2R4IA

Crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
GMNQRDVILDCEKKLLTAIQNNDVESLEVLLHDDLLFIIPSGETVTKETDIAAYSSGKIALRAVVPSDYIIRIIHDTVVVSVNIEIKGEYMEHTLDNTFRYLRVWKLFDGNWKVIAGSCTAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_678039.1) from Cytophaga hutchinsonii ATCC 33406 at 1.60 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Unknown function
total genus 33
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2r4iA00
2Z7AA 5AEUB 3F8HA 2F86B 3B8LA 3FSDA 1W6YA 4IIAA 2Z77A 5JPUA 4HVNA 3F7SA 1ULJB 3CU3A 7STDA 3F40A 2HMNB 1QMAA 4K1VA 1OPYA 3EX9A 3KE7A 4HM8B 4XDWA 1GS3A 1JN5A 2I9WA 3MKIA 2Z76A 1HKXA 3MHEA 5IF6A 3GWRA 2GBWB 1OF5A 3HZPA 3FF0A 1TP6A 5AIFA 1OH0A 5D82A 4HM4B 1OGXA 4XBYA 3EBYA 8CHOA 2HMKB 4HM7B 1JB4A 3SOYA 5D81A 3H3HA 2OWPA 3GZRA 2XR8B 1W00A 2XSHB 1WQLB 3EN8A 1ZO2A 1O7PB 3FKAA 1CQSA 5AEWB 2HMJB 2K54A 3G0KA 2PZVA 4HM5B 4HM2B 4R1KA 2YFLB 4XBTA 1JB2A 3CNXA 2GEYA 2IMJA 1JN5B 1UUVB 3T8NA 5DRVA 5CLKA 4WYKA 4HZBB 4HKVB 2CHCA 2GBXB 3H51A 1NWWA 1O7GB 2YFIB 1Q42A 1QJGA 1DMQA 1ULIB 1Q40B 1GY5A 5IEPA 5HGRA 3B4OA 3JUPA 3KKGA 4PEJA 3MG1A 2HMOB 5STDA 5IG5A 5CXOA 3S5CA 3UNLA 3KZTA 5CF1A 3OV4A 1OHPA 1W02A 4L8PA 3WMDA 2B24B 2XSOB 4H3UA 3SEDA 1ASKA 3T8UA 4N3VA 3FGYA 4U13A 3RGAA 3F7XA 3MG2A 3KSPA 3EF8A 5G2GA 3ECFA 1ISKA 2XRXB 2B1XB 1STDA 5TGNA 4WYKB 3NM2A 1BUQA 3A76A 3I0YA 1JB5A 1NDOB 1Q40A 3VSYA 2R4IA 4J9AA 3GZBA 1NU3A 2QIYA 3LYGA 4HZ9B 2YFJB 3UJMA 3GZYB 4OUQA 1O7MB 4KVHA 2W2CA 3DZLA 4R9LA 2HMMB 3D9RA 5IG3A 4GB5A 1W01A 4LGQA 3NBRA 1UUWB 3K7CA 2CKFB 3SOAA 4I4KA 3MSOA 5AIIA 1JKGB 1DMMA 4FCMA 3JUNA 3DM8A 4HM0B 1A2KA 3FLJA 3ER7A 5KP1A 1EA2A 3HX8A 3G16A 3MYTA 1E97A 1C7HA 1IDPA 1O7WB 1TUHA 2A15A 2GXFA 3DUKA 5DREA 4X2OA 2BMQB 2HMLB 1O7NB 3OWSA 3GRDA 3NHXA 2RGQA 3FH1A 1DMNA 5CK6A 3F8XA 3OWUA 4HM1B 3OX9A 4Q53A 1E3RA 1U5OA 1GYBA 1Z1SA 3B7CA 2BNGA 4MJDA 3FZWA 5CF2A 3M8CA 1GY7A 2BMRB 1E3VA 1JKGA 3EHCA 3B4PA 3GZXB 5FW5A 3JUMA 4XM4A 2F99A 5IEOA 5IG4A 6STDA 5AI1A 3DXOA 5BXQA 2RFRA 3NUVA 4XDVA 3EC9A 2F98A 3F9SA 3FF2A 3OWYA 3RGRA 1S5AA 4HM6B 1SJWA 4XBXA 3NXJA 4CDLA 3NV0A 4LEHA 5D83A 5KP4A 1ZX2A 4XB5A 3EN1B 3OXAA 5IG0A 5JPPA 1GY6A 2GEXA 4R9KA 3EQQB 4L8OA 3JUOA 1OHOA 3CNMA 4RZMA 2JQ5A 5EVHA 3CPOA 4ORLA 4HM3B 1K41A 3JUQA 5BVBA 4J8TA 3F14A 3BLZA 1OCVA 3STDA 3K0ZA 3MG3A 4L7KA 3BB9A 3ROBA 1OHSA 1AR0A 4K1UA 4FCJA 3VGNA 1OGZA 5IENA 4WWUC 5AIHA 2QGUA 2UX0A 2STDA 5KP3A 1OUNA 3DMCA 2INXA 4X2HA 3Q90A 3NV0B 4OVMA 3E99A 1OF5B 4HJLB 3EBTA 3LZAA 2RCDA 1VZZA 3EJVA 5AIGA 4STDA 1EG9B 1O7HB 4LMIA 3G8ZA 2BMOB 5IERA 4WP5A 3HK4A 3IPTA
chains in the Genus database with same CATH superfamily
1TFKA 2Z7AA 3LMLA 1UUGB 1N5PA 3PCRA 5AEUB 1TFOA 4HAAA 3F8HA 2F86B 3B8LA 3FSDA 3PYJA 2CWTA 3FG4A 3KN4A 1W6YA 7RNTA 4IIAA 2Z77A 1AV4A 2L1SA 1RCKA 3HOHA 2PNCA 3LT9A 3NX0A 5JPUA 4EBGA 1UCJA 4HVNA 3F7SA 2BU4A 3CCR3 1YVBI 1ULJB 3CU3A 4FCZA 1LNHA 1GD3A 1GOUA 1AVLA 5A0OB 7STDA 1AQZA 3F40A 1RGLA 2OQEA 4AKZA 4O3VA 4BTYA 2K0MA 4TX4A 3AHWA 1K28A 3BNBA 4KFDA 2HMNB 4MMYB 1QMAA 1M9GA 2IYJA 2Y74A 4K1VA 1OPYA 4H61A 5AYSC 2XGNA 3CME3 5EEOA 3EX9A 3DGOA 3KE7A 4HM8B 4XDWA 1RCLA 1M904 1MGRA 1PFPA 1GS3A 1JN5A 3LT8A 2I9WA 2KXGA 3MKIA 4RNTA 3ZG0A 2Z76A 1C54A 3Q3FA 1EUIC 2OTJ3 1UCIA 1G96A 1HKXA 1B2MA 3MHEA 1RMSA 3AGNA 5IF6A 1A2PA 3GWRA 1VQL3 3Q2PA 2GBWB 1OF5A 1BRKA 3AMOB 1PY3A 1K8A4 1RDSA 1VQ53 1I2FA 5RNTA 3HZPA 2D42A 1JBTA 3FF0A 1TP6A 1VQ43 2AAEA 5AIFA 1OH0A 1BNFA 5D82A 4HM4B 1LQGC 1OGXA 3CXC2 4XBYA 3EBYA 3I563 8CHOA 2KAAA 3PZWA 3CCL3 1MNLA 1CYUA 4KT3B 4CCVA 2HMKB 2WOHA 4HM7B 2H0IA 1BSAA 3SXXA 1W2ZA 2IUJA 1JB4A 3URPA 1UCLA 1D6ZA 1RLSA 1IQXA 4EXRA 3BNEA 3S67A 1LNIA 4NPBA 3SOYA 5LC6A 4EV2A 1VQ73 1D6YA 5D81A 1A2VA 3U1WA 2UUGC 1KD14 4LZIA 2E2VA 2ZL8A 1T5YA 5IW9A 3H3HA 2OWPA 3GZRA 5BIRA 1VQ93 2XR8B 1G0TA 1W00A 2XSHB 5G1KA 1MOLA 1WQLB 3BNDA 3EN8A 3FCSB 4O8SA 1ZO2A 1I0VA 1O7PB 4JRFA 4N6MA 3FKAA 4N6OB 1CQSA 4J5GA 5AEWB 2HMJB 2K54A 3G0KA 1KSIA 2PZVA 4HM5B 2ZA4A 2ZDJA 1Q864 4HM2B 4R1KA 1B2XA 2H0GA 2YFLB 2BT3A 1WMPA 4XBTA 1JB2A 1CH0A 1KQS2 3HIIA 3CNXA 1L5GB 1QVG2 1AVKA 2GEYA 1W4NA 2CWVA 1EQKA 1RGGA 1T3BA 1LQMB 2IMJA 1VQK3 1JN5B 3KSED 3PCSA 3BIRA 3CCQ3 3IJEB 1UUVB 2P0XA 3AHSA 1J2BA 1U8CB 3T8NA 5DRVA 3CC23 5CLKA 8RNTA 4WYKA 1KC84 2QEX3 3L0RA 1DYUA 4HZBB 1EEJA 4K90B 1YVSA 4HKVB 2CHCA 2GBXB 3H51A 1RGKA 1B21A 2UGIA 1NWWA 3N54B 1Q7Y4 1O7GB 1BNRA 1WTHA 2P05A 1QVF2 1QAKA 2C10A 2YFIB 1PYLA 2OTL3 1Q42A 1QJGA 1NO3A 2Z6BA 3ALAA 3PGBA 4RNZA 1BOXA 1IVVA 1DMQA 1ULIB 4RNYA 5M1AA 1GOVA 1YNVX 3K5TA 1Q40B 3TDGA 1S723 1GY5A 5ELUA 3VF1A 3J7Yd 1YJ93 1VQ83 3WDGB 1DVDA 5IEPA 3ZG5A 1UGHI 5GSPA 4OK0A 5HGRA 2GU1A 3B4OA 3DH2A 4CJNA 3JUPA 3KKGA 3CCE3 4PEJA 1HU9A 3MG1A 4N6TA 5FGOA 2HMOB 5STDA 3WR2A 5CXOA 3S5CA 3UNLA 5IG5A 3SYUA 3NBJA 3Q1CA 1RRHA 3KZTA 5CF1A 1BRNL 3MWZA 3CC43 1HYFA 3LTCA 4LYLB 3OV4A 1SARA 1IU7A 1OHPA 1R4YA 3DY5A 1W02A 3KCHA 3X42A 1I8VA 4L8PA 3WMDA 1I2EA 2B24B 2XSOB 4H3UA 3SEDA 1IVXA 1ASKA 1BANA 2FNQA 1NJI4 3T8UA 2OOVA 4N3VA 3FGYA 1UCKA 4QWTA 7GSPA 2ML6A 4U13A 3RGAA 3F7XA 1CYVA 1VQQA 4AKYA 1Q824 1YHQ3 1K9M4 3MG2A 3KSPA 1RTUA 3EF8A 1YGEA 3X3YA 4WFOA 4FMBA 1YJN3 2LYXA 1BSBA 1QALA 5G2GA 1IK3A 3KFQC 1IQ8A 3CCJ3 2BO9B 1MWTA 4EV5A 1IVWA 1JBSA 1YGWA 3D5GA 2CFGA 1QAFA 1JZOA 1A90A 2CFLA 3X41A 3ECFA 3U97A 1ISKA 1G02A 1GD4A 1FGOA 2XRXB 2IY2A 3D5IA 2B1XB 1TTOA 1STDA 5TGNA 3RNTA 4CPKA 1X1YA 1ROVA 4GHOA 4WYKB 3UL5A 4BL2A 1GOYA 1WMOA 3NM2A 1BUQA 3EB8A 1X1WA 3A76A 3I0YA 1UI7A 2XH9A 2Y73A 4NREA 1IYYA 1JB5A 1NDOB 1Q40A 3DGMA 3VSYA 1K734 1TU5A 2R4IA 4J9AA 3GZBA 1N9JA 3V98A 1YJW3 1NU3A 1RGAA 3G6E3 2QIYA 3LYGA 1B20A 2D1WA 2WGOA 2YFJB 4HZ9B 4IT7A 1IV9A 1W6GA 3UJMA 3LXUX 4JF8A 5AYRB 4O2HA 1Q9EA 3GZYB 3SLUA 1M1K4 3WHOA 1RSNA 4OUQA 1O7MB 1STFI 2CG0A 3X40A 3CCU3 2W9QA 4KVHA 2XGLA 4HBRA 2W2CA 1F8NA 3PXMA 1SIIA 5M19A 2Q07A 3CCV3 1MGWA 4N6V0 1UGIA 3DZLA 4R9LA 1TJDA 2W03A 1RN1A 3BNCA 2FXTA 2HMMB 3D9RA 3PS8A 4FMCA 5EQLA 1BNEA 5IG3A 1BNSA 4GB5A 4GL6A 1PU4A 1W01A 4LGQA 2SBLA 4J5KA 3KIIA 1T2HA 3DGYA 3T0UA 1M1XB 1SQWA 3NBRA 4R80A 1JZDA 2CIUA 5G1LA 4ZM8A 1MWSA 1UUWB 2OQEC 1BRJA 3K7CA 2CKFB 2KF4A 2IA7A 1UI8A 1US1A 3SOAA 2KF5A 4I4KA 1YIJ3 3CCS3 1W7CA 3MSOA 5AIIA 1JKGB 1BU4A 1IT8A 1DMMA 3K9MC 3LH4A 4FCMA 4FMDA 3WOEB 3JUNA 3SVAA 1FGMA 1LVNA 3DM8A 4FMAA 4HM0B 4WHAA 6RNTA 1A2KA 1BNIA 1Q7HA 1T2IA 5LC7A 4KFEA 3G713 1FW7A 2P09A 3S28A 1N9EA 3FLJA 4MEIA 3ER7A 5KP1A 1EA2A 2RNTA 3HX8A 1BAOA 2CW9A 1JNQA 1RGCA 3G16A 3MYTA 1E97A 1FYSA 1C7HA 1YIT3 1IDPA 1LOXA 4MMXB 4AEQA 1O7WB 1TUHA 2A15A 4N6NB 2GXFA 2XFSA 4EW5A 3DUKA 5DREA 4X2OA 1IV7A 1RN7A 2BMQB 1SPUA 3LTAA 2HMLB 3JVCA 1O7NB 3LTDA 3OWSA 3GRDA 1TIJA 3N8BA 4BTXA 2F4YA 3CCM3 1CEWI 1RGEA 3NHXA 1FA3A 1UW1A 2RGQA 1W2B2 1I0XA 1BSEA 1MWUA 3FH1A 1DMNA 1R4CA 5CK6A 3F8XA 3OWUA 2FGTA 5BU4A 1IVUA 1NNVA 4LSOA 4HM1B 2O3OA 3OX9A 4Q53A 3N9HA 3CPW2 1E3RA 1U5OA 4BIRA 1GMPA 1GYBA 1Z1SA 1WMNA 2WO0A 1FUTA 3B7CA 2IUKA 2K3DA 2JDIH 2CG1A 2BNGA 5ELJA 2F5MA 1NB5I 1NB3I 4MJDA 4FR9A 1TRPA 3FZWA 5JBSA 2M7OA 5CF2A 2XEPA 1LOVA 3WA3A 3M8CA 1LOWA 1BSDA 2W56A 1GY7A 1W5ZA 2BMRB 1BNGA 1BRGA 1E3VA 1FGTA 1JKGA 2E2UA 3ZFZA 1A67A 3EHCA 3B4PA 3GZXB 4EYCA 5FW5A 1RKYA 3CC73 3JUMA 4XM4A 1Y4KA 2F99A 2AADA 5IEOA 1DVCA 1I3IA 3MPHA 4BU4A 6STDA 5IG4A 2C4BA 1GMRA 1JV2B 5AI1A 3DXOA 5BXQA 2RFRA 3NUVA 1BUJA 4XDVA 3EC9A 1FGQA 2F98A 3LOYA 1MWRA 3F9SA 1VQP3 1BRIA 3I553 3FF2A 3OWYA 1BNJA 1I2GA 1RHLA 3RGRA 1I3FA 1B3SA 1S5AA 5I97A 4DKIA 2H0HA 1RRLA 4HM6B 1IT7A 1W6CA 3K63A 1YI23 1SJWA 4XBXA 3NXJA 1BSCA 4CDLA 2ML5A 4HYZA 3NV0A 3DGLA 4LEHA 2CK3H 2BHMA 5D83A 5KP4A 1D6UA 1ZX2A 2P0MA 3D3LA 3HI7A 3NQZA 4XB5A 1AY7A 2F56A 2WGQA 3D79A 1N8R4 1JBRA 3EN1B 1Q814 1BIRA 3A5EA 2W04A 1B2ZA 3WODG 1B2UA 3OXAA 2GSPA 3RDEA 5HOHA 1BVIA 1DETA 5IG0A 3NM7A 3DGNA 3BU4A 5JPPA 1FZUA 1JRQA 2V1LA 1GY6A 1I70A 2XFTA 2SARA 1VQO3 1KWIA 4N6LA 2CX0A 4MMZB 2GEXA 1JJ22 1X1UA 1LRAA 2ZHXB 4R9KA 1HZ1A 3EQQB 4L8OA 4KFFA 3JUOA 1OHOA 3CNMA 3X3ZA 3D4AA 4RZMA 2CFKA 2CC3A 2JQ5A 1GMQA 5EVHA 3CPOA 1N8QA 4ORLA 4HM3B 3LTBA 1K41A 1GSPA 3JUQA 4O02B 9RNTA 2OOVC 5BVBA 4J8TA 3QK9A 3WA2X 3S27A 1VQM3 2W56B 3O8YA 4NHFA 2RSXA 3GSPA 5M18A 3F14A 3BLZA 3WOFB 3IMAB 2W0QA 1OCVA 2GU3A 1RJOA 3HIGA 3STDA 2RBIA 4K61A 1BGSA 2CFWA 3AGOA 2CWUA 2KCDA 2MC8A 1EKMA 1ZS7A 2KF6A 3SX1A 2W6JH 3CD63 3K0ZA 3MG3A 2QA43 1LXEA 3FG1A 1OACA 3BB9A 3NQYA 4L7KA 1OHSA 3ROBA 1AR0A 4K1UA 4R4KA 4KZ1A 1V74A 4ILFA 4FCJA 3VGNA 1OGZA 4IPBA 2HOHA 3X3XA 4WWUC 4EC6A 5IENA 3OW22 1B27A 5AIHA 3QRDA 3G4S3 2C11A 2QGUA 2UX0A 2CH9A 4I5QA 2STDA 1LOYA 1RN4A 4HOHA 5KP3A 1OUNA 1WNHA 3AMOA 1DE3A 3DMCA 3UL6A 1RNBA 4GSPA 2INXA 4G1MB 2J8XB 2R41A 3Q90A 4X2HA 3S29A 1ROAA 3NV0B 4N6UA 4OVMA 2KRTA 3E99A 3GAXA 1VQN3 2MF7A 3FG3A 1V58A 2P38A 1ZGXA 1OF5B 4HJLB 2O9UX 1SIHA 2CX1A 3EBTA 3UB1A 1FUWA 1RGHA 2L4VA 2RCDA 3LZAA 1VZZA 1FGRA 2F5WA 1VQ63 3CMA3 3EJVA 3V99A 5AIGA 1B2SA 4STDA 1TRQA 2KF3A 1EG9B 2WOFA 4BTWA 6GSPA 1UDII 2CFDA 1IQYA 1O7HB 2OCTA 3NBBA 4RBNA 1BRSA 3G8ZA 2E2TA 4LMIA 2BMOB 5IERA 1RGFA 4BL3A 3V92A 1RNTA 1BRHA 1FUSA 2XF3A 2YX9A 1V57A 4WP5A 1X1XA 2W9PA 1N5HA 3EE1A 3HK4A 2BIRA 3IPTA 2LQVA
chains in the Genus database with same CATH topology
1TFKA 2Z7AA 3LMLA 1N5PA 3PCRA 5AEUB 1TFOA 3F8HA 2F86B 3B8LA 3FSDA 3PYJA 2CWTA 3FG4A 3KN4A 1W6YA 4IIAA 2Z77A 1AV4A 3LT9A 3NX0A 2PNCA 5JPUA 4EBGA 4HVNA 3CCR3 3F7SA 1YVBI 1ULJB 3CU3A 4FCZA 1LNHA 1GD3A 1AVLA 5A0OB 7STDA 2OQEA 3F40A 4AKZA 4O3VA 4BTYA 2K0MA 4TX4A 1K28A 3BNBA 4KFDA 2HMNB 4MMYB 1QMAA 1M9GA 2Y74A 4K1VA 3CME3 1OPYA 4H61A 5AYSC 2XGNA 5EEOA 3EX9A 3DGOA 3KE7A 4HM8B 4XDWA 1M904 1PFPA 1GS3A 1JN5A 3LT8A 2I9WA 2KXGA 3MKIA 2Z76A 2OTJ3 1G96A 1HKXA 3MHEA 5IF6A 3GWRA 1VQL3 3Q2PA 2GBWB 1OF5A 3AMOB 1K8A4 1VQ53 3HZPA 2D42A 3FF0A 1TP6A 1VQ43 5AIFA 1OH0A 5D82A 4HM4B 1OGXA 3CXC2 4XBYA 3EBYA 3I563 8CHOA 3CCL3 3PZWA 1MNLA 1CYUA 4CCVA 2HMKB 2WOHA 4HM7B 3SXXA 1W2ZA 2IUJA 1JB4A 1D6ZA 1IQXA 4EXRA 3BNEA 3S67A 3SOYA 5LC6A 4EV2A 1VQ73 1D6YA 5D81A 1A2VA 3U1WA 1KD14 4LZIA 2E2VA 2ZL8A 1T5YA 5IW9A 3H3HA 2OWPA 3GZRA 1VQ93 2XR8B 1W00A 2XSHB 1MOLA 1WQLB 3BNDA 3EN8A 3FCSB 4O8SA 1ZO2A 1O7PB 4JRFA 4N6MA 3FKAA 4N6OB 1CQSA 5AEWB 2HMJB 2K54A 3G0KA 1KSIA 2PZVA 4HM5B 2ZDJA 1Q864 4HM2B 4R1KA 2YFLB 2BT3A 1WMPA 4XBTA 1JB2A 1KQS2 3HIIA 3CNXA 1L5GB 1QVG2 1AVKA 2GEYA 1W4NA 2CWVA 1EQKA 2IMJA 1VQK3 1JN5B 3KSED 3PCSA 3CCQ3 3IJEB 1UUVB 2P0XA 1J2BA 1U8CB 3T8NA 5DRVA 3CC23 5CLKA 1KC84 4WYKA 2QEX3 3L0RA 1DYUA 4HZBB 4K90B 4HKVB 2CHCA 2GBXB 3H51A 3N54B 1NWWA 1Q7Y4 1O7GB 1WTHA 2P05A 1QVF2 1QAKA 2C10A 2YFIB 2OTL3 1Q42A 1QJGA 1NO3A 2Z6BA 3ALAA 3PGBA 4RNZA 1DMQA 1IVVA 4RNYA 1ULIB 3K5TA 1Q40B 3TDGA 1S723 1GY5A 5ELUA 3VF1A 3J7Yd 1YJ93 1VQ83 3WDGB 1DVDA 5IEPA 4OK0A 5HGRA 2GU1A 3B4OA 3JUPA 3KKGA 3CCE3 4PEJA 1HU9A 3MG1A 4N6TA 5FGOA 2HMOB 5STDA 5IG5A 5CXOA 3S5CA 3UNLA 3NBJA 3Q1CA 1RRHA 3KZTA 5CF1A 3CC43 3MWZA 3LTCA 3OV4A 1IU7A 1OHPA 3DY5A 3X42A 1W02A 4L8PA 3WMDA 2B24B 2XSOB 4H3UA 3SEDA 1IVXA 1ASKA 2FNQA 1NJI4 3T8UA 2OOVA 4N3VA 3FGYA 4QWTA 2ML6A 4U13A 3RGAA 3F7XA 1CYVA 4AKYA 1Q824 1YHQ3 1K9M4 3MG2A 3KSPA 3EF8A 1YGEA 3X3YA 4WFOA 4FMBA 1YJN3 2LYXA 1QALA 5G2GA 1IK3A 3KFQC 1IQ8A 3CCJ3 2BO9B 4EV5A 1IVWA 2CFGA 1QAFA 1A90A 2CFLA 3X41A 3ECFA 3U97A 1ISKA 1FGOA 1GD4A 2XRXB 2B1XB 1STDA 5TGNA 1ROVA 4WYKB 3UL5A 3NM2A 1WMOA 1BUQA 3EB8A 3A76A 3I0YA 1UI7A 2XH9A 2Y73A 4NREA 1JB5A 1NDOB 1Q40A 3DGMA 3VSYA 1K734 1TU5A 2R4IA 4J9AA 3GZBA 1N9JA 3V98A 1YJW3 1NU3A 3G6E3 2QIYA 3LYGA 2D1WA 2WGOA 2YFJB 4HZ9B 4IT7A 1IV9A 1W6GA 3UJMA 3LXUX 4JF8A 5AYRB 4O2HA 3GZYB 3SLUA 1M1K4 4OUQA 1O7MB 1STFI 2CG0A 3X40A 3CCU3 2W9QA 4KVHA 2XGLA 4HBRA 2W2CA 1F8NA 3PXMA 1SIIA 2Q07A 3CCV3 4N6V0 3DZLA 4R9LA 2W03A 3BNCA 2FXTA 2HMMB 3D9RA 3PS8A 4FMCA 5EQLA 5IG3A 4GB5A 4GL6A 1PU4A 1W01A 4LGQA 2SBLA 3KIIA 3T0UA 1M1XB 1SQWA 3NBRA 4R80A 2CIUA 4ZM8A 1UUWB 2OQEC 3K7CA 2CKFB 2IA7A 1UI8A 1US1A 3SOAA 1YIJ3 4I4KA 3CCS3 1W7CA 3MSOA 5AIIA 1JKGB 4FMDA 1IT8A 1DMMA 3K9MC 3LH4A 4FCMA 3WOEB 3JUNA 3SVAA 1LVNA 1FGMA 3DM8A 4FMAA 4HM0B 4WHAA 1A2KA 5LC7A 4KFEA 3G713 2P09A 3S28A 1N9EA 3FLJA 4MEIA 3ER7A 5KP1A 1EA2A 3HX8A 2CW9A 3G16A 1JNQA 3MYTA 1E97A 1C7HA 1YIT3 1IDPA 1LOXA 4MMXB 4AEQA 1O7WB 1TUHA 2A15A 4N6NB 2GXFA 2XFSA 3DUKA 5DREA 4X2OA 1IV7A 1RN7A 2BMQB 1SPUA 3LTAA 2HMLB 3JVCA 1O7NB 3LTDA 3OWSA 3GRDA 1TIJA 3N8BA 4BTXA 3CCM3 1CEWI 3NHXA 1FA3A 1UW1A 2RGQA 1W2B2 3FH1A 1DMNA 1R4CA 5CK6A 3F8XA 3OWUA 2FGTA 1IVUA 4LSOA 4HM1B 2O3OA 3OX9A 4Q53A 3N9HA 3CPW2 1E3RA 1U5OA 1GYBA 1Z1SA 1WMNA 2WO0A 3B7CA 2CG1A 2IUKA 3CMA3 2JDIH 2BNGA 5ELJA 1NB5I 1NB3I 4MJDA 4FR9A 3FZWA 5JBSA 2M7OA 5CF2A 2XEPA 3WA3A 3M8CA 2W56A 1GY7A 1W5ZA 2BMRB 1FGTA 2E2UA 1E3VA 1JKGA 1A67A 3EHCA 3B4PA 3GZXB 4EYCA 5FW5A 1RKYA 3CC73 3JUMA 4XM4A 1Y4KA 2F99A 5IEOA 1DVCA 3MPHA 5IG4A 6STDA 1JV2B 5AI1A 3DXOA 5BXQA 2RFRA 3NUVA 4XDVA 3EC9A 1FGQA 2F98A 3LOYA 3F9SA 1VQP3 3I553 3FF2A 3OWYA 3RGRA 1S5AA 5I97A 1RRLA 4HM6B 1IT7A 1W6CA 3K63A 1YI23 1SJWA 4XBXA 3NXJA 4CDLA 2ML5A 4HYZA 3NV0A 3DGLA 4LEHA 2CK3H 2BHMA 5D83A 5KP4A 1D6UA 1ZX2A 2P0MA 3D3LA 3HI7A 3NQZA 4XB5A 2WGQA 1N8R4 3EN1B 1Q814 2W04A 3WODG 3OXAA 3RDEA 5IG0A 3NM7A 3DGNA 5JPPA 2V1LA 1JRQA 1GY6A 2XFTA 1VQO3 1KWIA 4N6LA 4MMZB 2GEXA 1JJ22 4R9KA 3EQQB 4L8OA 4KFFA 3JUOA 1OHOA 3CNMA 3X3ZA 4RZMA 2CFKA 2CC3A 2JQ5A 5EVHA 3CPOA 1N8QA 4ORLA 4HM3B 3LTBA 1K41A 3JUQA 4O02B 2OOVC 5BVBA 4J8TA 3QK9A 3WA2X 3S27A 1VQM3 2W56B 3O8YA 4NHFA 2RSXA 3F14A 3BLZA 3WOFB 3IMAB 2W0QA 1OCVA 2GU3A 1RJOA 3HIGA 3STDA 4K61A 2CFWA 2CWUA 2KCDA 2MC8A 1EKMA 3SX1A 3CD63 2W6JH 3K0ZA 3MG3A 2QA43 1LXEA 3FG1A 1OACA 3BB9A 3NQYA 4L7KA 1OHSA 3ROBA 1AR0A 4K1UA 4R4KA 4KZ1A 1V74A 4FCJA 3VGNA 1OGZA 4IPBA 4EC6A 3X3XA 4WWUC 5IENA 3OW22 5AIHA 3QRDA 3G4S3 2C11A 2QGUA 2UX0A 2CH9A 2STDA 5KP3A 1OUNA 1WNHA 3AMOA 3DMCA 3UL6A 2INXA 4G1MB 4X2HA 3Q90A 3S29A 1ROAA 3NV0B 4N6UA 4OVMA 2KRTA 3E99A 3GAXA 1VQN3 2MF7A 3FG3A 2P38A 1OF5B 4HJLB 2O9UX 1SIHA 3EBTA 3UB1A 1FUWA 2L4VA 3LZAA 2RCDA 1VZZA 1FGRA 1VQ63 3EJVA 3V99A 5AIGA 4STDA 1EG9B 2WOFA 4BTWA 2CFDA 1IQYA 1O7HB 2OCTA 3NBBA 4RBNA 4LMIA 3G8ZA 2E2TA 2BMOB 5IERA 3V92A 2XF3A 2YX9A 4WP5A 2W9PA 1N5HA 3EE1A 3HK4A 3IPTA 2LQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7A A;  5AEU B;  3F8H A;  2F86 B;  3B8L A;  3FSD A;  1W6Y A;  4IIA A;  2Z77 A;  5JPU A;  4HVN A;  3F7S A;  1ULJ B;  3CU3 A;  7STD A;  3F40 A;  2HMN B;  1QMA A;  4K1V A;  1OPY A;  3EX9 A;  3KE7 A;  4HM8 B;  4XDW A;  1GS3 A;  1JN5 A;  2I9W A;  3MKI A;  2Z76 A;  1HKX A;  3MHE A;  5IF6 A;  3GWR A;  2GBW B;  1OF5 A;  3HZP A;  3FF0 A;  1TP6 A;  5AIF A;  1OH0 A;  5D82 A;  4HM4 B;  1OGX A;  4XBY A;  3EBY A;  8CHO A;  2HMK B;  4HM7 B;  1JB4 A;  3SOY A;  5D81 A;  3H3H A;  2OWP A;  3GZR A;  2XR8 B;  1W00 A;  2XSH B;  1WQL B;  3EN8 A;  1ZO2 A;  1O7P B;  3FKA A;  1CQS A;  5AEW B;  2HMJ B;  2K54 A;  3G0K A;  2PZV A;  4HM5 B;  4HM2 B;  4R1K A;  2YFL B;  4XBT A;  1JB2 A;  3CNX A;  2GEY A;  2IMJ A;  1JN5 B;  1UUV B;  3T8N A;  5DRV A;  5CLK A;  4WYK A;  4HZB B;  4HKV B;  2CHC A;  2GBX B;  3H51 A;  1NWW A;  1O7G B;  2YFI B;  1Q42 A;  1QJG A;  1DMQ A;  1ULI B;  1Q40 B;  1GY5 A;  5IEP A;  5HGR A;  3B4O A;  3JUP A;  3KKG A;  4PEJ A;  3MG1 A;  2HMO B;  5STD A;  5IG5 A;  5CXO A;  3S5C A;  3UNL A;  3KZT A;  5CF1 A;  3OV4 A;  1OHP A;  1W02 A;  4L8P A;  3WMD A;  2B24 B;  2XSO B;  4H3U A;  3SED A;  1ASK A;  3T8U A;  4N3V A;  3FGY A;  4U13 A;  3RGA A;  3F7X A;  3MG2 A;  3KSP A;  3EF8 A;  5G2G A;  3ECF A;  1ISK A;  2XRX B;  2B1X B;  1STD A;  5TGN A;  4WYK B;  3NM2 A;  1BUQ A;  3A76 A;  3I0Y A;  1JB5 A;  1NDO B;  1Q40 A;  3VSY A;  2R4I A;  4J9A A;  3GZB A;  1NU3 A;  2QIY A;  3LYG A;  4HZ9 B;  2YFJ B;  3UJM A;  3GZY B;  4OUQ A;  1O7M B;  4KVH A;  2W2C A;  3DZL A;  4R9L A;  2HMM B;  3D9R A;  5IG3 A;  4GB5 A;  1W01 A;  4LGQ A;  3NBR A;  1UUW B;  3K7C A;  2CKF B;  3SOA A;  4I4K A;  3MSO A;  5AII A;  1JKG B;  1DMM A;  4FCM A;  3JUN A;  3DM8 A;  4HM0 B;  1A2K A;  3FLJ A;  3ER7 A;  5KP1 A;  1EA2 A;  3HX8 A;  3G16 A;  3MYT A;  1E97 A;  1C7H A;  1IDP A;  1O7W B;  1TUH A;  2A15 A;  2GXF A;  3DUK A;  5DRE A;  4X2O A;  2BMQ B;  2HML B;  1O7N B;  3OWS A;  3GRD A;  3NHX A;  2RGQ A;  3FH1 A;  1DMN A;  5CK6 A;  3F8X A;  3OWU A;  4HM1 B;  3OX9 A;  4Q53 A;  1E3R A;  1U5O A;  1GYB A;  1Z1S A;  3B7C A;  2BNG A;  4MJD A;  3FZW A;  5CF2 A;  3M8C A;  1GY7 A;  2BMR B;  1E3V A;  1JKG A;  3EHC A;  3B4P A;  3GZX B;  5FW5 A;  3JUM A;  4XM4 A;  2F99 A;  5IEO A;  5IG4 A;  6STD A;  5AI1 A;  3DXO A;  5BXQ A;  2RFR A;  3NUV A;  4XDV A;  3EC9 A;  2F98 A;  3F9S A;  3FF2 A;  3OWY A;  3RGR A;  1S5A A;  4HM6 B;  1SJW A;  4XBX A;  3NXJ A;  4CDL A;  3NV0 A;  4LEH A;  5D83 A;  5KP4 A;  1ZX2 A;  4XB5 A;  3EN1 B;  3OXA A;  5IG0 A;  5JPP A;  1GY6 A;  2GEX A;  4R9K A;  3EQQ B;  4L8O A;  3JUO A;  1OHO A;  3CNM A;  4RZM A;  2JQ5 A;  5EVH A;  3CPO A;  4ORL A;  4HM3 B;  1K41 A;  3JUQ A;  5BVB A;  4J8T A;  3F14 A;  3BLZ A;  1OCV A;  3STD A;  3K0Z A;  3MG3 A;  4L7K A;  3BB9 A;  3ROB A;  1OHS A;  1AR0 A;  4K1U A;  4FCJ A;  3VGN A;  1OGZ A;  5IEN A;  4WWU C;  5AIH A;  2QGU A;  2UX0 A;  2STD A;  5KP3 A;  1OUN A;  3DMC A;  2INX A;  4X2H A;  3Q90 A;  3NV0 B;  4OVM A;  3E99 A;  1OF5 B;  4HJL B;  3EBT A;  3LZA A;  2RCD A;  1VZZ A;  3EJV A;  5AIG A;  4STD A;  1EG9 B;  1O7H B;  4LMI A;  3G8Z A;  2BMO B;  5IER A;  4WP5 A;  3HK4 A;  3IPT A; 
#chains in the Genus database with same CATH topology
 1TFK A;  2Z7A A;  3LML A;  1UUG B;  1N5P A;  3PCR A;  5AEU B;  1TFO A;  4HAA A;  3F8H A;  2F86 B;  3B8L A;  3FSD A;  3PYJ A;  2CWT A;  3FG4 A;  3KN4 A;  1W6Y A;  7RNT A;  4IIA A;  2Z77 A;  1AV4 A;  2L1S A;  1RCK A;  3HOH A;  2PNC A;  3LT9 A;  3NX0 A;  5JPU A;  4EBG A;  1UCJ A;  4HVN A;  3F7S A;  2BU4 A;  3CCR 3;  1YVB I;  1ULJ B;  3CU3 A;  4FCZ A;  1LNH A;  1GD3 A;  1GOU A;  1AVL A;  5A0O B;  7STD A;  1AQZ A;  3F40 A;  1RGL A;  2OQE A;  4AKZ A;  4O3V A;  4BTY A;  2K0M A;  4TX4 A;  3AHW A;  1K28 A;  3BNB A;  4KFD A;  2HMN B;  4MMY B;  1QMA A;  1M9G A;  2IYJ A;  2Y74 A;  4K1V A;  1OPY A;  4H61 A;  5AYS C;  2XGN A;  3CME 3;  5EEO A;  3EX9 A;  3DGO A;  3KE7 A;  4HM8 B;  4XDW A;  1RCL A;  1M90 4;  1MGR A;  1PFP A;  1GS3 A;  1JN5 A;  3LT8 A;  2I9W A;  2KXG A;  3MKI A;  4RNT A;  3ZG0 A;  2Z76 A;  1C54 A;  3Q3F A;  1EUI C;  2OTJ 3;  1UCI A;  1G96 A;  1HKX A;  1B2M A;  3MHE A;  1RMS A;  3AGN A;  5IF6 A;  1A2P A;  3GWR A;  1VQL 3;  3Q2P A;  2GBW B;  1OF5 A;  1BRK A;  3AMO B;  1PY3 A;  1K8A 4;  1RDS A;  1VQ5 3;  1I2F A;  5RNT A;  3HZP A;  2D42 A;  1JBT A;  3FF0 A;  1TP6 A;  1VQ4 3;  2AAE A;  5AIF A;  1OH0 A;  1BNF A;  5D82 A;  4HM4 B;  1LQG C;  1OGX A;  3CXC 2;  4XBY A;  3EBY A;  3I56 3;  8CHO A;  2KAA A;  3PZW A;  3CCL 3;  1MNL A;  1CYU A;  4KT3 B;  4CCV A;  2HMK B;  2WOH A;  4HM7 B;  2H0I A;  1BSA A;  3SXX A;  1W2Z A;  2IUJ A;  1JB4 A;  3URP A;  1UCL A;  1D6Z A;  1RLS A;  1IQX A;  4EXR A;  3BNE A;  3S67 A;  1LNI A;  4NPB A;  3SOY A;  5LC6 A;  4EV2 A;  1VQ7 3;  1D6Y A;  5D81 A;  1A2V A;  3U1W A;  2UUG C;  1KD1 4;  4LZI A;  2E2V A;  2ZL8 A;  1T5Y A;  5IW9 A;  3H3H A;  2OWP A;  3GZR A;  5BIR A;  1VQ9 3;  2XR8 B;  1G0T A;  1W00 A;  2XSH B;  5G1K A;  1MOL A;  1WQL B;  3BND A;  3EN8 A;  3FCS B;  4O8S A;  1ZO2 A;  1I0V A;  1O7P B;  4JRF A;  4N6M A;  3FKA A;  4N6O B;  1CQS A;  4J5G A;  5AEW B;  2HMJ B;  2K54 A;  3G0K A;  1KSI A;  2PZV A;  4HM5 B;  2ZA4 A;  2ZDJ A;  1Q86 4;  4HM2 B;  4R1K A;  1B2X A;  2H0G A;  2YFL B;  2BT3 A;  1WMP A;  4XBT A;  1JB2 A;  1CH0 A;  1KQS 2;  3HII A;  3CNX A;  1L5G B;  1QVG 2;  1AVK A;  2GEY A;  1W4N A;  2CWV A;  1EQK A;  1RGG A;  1T3B A;  1LQM B;  2IMJ A;  1VQK 3;  1JN5 B;  3KSE D;  3PCS A;  3BIR A;  3CCQ 3;  3IJE B;  1UUV B;  2P0X A;  3AHS A;  1J2B A;  1U8C B;  3T8N A;  5DRV A;  3CC2 3;  5CLK A;  8RNT A;  4WYK A;  1KC8 4;  2QEX 3;  3L0R A;  1DYU A;  4HZB B;  1EEJ A;  4K90 B;  1YVS A;  4HKV B;  2CHC A;  2GBX B;  3H51 A;  1RGK A;  1B21 A;  2UGI A;  1NWW A;  3N54 B;  1Q7Y 4;  1O7G B;  1BNR A;  1WTH A;  2P05 A;  1QVF 2;  1QAK A;  2C10 A;  2YFI B;  1PYL A;  2OTL 3;  1Q42 A;  1QJG A;  1NO3 A;  2Z6B A;  3ALA A;  3PGB A;  4RNZ A;  1BOX A;  1IVV A;  1DMQ A;  1ULI B;  4RNY A;  5M1A A;  1GOV A;  1YNV X;  3K5T A;  1Q40 B;  3TDG A;  1S72 3;  1GY5 A;  5ELU A;  3VF1 A;  3J7Y d;  1YJ9 3;  1VQ8 3;  3WDG B;  1DVD A;  5IEP A;  3ZG5 A;  1UGH I;  5GSP A;  4OK0 A;  5HGR A;  2GU1 A;  3B4O A;  3DH2 A;  4CJN A;  3JUP A;  3KKG A;  3CCE 3;  4PEJ A;  1HU9 A;  3MG1 A;  4N6T A;  5FGO A;  2HMO B;  5STD A;  3WR2 A;  5CXO A;  3S5C A;  3UNL A;  5IG5 A;  3SYU A;  3NBJ A;  3Q1C A;  1RRH A;  3KZT A;  5CF1 A;  1BRN L;  3MWZ A;  3CC4 3;  1HYF A;  3LTC A;  4LYL B;  3OV4 A;  1SAR A;  1IU7 A;  1OHP A;  1R4Y A;  3DY5 A;  1W02 A;  3KCH A;  3X42 A;  1I8V A;  4L8P A;  3WMD A;  1I2E A;  2B24 B;  2XSO B;  4H3U A;  3SED A;  1IVX A;  1ASK A;  1BAN A;  2FNQ A;  1NJI 4;  3T8U A;  2OOV A;  4N3V A;  3FGY A;  1UCK A;  4QWT A;  7GSP A;  2ML6 A;  4U13 A;  3RGA A;  3F7X A;  1CYV A;  1VQQ A;  4AKY A;  1Q82 4;  1YHQ 3;  1K9M 4;  3MG2 A;  3KSP A;  1RTU A;  3EF8 A;  1YGE A;  3X3Y A;  4WFO A;  4FMB A;  1YJN 3;  2LYX A;  1BSB A;  1QAL A;  5G2G A;  1IK3 A;  3KFQ C;  1IQ8 A;  3CCJ 3;  2BO9 B;  1MWT A;  4EV5 A;  1IVW A;  1JBS A;  1YGW A;  3D5G A;  2CFG A;  1QAF A;  1JZO A;  1A90 A;  2CFL A;  3X41 A;  3ECF A;  3U97 A;  1ISK A;  1G02 A;  1GD4 A;  1FGO A;  2XRX B;  2IY2 A;  3D5I A;  2B1X B;  1TTO A;  1STD A;  5TGN A;  3RNT A;  4CPK A;  1X1Y A;  1ROV A;  4GHO A;  4WYK B;  3UL5 A;  4BL2 A;  1GOY A;  1WMO A;  3NM2 A;  1BUQ A;  3EB8 A;  1X1W A;  3A76 A;  3I0Y A;  1UI7 A;  2XH9 A;  2Y73 A;  4NRE A;  1IYY A;  1JB5 A;  1NDO B;  1Q40 A;  3DGM A;  3VSY A;  1K73 4;  1TU5 A;  2R4I A;  4J9A A;  3GZB A;  1N9J A;  3V98 A;  1YJW 3;  1NU3 A;  1RGA A;  3G6E 3;  2QIY A;  3LYG A;  1B20 A;  2D1W A;  2WGO A;  2YFJ B;  4HZ9 B;  4IT7 A;  1IV9 A;  1W6G A;  3UJM A;  3LXU X;  4JF8 A;  5AYR B;  4O2H A;  1Q9E A;  3GZY B;  3SLU A;  1M1K 4;  3WHO A;  1RSN A;  4OUQ A;  1O7M B;  1STF I;  2CG0 A;  3X40 A;  3CCU 3;  2W9Q A;  4KVH A;  2XGL A;  4HBR A;  2W2C A;  1F8N A;  3PXM A;  1SII A;  5M19 A;  2Q07 A;  3CCV 3;  1MGW A;  4N6V 0;  1UGI A;  3DZL A;  4R9L A;  1TJD A;  2W03 A;  1RN1 A;  3BNC A;  2FXT A;  2HMM B;  3D9R A;  3PS8 A;  4FMC A;  5EQL A;  1BNE A;  5IG3 A;  1BNS A;  4GB5 A;  4GL6 A;  1PU4 A;  1W01 A;  4LGQ A;  2SBL A;  4J5K A;  3KII A;  1T2H A;  3DGY A;  3T0U A;  1M1X B;  1SQW A;  3NBR A;  4R80 A;  1JZD A;  2CIU A;  5G1L A;  4ZM8 A;  1MWS A;  1UUW B;  2OQE C;  1BRJ A;  3K7C A;  2CKF B;  2KF4 A;  2IA7 A;  1UI8 A;  1US1 A;  3SOA A;  2KF5 A;  4I4K A;  1YIJ 3;  3CCS 3;  1W7C A;  3MSO A;  5AII A;  1JKG B;  1BU4 A;  1IT8 A;  1DMM A;  3K9M C;  3LH4 A;  4FCM A;  4FMD A;  3WOE B;  3JUN A;  3SVA A;  1FGM A;  1LVN A;  3DM8 A;  4FMA A;  4HM0 B;  4WHA A;  6RNT A;  1A2K A;  1BNI A;  1Q7H A;  1T2I A;  5LC7 A;  4KFE A;  3G71 3;  1FW7 A;  2P09 A;  3S28 A;  1N9E A;  3FLJ A;  4MEI A;  3ER7 A;  5KP1 A;  1EA2 A;  2RNT A;  3HX8 A;  1BAO A;  2CW9 A;  1JNQ A;  1RGC A;  3G16 A;  3MYT A;  1E97 A;  1FYS A;  1C7H A;  1YIT 3;  1IDP A;  1LOX A;  4MMX B;  4AEQ A;  1O7W B;  1TUH A;  2A15 A;  4N6N B;  2GXF A;  2XFS A;  4EW5 A;  3DUK A;  5DRE A;  4X2O A;  1IV7 A;  1RN7 A;  2BMQ B;  1SPU A;  3LTA A;  2HML B;  3JVC A;  1O7N B;  3LTD A;  3OWS A;  3GRD A;  1TIJ A;  3N8B A;  4BTX A;  2F4Y A;  3CCM 3;  1CEW I;  1RGE A;  3NHX A;  1FA3 A;  1UW1 A;  2RGQ A;  1W2B 2;  1I0X A;  1BSE A;  1MWU A;  3FH1 A;  1DMN A;  1R4C A;  5CK6 A;  3F8X A;  3OWU A;  2FGT A;  5BU4 A;  1IVU A;  1NNV A;  4LSO A;  4HM1 B;  2O3O A;  3OX9 A;  4Q53 A;  3N9H A;  3CPW 2;  1E3R A;  1U5O A;  4BIR A;  1GMP A;  1GYB A;  1Z1S A;  1WMN A;  2WO0 A;  1FUT A;  3B7C A;  2IUK A;  2K3D A;  2JDI H;  2CG1 A;  2BNG A;  5ELJ A;  2F5M A;  1NB5 I;  1NB3 I;  4MJD A;  4FR9 A;  1TRP A;  3FZW A;  5JBS A;  2M7O A;  5CF2 A;  2XEP A;  1LOV A;  3WA3 A;  3M8C A;  1LOW A;  1BSD A;  2W56 A;  1GY7 A;  1W5Z A;  2BMR B;  1BNG A;  1BRG A;  1E3V A;  1FGT A;  1JKG A;  2E2U A;  3ZFZ A;  1A67 A;  3EHC A;  3B4P A;  3GZX B;  4EYC A;  5FW5 A;  1RKY A;  3CC7 3;  3JUM A;  4XM4 A;  1Y4K A;  2F99 A;  2AAD A;  5IEO A;  1DVC A;  1I3I A;  3MPH A;  4BU4 A;  6STD A;  5IG4 A;  2C4B A;  1GMR A;  1JV2 B;  5AI1 A;  3DXO A;  5BXQ A;  2RFR A;  3NUV A;  1BUJ A;  4XDV A;  3EC9 A;  1FGQ A;  2F98 A;  3LOY A;  1MWR A;  3F9S A;  1VQP 3;  1BRI A;  3I55 3;  3FF2 A;  3OWY A;  1BNJ A;  1I2G A;  1RHL A;  3RGR A;  1I3F A;  1B3S A;  1S5A A;  5I97 A;  4DKI A;  2H0H A;  1RRL A;  4HM6 B;  1IT7 A;  1W6C A;  3K63 A;  1YI2 3;  1SJW A;  4XBX A;  3NXJ A;  1BSC A;  4CDL A;  2ML5 A;  4HYZ A;  3NV0 A;  3DGL A;  4LEH A;  2CK3 H;  2BHM A;  5D83 A;  5KP4 A;  1D6U A;  1ZX2 A;  2P0M A;  3D3L A;  3HI7 A;  3NQZ A;  4XB5 A;  1AY7 A;  2F56 A;  2WGQ A;  3D79 A;  1N8R 4;  1JBR A;  3EN1 B;  1Q81 4;  1BIR A;  3A5E A;  2W04 A;  1B2Z A;  3WOD G;  1B2U A;  3OXA A;  2GSP A;  3RDE A;  5HOH A;  1BVI A;  1DET A;  5IG0 A;  3NM7 A;  3DGN A;  3BU4 A;  5JPP A;  1FZU A;  1JRQ A;  2V1L A;  1GY6 A;  1I70 A;  2XFT A;  2SAR A;  1VQO 3;  1KWI A;  4N6L A;  2CX0 A;  4MMZ B;  2GEX A;  1JJ2 2;  1X1U A;  1LRA A;  2ZHX B;  4R9K A;  1HZ1 A;  3EQQ B;  4L8O A;  4KFF A;  3JUO A;  1OHO A;  3CNM A;  3X3Z A;  3D4A A;  4RZM A;  2CFK A;  2CC3 A;  2JQ5 A;  1GMQ A;  5EVH A;  3CPO A;  1N8Q A;  4ORL A;  4HM3 B;  3LTB A;  1K41 A;  1GSP A;  3JUQ A;  4O02 B;  9RNT A;  2OOV C;  5BVB A;  4J8T A;  3QK9 A;  3WA2 X;  3S27 A;  1VQM 3;  2W56 B;  3O8Y A;  4NHF A;  2RSX A;  3GSP A;  5M18 A;  3F14 A;  3BLZ A;  3WOF B;  3IMA B;  2W0Q A;  1OCV A;  2GU3 A;  1RJO A;  3HIG A;  3STD A;  2RBI A;  4K61 A;  1BGS A;  2CFW A;  3AGO A;  2CWU A;  2KCD A;  2MC8 A;  1EKM A;  1ZS7 A;  2KF6 A;  3SX1 A;  2W6J H;  3CD6 3;  3K0Z A;  3MG3 A;  2QA4 3;  1LXE A;  3FG1 A;  1OAC A;  3BB9 A;  3NQY A;  4L7K A;  1OHS A;  3ROB A;  1AR0 A;  4K1U A;  4R4K A;  4KZ1 A;  1V74 A;  4ILF A;  4FCJ A;  3VGN A;  1OGZ A;  4IPB A;  2HOH A;  3X3X A;  4WWU C;  4EC6 A;  5IEN A;  3OW2 2;  1B27 A;  5AIH A;  3QRD A;  3G4S 3;  2C11 A;  2QGU A;  2UX0 A;  2CH9 A;  4I5Q A;  2STD A;  1LOY A;  1RN4 A;  4HOH A;  5KP3 A;  1OUN A;  1WNH A;  3AMO A;  1DE3 A;  3DMC A;  3UL6 A;  1RNB A;  4GSP A;  2INX A;  4G1M B;  2J8X B;  2R41 A;  3Q90 A;  4X2H A;  3S29 A;  1ROA A;  3NV0 B;  4N6U A;  4OVM A;  2KRT A;  3E99 A;  3GAX A;  1VQN 3;  2MF7 A;  3FG3 A;  1V58 A;  2P38 A;  1ZGX A;  1OF5 B;  4HJL B;  2O9U X;  1SIH A;  2CX1 A;  3EBT A;  3UB1 A;  1FUW A;  1RGH A;  2L4V A;  2RCD A;  3LZA A;  1VZZ A;  1FGR A;  2F5W A;  1VQ6 3;  3CMA 3;  3EJV A;  3V99 A;  5AIG A;  1B2S A;  4STD A;  1TRQ A;  2KF3 A;  1EG9 B;  2WOF A;  4BTW A;  6GSP A;  1UDI I;  2CFD A;  1IQY A;  1O7H B;  2OCT A;  3NBB A;  4RBN A;  1BRS A;  3G8Z A;  2E2T A;  4LMI A;  2BMO B;  5IER A;  1RGF A;  4BL3 A;  3V92 A;  1RNT A;  1BRH A;  1FUS A;  2XF3 A;  2YX9 A;  1V57 A;  4WP5 A;  1X1X A;  2W9P A;  1N5H A;  3EE1 A;  3HK4 A;  2BIR A;  3IPT A;  2LQV A; 
#chains in the Genus database with same CATH homology
 1TFK A;  2Z7A A;  3LML A;  1N5P A;  3PCR A;  5AEU B;  1TFO A;  3F8H A;  2F86 B;  3B8L A;  3FSD A;  3PYJ A;  2CWT A;  3FG4 A;  3KN4 A;  1W6Y A;  4IIA A;  2Z77 A;  1AV4 A;  3LT9 A;  3NX0 A;  2PNC A;  5JPU A;  4EBG A;  4HVN A;  3CCR 3;  3F7S A;  1YVB I;  1ULJ B;  3CU3 A;  4FCZ A;  1LNH A;  1GD3 A;  1AVL A;  5A0O B;  7STD A;  2OQE A;  3F40 A;  4AKZ A;  4O3V A;  4BTY A;  2K0M A;  4TX4 A;  1K28 A;  3BNB A;  4KFD A;  2HMN B;  4MMY B;  1QMA A;  1M9G A;  2Y74 A;  4K1V A;  3CME 3;  1OPY A;  4H61 A;  5AYS C;  2XGN A;  5EEO A;  3EX9 A;  3DGO A;  3KE7 A;  4HM8 B;  4XDW A;  1M90 4;  1PFP A;  1GS3 A;  1JN5 A;  3LT8 A;  2I9W A;  2KXG A;  3MKI A;  2Z76 A;  2OTJ 3;  1G96 A;  1HKX A;  3MHE A;  5IF6 A;  3GWR A;  1VQL 3;  3Q2P A;  2GBW B;  1OF5 A;  3AMO B;  1K8A 4;  1VQ5 3;  3HZP A;  2D42 A;  3FF0 A;  1TP6 A;  1VQ4 3;  5AIF A;  1OH0 A;  5D82 A;  4HM4 B;  1OGX A;  3CXC 2;  4XBY A;  3EBY A;  3I56 3;  8CHO A;  3CCL 3;  3PZW A;  1MNL A;  1CYU A;  4CCV A;  2HMK B;  2WOH A;  4HM7 B;  3SXX A;  1W2Z A;  2IUJ A;  1JB4 A;  1D6Z A;  1IQX A;  4EXR A;  3BNE A;  3S67 A;  3SOY A;  5LC6 A;  4EV2 A;  1VQ7 3;  1D6Y A;  5D81 A;  1A2V A;  3U1W A;  1KD1 4;  4LZI A;  2E2V A;  2ZL8 A;  1T5Y A;  5IW9 A;  3H3H A;  2OWP A;  3GZR A;  1VQ9 3;  2XR8 B;  1W00 A;  2XSH B;  1MOL A;  1WQL B;  3BND A;  3EN8 A;  3FCS B;  4O8S A;  1ZO2 A;  1O7P B;  4JRF A;  4N6M A;  3FKA A;  4N6O B;  1CQS A;  5AEW B;  2HMJ B;  2K54 A;  3G0K A;  1KSI A;  2PZV A;  4HM5 B;  2ZDJ A;  1Q86 4;  4HM2 B;  4R1K A;  2YFL B;  2BT3 A;  1WMP A;  4XBT A;  1JB2 A;  1KQS 2;  3HII A;  3CNX A;  1L5G B;  1QVG 2;  1AVK A;  2GEY A;  1W4N A;  2CWV A;  1EQK A;  2IMJ A;  1VQK 3;  1JN5 B;  3KSE D;  3PCS A;  3CCQ 3;  3IJE B;  1UUV B;  2P0X A;  1J2B A;  1U8C B;  3T8N A;  5DRV A;  3CC2 3;  5CLK A;  1KC8 4;  4WYK A;  2QEX 3;  3L0R A;  1DYU A;  4HZB B;  4K90 B;  4HKV B;  2CHC A;  2GBX B;  3H51 A;  3N54 B;  1NWW A;  1Q7Y 4;  1O7G B;  1WTH A;  2P05 A;  1QVF 2;  1QAK A;  2C10 A;  2YFI B;  2OTL 3;  1Q42 A;  1QJG A;  1NO3 A;  2Z6B A;  3ALA A;  3PGB A;  4RNZ A;  1DMQ A;  1IVV A;  4RNY A;  1ULI B;  3K5T A;  1Q40 B;  3TDG A;  1S72 3;  1GY5 A;  5ELU A;  3VF1 A;  3J7Y d;  1YJ9 3;  1VQ8 3;  3WDG B;  1DVD A;  5IEP A;  4OK0 A;  5HGR A;  2GU1 A;  3B4O A;  3JUP A;  3KKG A;  3CCE 3;  4PEJ A;  1HU9 A;  3MG1 A;  4N6T A;  5FGO A;  2HMO B;  5STD A;  5IG5 A;  5CXO A;  3S5C A;  3UNL A;  3NBJ A;  3Q1C A;  1RRH A;  3KZT A;  5CF1 A;  3CC4 3;  3MWZ A;  3LTC A;  3OV4 A;  1IU7 A;  1OHP A;  3DY5 A;  3X42 A;  1W02 A;  4L8P A;  3WMD A;  2B24 B;  2XSO B;  4H3U A;  3SED A;  1IVX A;  1ASK A;  2FNQ A;  1NJI 4;  3T8U A;  2OOV A;  4N3V A;  3FGY A;  4QWT A;  2ML6 A;  4U13 A;  3RGA A;  3F7X A;  1CYV A;  4AKY A;  1Q82 4;  1YHQ 3;  1K9M 4;  3MG2 A;  3KSP A;  3EF8 A;  1YGE A;  3X3Y A;  4WFO A;  4FMB A;  1YJN 3;  2LYX A;  1QAL A;  5G2G A;  1IK3 A;  3KFQ C;  1IQ8 A;  3CCJ 3;  2BO9 B;  4EV5 A;  1IVW A;  2CFG A;  1QAF A;  1A90 A;  2CFL A;  3X41 A;  3ECF A;  3U97 A;  1ISK A;  1FGO A;  1GD4 A;  2XRX B;  2B1X B;  1STD A;  5TGN A;  1ROV A;  4WYK B;  3UL5 A;  3NM2 A;  1WMO A;  1BUQ A;  3EB8 A;  3A76 A;  3I0Y A;  1UI7 A;  2XH9 A;  2Y73 A;  4NRE A;  1JB5 A;  1NDO B;  1Q40 A;  3DGM A;  3VSY A;  1K73 4;  1TU5 A;  2R4I A;  4J9A A;  3GZB A;  1N9J A;  3V98 A;  1YJW 3;  1NU3 A;  3G6E 3;  2QIY A;  3LYG A;  2D1W A;  2WGO A;  2YFJ B;  4HZ9 B;  4IT7 A;  1IV9 A;  1W6G A;  3UJM A;  3LXU X;  4JF8 A;  5AYR B;  4O2H A;  3GZY B;  3SLU A;  1M1K 4;  4OUQ A;  1O7M B;  1STF I;  2CG0 A;  3X40 A;  3CCU 3;  2W9Q A;  4KVH A;  2XGL A;  4HBR A;  2W2C A;  1F8N A;  3PXM A;  1SII A;  2Q07 A;  3CCV 3;  4N6V 0;  3DZL A;  4R9L A;  2W03 A;  3BNC A;  2FXT A;  2HMM B;  3D9R A;  3PS8 A;  4FMC A;  5EQL A;  5IG3 A;  4GB5 A;  4GL6 A;  1PU4 A;  1W01 A;  4LGQ A;  2SBL A;  3KII A;  3T0U A;  1M1X B;  1SQW A;  3NBR A;  4R80 A;  2CIU A;  4ZM8 A;  1UUW B;  2OQE C;  3K7C A;  2CKF B;  2IA7 A;  1UI8 A;  1US1 A;  3SOA A;  1YIJ 3;  4I4K A;  3CCS 3;  1W7C A;  3MSO A;  5AII A;  1JKG B;  4FMD A;  1IT8 A;  1DMM A;  3K9M C;  3LH4 A;  4FCM A;  3WOE B;  3JUN A;  3SVA A;  1LVN A;  1FGM A;  3DM8 A;  4FMA A;  4HM0 B;  4WHA A;  1A2K A;  5LC7 A;  4KFE A;  3G71 3;  2P09 A;  3S28 A;  1N9E A;  3FLJ A;  4MEI A;  3ER7 A;  5KP1 A;  1EA2 A;  3HX8 A;  2CW9 A;  3G16 A;  1JNQ A;  3MYT A;  1E97 A;  1C7H A;  1YIT 3;  1IDP A;  1LOX A;  4MMX B;  4AEQ A;  1O7W B;  1TUH A;  2A15 A;  4N6N B;  2GXF A;  2XFS A;  3DUK A;  5DRE A;  4X2O A;  1IV7 A;  1RN7 A;  2BMQ B;  1SPU A;  3LTA A;  2HML B;  3JVC A;  1O7N B;  3LTD A;  3OWS A;  3GRD A;  1TIJ A;  3N8B A;  4BTX A;  3CCM 3;  1CEW I;  3NHX A;  1FA3 A;  1UW1 A;  2RGQ A;  1W2B 2;  3FH1 A;  1DMN A;  1R4C A;  5CK6 A;  3F8X A;  3OWU A;  2FGT A;  1IVU A;  4LSO A;  4HM1 B;  2O3O A;  3OX9 A;  4Q53 A;  3N9H A;  3CPW 2;  1E3R A;  1U5O A;  1GYB A;  1Z1S A;  1WMN A;  2WO0 A;  3B7C A;  2CG1 A;  2IUK A;  3CMA 3;  2JDI H;  2BNG A;  5ELJ A;  1NB5 I;  1NB3 I;  4MJD A;  4FR9 A;  3FZW A;  5JBS A;  2M7O A;  5CF2 A;  2XEP A;  3WA3 A;  3M8C A;  2W56 A;  1GY7 A;  1W5Z A;  2BMR B;  1FGT A;  2E2U A;  1E3V A;  1JKG A;  1A67 A;  3EHC A;  3B4P A;  3GZX B;  4EYC A;  5FW5 A;  1RKY A;  3CC7 3;  3JUM A;  4XM4 A;  1Y4K A;  2F99 A;  5IEO A;  1DVC A;  3MPH A;  5IG4 A;  6STD A;  1JV2 B;  5AI1 A;  3DXO A;  5BXQ A;  2RFR A;  3NUV A;  4XDV A;  3EC9 A;  1FGQ A;  2F98 A;  3LOY A;  3F9S A;  1VQP 3;  3I55 3;  3FF2 A;  3OWY A;  3RGR A;  1S5A A;  5I97 A;  1RRL A;  4HM6 B;  1IT7 A;  1W6C A;  3K63 A;  1YI2 3;  1SJW A;  4XBX A;  3NXJ A;  4CDL A;  2ML5 A;  4HYZ A;  3NV0 A;  3DGL A;  4LEH A;  2CK3 H;  2BHM A;  5D83 A;  5KP4 A;  1D6U A;  1ZX2 A;  2P0M A;  3D3L A;  3HI7 A;  3NQZ A;  4XB5 A;  2WGQ A;  1N8R 4;  3EN1 B;  1Q81 4;  2W04 A;  3WOD G;  3OXA A;  3RDE A;  5IG0 A;  3NM7 A;  3DGN A;  5JPP A;  2V1L A;  1JRQ A;  1GY6 A;  2XFT A;  1VQO 3;  1KWI A;  4N6L A;  4MMZ B;  2GEX A;  1JJ2 2;  4R9K A;  3EQQ B;  4L8O A;  4KFF A;  3JUO A;  1OHO A;  3CNM A;  3X3Z A;  4RZM A;  2CFK A;  2CC3 A;  2JQ5 A;  5EVH A;  3CPO A;  1N8Q A;  4ORL A;  4HM3 B;  3LTB A;  1K41 A;  3JUQ A;  4O02 B;  2OOV C;  5BVB A;  4J8T A;  3QK9 A;  3WA2 X;  3S27 A;  1VQM 3;  2W56 B;  3O8Y A;  4NHF A;  2RSX A;  3F14 A;  3BLZ A;  3WOF B;  3IMA B;  2W0Q A;  1OCV A;  2GU3 A;  1RJO A;  3HIG A;  3STD A;  4K61 A;  2CFW A;  2CWU A;  2KCD A;  2MC8 A;  1EKM A;  3SX1 A;  3CD6 3;  2W6J H;  3K0Z A;  3MG3 A;  2QA4 3;  1LXE A;  3FG1 A;  1OAC A;  3BB9 A;  3NQY A;  4L7K A;  1OHS A;  3ROB A;  1AR0 A;  4K1U A;  4R4K A;  4KZ1 A;  1V74 A;  4FCJ A;  3VGN A;  1OGZ A;  4IPB A;  4EC6 A;  3X3X A;  4WWU C;  5IEN A;  3OW2 2;  5AIH A;  3QRD A;  3G4S 3;  2C11 A;  2QGU A;  2UX0 A;  2CH9 A;  2STD A;  5KP3 A;  1OUN A;  1WNH A;  3AMO A;  3DMC A;  3UL6 A;  2INX A;  4G1M B;  4X2H A;  3Q90 A;  3S29 A;  1ROA A;  3NV0 B;  4N6U A;  4OVM A;  2KRT A;  3E99 A;  3GAX A;  1VQN 3;  2MF7 A;  3FG3 A;  2P38 A;  1OF5 B;  4HJL B;  2O9U X;  1SIH A;  3EBT A;  3UB1 A;  1FUW A;  2L4V A;  3LZA A;  2RCD A;  1VZZ A;  1FGR A;  1VQ6 3;  3EJV A;  3V99 A;  5AIG A;  4STD A;  1EG9 B;  2WOF A;  4BTW A;  2CFD A;  1IQY A;  1O7H B;  2OCT A;  3NBB A;  4RBN A;  4LMI A;  3G8Z A;  2E2T A;  2BMO B;  5IER A;  3V92 A;  2XF3 A;  2YX9 A;  4WP5 A;  2W9P A;  1N5H A;  3EE1 A;  3HK4 A;  3IPT A;  2LQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...