 4GB33 3V0BA 2C9AA 3I3EA 4L92A 5FYVA 4AVBA 3WDWA 1RUG2 1ULCA 2VE1A 3HBKA 1O8PA 1YEWA 2QTWB 5LEJA 5LA2A 1MVEA 1ZBE3 2ZGKA 2ZHKA 4LKDA 3AMNA 1QQP1 1VP6A 2Q30A 3CEWA 4LK6A 3VZOA 4NHLA 3U4SA 4AGGA 4CCMA 2JDNA 1YFWA 4N53C 5FXVA 1HRV2 3WNMA 5BY5A 1C1FA 4RS5C 1PNFA 1RUNA 4CSWA 2FDIA 1BQPA 2FCTA 5A3UA 4Q8LA 1WCDJ 2AREA 1YYNA 5I0UA 3S30A 3ZSLA 4BJ0A 4UFJA 3LIHA 4EN0A 2WN2A 3R05A 1D2QA 5CYYA 1PGL2 3H1MA 4YVSB 4IV1B 3BCWA 3AVSA 3QBQA 5DG2A 2FZ2A 5A3TA 3ZPOA 5FP9A 3RZGA 3HBZA 3WG2A 4YGEA 1C8M2 2OX0A 3MLJA 3RPQA 3VDAA 4XBNA 4L8QA 4Q4Y3 2PTMA 1BK0A 1TNFA 2A3WA 4NMIA 4RGGA 4OUSA 2HWE1 2WZEA 2WYSA 4CCOA 4YPJA 5SV5A 5A7PA 4KG0A 1WCSA 5ACA3 3PMSA 1QH6A 1OH3A 4KMQA 1EP0A 2X10A 3AP4A 1H1AA 1XQNA 4XPVA 4ZXEA 1WD4A 5JI9A 3M3IA 1IS6A 1K5JA 3WNKA 3WUCA 4XFHA 2NQYA 5FLJA 5FP3A 4XFGA 4AVVA 1Z7S3 2CHHA 4P9YA 4A4AA 4DIQA 4QPWA 2GH8A 4LO8A 1N3OA 4QQPA 3AZZA 3MLLA 3VV1A 3VBHB 1PVC1 1KQRA 2XJQA 1J3PA 3BI3A 1QQP2 3USUB 1O91A 1R1ZA 1RUJ1 2LM3A 5AVAA 1J3RA 2PMWB 2X09A 2WS93 4XURA 5D8AA 4ZXKA 3RZKA 4FAHA 5CFCA 4FTSA 5F8PA 3FUQA 1W3VA 1RUE1 1TZOA 4IV1A 3V0AA 4EZ4A 1QOOA 4YW2A 4FXKB 1BVP1 4IEYA 1GZWA 4LHKA 2DUQA 2B39A 3JD73 3UT0A 4COUA 5JXIA 1EY2A 3BB6A 1RUH2 1UW8A 4H7LA 1J3QA 2WT2A 4RQPC 2BP6A 5C8WA 1ASJ2 5FZOB 5H9RA 2BRTA 4COWA 2E7QA 3JZVA 3CZUA 2QQOA 4Y5Z0 5SV8A 4QPYA 4JGZB 3HMYA 1UOJA 5DZEA 3U37A 2BGOA 3INAA 4IEUA 5DPNA 5BNPC 3MIFA 4LE3A 5GALA 1PM7A 1RHI1 2XB6C 4CEYC 4CDUB 1ZVFA 4C1XA 4IUGA 5K7PA 2HWB1 2JE8A 3DXUA 4EQVA 1JU4A 5GLUA 5DN2A 3ZYGA 5FR3A 3RJ2X 1D7PM 1GV9A 5D8AC 5LW9A 2VZRA 3VZMA 4QQOA 5JZGC 5DUXA 2J1TA 2ZZQA 2ARBA 4HSJA 2FCUA 1J84A 1MQTA 5LBBA 4OQ9A 2PHDA 1H0BA 1HXS2 4LA2A 2GNDA 5FYBA 1S0IA 1UKRA 3H1YA 3VD3A 4AI0A 5IVCA 4GD4A 3PNAA 2Z2SB 1QJEA 3NV2A 1OXCA 3B02A 1VBB2 4CP9A 4D7TA 1LOAA 1HJFA 5F2WA 1OT5A 1YJKA 1V6MA 2P3KA 5BNPB 2HWD3 1Z7S1 2ZHLA 3IKWA 5FYYA 1AR91 2Y0IA 1KGYA 3LEIA 1Y3TA 3O0XA 4LQRA 5FQ0A 2OVUA 2D43A 3ZXFA 2K46A 4ASKA 4WVZA 1AYM2 2R042
chains in the Genus database with same CATH topology
3HIFA 2PFWA 1UMZA 4I3PA 5DDJ3 3SITA 2DU0A 3ZFEB 4S2DA 1IPKA 1IQAA 3BALA 3U10A 1ZZBA 1YFYA 1SLLA 1H30A 3KSCA 2RHPA 3R4UA 2IXHA 3ZSKA 5GLTA 2OYZA 1Y9QA 5IUQA 1Y7BA 2PQQA 5J37A 2ZAAA 3WCRA 4Y1UA 2XJPA 1Q8VA 3SH3A 1NQJA 4WM7B 3OTFA 4M3CB 3APBA 3USUA 1FI2A 5GKAC 2AH2A 5T55A 1LECA 3S7EA 4PF5A 2HYKA 4GULA 2ZABA 3I59A 5T5OA 1AUYA 4IEZA 1ZRCA 2DFCA 1J1LA 1JHNA 1HV1A 3M3QA 4QGMA 2ETEA 1OQDA 4XF9A 3ZFEC 4XZPA 1FX5A 4XMIA 5FMOL 2IC1A 2BVVA 2DWRA 4JC1A 4AQ2A 4XTMA 1U12A 3M1HA 2VXRA 1R083 1JUHA 1DGWA 1ZZ9A 4KL1A 2NYYA 4NOTA 3MF6A 1J59A 4MGYE 1UPIA 4LO7A 1F8VA 3B3QE 1O4YA 1HQWA 2ZGTA 3NWKA 3WXPA 4IQPA 4HVRA 2R16A 4FCAA 4GMP3 4XTPA 4RS5B 2ZOEB 1PNGA 1TEIA 5F5QA 5C4WC 4KU7A 1RUF3 2R6QA 1V9U3 3CF6E 2ZGLA 3ZO0B 2DUOA 1M06G 5JDBA 1AR61 1WGPA 5KXDA 3GBFA 1X8EA 4BQ1A 1AHSA 1S0EA 5FCCA 5BNPA 4QM8A 1A3KA 4EN7B 1D4M2 3QH7A 1PHMA 2YYOA 3QCWA 4X8PA 3WQ7A 1MEC1 2HEWF 4E2QA 1DBNA 1VJ2A 2QZ2A 5E89A 4ASLA 4IEWA 1G9CA 2EALA 1OA3A 1RUC1 3MW2A 3RG0A 3MFCA 3TN93 3ZYJB 4JQRA 2R041 3AFKA 2PLV1 1PO12 4HKWA 3N36A 1PIV2 4R9CA 1RMU1 4FQ4A 2ZGPA 1PMIA 3VGIA 1JXNA 3LWCA 1VBA1 5E88A 2WNUA 3M3EA 4RA0A 3GZAA 4AEJA 1ULFA 1G9BA 4XILA 4Q8KA 1WLCA 1IZ3A 3VDDC 3SCHA 1QGLA 2PHFA 3OCPA 4P9JA 3DKWA 4AI1A 3L2HA 4D69A 5DUUA 1ND3C 3VHNA 4Y1YA 1DQ0A 3WLUA 3MYXA 3LA7A 5BNNB 1ZBA1 3J4UH 1V9U1 1QDOA 2BNNA 4GH4C 4P9GA 1S0BA 3JBG1 2HWF2 1YJLA 4PLMA 4AQSA 2YHJA 4MUVA 4UXAA 2YXSA 4IEQA 5D8AB 4FTEA 4ITCA 2BGCA 4PLOA 1NY71 2LALA 2CTVA 2JX9A 4HBNA 1GNZA 2QKDA 5KBFA 2YMZA 3GZTB 4CDXC 4MXWB 3T1MA 3MIGA 3I7DA 5FFOC 3WDUA 2B7YA 5CNAA 4I09A 1TME2 4GA9A 4RS5A 1GZCA 4JRAA 2PN5A 3VBSA 3WD5A 3ZSMA 4XF0A 2P3JA 2UWCA 2NMNA 4DINB 1ND3B 4U36A 1LOEA 1H9WA 1CAUA 3VKFC 2UWAA 1YCIA 3VBUB 4IV3B 2WKKA 2GZWA 2SLIA 4ZU7A 1WA4A 3GZUC 2RR11 4LTAA 1VBD1 4CP2A 4XBLA 2XVKA 3WV6A 2KXLA 4Y4YA 4ZU4A 1C8M1 4R9AA 4Z2WA 4XE9A 4YVSA 4KU8A 1FMD3 1QNYA 1J1TA 3D6EA 4KH9A 1XNBA 3WZ1A 1F5FA 1LHUA 1VBD2 2ZMLA 2XBO3 4HPKA 1YNAA 2GMEA 4N90A 4AHYA 2ILMA 4O9GA 4OLLA 1RB8G 5FRAA 1BBT3 1ENRA 5KHHA 4DRVA 1KDMA 1N3QA 5JSOA 1RVF3 4YGCA 1F31A 2NMOA 1W6OB 1RUH1 2JENA 1AR93 2VMGA 4Y1VA 2ET7A 5JVVA 1RUI3 1XYPA 1R092 1LEMA 2P17A 1K5MC 4FPJA 3JD72 2WWSA 1YHFA 1ND2C 1CONA 3PHMA 5FO8B 3I59B 2HWF3 3VKLA 2GMPA 4RHV1 1UU5A 3GYDA 4DMIA 3KCXA 2A6YA 3M8LA 4X8NA 3E97A 2VOVA 5JOZA 4UW3A 2I45A 3LB9A 3WDYA 1HLCA 2ZX1A 3UJOA 1H8VA 4C90A 3AP7A 3WDXA 3WG4A 2ERFA 4W6XA 1BBT2 3LCPA 5BNOB 4R4ZA 1CR7A 1VIWB 4YG0A 4FPFA 4KWLA 2CYFA 1CAWA 1W6PB 2GNTA 1AX0A 1O7FA 1I1EA 4DQAA 5FQ0B 4AG4A 1TNRA 2VH9A 3IPVA 3AYCA 3N7LA 4R8HA 1HQNA 1R091 4WVMA 1MACA 1ZZ6A 3RI9A 2G9FA 2R063 1DLLA 1U5ZA 2EA7A 1R1A2 1IPJA 3B94A 5AFEA 1QJY1 4JGYA 1CPMA 3LOIA 4LHLA 2WLPA 5FO7B 2ZGUA 1AF9A 1KD7A 5C33A 2DVAA 1W6QB 2WSUA 2DCTA 5KC6A 1FPN2 2RS12 3MZHA 1H2MA 3FX3A 4XF1A 3KCCA 1ZREA 3RSJA 2WZR3 2UU8A 4Q4W1 3AJZA 1D2SA 3ES1A 3WG1A 1O3RA 3IIAA 4B4PA 2QVSB 4S2HA 4OHWA 4SLIA 4YFWA 4DNYA 3CL1A 4N53A 4NPRA 4OHYA 4LBQD 1LKNA 4QMAA 1LOFC 2VNGA 4XJUA 4LLFA 5ABJC 1GBGA 1V6IA 2Z79A 1F2NA 4GWMA 3THTA 3AP5A 3SMHA 1W0PA 3AZWA 5AC93 2R073 1CX4A 1VBE3 1LHVA 4Z82A 3UV9A 1TQ5A 2XGXA 2GN3A 2JJ6A 3WDVA 1AR92 1NA1C 1S0FA 5LK7B 3ZN6B 1AR83 4Q0SA 1A8MA 4M0HA 3JBG2 4GXLA 5J96B 4CP1A 1KS5A 2XHKA 2A6XA 3K51A 2D93A 3ZDSA 4B3NA 3OY8B 4KGQA 5KWRA 1G8WA 1LCLA 1XU2A 4SBVA 5GLZA 1NCQB 1W6OA 2P37A 3UJQA 4X6QB 4COYA 4YM1A 1LGBA 1SBFA 5C9AA 2DCZA 2WC2A 4M3CA 3TYJA 4WV8A 1PK6A 3GHNA 4HLTA 1VLNA 4YVWB 4BYYA 5CFDC 2SBAA 4FVVA 3G7DA 5ABJA 2VQAA 1UN1A 4B7KA 2JICA 2PELA 2XL7A 3WW1A 1XE7A 3MEPA 1NZCA 5JAXA 4XFIA 1S2KA 5DG1A 2XLAA 3VHRA 4ATFA 4XIOA 2IFRA 2WZPP 1QU0A 2ZGRA 2QDRA 3KB5A 4GMP0 2ZGQA 1QQP3 2RE9A 4QPGA 1QJZA 1PGW2 1NCQC 1XU1A 5JOXA 4B29A 4NN0A 2NPIA 2A75A 3B00A 3M7AA 1BZWA 3POSA 4AQ6A 5BV6A 4JGZC 3VBSB 4FOVA 3POWA 4ONUA 4NVPA 5IK7A 4COVA 2D40A 1DGRA 2KA3A 3O12A 4BCUA 3AP6A 1YIPA 2RR13 1BYHA 2HWB3 1ND2B 4LBOA 4CEYA 1LRHA 1EPZA 5A3MA 3DPRA 1REEA 5GZEA 5CBLA 3CU7A 1HRI3 1SCSA 4HETA 1RUI2 4ZU5A 1POV0 1AJKA 1IHMA 4FPEA 3QD6A 2OPKA 3NW4A 5HI0A 4P14A 2BFUL 3ATGA 3GNEA 3MW3A 4I02A 4XFFA 1W0OA 4FPLA 2D6NA 1LHNA 2Z69A 1BBT1 1DFQA 1SQ4A 1LU1A 1OA4A 3VBSC 5KC5A 2EAAA 1LOCA 1RVF1 4GMP1 1RL3A 3PVNA 1PGSA 5K0UB 1MR5A 1POV1 4XYXA 1DZRA 1VRH1 2F6BA 4YG3A 5CVRA 4IETA 3FBMA 1SFYA 4UW5A 3AZXA 4FOQA 1YUDA 1CIWA 4AHXA 3WNXA 1FATA 3E5XA 2Q8OA 1RINA 2WT0A 2R0HA 4Q27A 3ZXGA 4EN6B 3VLBB 4Q0UA 5DUWA 1RJ7A 1PZ9A 3MICA 3VDDA 1MEC3 4LBMA 4AFAA 2GALA 4YFZA 4QU2A 2V5YA 3AMQA 1NCQA 4M00A 2Q0AA 2EVXA 5FPZA 1C57A 1V6LA 3FHIB 3J9SA 2E7AA 4N43A 3TB0A 4B7EA 4XIKA 4I0BA 3WOGA 4I01A 4JV4A 2R49A 4HANA 4UBGA 3UKNA 4LE4A 5KXBA 4HVQA 2OW4A 4HN0A 4CDQC 4KWKA 5ACA1 5FBZA 4Q29A 1KFXL 3ZMNA 2VECA 1WLWA 3L9JT 3RJRA 1QF3A 3SH5A 4PBPA 1FNYA 1MZ5A 5KHIA 5FDBA 3WG3A 1WLTA 4XF4A 2VG9A 2D6MA 1BEV1 5FREA 3LKJA 4ZKTB 1AR72 1ULEA 4DY3A 1LJ7A 3D82A 5F1RA 1SDWA 1VRH3 5LEKA 4N9HA 4Q1PA 3VBUA 3PVEA 1X82A 2KM2A 4JVAA 3RDIA 1QJX2 4QGNA 4HN1A 3A0NA 4BOWA 1WBFA 3JUUA 4AI2A 4Q4X1 1NOVA 3EO6A 1G9FA 1OPOA 4N43B 3VN4A 3ACLA 2JG8C 3AKQA 4ISRA 2CV6A 1NLSA 1EAH1 2MHFA 4HMZA 1D4VB 3ZFGB 1JTZX 2RR12 2Z42A 2R1DA 1YFUA 3P3PA 4AI3A 5JPMB 1AYM1 3PMEA 1LGCA 4AW7A 3WP3A 1WLDA 2JECA 4F83A 1QHDA 1AR73 2VULA 1RGSA 1CQ9A 1ND2A 2K2SA 3B9IA 4XFAA 5CAZA 5BNNA 2UY9A 2OZJA 1DIWA 2D97A 1H1MA 1N47A 2R0FA 3I4IA 4FSJA 1S55A 4MGKE 2AGSA 4YW4A 4DOUA 3NV3A 1VBE1 4AVSA 2C5DA 1YRZA 4F8AA 1OSGA 3LA2A 3FMGA 3V0BB 3ZFEA 3KT1A 2W39A 3VBRB 4BE3A 2D6LX 4WVWA 1AL22 5H9SA 1RJ8A 1GNHA 3R4SA 3ZFGC 2PHLA 3J8F3 3TRSB 3E6CC 2WIIB 2WFPA 2DURA 2YC0A 3HN1A 2I2SA 2UURA 1SLCA 2JG9A 4AEDA 4AEDB 5GZDA 2BW8A 1A8DA 1OOPB 4FOYA 5EWSA 3ST7A 4HFSA 3T1LA 2P2KA 1ENQA 4UBHA 4BIOA 2IWGB 3VBFA 4MGIE 3JBG3 3ILRA 1MS4A 3O14A 2HWF1 4LBQB 1CESA 1RIRA 3RNSA 2RS33 3TAYA 2HWC2 1EAH3 3QH6A 4M3CF 1NYWA 4Y1XA 4KQ7A 4NHKA 3AKSA 1NXMA 5K9YA 4JDOA 4P9LA 3V64A 2VVEA 4L97A 1QJU2 4JGZA 1RTVA 1AR71 5C9AB 3ENRA 1GSLA 3ZVXA 1COV2 2YPJA 2VOWA 3VZLA 1MS8A 4AE2A 2BBVA 2IZWA 3ZXAC 3VBHA 3ZSEA 5HCAA 3JB8A 1O5UA 3IDEA 5JZGA 3N7KA 4P9IA 2IFWA 1SLAA 1ZZ8A 2RM23 3UKTA 3JQWA 4I2OA 3N3HA 2HWE3 2Q1ZB 2X5IC 4QT6A 5L19A 2C0ZA 2GSYA 4MSVA 4TLFA 5CB7A 3SH4A 4WM8C 1QJU1 3AXDA 2WLQA 1HDKA 2GMMA 2EIGA 4BMEA 1RITA 5I8YA 4N53B 1ZM1A 2VOXA 4E27A 4XQ4A 4AHWA 4ATEA 2AENA 3VBFC 4EWDA 1W6MB 4YW3A 4N7UA 5H9QA 3OPZA 1NG0A 1Q8PA 4YVSC 2WZR2 1C8NA 5KHGA 1DGLA 2UYBA 2NZ9A 3MPBA 2ES3A 3CJIA 3AXEA 4Q0PA 2GN7A 2QNKA 3RRDA 3SCFA 3W59A 3KT7A 3SISA 5A33A 3H3ZA 1V6JA 4WM8A 4EN9B 1HQLA 4Z1VA 2XUMA 5L7OB 5KHJA 1OKQA 3E5UA 3FZ3A 3D0JA 2BEOA 4MXVA 5AVPA 4C91A 4C0BA 1ASJ3 3KM5A 3R4DB 3MIEA 4META 4CDWC 2PHXA 3FFZA 3ZFFC 1NE4A 1UKGA 1RHI3 1RUG3 1SBEA 1DQ5A 3TN91 4YVWC 5AC91 1APNA 1UCXA 2PLV3 3E6DA 2Q4SA 1R082 5F6LB 4ASMB 1QY4A 4FO9A 3ALQA 1AR81 2HWB2 2EF6A 1COV3 2VW1A 1XNKA 1RHI2 2DVDA 3HT2A 3D5OA 1DHKB 4K20A 2R30A 1AYN3 4GKXA 5I91A 2BQPA 4ISQA 1O4TA 1G9DA 1DDLA 4XJWA 4COZA 1RUH3 2K9ZA 2Q1MA 1UZZA 3AFGA 4OHXA 4X6RB 1TME1 5F9TA 4MVTA 3B5LB 1ZA4A 2QE3A 3TN92 3AB0A 4D7YA 1S0DA 4RHV3 5DDJ1 1DF0A 2VUAA 2ZMNA 3HWJA 4K1ZA 1KS4A 4MX3A 4XEZA 1IS4A 1Z7S2 4S2FA 1KJRA 4OI1A 4O9EA 5L7OA 1JN2P 3KGZA 2XKOA 3JQXA 4PJYA 3QOPA 1XYNA 5BXXA 5JOYA 4LA3A 4YW1A 1HV0A 1GQHA 2PAMA 2VNRA 1R1A3 3J8F2 4YVWA 5C4WA 1RC6A 4PLNA 3GF6A 3AKTA 2XVGA 2O1QA 1Z0HA 2XBO2 2B8MA 4ES8A 1AX1A 4R9DA 4YZ1A 2JXAA 1DQ2A 4Q2FA 3BU7A 2BWCA 2GC3A 2X5IB 1H8TB 1FMD1 1V00A 4MH0E 2YGMA 1OLQA 4TZDA 1SLBA 1HRV3 1OFSA 1PVC2 4UW4A 2A7AA 2R061 4OI4A 1I3HA 5C8CA 3FFQA 1VBA2 3H8UA 3J26N 4JDNA 2VGDA 3PJYA 4NWWA 3DF0A 1G7YA 1RMU2 2A73B 1YI9A 4P5HA 1S1AA 4HK9A 4HVOA 3ZXDA 1BCXA 1NA1A 5EXOA 4IV1C 1K5MB 3B7MA 3R0RA 2RS13 1IOAA 4LBQA 4QHBA 4H55A 1H2KA 1EV11 1ENSA 4WVVA 4FTBA 5J7MA 3A4UA 5JLVA 2CGNA 3VKNA 4WVMB 3RYRA 5KXCA 3VKOA 2JE9A 3CJXA 3SNMA 4PCRA 3SCGA 1Q8SA 2JG9B