2R4IA

Crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
GMNQRDVILDCEKKLLTAIQNNDVESLEVLLHDDLLFIIPSGETVTKETDIAAYSSGKIALRAVVPSDYIIRIIHDTVVVSVNIEIKGEYMEHTLDNTFRYLRVWKLFDGNWKVIAGSCTAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_678039.1) from Cytophaga hutchinsonii ATCC 33406 at 1.60 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Unknown function
total genus 33
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2r4iA00
2Z76A 4HM0B 2BMRB 3CU3A 3EN8A 3EBTA 3ROBA 1JN5B 3DXOA 1ZO2A 5CK6A 1UUWB 1OF5B 2BMOB 3FKAA 2RCDA 3NXJA 3DUKA 3EJVA 1Q40A 5TGNA 3MG3A 1S5AA 4WWUC 3M8CA 5IEPA 3MYTA 1STDA 3F8HA 1GY5A 5DRVA 5IG0A 3KE7A 3KZTA 5JPUA 3JUMA 4HZ9B 3K7CA 3JUPA 4Q53A 1Q42A 3FH1A 4LMIA 3KSPA 4CDLA 5KP1A 1IDPA 1ASKA 3ER7A 4OUQA 4HM1B 5FW5A 4J8TA 3MG2A 4N3VA 2YFIB 3EQQB 3GZYB 1NDOB 1JN5A 5BVBA 2F98A 5AEWB 2IMJA 3OWUA 4L7KA 3I0YA 5CF1A 3B4PA 2RGQA 1OUNA 2HMNB 4HM2B 5G2GA 5IG3A 2QGUA 1ULIB 1EG9B 3F8XA 3RGRA 1GY7A 3MSOA 2A15A 3GRDA 1W00A 5EVHA 1TUHA 3K0ZA 4HM8B 3CPOA 3FF0A 3STDA 3G16A 3KKGA 1OH0A 1SJWA 3T8UA 3FLJA 4R9LA 3UJMA 2RFRA 1ISKA 3DM8A 3F40A 5IEOA 7STDA 4LGQA 3UNLA 4XBTA 3NUVA 1O7MB 3F14A 3G0KA 3G8ZA 4WYKB 5CF2A 1OGZA 8CHOA 2HMKB 2OWPA 4FCJA 4HJLB 3IPTA 3NHXA 3HZPA 3B7CA 1HKXA 1E3RA 3GZRA 3MHEA 3NBRA 2GEXA 3JUNA 4X2OA 4GB5A 2GEYA 5AIHA 3F9SA 3JUQA 3VGNA 1JB5A 5HGRA 3NV0B 5KP3A 2XR8B 1GS3A 1U5OA 4HM3B 2HMOB 3LYGA 4RZMA 5AIIA 3JUOA 1O7GB 1BUQA 4H3UA 2BMQB 4WYKA 1JKGB 1OHOA 5JPPA 3SOAA 3T8NA 2Z7AA 4R1KA 1DMQA 3E99A 4HM5B 1GY6A 5IF6A 1OF5A 4WP5A 3OWSA 4HM6B 1CQSA 5IENA 3F7SA 4XDWA 5D82A 2R4IA 4FCMA 2Z77A 3BLZA 4HZBB 2CHCA 2GXFA 4HKVB 3DMCA 2CKFB 1A2KA 1DMMA 1K41A 3LZAA 1JKGA 1JB2A 5KP4A 5IG4A 5BXQA 2B24B 3FZWA 5IG5A 4STDA 3FF2A 1AR0A 4K1UA 4HVNA 2BNGA 4OVMA 3NM2A 1ULJB 4X2HA 4L8PA 2UX0A 3DZLA 5D83A 1ZX2A 4XB5A 3B4OA 2XRXB 3Q90A 1OCVA 3HK4A 2W2CA 1WQLB 3ECFA 3CNXA 1OHPA 3EN1B 3EX9A 3WMDA 5IERA 2HMJB 3SEDA 1O7NB 4XBXA 5AIFA 3GZBA 3EC9A 3SOYA 2GBXB 1QMAA 3H51A 4XDVA 4PEJA 1GYBA 3CNMA 2K54A 1DMNA 4U13A 3EF8A 2YFLB 1W6YA 1E97A 2PZVA 2XSOB 3OX9A 4HM4B 4KVHA 3VSYA 5D81A 3OXAA 2GBWB 2I9WA 3OV4A 6STDA 3D9RA 1C7HA 3NV0A 1O7HB 4R9KA 1TP6A 4J9AA 1OHSA 1OPYA 5AEUB 4I4KA 4MJDA 1O7PB 2INXA 5DREA 3MG1A 1O7WB 3H3HA 1W02A 1OGXA 4L8OA 5CLKA 3GZXB 1E3VA 2YFJB 2F99A 1JB4A 5AIGA 1W01A 2STDA 2XSHB 4LEHA 4IIAA 1NWWA 3RGAA 3S5CA 2HMMB 2QIYA 3MKIA 3F7XA 3OWYA 5AI1A 2B1XB 3FSDA 4K1VA 3BB9A 3FGYA 3B8LA 1Q40B 4XM4A 3HX8A 2HMLB 2F86B 4HM7B 4XBYA 5STDA 5CXOA 3GWRA 1EA2A 1UUVB 3EHCA 3A76A 1VZZA 4ORLA 3EBYA 1QJGA 1NU3A 1Z1SA 2JQ5A
chains in the Genus database with same CATH superfamily
1TTOA 2MF7A 2E2UA 2Z76A 4HM0B 3FG1A 4RNZA 3LMLA 4RNTA 4AKYA 1UCKA 2BMRB 1V58A 3GSPA 3CU3A 2OOVA 1Q7HA 3EN8A 3EBTA 3ROBA 3DGNA 3X40A 2KF4A 1JN5B 3DXOA 1B2MA 1ZO2A 5CK6A 1UUWB 2OTJ3 4EBGA 1OF5B 2BMOB 2H0IA 2J8XB 3FKAA 4BL2A 2RCDA 1RN4A 3O8YA 3NXJA 3DUKA 3EJVA 1AV4A 1EKMA 1Q40A 5TGNA 9RNTA 3MG3A 1S5AA 1NO3A 4WWUC 3GAXA 3BNCA 4H61A 2WGQA 7GSPA 1IU7A 5EEOA 3M8CA 5IEPA 1HU9A 2RNTA 3DGLA 1STDA 3F8HA 3MYTA 4N6OB 4N6LA 4J5GA 1SARA 1GY5A 2PNCA 5DRVA 5IG0A 3KE7A 3KZTA 1NB5I 2FNQA 3JUMA 5AYRB 4HZ9B 5JPUA 1HYFA 3MWZA 5JBSA 2QA43 3Q1CA 3K7CA 3SX1A 3WDGB 3WOEB 3JUPA 2E2VA 4Q53A 1J2BA 2F5WA 1Q42A 2W56B 4CJNA 3FH1A 4LMIA 4LYLB 4MMXB 2YX9A 1T2HA 3KSPA 4CDLA 3QK9A 2JDIH 3BNBA 5KP1A 2RBIA 2IA7A 3NBBA 1IDPA 1ASKA 2CW9A 3ER7A 4OUQA 4HM1B 2OCTA 1Q9EA 2C4BA 5A0OB 5FW5A 1QAKA 1EQKA 1IV7A 1VQK3 1FGTA 2V1LA 3MG2A 1IT7A 1FZUA 4J8TA 2CIUA 4N3VA 3PS8A 3CCM3 2YFIB 5RNTA 1B2XA 5BU4A 3EQQB 1W5ZA 3GZYB 1NDOB 4BTWA 1JN5A 1QALA 3K9MC 3QRDA 5BVBA 1LOWA 4CPKA 2F98A 1N9EA 1RLSA 1T3BA 5AEWB 2IMJA 4EYCA 1MNLA 3OWUA 3PCRA 1RDSA 3CCJ3 4L7KA 3I0YA 5CF1A 1IK3A 1CYUA 1NJI4 1YJW3 2Q07A 3B4PA 4MMYB 2RGQA 2CC3A 1OUNA 1GOUA 1JV2B 2HMNB 3V92A 4HM2B 3CCS3 4AKZA 1VQ43 5G2GA 2CWUA 3CCQ3 5IG3A 1X1XA 2QGUA 1ULIB 1EG9B 3F8XA 1DVCA 3RGRA 1GY7A 1BNIA 1BNRA 3TDGA 1IVUA 3MSOA 1Q864 1Y4KA 3HI7A 1VQO3 1Q814 2A15A 4NREA 1EUIC 1RTUA 2W56A 3GRDA 1FUWA 1W00A 5EVHA 1TUHA 2CFLA 2D1WA 1RCLA 3X42A 3J7Yd 2CH9A 3K0ZA 2W9QA 2IUKA 2KF3A 3N9HA 4HM8B 2WGOA 3CPOA 3FF0A 1BSAA 1YJN3 2XFTA 5G1LA 3STDA 6GSPA 3V98A 1CH0A 3G16A 1UCIA 1OH0A 2C10A 3KKGA 1WTHA 3ZG5A 1X1UA 3X3XA 1YJ93 1SJWA 3T8UA 1VQP3 1I2GA 3FLJA 2OQEC 1VQ53 4R9LA 4NHFA 3UJMA 2RFRA 5LC6A 2AADA 2F56A 1FGQA 1ISKA 1JRQA 3AHWA 3DM8A 3F40A 2CWTA 2XGNA 3URPA 1RN1A 2W6JH 5IEOA 5FGOA 1QVF2 1M9GA 2AAEA 7STDA 1L5GB 4LGQA 1SIHA 3UNLA 1FW7A 1I70A 4GL6A 4XBTA 2F4YA 3NUVA 1O7MB 3WA3A 3PYJA 2CG1A 3F14A 2XH9A 3G0KA 3G8ZA 4WYKB 1RGHA 5CF2A 4BTXA 2ML5A 1BSDA 1LNIA 1DETA 1PYLA 1IQYA 2P0XA 1W6GA 3D4AA 4O02B 1GOYA 1MWRA 1GD4A 1AVLA 1OGZA 8CHOA 2HMKB 2H0HA 1MOLA 2OWPA 3CCL3 4FCJA 4HJLB 1VQ93 3IPTA 4RBNA 3NHXA 3X3ZA 2BO9B 2C11A 3B7CA 1HKXA 1LXEA 1E3RA 2IY2A 3HZPA 4KFFA 3GZRA 3MHEA 1BNEA 2GEXA 3NBRA 3JUNA 4X2OA 4GB5A 4O3VA 3NQYA 2GEYA 3KCHA 5AIHA 4BIRA 1Q824 1BNSA 1B20A 1RRHA 3F9SA 1N8R4 1JNQA 3PGBA 3JUQA 3VGNA 3X41A 1JZDA 2W9PA 3CMA3 1JB5A 2P09A 2D42A 4EV2A 3Q3FA 4R80A 5HGRA 3NV0B 4FMDA 1BRIA 5KP3A 1GMQA 2XR8B 1LRAA 1C54A 1BRHA 1GS3A 1U5OA 4HM3B 4LZIA 1NNVA 3KIIA 2HMOB 1G96A 2XFSA 3U1WA 3LYGA 1TRPA 3SVAA 4RZMA 5AIIA 1G0TA 2FXTA 3JUOA 4FMBA 1N5HA 2CFGA 4N6TA 1TFKA 1O7GB 1CYVA 1YGWA 3LT9A 1GOVA 1BUQA 2XF3A 3AGNA 4LSOA 5GSPA 4H3UA 1PFPA 2BMQB 3OW22 4WYKA 1BNGA 1JKGB 1OHOA 4N6NB 1RGCA 5JPPA 1RMSA 3SOAA 1MWTA 3CME3 2Z7AA 3KFQC 4R1KA 3T8NA 1VQM3 1I0VA 3SLUA 2CK3H 1RNBA 2Y74A 1DMQA 2H0GA 3E99A 3A5EA 4HM5B 1X1YA 1GY6A 1UUGB 5IF6A 1OF5A 4WP5A 4K61A 3OWSA 1V74A 2L4VA 5ELJA 4EXRA 3KSED 1UDII 3HOHA 4HM6B 1CQSA 3RDEA 5IENA 2GU1A 3F7SA 2CX0A 3LXUX 4XDWA 1IQXA 3CCR3 5D82A 2R4IA 5BIRA 3AMOB 1RN7A 1I3FA 4FCMA 3N8BA 3G6E3 2Z77A 3CC23 1W4NA 1BSBA 1N9JA 4GSPA 3BLZA 1YVBI 2RSXA 1PU4A 3SYUA 3FG3A 3DY5A 2KXGA 3LTCA 4HZBB 3N54B 3SXXA 4BU4A 1FA3A 2CHCA 2GXFA 3PCSA 4HKVB 3S28A 1LNHA 4DKIA 3DMCA 2CFWA 2K0MA 1JBSA 2CKFB 3BNDA 4QWTA 1A2KA 1DMMA 1V57A 2IYJA 1K41A 4BL3A 1BNFA 2KCDA 3LZAA 5M18A 1JKGA 1JB2A 5KP4A 1VQN3 3CC43 1JZOA 1KD14 1RGFA 2SARA 4AEQA 4HYZA 3DGYA 5IG4A 1A2VA 5BXQA 1BRJA 2LYXA 3WHOA 2L1SA 1U8CB 3I563 1STFI 2QEX3 1W6CA 2B24B 1SIIA 2O9UX 1I3IA 5ELUA 3FZWA 3CD63 1I0XA 3FCSB 1BGSA 5IG5A 4STDA 1UI8A 3FF2A 1RKYA 3AGOA 1AR0A 1LOXA 1I2FA 2CFKA 1B2SA 1F8NA 3MPHA 2BNGA 4HBRA 4HVNA 4K1UA 1VQ83 4OVMA 1QVG2 3NM2A 1ULJB 4X2HA 2P0MA 4L8PA 3S67A 4EC6A 1YIJ3 2UGIA 1QAFA 1T2IA 1IV9A 1BVIA 4BTYA 4KFDA 2UX0A 3DZLA 5D83A 3DGOA 1ZX2A 1W7CA 3Q2PA 1BRKA 3WA2X 1VQ73 2BIRA 3DGMA 1YNVX 4XB5A 3CXC2 3CCU3 5AYSC 2M7OA 3ALAA 3KN4A 4O8SA 1VQ63 1WMNA 4N6MA 2XEPA 4IPBA 1ROVA 1DE3A 3B4OA 2XRXB 1RJOA 3HIIA 1FGOA 3X3YA 2OOVC 2CX1A 1UCLA 1LOYA 3Q90A 1OCVA 3LT8A 1I8VA 1R4YA 2WOFA 3NM7A 3HK4A 2W2CA 3K63A 1VQL3 1WQLB 4FMCA 1A90A 3LTAA 5G1KA 1K9M4 3ECFA 2OQEA 4KZ1A 1DYUA 2P05A 2KRTA 3CNXA 1IQ8A 1EEJA 2E2TA 1R4CA 2FGTA 2F5MA 2ZHXB 1OHPA 1KC84 1K28A 4JRFA 3HIGA 1D6ZA 1TFOA 3CC73 3EN1B 1TRQA 4FMAA 3EX9A 1IT8A 4WFOA 1TU5A 3BIRA 1IVWA 1MWSA 1K734 2P38A 1UCJA 2CG0A 3WMDA 2HMJB 5IERA 1B2ZA 3SEDA 1Q7Y4 1O7NB 2CFDA 4XBXA 4FR9A 3GZBA 5AIFA 1US1A 3EC9A 5LC7A 3SOYA 1IVVA 1IVXA 1RHLA 8RNTA 1BANA 2GBXB 2ZA4A 1TJDA 2W0QA 1LVNA 2GSPA 1BRGA 1QMAA 3H51A 3V99A 1IYYA 1GMPA 3LTDA 4XDVA 1B3SA 3DH2A 4RNYA 1K8A4 3LOYA 4PEJA 1LOVA 1BIRA 1WMOA 3D3LA 1GYBA 2KF6A 2O3OA 1RGKA 3CNMA 1RGAA 1N8QA 2K54A 1T5YA 1DMNA 4TX4A 5HOHA 4U13A 5M1AA 1WMPA 2WO0A 2BHMA 1KQS2 1A2PA 2YFLB 1UW1A 3EF8A 4JF8A 2LQVA 1BU4A 1RRLA 3CPW2 1YVSA 1NB3I 2ZL8A 1WNHA 1W6YA 1E97A 2PZVA 3FG4A 5I97A 1M904 1JBRA 2W03A 2Z6BA 2XSOB 3OX9A 4HM4B 4KVHA 2ML6A 3PZWA 3D79A 1LQMB 1A67A 3VSYA 1B2UA 3L0RA 4NPBA 4WHAA 1FYSA 5D81A 3ZG0A 3OXAA 4EW5A 1AVKA 1JBTA 1BRNL 2GBWB 1ZS7A 3LH4A 2I9WA 1ROAA 3EE1A 3EB8A 1TIJA 3OV4A 3BNEA 6STDA 3D9RA 4GHOA 1RGEA 1C7HA 3NV0A 1O7HB 4R9KA 1X1WA 1TP6A 2BU4A 1I2EA 4HAAA 4MMZB 1RSNA 4J9AA 1M1K4 1OHSA 2R41A 1RGGA 4J5KA 1OPYA 3G713 5AEUB 4I4KA 4N6UA 4MJDA 2KF5A 1O7PB 1B27A 1ZGXA 2INXA 5DREA 3MG1A 1D6YA 2WOHA 1O7WB 3H3HA 1W02A 1UI7A 3AHSA 4I5QA 1OGXA 2MC8A 1BRSA 1SQWA 1W2B2 4HOHA 1MGWA 1RGLA 2SBLA 3UL6A 3U97A 1KWIA 2KAAA 1SPUA 1FUTA 7RNTA 4L8OA 2K3DA 1YIT3 1YHQ3 4G1MB 5CLKA 3GZXB 1UGHI 2CWVA 1E3VA 1YI23 3WOFB 2ZDJA 2YFJB 1GMRA 3NX0A 2F99A 3VF1A 2IUJA 3S29A 1JB4A 5AIGA 1FGRA 3G4S3 3K5TA 1W01A 3CCE3 2STDA 1B21A 2XSHB 4LEHA 1RNTA 4IIAA 1FGMA 3UL5A 1LQGC 1NWWA 2BT3A 4MEIA 3RGAA 1BOXA 3S5CA 1JJ22 2HMMB 1BSCA 4R4KA 1HZ1A 1W2ZA 2QIYA 3MKIA 3F7XA 3AMOA 1BAOA 1BSEA 3OWYA 5AI1A 1DVDA 1OACA 2B1XB 3JVCA 3FSDA 3PXMA 3NQZA 4K1VA 3S27A 3I553 3BB9A 5M19A 1D6UA 3D5IA 1AY7A 4KT3B 3T0UA 1GSPA 4IT7A 3WR2A 3FGYA 3B8LA 5IW9A 1Q40B 4XM4A 3HX8A 1MGRA 2HMLB 2F86B 4HM7B 1GD3A 2OTL3 1G02A 1AQZA 2UUGC 4CCVA 2HOHA 4XBYA 5STDA 4FCZA 5CXOA 4ZM8A 1MWUA 1N5PA 3WODG 2XGLA 3GWRA 1KSIA 4OK0A 1VQQA 1M1XB 4K90B 1EA2A 1BNJA 1UUVB 3RNTA 4EV5A 6RNTA 3EHCA 3A76A 3CCV3 3IMAB 1VZZA 4ORLA 1UGIA 5EQLA 4O2HA 1PY3A 1CEWI 1BUJA 3EBYA 1QJGA 1RCKA 3LTBA 3ZFZA 2Y73A 4ILFA 3BU4A 1S723 4KFEA 3D5GA 2GU3A 3IJEB 1NU3A 1Z1SA 2JQ5A 2W04A 3UB1A 4N6V0 3NBJA 1YGEA 1FUSA
chains in the Genus database with same CATH topology
2MF7A 2E2UA 2Z76A 4HM0B 3FG1A 4RNZA 3LMLA 4AKYA 2BMRB 3CU3A 2OOVA 3EN8A 3EBTA 3ROBA 3DGNA 3X40A 1JN5B 3DXOA 1ZO2A 5CK6A 1UUWB 2OTJ3 4EBGA 1OF5B 2BMOB 3FKAA 2RCDA 3O8YA 3NXJA 3DUKA 3EJVA 1AV4A 1EKMA 1Q40A 5TGNA 3MG3A 1S5AA 1NO3A 4WWUC 3GAXA 3BNCA 4H61A 2WGQA 1IU7A 5EEOA 3M8CA 5IEPA 1HU9A 3DGLA 3MYTA 1STDA 3F8HA 4N6OB 4N6LA 1GY5A 2PNCA 5DRVA 5IG0A 3KE7A 3KZTA 1NB5I 2FNQA 3JUMA 5AYRB 4HZ9B 5JPUA 5JBSA 3MWZA 2QA43 3Q1CA 3K7CA 3SX1A 3WDGB 3WOEB 3JUPA 2E2VA 4Q53A 1J2BA 1Q42A 2W56B 3FH1A 4LMIA 4MMXB 2YX9A 3KSPA 4CDLA 3QK9A 2JDIH 3BNBA 5KP1A 2IA7A 3NBBA 1IDPA 1ASKA 2CW9A 3ER7A 4OUQA 4HM1B 2OCTA 5A0OB 5FW5A 1QAKA 1EQKA 1IV7A 1VQK3 1FGTA 2V1LA 3MG2A 1IT7A 4J8TA 4N3VA 2CIUA 3PS8A 3CCM3 2YFIB 3EQQB 1W5ZA 3GZYB 1NDOB 4BTWA 1JN5A 1QALA 3K9MC 3QRDA 5BVBA 2F98A 1N9EA 5AEWB 2IMJA 4EYCA 1MNLA 3OWUA 3PCRA 3CCJ3 4L7KA 3I0YA 5CF1A 1IK3A 1CYUA 1NJI4 1YJW3 2Q07A 3B4PA 4MMYB 2RGQA 2CC3A 1OUNA 1JV2B 2HMNB 4HM2B 3CCS3 4AKZA 1VQ43 5G2GA 2CWUA 3CCQ3 5IG3A 2QGUA 1ULIB 1EG9B 3F8XA 1DVCA 3RGRA 1GY7A 3TDGA 1IVUA 3MSOA 1Q864 1Y4KA 3HI7A 1VQO3 1Q814 2A15A 4NREA 2W56A 3GRDA 1FUWA 1W00A 5EVHA 1TUHA 2CFLA 2D1WA 3X42A 3J7Yd 2CH9A 3K0ZA 2W9QA 2IUKA 3N9HA 4HM8B 2WGOA 3CPOA 3FF0A 1YJN3 2XFTA 3STDA 3V98A 3G16A 2C10A 1OH0A 3KKGA 1WTHA 3X3XA 1YJ93 1SJWA 3T8UA 1VQP3 3FLJA 2OQEC 1VQ53 4R9LA 4NHFA 3UJMA 2RFRA 5LC6A 1FGQA 1ISKA 1JRQA 3DM8A 3F40A 2CWTA 2XGNA 2W6JH 5IEOA 5FGOA 1QVF2 1M9GA 7STDA 1L5GB 4LGQA 1SIHA 3UNLA 4GL6A 4XBTA 3NUVA 1O7MB 3WA3A 3PYJA 2CG1A 3F14A 2XH9A 3G0KA 3G8ZA 4WYKB 5CF2A 4BTXA 2ML5A 3V92A 1IQYA 2P0XA 1W6GA 4O02B 1OGZA 8CHOA 1GD4A 1AVLA 2HMKB 1MOLA 2OWPA 3CCL3 4FCJA 4HJLB 1VQ93 3IPTA 4RBNA 3NHXA 3X3ZA 2BO9B 2C11A 3B7CA 1HKXA 1LXEA 1E3RA 3HZPA 4KFFA 3GZRA 3MHEA 3NBRA 2GEXA 3JUNA 4X2OA 4GB5A 4O3VA 3NQYA 2GEYA 5AIHA 1Q824 3F9SA 1RRHA 1N8R4 1JNQA 3PGBA 3JUQA 3VGNA 3X41A 2W9PA 3CMA3 1JB5A 2P09A 2D42A 4EV2A 4R80A 5HGRA 3NV0B 4FMDA 5KP3A 2XR8B 1GS3A 1U5OA 4HM3B 4LZIA 3KIIA 2HMOB 1G96A 2XFSA 3U1WA 3LYGA 3SVAA 4RZMA 5AIIA 2FXTA 3JUOA 4FMBA 1N5HA 2CFGA 4N6TA 1TFKA 1O7GB 1CYVA 3LT9A 1BUQA 2XF3A 4LSOA 4H3UA 1PFPA 2BMQB 3OW22 4WYKA 1JKGB 1OHOA 4N6NB 5JPPA 3SOAA 3CME3 2Z7AA 3KFQC 4R1KA 3T8NA 1VQM3 3SLUA 2CK3H 2Y74A 1DMQA 3E99A 4HM5B 1GY6A 5IF6A 1OF5A 4WP5A 4K61A 3OWSA 1V74A 2L4VA 5ELJA 4EXRA 3KSED 4HM6B 1CQSA 3RDEA 5IENA 2GU1A 3F7SA 3LXUX 4XDWA 1IQXA 3CCR3 5D82A 2R4IA 3AMOB 1RN7A 3G6E3 4FCMA 3N8BA 2Z77A 3CC23 1W4NA 1N9JA 3BLZA 1YVBI 2RSXA 1PU4A 3FG3A 3DY5A 2KXGA 3LTCA 4HZBB 3N54B 3SXXA 1FA3A 2CHCA 2GXFA 3PCSA 4HKVB 3S28A 1LNHA 3DMCA 2CFWA 2K0MA 2CKFB 3BNDA 4QWTA 1A2KA 1DMMA 1K41A 2KCDA 3LZAA 1JKGA 1JB2A 5KP4A 1VQN3 3CC43 1KD14 4AEQA 4HYZA 5IG4A 1A2VA 5BXQA 3I563 2LYXA 2QEX3 1U8CB 1STFI 1W6CA 2B24B 1SIIA 2O9UX 3CD63 5ELUA 3FZWA 3FCSB 5IG5A 4STDA 1UI8A 3FF2A 1RKYA 1AR0A 1LOXA 2CFKA 1F8NA 3MPHA 4HVNA 2BNGA 4HBRA 4K1UA 1VQ83 4OVMA 1QVG2 3NM2A 1ULJB 4X2HA 2P0MA 4L8PA 3S67A 4EC6A 1YIJ3 1QAFA 1IV9A 4BTYA 4KFDA 2UX0A 3DZLA 5D83A 3DGOA 1ZX2A 1W7CA 3Q2PA 3WA2X 1VQ73 3DGMA 4XB5A 3CXC2 3CCU3 5AYSC 2M7OA 3ALAA 3KN4A 4O8SA 1VQ63 1WMNA 1YGEA 2XEPA 4IPBA 1ROVA 4N6MA 3B4OA 2XRXB 1RJOA 3HIIA 1FGOA 3X3YA 2OOVC 3Q90A 1OCVA 3LT8A 2WOFA 3NM7A 3HK4A 2W2CA 3K63A 1VQL3 1WQLB 4FMCA 1A90A 3LTAA 1K9M4 3ECFA 2OQEA 4KZ1A 1DYUA 2P05A 2KRTA 3CNXA 1IQ8A 2E2TA 1R4CA 2FGTA 1KC84 1OHPA 1K28A 4JRFA 3HIGA 1D6ZA 1TFOA 3CC73 3EN1B 4FMAA 3EX9A 1IT8A 4WFOA 1TU5A 1K734 1IVWA 2P38A 3WMDA 2CG0A 5IERA 2HMJB 1Q7Y4 3SEDA 1O7NB 2CFDA 4XBXA 4FR9A 3GZBA 5AIFA 1US1A 3EC9A 5LC7A 3SOYA 1IVVA 1IVXA 2GBXB 2W0QA 1LVNA 1QMAA 3V99A 3H51A 3LTDA 4XDVA 4RNYA 1K8A4 3LOYA 4PEJA 1WMOA 3D3LA 1GYBA 2O3OA 3CNMA 1N8QA 2K54A 1T5YA 1DMNA 4TX4A 4U13A 1WMPA 2WO0A 2BHMA 1KQS2 3EF8A 2YFLB 1UW1A 4JF8A 2LQVA 1RRLA 3CPW2 1NB3I 2ZL8A 1WNHA 1W6YA 1E97A 2PZVA 3FG4A 5I97A 1M904 2W03A 2Z6BA 2XSOB 3OX9A 4HM4B 4KVHA 2ML6A 3PZWA 1A67A 3VSYA 3L0RA 4WHAA 5D81A 3OXAA 1AVKA 2GBWB 3LH4A 2I9WA 1ROAA 3EE1A 3EB8A 1TIJA 3OV4A 3BNEA 6STDA 3D9RA 1C7HA 3NV0A 1O7HB 4R9KA 1TP6A 4MMZB 4J9AA 1M1K4 1OHSA 3G713 1OPYA 5AEUB 4I4KA 4N6UA 4MJDA 1O7PB 2INXA 5DREA 3MG1A 1D6YA 2WOHA 1O7WB 3H3HA 1W02A 1UI7A 1OGXA 2MC8A 1SQWA 1W2B2 3UL6A 2SBLA 3U97A 1KWIA 1SPUA 4L8OA 1YIT3 1YHQ3 4G1MB 5CLKA 3GZXB 2CWVA 1E3VA 1YI23 3WOFB 2YFJB 3NX0A 2F99A 3VF1A 2IUJA 3S29A 1JB4A 5AIGA 1FGRA 3G4S3 3K5TA 1W01A 3CCE3 2STDA 2XSHB 4LEHA 4IIAA 1FGMA 3UL5A 2BT3A 1NWWA 4MEIA 3RGAA 3S5CA 1JJ22 2HMMB 4R4KA 1W2ZA 2QIYA 3MKIA 3F7XA 3AMOA 3OWYA 5AI1A 1DVDA 1OACA 2B1XB 3JVCA 3FSDA 3PXMA 3NQZA 4K1VA 3S27A 3I553 3BB9A 1D6UA 3T0UA 4IT7A 3FGYA 3B8LA 5IW9A 1Q40B 4XM4A 3HX8A 2HMLB 2F86B 4HM7B 1GD3A 2OTL3 4CCVA 4XBYA 5STDA 4ZM8A 4FCZA 5CXOA 1N5PA 3WODG 2XGLA 3GWRA 1KSIA 4OK0A 1M1XB 4K90B 1EA2A 1UUVB 4EV5A 3EHCA 3A76A 3CCV3 3IMAB 1VZZA 4ORLA 5EQLA 4O2HA 1CEWI 3EBYA 1QJGA 3LTBA 2Y73A 1S723 4KFEA 2GU3A 3IJEB 1NU3A 1Z1SA 2JQ5A 2W04A 3UB1A 4N6V0 3NBJA 2ZDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z76 A;  4HM0 B;  2BMR B;  3CU3 A;  3EN8 A;  3EBT A;  3ROB A;  1JN5 B;  3DXO A;  1ZO2 A;  5CK6 A;  1UUW B;  1OF5 B;  2BMO B;  3FKA A;  2RCD A;  3NXJ A;  3DUK A;  3EJV A;  1Q40 A;  5TGN A;  3MG3 A;  1S5A A;  4WWU C;  3M8C A;  5IEP A;  3MYT A;  1STD A;  3F8H A;  1GY5 A;  5DRV A;  5IG0 A;  3KE7 A;  3KZT A;  5JPU A;  3JUM A;  4HZ9 B;  3K7C A;  3JUP A;  4Q53 A;  1Q42 A;  3FH1 A;  4LMI A;  3KSP A;  4CDL A;  5KP1 A;  1IDP A;  1ASK A;  3ER7 A;  4OUQ A;  4HM1 B;  5FW5 A;  4J8T A;  3MG2 A;  4N3V A;  2YFI B;  3EQQ B;  3GZY B;  1NDO B;  1JN5 A;  5BVB A;  2F98 A;  5AEW B;  2IMJ A;  3OWU A;  4L7K A;  3I0Y A;  5CF1 A;  3B4P A;  2RGQ A;  1OUN A;  2HMN B;  4HM2 B;  5G2G A;  5IG3 A;  2QGU A;  1ULI B;  1EG9 B;  3F8X A;  3RGR A;  1GY7 A;  3MSO A;  2A15 A;  3GRD A;  1W00 A;  5EVH A;  1TUH A;  3K0Z A;  4HM8 B;  3CPO A;  3FF0 A;  3STD A;  3G16 A;  3KKG A;  1OH0 A;  1SJW A;  3T8U A;  3FLJ A;  4R9L A;  3UJM A;  2RFR A;  1ISK A;  3DM8 A;  3F40 A;  5IEO A;  7STD A;  4LGQ A;  3UNL A;  4XBT A;  3NUV A;  1O7M B;  3F14 A;  3G0K A;  3G8Z A;  4WYK B;  5CF2 A;  1OGZ A;  8CHO A;  2HMK B;  2OWP A;  4FCJ A;  4HJL B;  3IPT A;  3NHX A;  3HZP A;  3B7C A;  1HKX A;  1E3R A;  3GZR A;  3MHE A;  3NBR A;  2GEX A;  3JUN A;  4X2O A;  4GB5 A;  2GEY A;  5AIH A;  3F9S A;  3JUQ A;  3VGN A;  1JB5 A;  5HGR A;  3NV0 B;  5KP3 A;  2XR8 B;  1GS3 A;  1U5O A;  4HM3 B;  2HMO B;  3LYG A;  4RZM A;  5AII A;  3JUO A;  1O7G B;  1BUQ A;  4H3U A;  2BMQ B;  4WYK A;  1JKG B;  1OHO A;  5JPP A;  3SOA A;  3T8N A;  2Z7A A;  4R1K A;  1DMQ A;  3E99 A;  4HM5 B;  1GY6 A;  5IF6 A;  1OF5 A;  4WP5 A;  3OWS A;  4HM6 B;  1CQS A;  5IEN A;  3F7S A;  4XDW A;  5D82 A;  2R4I A;  4FCM A;  2Z77 A;  3BLZ A;  4HZB B;  2CHC A;  2GXF A;  4HKV B;  3DMC A;  2CKF B;  1A2K A;  1DMM A;  1K41 A;  3LZA A;  1JKG A;  1JB2 A;  5KP4 A;  5IG4 A;  5BXQ A;  2B24 B;  3FZW A;  5IG5 A;  4STD A;  3FF2 A;  1AR0 A;  4K1U A;  4HVN A;  2BNG A;  4OVM A;  3NM2 A;  1ULJ B;  4X2H A;  4L8P A;  2UX0 A;  3DZL A;  5D83 A;  1ZX2 A;  4XB5 A;  3B4O A;  2XRX B;  3Q90 A;  1OCV A;  3HK4 A;  2W2C A;  1WQL B;  3ECF A;  3CNX A;  1OHP A;  3EN1 B;  3EX9 A;  3WMD A;  5IER A;  2HMJ B;  3SED A;  1O7N B;  4XBX A;  5AIF A;  3GZB A;  3EC9 A;  3SOY A;  2GBX B;  1QMA A;  3H51 A;  4XDV A;  4PEJ A;  1GYB A;  3CNM A;  2K54 A;  1DMN A;  4U13 A;  3EF8 A;  2YFL B;  1W6Y A;  1E97 A;  2PZV A;  2XSO B;  3OX9 A;  4HM4 B;  4KVH A;  3VSY A;  5D81 A;  3OXA A;  2GBW B;  2I9W A;  3OV4 A;  6STD A;  3D9R A;  1C7H A;  3NV0 A;  1O7H B;  4R9K A;  1TP6 A;  4J9A A;  1OHS A;  1OPY A;  5AEU B;  4I4K A;  4MJD A;  1O7P B;  2INX A;  5DRE A;  3MG1 A;  1O7W B;  3H3H A;  1W02 A;  1OGX A;  4L8O A;  5CLK A;  3GZX B;  1E3V A;  2YFJ B;  2F99 A;  1JB4 A;  5AIG A;  1W01 A;  2STD A;  2XSH B;  4LEH A;  4IIA A;  1NWW A;  3RGA A;  3S5C A;  2HMM B;  2QIY A;  3MKI A;  3F7X A;  3OWY A;  5AI1 A;  2B1X B;  3FSD A;  4K1V A;  3BB9 A;  3FGY A;  3B8L A;  1Q40 B;  4XM4 A;  3HX8 A;  2HML B;  2F86 B;  4HM7 B;  4XBY A;  5STD A;  5CXO A;  3GWR A;  1EA2 A;  1UUV B;  3EHC A;  3A76 A;  1VZZ A;  4ORL A;  3EBY A;  1QJG A;  1NU3 A;  1Z1S A;  2JQ5 A; 
#chains in the Genus database with same CATH topology
 1TTO A;  2MF7 A;  2E2U A;  2Z76 A;  4HM0 B;  3FG1 A;  4RNZ A;  3LML A;  4RNT A;  4AKY A;  1UCK A;  2BMR B;  1V58 A;  3GSP A;  3CU3 A;  2OOV A;  1Q7H A;  3EN8 A;  3EBT A;  3ROB A;  3DGN A;  3X40 A;  2KF4 A;  1JN5 B;  3DXO A;  1B2M A;  1ZO2 A;  5CK6 A;  1UUW B;  2OTJ 3;  4EBG A;  1OF5 B;  2BMO B;  2H0I A;  2J8X B;  3FKA A;  4BL2 A;  2RCD A;  1RN4 A;  3O8Y A;  3NXJ A;  3DUK A;  3EJV A;  1AV4 A;  1EKM A;  1Q40 A;  5TGN A;  9RNT A;  3MG3 A;  1S5A A;  1NO3 A;  4WWU C;  3GAX A;  3BNC A;  4H61 A;  2WGQ A;  7GSP A;  1IU7 A;  5EEO A;  3M8C A;  5IEP A;  1HU9 A;  2RNT A;  3DGL A;  1STD A;  3F8H A;  3MYT A;  4N6O B;  4N6L A;  4J5G A;  1SAR A;  1GY5 A;  2PNC A;  5DRV A;  5IG0 A;  3KE7 A;  3KZT A;  1NB5 I;  2FNQ A;  3JUM A;  5AYR B;  4HZ9 B;  5JPU A;  1HYF A;  3MWZ A;  5JBS A;  2QA4 3;  3Q1C A;  3K7C A;  3SX1 A;  3WDG B;  3WOE B;  3JUP A;  2E2V A;  4Q53 A;  1J2B A;  2F5W A;  1Q42 A;  2W56 B;  4CJN A;  3FH1 A;  4LMI A;  4LYL B;  4MMX B;  2YX9 A;  1T2H A;  3KSP A;  4CDL A;  3QK9 A;  2JDI H;  3BNB A;  5KP1 A;  2RBI A;  2IA7 A;  3NBB A;  1IDP A;  1ASK A;  2CW9 A;  3ER7 A;  4OUQ A;  4HM1 B;  2OCT A;  1Q9E A;  2C4B A;  5A0O B;  5FW5 A;  1QAK A;  1EQK A;  1IV7 A;  1VQK 3;  1FGT A;  2V1L A;  3MG2 A;  1IT7 A;  1FZU A;  4J8T A;  2CIU A;  4N3V A;  3PS8 A;  3CCM 3;  2YFI B;  5RNT A;  1B2X A;  5BU4 A;  3EQQ B;  1W5Z A;  3GZY B;  1NDO B;  4BTW A;  1JN5 A;  1QAL A;  3K9M C;  3QRD A;  5BVB A;  1LOW A;  4CPK A;  2F98 A;  1N9E A;  1RLS A;  1T3B A;  5AEW B;  2IMJ A;  4EYC A;  1MNL A;  3OWU A;  3PCR A;  1RDS A;  3CCJ 3;  4L7K A;  3I0Y A;  5CF1 A;  1IK3 A;  1CYU A;  1NJI 4;  1YJW 3;  2Q07 A;  3B4P A;  4MMY B;  2RGQ A;  2CC3 A;  1OUN A;  1GOU A;  1JV2 B;  2HMN B;  3V92 A;  4HM2 B;  3CCS 3;  4AKZ A;  1VQ4 3;  5G2G A;  2CWU A;  3CCQ 3;  5IG3 A;  1X1X A;  2QGU A;  1ULI B;  1EG9 B;  3F8X A;  1DVC A;  3RGR A;  1GY7 A;  1BNI A;  1BNR A;  3TDG A;  1IVU A;  3MSO A;  1Q86 4;  1Y4K A;  3HI7 A;  1VQO 3;  1Q81 4;  2A15 A;  4NRE A;  1EUI C;  1RTU A;  2W56 A;  3GRD A;  1FUW A;  1W00 A;  5EVH A;  1TUH A;  2CFL A;  2D1W A;  1RCL A;  3X42 A;  3J7Y d;  2CH9 A;  3K0Z A;  2W9Q A;  2IUK A;  2KF3 A;  3N9H A;  4HM8 B;  2WGO A;  3CPO A;  3FF0 A;  1BSA A;  1YJN 3;  2XFT A;  5G1L A;  3STD A;  6GSP A;  3V98 A;  1CH0 A;  3G16 A;  1UCI A;  1OH0 A;  2C10 A;  3KKG A;  1WTH A;  3ZG5 A;  1X1U A;  3X3X A;  1YJ9 3;  1SJW A;  3T8U A;  1VQP 3;  1I2G A;  3FLJ A;  2OQE C;  1VQ5 3;  4R9L A;  4NHF A;  3UJM A;  2RFR A;  5LC6 A;  2AAD A;  2F56 A;  1FGQ A;  1ISK A;  1JRQ A;  3AHW A;  3DM8 A;  3F40 A;  2CWT A;  2XGN A;  3URP A;  1RN1 A;  2W6J H;  5IEO A;  5FGO A;  1QVF 2;  1M9G A;  2AAE A;  7STD A;  1L5G B;  4LGQ A;  1SIH A;  3UNL A;  1FW7 A;  1I70 A;  4GL6 A;  4XBT A;  2F4Y A;  3NUV A;  1O7M B;  3WA3 A;  3PYJ A;  2CG1 A;  3F14 A;  2XH9 A;  3G0K A;  3G8Z A;  4WYK B;  1RGH A;  5CF2 A;  4BTX A;  2ML5 A;  1BSD A;  1LNI A;  1DET A;  1PYL A;  1IQY A;  2P0X A;  1W6G A;  3D4A A;  4O02 B;  1GOY A;  1MWR A;  1GD4 A;  1AVL A;  1OGZ A;  8CHO A;  2HMK B;  2H0H A;  1MOL A;  2OWP A;  3CCL 3;  4FCJ A;  4HJL B;  1VQ9 3;  3IPT A;  4RBN A;  3NHX A;  3X3Z A;  2BO9 B;  2C11 A;  3B7C A;  1HKX A;  1LXE A;  1E3R A;  2IY2 A;  3HZP A;  4KFF A;  3GZR A;  3MHE A;  1BNE A;  2GEX A;  3NBR A;  3JUN A;  4X2O A;  4GB5 A;  4O3V A;  3NQY A;  2GEY A;  3KCH A;  5AIH A;  4BIR A;  1Q82 4;  1BNS A;  1B20 A;  1RRH A;  3F9S A;  1N8R 4;  1JNQ A;  3PGB A;  3JUQ A;  3VGN A;  3X41 A;  1JZD A;  2W9P A;  3CMA 3;  1JB5 A;  2P09 A;  2D42 A;  4EV2 A;  3Q3F A;  4R80 A;  5HGR A;  3NV0 B;  4FMD A;  1BRI A;  5KP3 A;  1GMQ A;  2XR8 B;  1LRA A;  1C54 A;  1BRH A;  1GS3 A;  1U5O A;  4HM3 B;  4LZI A;  1NNV A;  3KII A;  2HMO B;  1G96 A;  2XFS A;  3U1W A;  3LYG A;  1TRP A;  3SVA A;  4RZM A;  5AII A;  1G0T A;  2FXT A;  3JUO A;  4FMB A;  1N5H A;  2CFG A;  4N6T A;  1TFK A;  1O7G B;  1CYV A;  1YGW A;  3LT9 A;  1GOV A;  1BUQ A;  2XF3 A;  3AGN A;  4LSO A;  5GSP A;  4H3U A;  1PFP A;  2BMQ B;  3OW2 2;  4WYK A;  1BNG A;  1JKG B;  1OHO A;  4N6N B;  1RGC A;  5JPP A;  1RMS A;  3SOA A;  1MWT A;  3CME 3;  2Z7A A;  3KFQ C;  4R1K A;  3T8N A;  1VQM 3;  1I0V A;  3SLU A;  2CK3 H;  1RNB A;  2Y74 A;  1DMQ A;  2H0G A;  3E99 A;  3A5E A;  4HM5 B;  1X1Y A;  1GY6 A;  1UUG B;  5IF6 A;  1OF5 A;  4WP5 A;  4K61 A;  3OWS A;  1V74 A;  2L4V A;  5ELJ A;  4EXR A;  3KSE D;  1UDI I;  3HOH A;  4HM6 B;  1CQS A;  3RDE A;  5IEN A;  2GU1 A;  3F7S A;  2CX0 A;  3LXU X;  4XDW A;  1IQX A;  3CCR 3;  5D82 A;  2R4I A;  5BIR A;  3AMO B;  1RN7 A;  1I3F A;  4FCM A;  3N8B A;  3G6E 3;  2Z77 A;  3CC2 3;  1W4N A;  1BSB A;  1N9J A;  4GSP A;  3BLZ A;  1YVB I;  2RSX A;  1PU4 A;  3SYU A;  3FG3 A;  3DY5 A;  2KXG A;  3LTC A;  4HZB B;  3N54 B;  3SXX A;  4BU4 A;  1FA3 A;  2CHC A;  2GXF A;  3PCS A;  4HKV B;  3S28 A;  1LNH A;  4DKI A;  3DMC A;  2CFW A;  2K0M A;  1JBS A;  2CKF B;  3BND A;  4QWT A;  1A2K A;  1DMM A;  1V57 A;  2IYJ A;  1K41 A;  4BL3 A;  1BNF A;  2KCD A;  3LZA A;  5M18 A;  1JKG A;  1JB2 A;  5KP4 A;  1VQN 3;  3CC4 3;  1JZO A;  1KD1 4;  1RGF A;  2SAR A;  4AEQ A;  4HYZ A;  3DGY A;  5IG4 A;  1A2V A;  5BXQ A;  1BRJ A;  2LYX A;  3WHO A;  2L1S A;  1U8C B;  3I56 3;  1STF I;  2QEX 3;  1W6C A;  2B24 B;  1SII A;  2O9U X;  1I3I A;  5ELU A;  3FZW A;  3CD6 3;  1I0X A;  3FCS B;  1BGS A;  5IG5 A;  4STD A;  1UI8 A;  3FF2 A;  1RKY A;  3AGO A;  1AR0 A;  1LOX A;  1I2F A;  2CFK A;  1B2S A;  1F8N A;  3MPH A;  2BNG A;  4HBR A;  4HVN A;  4K1U A;  1VQ8 3;  4OVM A;  1QVG 2;  3NM2 A;  1ULJ B;  4X2H A;  2P0M A;  4L8P A;  3S67 A;  4EC6 A;  1YIJ 3;  2UGI A;  1QAF A;  1T2I A;  1IV9 A;  1BVI A;  4BTY A;  4KFD A;  2UX0 A;  3DZL A;  5D83 A;  3DGO A;  1ZX2 A;  1W7C A;  3Q2P A;  1BRK A;  3WA2 X;  1VQ7 3;  2BIR A;  3DGM A;  1YNV X;  4XB5 A;  3CXC 2;  3CCU 3;  5AYS C;  2M7O A;  3ALA A;  3KN4 A;  4O8S A;  1VQ6 3;  1WMN A;  4N6M A;  2XEP A;  4IPB A;  1ROV A;  1DE3 A;  3B4O A;  2XRX B;  1RJO A;  3HII A;  1FGO A;  3X3Y A;  2OOV C;  2CX1 A;  1UCL A;  1LOY A;  3Q90 A;  1OCV A;  3LT8 A;  1I8V A;  1R4Y A;  2WOF A;  3NM7 A;  3HK4 A;  2W2C A;  3K63 A;  1VQL 3;  1WQL B;  4FMC A;  1A90 A;  3LTA A;  5G1K A;  1K9M 4;  3ECF A;  2OQE A;  4KZ1 A;  1DYU A;  2P05 A;  2KRT A;  3CNX A;  1IQ8 A;  1EEJ A;  2E2T A;  1R4C A;  2FGT A;  2F5M A;  2ZHX B;  1OHP A;  1KC8 4;  1K28 A;  4JRF A;  3HIG A;  1D6Z A;  1TFO A;  3CC7 3;  3EN1 B;  1TRQ A;  4FMA A;  3EX9 A;  1IT8 A;  4WFO A;  1TU5 A;  3BIR A;  1IVW A;  1MWS A;  1K73 4;  2P38 A;  1UCJ A;  2CG0 A;  3WMD A;  2HMJ B;  5IER A;  1B2Z A;  3SED A;  1Q7Y 4;  1O7N B;  2CFD A;  4XBX A;  4FR9 A;  3GZB A;  5AIF A;  1US1 A;  3EC9 A;  5LC7 A;  3SOY A;  1IVV A;  1IVX A;  1RHL A;  8RNT A;  1BAN A;  2GBX B;  2ZA4 A;  1TJD A;  2W0Q A;  1LVN A;  2GSP A;  1BRG A;  1QMA A;  3H51 A;  3V99 A;  1IYY A;  1GMP A;  3LTD A;  4XDV A;  1B3S A;  3DH2 A;  4RNY A;  1K8A 4;  3LOY A;  4PEJ A;  1LOV A;  1BIR A;  1WMO A;  3D3L A;  1GYB A;  2KF6 A;  2O3O A;  1RGK A;  3CNM A;  1RGA A;  1N8Q A;  2K54 A;  1T5Y A;  1DMN A;  4TX4 A;  5HOH A;  4U13 A;  5M1A A;  1WMP A;  2WO0 A;  2BHM A;  1KQS 2;  1A2P A;  2YFL B;  1UW1 A;  3EF8 A;  4JF8 A;  2LQV A;  1BU4 A;  1RRL A;  3CPW 2;  1YVS A;  1NB3 I;  2ZL8 A;  1WNH A;  1W6Y A;  1E97 A;  2PZV A;  3FG4 A;  5I97 A;  1M90 4;  1JBR A;  2W03 A;  2Z6B A;  2XSO B;  3OX9 A;  4HM4 B;  4KVH A;  2ML6 A;  3PZW A;  3D79 A;  1LQM B;  1A67 A;  3VSY A;  1B2U A;  3L0R A;  4NPB A;  4WHA A;  1FYS A;  5D81 A;  3ZG0 A;  3OXA A;  4EW5 A;  1AVK A;  1JBT A;  1BRN L;  2GBW B;  1ZS7 A;  3LH4 A;  2I9W A;  1ROA A;  3EE1 A;  3EB8 A;  1TIJ A;  3OV4 A;  3BNE A;  6STD A;  3D9R A;  4GHO A;  1RGE A;  1C7H A;  3NV0 A;  1O7H B;  4R9K A;  1X1W A;  1TP6 A;  2BU4 A;  1I2E A;  4HAA A;  4MMZ B;  1RSN A;  4J9A A;  1M1K 4;  1OHS A;  2R41 A;  1RGG A;  4J5K A;  1OPY A;  3G71 3;  5AEU B;  4I4K A;  4N6U A;  4MJD A;  2KF5 A;  1O7P B;  1B27 A;  1ZGX A;  2INX A;  5DRE A;  3MG1 A;  1D6Y A;  2WOH A;  1O7W B;  3H3H A;  1W02 A;  1UI7 A;  3AHS A;  4I5Q A;  1OGX A;  2MC8 A;  1BRS A;  1SQW A;  1W2B 2;  4HOH A;  1MGW A;  1RGL A;  2SBL A;  3UL6 A;  3U97 A;  1KWI A;  2KAA A;  1SPU A;  1FUT A;  7RNT A;  4L8O A;  2K3D A;  1YIT 3;  1YHQ 3;  4G1M B;  5CLK A;  3GZX B;  1UGH I;  2CWV A;  1E3V A;  1YI2 3;  3WOF B;  2ZDJ A;  2YFJ B;  1GMR A;  3NX0 A;  2F99 A;  3VF1 A;  2IUJ A;  3S29 A;  1JB4 A;  5AIG A;  1FGR A;  3G4S 3;  3K5T A;  1W01 A;  3CCE 3;  2STD A;  1B21 A;  2XSH B;  4LEH A;  1RNT A;  4IIA A;  1FGM A;  3UL5 A;  1LQG C;  1NWW A;  2BT3 A;  4MEI A;  3RGA A;  1BOX A;  3S5C A;  1JJ2 2;  2HMM B;  1BSC A;  4R4K A;  1HZ1 A;  1W2Z A;  2QIY A;  3MKI A;  3F7X A;  3AMO A;  1BAO A;  1BSE A;  3OWY A;  5AI1 A;  1DVD A;  1OAC A;  2B1X B;  3JVC A;  3FSD A;  3PXM A;  3NQZ A;  4K1V A;  3S27 A;  3I55 3;  3BB9 A;  5M19 A;  1D6U A;  3D5I A;  1AY7 A;  4KT3 B;  3T0U A;  1GSP A;  4IT7 A;  3WR2 A;  3FGY A;  3B8L A;  5IW9 A;  1Q40 B;  4XM4 A;  3HX8 A;  1MGR A;  2HML B;  2F86 B;  4HM7 B;  1GD3 A;  2OTL 3;  1G02 A;  1AQZ A;  2UUG C;  4CCV A;  2HOH A;  4XBY A;  5STD A;  4FCZ A;  5CXO A;  4ZM8 A;  1MWU A;  1N5P A;  3WOD G;  2XGL A;  3GWR A;  1KSI A;  4OK0 A;  1VQQ A;  1M1X B;  4K90 B;  1EA2 A;  1BNJ A;  1UUV B;  3RNT A;  4EV5 A;  6RNT A;  3EHC A;  3A76 A;  3CCV 3;  3IMA B;  1VZZ A;  4ORL A;  1UGI A;  5EQL A;  4O2H A;  1PY3 A;  1CEW I;  1BUJ A;  3EBY A;  1QJG A;  1RCK A;  3LTB A;  3ZFZ A;  2Y73 A;  4ILF A;  3BU4 A;  1S72 3;  4KFE A;  3D5G A;  2GU3 A;  3IJE B;  1NU3 A;  1Z1S A;  2JQ5 A;  2W04 A;  3UB1 A;  4N6V 0;  3NBJ A;  1YGE A;  1FUS A; 
#chains in the Genus database with same CATH homology
 2MF7 A;  2E2U A;  2Z76 A;  4HM0 B;  3FG1 A;  4RNZ A;  3LML A;  4AKY A;  2BMR B;  3CU3 A;  2OOV A;  3EN8 A;  3EBT A;  3ROB A;  3DGN A;  3X40 A;  1JN5 B;  3DXO A;  1ZO2 A;  5CK6 A;  1UUW B;  2OTJ 3;  4EBG A;  1OF5 B;  2BMO B;  3FKA A;  2RCD A;  3O8Y A;  3NXJ A;  3DUK A;  3EJV A;  1AV4 A;  1EKM A;  1Q40 A;  5TGN A;  3MG3 A;  1S5A A;  1NO3 A;  4WWU C;  3GAX A;  3BNC A;  4H61 A;  2WGQ A;  1IU7 A;  5EEO A;  3M8C A;  5IEP A;  1HU9 A;  3DGL A;  3MYT A;  1STD A;  3F8H A;  4N6O B;  4N6L A;  1GY5 A;  2PNC A;  5DRV A;  5IG0 A;  3KE7 A;  3KZT A;  1NB5 I;  2FNQ A;  3JUM A;  5AYR B;  4HZ9 B;  5JPU A;  5JBS A;  3MWZ A;  2QA4 3;  3Q1C A;  3K7C A;  3SX1 A;  3WDG B;  3WOE B;  3JUP A;  2E2V A;  4Q53 A;  1J2B A;  1Q42 A;  2W56 B;  3FH1 A;  4LMI A;  4MMX B;  2YX9 A;  3KSP A;  4CDL A;  3QK9 A;  2JDI H;  3BNB A;  5KP1 A;  2IA7 A;  3NBB A;  1IDP A;  1ASK A;  2CW9 A;  3ER7 A;  4OUQ A;  4HM1 B;  2OCT A;  5A0O B;  5FW5 A;  1QAK A;  1EQK A;  1IV7 A;  1VQK 3;  1FGT A;  2V1L A;  3MG2 A;  1IT7 A;  4J8T A;  4N3V A;  2CIU A;  3PS8 A;  3CCM 3;  2YFI B;  3EQQ B;  1W5Z A;  3GZY B;  1NDO B;  4BTW A;  1JN5 A;  1QAL A;  3K9M C;  3QRD A;  5BVB A;  2F98 A;  1N9E A;  5AEW B;  2IMJ A;  4EYC A;  1MNL A;  3OWU A;  3PCR A;  3CCJ 3;  4L7K A;  3I0Y A;  5CF1 A;  1IK3 A;  1CYU A;  1NJI 4;  1YJW 3;  2Q07 A;  3B4P A;  4MMY B;  2RGQ A;  2CC3 A;  1OUN A;  1JV2 B;  2HMN B;  4HM2 B;  3CCS 3;  4AKZ A;  1VQ4 3;  5G2G A;  2CWU A;  3CCQ 3;  5IG3 A;  2QGU A;  1ULI B;  1EG9 B;  3F8X A;  1DVC A;  3RGR A;  1GY7 A;  3TDG A;  1IVU A;  3MSO A;  1Q86 4;  1Y4K A;  3HI7 A;  1VQO 3;  1Q81 4;  2A15 A;  4NRE A;  2W56 A;  3GRD A;  1FUW A;  1W00 A;  5EVH A;  1TUH A;  2CFL A;  2D1W A;  3X42 A;  3J7Y d;  2CH9 A;  3K0Z A;  2W9Q A;  2IUK A;  3N9H A;  4HM8 B;  2WGO A;  3CPO A;  3FF0 A;  1YJN 3;  2XFT A;  3STD A;  3V98 A;  3G16 A;  2C10 A;  1OH0 A;  3KKG A;  1WTH A;  3X3X A;  1YJ9 3;  1SJW A;  3T8U A;  1VQP 3;  3FLJ A;  2OQE C;  1VQ5 3;  4R9L A;  4NHF A;  3UJM A;  2RFR A;  5LC6 A;  1FGQ A;  1ISK A;  1JRQ A;  3DM8 A;  3F40 A;  2CWT A;  2XGN A;  2W6J H;  5IEO A;  5FGO A;  1QVF 2;  1M9G A;  7STD A;  1L5G B;  4LGQ A;  1SIH A;  3UNL A;  4GL6 A;  4XBT A;  3NUV A;  1O7M B;  3WA3 A;  3PYJ A;  2CG1 A;  3F14 A;  2XH9 A;  3G0K A;  3G8Z A;  4WYK B;  5CF2 A;  4BTX A;  2ML5 A;  3V92 A;  1IQY A;  2P0X A;  1W6G A;  4O02 B;  1OGZ A;  8CHO A;  1GD4 A;  1AVL A;  2HMK B;  1MOL A;  2OWP A;  3CCL 3;  4FCJ A;  4HJL B;  1VQ9 3;  3IPT A;  4RBN A;  3NHX A;  3X3Z A;  2BO9 B;  2C11 A;  3B7C A;  1HKX A;  1LXE A;  1E3R A;  3HZP A;  4KFF A;  3GZR A;  3MHE A;  3NBR A;  2GEX A;  3JUN A;  4X2O A;  4GB5 A;  4O3V A;  3NQY A;  2GEY A;  5AIH A;  1Q82 4;  3F9S A;  1RRH A;  1N8R 4;  1JNQ A;  3PGB A;  3JUQ A;  3VGN A;  3X41 A;  2W9P A;  3CMA 3;  1JB5 A;  2P09 A;  2D42 A;  4EV2 A;  4R80 A;  5HGR A;  3NV0 B;  4FMD A;  5KP3 A;  2XR8 B;  1GS3 A;  1U5O A;  4HM3 B;  4LZI A;  3KII A;  2HMO B;  1G96 A;  2XFS A;  3U1W A;  3LYG A;  3SVA A;  4RZM A;  5AII A;  2FXT A;  3JUO A;  4FMB A;  1N5H A;  2CFG A;  4N6T A;  1TFK A;  1O7G B;  1CYV A;  3LT9 A;  1BUQ A;  2XF3 A;  4LSO A;  4H3U A;  1PFP A;  2BMQ B;  3OW2 2;  4WYK A;  1JKG B;  1OHO A;  4N6N B;  5JPP A;  3SOA A;  3CME 3;  2Z7A A;  3KFQ C;  4R1K A;  3T8N A;  1VQM 3;  3SLU A;  2CK3 H;  2Y74 A;  1DMQ A;  3E99 A;  4HM5 B;  1GY6 A;  5IF6 A;  1OF5 A;  4WP5 A;  4K61 A;  3OWS A;  1V74 A;  2L4V A;  5ELJ A;  4EXR A;  3KSE D;  4HM6 B;  1CQS A;  3RDE A;  5IEN A;  2GU1 A;  3F7S A;  3LXU X;  4XDW A;  1IQX A;  3CCR 3;  5D82 A;  2R4I A;  3AMO B;  1RN7 A;  3G6E 3;  4FCM A;  3N8B A;  2Z77 A;  3CC2 3;  1W4N A;  1N9J A;  3BLZ A;  1YVB I;  2RSX A;  1PU4 A;  3FG3 A;  3DY5 A;  2KXG A;  3LTC A;  4HZB B;  3N54 B;  3SXX A;  1FA3 A;  2CHC A;  2GXF A;  3PCS A;  4HKV B;  3S28 A;  1LNH A;  3DMC A;  2CFW A;  2K0M A;  2CKF B;  3BND A;  4QWT A;  1A2K A;  1DMM A;  1K41 A;  2KCD A;  3LZA A;  1JKG A;  1JB2 A;  5KP4 A;  1VQN 3;  3CC4 3;  1KD1 4;  4AEQ A;  4HYZ A;  5IG4 A;  1A2V A;  5BXQ A;  3I56 3;  2LYX A;  2QEX 3;  1U8C B;  1STF I;  1W6C A;  2B24 B;  1SII A;  2O9U X;  3CD6 3;  5ELU A;  3FZW A;  3FCS B;  5IG5 A;  4STD A;  1UI8 A;  3FF2 A;  1RKY A;  1AR0 A;  1LOX A;  2CFK A;  1F8N A;  3MPH A;  4HVN A;  2BNG A;  4HBR A;  4K1U A;  1VQ8 3;  4OVM A;  1QVG 2;  3NM2 A;  1ULJ B;  4X2H A;  2P0M A;  4L8P A;  3S67 A;  4EC6 A;  1YIJ 3;  1QAF A;  1IV9 A;  4BTY A;  4KFD A;  2UX0 A;  3DZL A;  5D83 A;  3DGO A;  1ZX2 A;  1W7C A;  3Q2P A;  3WA2 X;  1VQ7 3;  3DGM A;  4XB5 A;  3CXC 2;  3CCU 3;  5AYS C;  2M7O A;  3ALA A;  3KN4 A;  4O8S A;  1VQ6 3;  1WMN A;  1YGE A;  2XEP A;  4IPB A;  1ROV A;  4N6M A;  3B4O A;  2XRX B;  1RJO A;  3HII A;  1FGO A;  3X3Y A;  2OOV C;  3Q90 A;  1OCV A;  3LT8 A;  2WOF A;  3NM7 A;  3HK4 A;  2W2C A;  3K63 A;  1VQL 3;  1WQL B;  4FMC A;  1A90 A;  3LTA A;  1K9M 4;  3ECF A;  2OQE A;  4KZ1 A;  1DYU A;  2P05 A;  2KRT A;  3CNX A;  1IQ8 A;  2E2T A;  1R4C A;  2FGT A;  1KC8 4;  1OHP A;  1K28 A;  4JRF A;  3HIG A;  1D6Z A;  1TFO A;  3CC7 3;  3EN1 B;  4FMA A;  3EX9 A;  1IT8 A;  4WFO A;  1TU5 A;  1K73 4;  1IVW A;  2P38 A;  3WMD A;  2CG0 A;  5IER A;  2HMJ B;  1Q7Y 4;  3SED A;  1O7N B;  2CFD A;  4XBX A;  4FR9 A;  3GZB A;  5AIF A;  1US1 A;  3EC9 A;  5LC7 A;  3SOY A;  1IVV A;  1IVX A;  2GBX B;  2W0Q A;  1LVN A;  1QMA A;  3V99 A;  3H51 A;  3LTD A;  4XDV A;  4RNY A;  1K8A 4;  3LOY A;  4PEJ A;  1WMO A;  3D3L A;  1GYB A;  2O3O A;  3CNM A;  1N8Q A;  2K54 A;  1T5Y A;  1DMN A;  4TX4 A;  4U13 A;  1WMP A;  2WO0 A;  2BHM A;  1KQS 2;  3EF8 A;  2YFL B;  1UW1 A;  4JF8 A;  2LQV A;  1RRL A;  3CPW 2;  1NB3 I;  2ZL8 A;  1WNH A;  1W6Y A;  1E97 A;  2PZV A;  3FG4 A;  5I97 A;  1M90 4;  2W03 A;  2Z6B A;  2XSO B;  3OX9 A;  4HM4 B;  4KVH A;  2ML6 A;  3PZW A;  1A67 A;  3VSY A;  3L0R A;  4WHA A;  5D81 A;  3OXA A;  1AVK A;  2GBW B;  3LH4 A;  2I9W A;  1ROA A;  3EE1 A;  3EB8 A;  1TIJ A;  3OV4 A;  3BNE A;  6STD A;  3D9R A;  1C7H A;  3NV0 A;  1O7H B;  4R9K A;  1TP6 A;  4MMZ B;  4J9A A;  1M1K 4;  1OHS A;  3G71 3;  1OPY A;  5AEU B;  4I4K A;  4N6U A;  4MJD A;  1O7P B;  2INX A;  5DRE A;  3MG1 A;  1D6Y A;  2WOH A;  1O7W B;  3H3H A;  1W02 A;  1UI7 A;  1OGX A;  2MC8 A;  1SQW A;  1W2B 2;  3UL6 A;  2SBL A;  3U97 A;  1KWI A;  1SPU A;  4L8O A;  1YIT 3;  1YHQ 3;  4G1M B;  5CLK A;  3GZX B;  2CWV A;  1E3V A;  1YI2 3;  3WOF B;  2YFJ B;  3NX0 A;  2F99 A;  3VF1 A;  2IUJ A;  3S29 A;  1JB4 A;  5AIG A;  1FGR A;  3G4S 3;  3K5T A;  1W01 A;  3CCE 3;  2STD A;  2XSH B;  4LEH A;  4IIA A;  1FGM A;  3UL5 A;  2BT3 A;  1NWW A;  4MEI A;  3RGA A;  3S5C A;  1JJ2 2;  2HMM B;  4R4K A;  1W2Z A;  2QIY A;  3MKI A;  3F7X A;  3AMO A;  3OWY A;  5AI1 A;  1DVD A;  1OAC A;  2B1X B;  3JVC A;  3FSD A;  3PXM A;  3NQZ A;  4K1V A;  3S27 A;  3I55 3;  3BB9 A;  1D6U A;  3T0U A;  4IT7 A;  3FGY A;  3B8L A;  5IW9 A;  1Q40 B;  4XM4 A;  3HX8 A;  2HML B;  2F86 B;  4HM7 B;  1GD3 A;  2OTL 3;  4CCV A;  4XBY A;  5STD A;  4ZM8 A;  4FCZ A;  5CXO A;  1N5P A;  3WOD G;  2XGL A;  3GWR A;  1KSI A;  4OK0 A;  1M1X B;  4K90 B;  1EA2 A;  1UUV B;  4EV5 A;  3EHC A;  3A76 A;  3CCV 3;  3IMA B;  1VZZ A;  4ORL A;  5EQL A;  4O2H A;  1CEW I;  3EBY A;  1QJG A;  3LTB A;  2Y73 A;  1S72 3;  4KFE A;  2GU3 A;  3IJE B;  1NU3 A;  1Z1S A;  2JQ5 A;  2W04 A;  3UB1 A;  4N6V 0;  3NBJ A;  2ZDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...