2R4IA

Crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
GMNQRDVILDCEKKLLTAIQNNDVESLEVLLHDDLLFIIPSGETVTKETDIAAYSSGKIALRAVVPSDYIIRIIHDTVVVSVNIEIKGEYMEHTLDNTFRYLRVWKLFDGNWKVIAGSCTAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF2-like protein of unknown function (YP_678039.1) from Cytophaga hutchinsonii ATCC 33406 at 1.60 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 33
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2r4iA00
4Q53A 1C7HA 3A76A 3F9SA 1OH0A 1WQLB 3MKIA 4WP5A 5AEUB 4XBYA 1EA2A 3MG1A 1ASKA 1E97A 3DUKA 5AI1A 3KE7A 2QIYA 1OHOA 3GRDA 4OVMA 4I4KA 3NV0A 1OCVA 3JUQA 4H3UA 3CU3A 3JUMA 1E3RA 3F7SA 3MYTA 4FCMA 1DMMA 1JKGA 1JKGB 1NWWA 3FF2A 3RGRA 1JN5A 1ISKA 3FLJA 2HMOB 2R4IA 4HM2B 4L7KA 3HK4A 4N3VA 3ROBA 5KP1A 1EG9B 2RGQA 2XSHB 3EN8A 3BLZA 2RCDA 1HKXA 4HM6B 1IDPA 3D9RA 3FH1A 5IG3A 1O7NB 8CHOA 1NDOB 2GXFA 1BUQA 5HGRA 4J8TA 5D81A 3OWUA 1O7WB 4HVNA 1O7MB 2I9WA 2YFIB 3F7XA 4XBXA 5JPPA 1AR0A 4LEHA 3VSYA 4MJDA 5IEOA 5IEPA 3HZPA 3EJVA 4U13A 2IMJA 3CNMA 4WYKA 4K1VA 5KP3A 2YFJB 1JB2A 3ER7A 1U5OA 5CF1A 5KP4A 3EC9A 2Z7AA 2BMOB 1NU3A 2HMNB 1GY6A 3F8XA 1O7GB 2HMMB 2QGUA 1TUHA 3EX9A 3HX8A 3JUOA 3UJMA 1CQSA 2HMKB 3MHEA 1OGXA 3S5CA 4KVHA 4J9AA 3LYGA 3VGNA 5IG5A 5DREA 3SOYA 2GBXB 3EBYA 1SJWA 3EHCA 3EN1B 7STDA 3OWSA 3NUVA 2CHCA 1JB4A 2OWPA 3SEDA 3NBRA 3K0ZA 5AIIA 3E99A 2XSOB 1ZO2A 5G2GA 4WWUC 1VZZA 3FGYA 3NXJA 1UUVB 5CK6A 3WMDA 1TP6A 5EVHA 3DMCA 5AIFA 1E3VA 3STDA 2JQ5A 2CKFB 3FKAA 2STDA 5BVBA 2F98A 1ZX2A 4R9LA 3G16A 4X2OA 3RGAA 3F8HA 2BNGA 2GBWB 3MG2A 1DMQA 4HM5B 1K41A 3GZXB 1Q40B 3LZAA 1A2KA 2PZVA 3BB9A 4RZMA 5IF6A 1GS3A 4HM8B 4STDA 2Z76A 3G8ZA 3Q90A 3NV0B 4XDVA 3EF8A 2XR8B 3SOAA 5IENA 2W2CA 5DRVA 3EBTA 3I0YA 4L8OA 4LMIA 4XB5A 1W02A 1Z1SA 3DM8A 3B4PA 4L8PA 3H51A 1QMAA 1Q42A 3KKGA 3B4OA 1QJGA 4XDWA 3OX9A 1DMNA 2INXA 4HJLB 5CLKA 5AEWB 2XRXB 6STDA 4LGQA 3G0KA 1STDA 2B24B 2K54A 3B8LA 4WYKB 1ULJB 1W00A 4XM4A 4OUQA 5JPUA 3DZLA 3NM2A 1O7PB 3F14A 3KSPA 3MG3A 5IG0A 2BMRB 1Q40A 1OF5B 3B7CA 4PEJA 2F86B 3T8NA 1OHPA 4HM4B 2RFRA 3MSOA 2BMQB 4R1KA 3KZTA 3IPTA 2HMLB 2UX0A 3M8CA 3CNXA 5AIHA 2A15A 1GY7A 2HMJB 3ECFA 3OV4A 1OGZA 4GB5A 4HM1B 4ORLA 4HM0B 2B1XB 3GZBA 4HZBB 1O7HB 1UUWB 3NHXA 4HM7B 5AIGA 2Z77A 4XBTA 5STDA 3UNLA 3FF0A 1GY5A 5D82A 4CDLA 5BXQA 3K7CA 1OPYA 2F99A 3FZWA 3T8UA 3OWYA 4IIAA 4X2HA 4HKVB 4HM3B 5TGNA 4R9KA 2YFLB 1GYBA 5IG4A 3GWRA 4HZ9B 3OXAA 4FCJA 3DXOA 3JUNA 1OF5A 3F40A 5FW5A 5CF2A 3JUPA 1ULIB 1JN5B 3CPOA 2GEXA 3H3HA 3FSDA 3GZRA 1OHSA 1S5AA 1OUNA 3EQQB 5IERA 4K1UA 5CXOA 1W6YA 5D83A 3GZYB 2GEYA 1JB5A 1W01A
chains in the Genus database with same CATH superfamily
5ELJA 1B3SA 3MKIA 4WP5A 3LXUX 3BU4A 1BIRA 1KC84 2WOFA 1M904 3D3LA 2P38A 1OHOA 3K63A 1B27A 4H3UA 1HYFA 1E3RA 3MYTA 3I553 3KFQC 1X1YA 4ZM8A 1JN5A 1YIT3 1T5YA 1UCJA 3FLJA 4L7KA 1VQ43 4N6UA 1FGOA 2BHMA 3BLZA 1HKXA 1LVNA 4HM6B 1IDPA 1LNIA 4DKIA 1IU7A 1UGIA 1L5GB 2GXFA 4J8TA 1I0XA 5D81A 4LSOA 3OWUA 5IW9A 3BNBA 2YFIB 5JPPA 1BSDA 4XBXA 3N9HA 1M9GA 2OQEC 5IEPA 1JZDA 1I2GA 1A2VA 1Q9EA 2CIUA 1CYVA 3SLUA 1VQM3 2CX1A 2CFLA 5G1KA 3FG4A 1JJ22 3CCR3 1TIJA 1UI8A 2FXTA 1OGXA 4LYLB 7STDA 3LH4A 3NUVA 3OWSA 3SEDA 1B20A 1V74A 3AHSA 3K0ZA 2P09A 2XSOB 1ZO2A 2RBIA 5G2GA 2F5WA 3DGNA 1YJ93 1VZZA 1EUIC 2ZL8A 1K28A 1TP6A 1AVLA 3KSED 5BVBA 1NNVA 2F98A 1SIHA 1GOUA 3G16A 1B2SA 2C10A 1LNHA 1VQN3 1FUWA 1JNQA 1RRHA 4NPBA 3LMLA 1BRJA 3LZAA 1M1XB 2SBLA 3G713 3X3YA 4RZMA 2E2UA 5IF6A 4HM8B 3CCM3 4XDVA 3WHOA 3NV0B 3WOEB 5DRVA 1HZ1A 4XB5A 1NB3I 4LMIA 1I70A 4EBGA 1Z1SA 2GU3A 1RGCA 1QMAA 1Q42A 1V57A 3D79A 3B4OA 1OACA 2IUKA 3CC73 5CLKA 1Q824 1NO3A 2XRXB 1IVUA 4LGQA 5IG0A 2K54A 4ILFA 3B8LA 3G6E3 1W00A 1X1WA 5AYSC 3NM2A 1BNEA 1MGRA 2W56B 2P0XA 1BGSA 1RKYA 2F86B 1M1K4 2CH9A 4HM4B 2GSPA 2H0HA 4FMAA 3MSOA 3CC23 1W2ZA 2HMLB 2KF6A 5HOHA 1I2EA 2V1LA 3CNXA 1VQO3 4BL3A 1WMPA 3LTAA 1C54A 1TJDA 2CFDA 4EXRA 2PNCA 3WODG 1VQ53 4HM7B 5BXQA 1AQZA 1AY7A 3K7CA 3FCSB 2W6JH 1LOXA 1BRGA 1RGFA 3OWYA 2Y74A 4IIAA 5TGNA 3CXC2 4KFDA 2YFLB 1PU4A 1UW1A 1RGKA 1T2IA 1BSCA 3Q2PA 1GOVA 1RSNA 2UUGC 3PYJA 1MNLA 2H0GA 3GZRA 5CXOA 2ML6A 1YVBI 1JB5A 1SQWA 4EV2A 5ELUA 4RNTA 2MC8A 1WMNA 1C7HA 2OCTA 3A76A 1OH0A 3F9SA 3A5EA 1VQK3 1LOVA 3DUKA 3HI7A 3U97A 1TTOA 1N8R4 4I4KA 3JUQA 3JUMA 2ZDJA 1JV2B 1FA3A 1BNFA 3PS8A 1DMMA 2L4VA 3FF2A 1ISKA 1AVKA 2R4IA 5KP1A 1KSIA 2BO9B 2XSHB 3V99A 2KRTA 2XGLA 1YGWA 3FH1A 3LTCA 3PXMA 1IVWA 1FGRA 1NDOB 3SXXA 1KD14 1W6CA 1O7WB 2I9WA 4BL2A 1VQ93 1YJN3 3VSYA 5IEOA 1LRAA 3DGOA 3HZPA 1FW7A 4RNYA 4K1VA 5KP3A 2YFJB 1JB2A 3ER7A 1TRQA 3ZG0A 1WTHA 2Z7AA 1FGQA 6RNTA 1NU3A 3EX9A 2KAAA 2HMKB 1NB5I 1CH0A 5IG5A 5DREA 1W5ZA 3EN1B 3PZWA 3CCE3 4FMBA 2IUJA 6GSPA 2UGIA 1BSEA 1JBTA 4WWUC 1FGMA 7GSPA 1UUVB 3QRDA 5EVHA 5M1AA 3ZFZA 1E3VA 1RGEA 2CFGA 2JQ5A 3FKAA 2STDA 1NJI4 3EE1A 1TRPA 2MF7A 1STFI 4TX4A 4HM5B 5BU4A 3CCQ3 3GSPA 1RTUA 1A2KA 1BRSA 4EV5A 1B21A 5I97A 1RN1A 3Q90A 1YHQ3 3EF8A 2SARA 2XGNA 5IENA 1RHLA 1A90A 1SIIA 3I0YA 4KZ1A 2BIRA 1YNVX 3DM8A 3B4PA 3KN4A 4L8PA 1JBRA 1U8CB 1Q7Y4 4XDWA 1KWIA 3S29A 1SPUA 1RGGA 4GSPA 3AMOB 1T3BA 2OTJ3 1V58A 4XM4A 4HAAA 4GHOA 1PFPA 4WYKB 1RDSA 5EQLA 5GSPA 3WR2A 4AKYA 1QAFA 7RNTA 5JPUA 1K8A4 1JBSA 3F14A 1ROVA 2BMRB 1Q40A 1OF5B 3CMA3 2WOHA 3I563 3T8NA 1IVVA 1OHPA 2OOVA 1N5HA 1YJW3 1A2PA 1JRQA 2L1SA 3IPTA 4R1KA 1W2B2 1VQQA 5AIHA 1I2FA 1GY7A 4FMCA 3OV4A 4ORLA 1Q814 4HZBB 3GAXA 3UNLA 2P05A 4XBTA 3BIRA 3FF0A 4J5KA 2Y73A 2F99A 3T8UA 3Q3FA 1I8VA 4HKVB 4HM3B 3NQYA 4J5GA 3GWRA 1VQL3 1W4NA 1ZGXA 3JUNA 4FCJA 3F40A 1BU4A 1JN5B 2LQVA 2GEXA 1FUTA 2FNQA 3FSDA 5LC7A 1S5AA 1BVIA 4AKZA 4JF8A 5D83A 1K734 3DGYA 3GZYB 2GEYA 3SX1A 2QA43 1KQS2 1YVSA 2CK3H 4Q53A 1D6YA 3CCU3 2YX9A 1LOYA 5AEUB 1Y4KA 2RNTA 1LOWA 1EA2A 3MG1A 4XBYA 1BUJA 1QVG2 3KE7A 3FG3A 2IA7A 2RSXA 3LTBA 1OCVA 1YI23 3CU3A 3D5IA 2Z6BA 1BNIA 3F7SA 4FCMA 2W04A 1JZOA 2WO0A 1JKGB 1NWWA 2F56A 1DETA 1MWTA 3CCV3 1I3IA 3O8YA 3HK4A 2ZA4A 4N3VA 1IQYA 1BOXA 3EN8A 1R4YA 3DGLA 4FR9A 1LQMB 1UCLA 5IG3A 2KF3A 3S67A 1O7NB 4I5QA 3JVCA 5HGRA 4HBRA 1O7MB 1DVDA 1T2HA 3CNMA 1GSPA 1ZS7A 2J8XB 5AYRB 8RNTA 1U5OA 3EC9A 2BMOB 3F8XA 1TUHA 1EQKA 3HX8A 1GOYA 4GL6A 2CFKA 3UJMA 3MHEA 3NBJA 3S5CA 4KVHA 1S723 3URPA 2LYXA 3AMOA 1SJWA 1I3FA 3WA2X 4BIRA 2KCDA 2CHCA 2JDIH 3NBRA 1A67A 1Q7HA 4BTXA 2W9QA 3EB8A 3FGYA 2ZHXB 3PCRA 3WMDA 4CPKA 3BNCA 4MMYB 3CCJ3 3STDA 2H0IA 3DGMA 1K9M4 3BNDA 3SYUA 1US1A 2BT3A 3BNEA 5FGOA 3MG2A 2K0MA 3HIIA 3NX0A 1K41A 1G96A 4IT7A 3DY5A 3D4AA 1IT8A 2PZVA 3BB9A 3T0UA 4CJNA 1GS3A 1BSAA 2XF3A 2Z76A 3G8ZA 3LOYA 1AV4A 2R41A 2XR8B 1MGWA 2W2CA 3X3ZA 1R4CA 1RLSA 3X3XA 2KF4A 4MMXB 2OOVC 1BNJA 2CG0A 2BU4A 1DMNA 2INXA 4HJLB 4LZIA 1IQ8A 2F4YA 6STDA 3G0KA 1STDA 2B24B 3HOHA 1ULJB 3N8BA 4OUQA 3DZLA 3KSPA 1G02A 4PEJA 3B7CA 3LT8A 1IV9A 2E2TA 4MMZB 1B2ZA 3IJEB 1RCKA 3V98A 1GD3A 3KZTA 1RGLA 1EKMA 2CFWA 2UX0A 2D1WA 5CF1A 2A15A 1CEWI 3ECFA 4JRFA 5LC6A 1OGZA 4GB5A 1VQ63 1BNSA 4O8SA 3D5GA 1X1UA 1O7HB 2XFTA 3X40A 3NHXA 5STDA 1HU9A 5AIGA 3CCL3 1FZUA 4HOHA 5D82A 1B2XA 4X2HA 1RNBA 4R9KA 1GYBA 5IG4A 4HZ9B 2K3DA 4FMDA 1BNRA 3OXAA 5CF2A 3DXOA 2W56A 3CCS3 3JUPA 2XH9A 3CPOA 3H3HA 3CC43 1OHSA 5IERA 2C11A 3EQQB 1UI7A 3WA3A 1F8NA 4K1UA 3VF1A 1W6GA 3ROBA 3WOFB 4N6LA 1VQP3 1BUQA 2CWVA 3J7Yd 1QVF2 9RNTA 1WNHA 1Q864 1UCIA 1MOLA 1N5PA 1W7CA 4OK0A 1WQLB 2IYJA 2WGQA 2AAEA 1ASKA 2XFSA 4K61A 1E97A 1J2BA 1RJOA 5AI1A 2KXGA 2QIYA 3FG1A 3GRDA 4OVMA 2O9UX 3NV0A 1GMQA 1RRLA 2W03A 2IY2A 1D6UA 4O02B 2OQEA 1JKGA 1RMSA 3RGRA 1B2UA 1TU5A 1GMPA 2HMOB 4HM2B 1IVXA 1IT7A 1BAOA 1EG9B 1TFOA 2CWTA 2RGQA 2RCDA 4FCZA 4R4KA 3D9RA 3NBBA 1N9EA 1D6ZA 4HYZA 3LTDA 4O2HA 8CHOA 5M19A 1UUGB 3G4S3 1BANA 5EEOA 4KT3B 2ML5A 2WGOA 1QALA 4HVNA 3X41A 3F7XA 4N6NB 1AR0A 4LEHA 3TDGA 4MJDA 4G1MB 3EJVA 3LT9A 2IMJA 4U13A 3X42A 4WYKA 1IK3A 1VQ83 5BIRA 5KP4A 4N6OB 1GD4A 1UDII 2HMNB 1GY6A 3UB1A 1O7GB 2HMMB 2Q07A 2QGUA 3JUOA 3UL6A 1TFKA 1CQSA 3AHWA 2HOHA 3VGNA 4J9AA 3LYGA 3U1WA 4CCVA 3SOYA 2GBXB 3EBYA 3EHCA 5RNTA 1RGHA 1GMRA 2W9PA 3Q1CA 1JB4A 2OWPA 3MPHA 1MWSA 3QK9A 4N6V0 5AIIA 3E99A 3S27A 4BU4A 2CWUA 3CME3 2F5MA 2FGTA 1N8QA 2CC3A 4EYCA 3NXJA 1EEJA 5CK6A 1G0TA 3V92A 3DMCA 5AIFA 4BTYA 2CKFB 3N54B 1MWRA 1SARA 1ZX2A 1QAKA 1RNTA 4R9LA 4X2OA 1DVCA 3RGAA 3AGNA 3ZG5A 1RGAA 3F8HA 2BNGA 2GBWB 3CPW2 1YGEA 1DMQA 1B2MA 3GZXB 2GU1A 1RN7A 4EW5A 1Q40B 4NREA 4O3VA 3NM7A 3OW22 1DYUA 2C4BA 4STDA 5AEWB 1VQ73 3SOAA 3CD63 3EBTA 4L8OA 2KF5A 1W02A 4WHAA 2OTL3 1CYUA 4KFEA 3H51A 3ALAA 1MWUA 3KKGA 4BTWA 1QJGA 3OX9A 4N6TA 2QEX3 4KFFA 3K9MC 1IQXA 3UL5A 3KCHA 3PGBA 1BRIA 4NHFA 4AEQA 4K90B 1LXEA 3NQZA 1O7PB 1RN4A 1FUSA 2D42A 1PY3A 1ROAA 2M7OA 3L0RA 3MG3A 1FYSA 1RCLA 4MEIA 5JBSA 3S28A 1UGHI 2RFRA 3MWZA 4EC6A 2BMQB 2W0QA 3AGOA 2CX0A 1I0VA 3IMAB 1BRKA 3M8CA 3SVAA 1YIJ3 2HMJB 4WFOA 2O3OA 2CG1A 4HM1B 1WMOA 2XEPA 4HM0B 2B1XB 3GZBA 1UUWB 1BSBA 4CDLA 3RNTA 1GY5A 4QWTA 4IPBA 2E2VA 1OPYA 3DH2A 3FZWA 1BNGA 3KIIA 4H61A 1BRHA 4N6MA 5M18A 3HIGA 2AADA 3PCSA 2CW9A 1PYLA 3K5TA 4RBNA 2P0MA 1LQGC 1OF5A 5FW5A 3WDGB 1IV7A 1ULIB 4R80A 5G1LA 1X1XA 1FGTA 5A0OB 1DE3A 1UCKA 1N9JA 1OUNA 4RNZA 1W6YA 1IYYA 1BRNL 2Z77A 3RDEA 1W01A
chains in the Genus database with same CATH topology
5ELJA 3MKIA 4WP5A 3LXUX 1KC84 2WOFA 1M904 3D3LA 2P38A 1OHOA 3K63A 4H3UA 1E3RA 3MYTA 3I553 3KFQC 4ZM8A 1JN5A 1YIT3 1T5YA 3FLJA 4L7KA 1VQ43 4N6UA 1FGOA 2BHMA 3BLZA 1HKXA 1LVNA 4HM6B 1IDPA 1IU7A 1L5GB 2GXFA 4J8TA 5D81A 4LSOA 3OWUA 5IW9A 3BNBA 2YFIB 5JPPA 4XBXA 3N9HA 1M9GA 2OQEC 5IEPA 1A2VA 2CIUA 1CYVA 3SLUA 1VQM3 2CFLA 3FG4A 1JJ22 3CCR3 1TIJA 1UI8A 2FXTA 1OGXA 7STDA 3LH4A 3NUVA 3OWSA 3SEDA 1V74A 3K0ZA 2P09A 2XSOB 1ZO2A 5G2GA 3DGNA 1YJ93 1VZZA 2ZL8A 1K28A 1TP6A 1AVLA 3KSED 5BVBA 2F98A 1SIHA 3G16A 2C10A 1LNHA 1VQN3 1FUWA 1JNQA 1RRHA 3LMLA 3LZAA 1M1XB 2SBLA 3G713 3X3YA 4RZMA 2E2UA 5IF6A 4HM8B 3CCM3 4XDVA 3WOEB 3NV0B 5DRVA 4XB5A 1NB3I 4LMIA 4EBGA 1Z1SA 2GU3A 1QMAA 1Q42A 3B4OA 1OACA 2IUKA 3CC73 5CLKA 1Q824 1NO3A 2XRXB 1IVUA 4LGQA 5IG0A 2K54A 3B8LA 3G6E3 1W00A 5AYSC 3NM2A 2W56B 2P0XA 1RKYA 2F86B 1M1K4 2CH9A 4HM4B 4FMAA 3MSOA 3CC23 1W2ZA 2HMLB 3CNXA 2V1LA 1VQO3 1WMPA 3LTAA 2CFDA 4EXRA 2PNCA 3WODG 1VQ53 4HM7B 5BXQA 3K7CA 3FCSB 2W6JH 1LOXA 3OWYA 2Y74A 4IIAA 5TGNA 3CXC2 4KFDA 2YFLB 1PU4A 1UW1A 3Q2PA 3PYJA 1MNLA 3GZRA 5CXOA 2ML6A 1YVBI 1JB5A 1SQWA 4EV2A 5ELUA 2MC8A 1WMNA 1C7HA 2OCTA 3A76A 1OH0A 3F9SA 1VQK3 3HI7A 3DUKA 3U97A 1N8R4 4I4KA 3JUQA 3JUMA 2ZDJA 1JV2B 1FA3A 3PS8A 1DMMA 2L4VA 3FF2A 1ISKA 1AVKA 2R4IA 5KP1A 1KSIA 2BO9B 2XSHB 3V99A 2KRTA 2XGLA 3FH1A 3LTCA 3PXMA 1IVWA 1FGRA 1NDOB 3SXXA 1KD14 1W6CA 1O7WB 2I9WA 1VQ93 1YJN3 3VSYA 5IEOA 3DGOA 3HZPA 4RNYA 4K1VA 5KP3A 2YFJB 1JB2A 3ER7A 1WTHA 2Z7AA 1FGQA 1NU3A 3EX9A 2HMKB 1NB5I 5IG5A 5DREA 1W5ZA 3EN1B 3PZWA 3CCE3 4FMBA 2IUJA 4WWUC 1FGMA 1UUVB 3QRDA 5EVHA 1E3VA 2CFGA 2JQ5A 3FKAA 2STDA 1NJI4 3EE1A 4TX4A 2MF7A 1STFI 4HM5B 3CCQ3 1A2KA 4EV5A 5I97A 1YHQ3 3Q90A 3EF8A 2XGNA 5IENA 1A90A 1SIIA 3I0YA 4KZ1A 3DM8A 3B4PA 3KN4A 4L8PA 1U8CB 1Q7Y4 4XDWA 1KWIA 3S29A 1SPUA 3AMOB 2OTJ3 4XM4A 5EQLA 4WYKB 1PFPA 4AKYA 5JPUA 1K8A4 1QAFA 3F14A 1ROVA 2BMRB 1Q40A 1OF5B 3CMA3 2WOHA 3I563 3T8NA 1IVVA 1OHPA 2OOVA 1N5HA 1YJW3 1JRQA 4R1KA 3IPTA 1W2B2 5AIHA 1GY7A 4FMCA 3OV4A 4ORLA 1Q814 4HZBB 3GAXA 3UNLA 2P05A 4XBTA 3FF0A 2Y73A 2F99A 3T8UA 4HKVB 4HM3B 3NQYA 3GWRA 1VQL3 1W4NA 4FCJA 3JUNA 3F40A 1JN5B 2LQVA 2GEXA 2FNQA 3FSDA 5LC7A 1S5AA 4AKZA 4JF8A 5D83A 1K734 3GZYB 2GEYA 3SX1A 2QA43 1KQS2 2CK3H 4Q53A 1D6YA 3CCU3 2YX9A 5AEUB 1Y4KA 4XBYA 1EA2A 3MG1A 1QVG2 3KE7A 3FG3A 2IA7A 2RSXA 3LTBA 1OCVA 1YI23 3CU3A 2Z6BA 3F7SA 4FCMA 2W04A 2WO0A 1JKGB 1NWWA 3CCV3 3O8YA 3HK4A 4N3VA 1IQYA 3EN8A 3DGLA 4FR9A 5IG3A 3S67A 1O7NB 3JVCA 5HGRA 4HBRA 1O7MB 1DVDA 3CNMA 5AYRB 1U5OA 3EC9A 2BMOB 3F8XA 1TUHA 1EQKA 3HX8A 4GL6A 2CFKA 3UJMA 3MHEA 3NBJA 3S5CA 4KVHA 1S723 2LYXA 3AMOA 1SJWA 3WA2X 2KCDA 2CHCA 2JDIH 3NBRA 1A67A 4BTXA 2W9QA 3EB8A 3FGYA 3PCRA 3WMDA 3BNCA 4MMYB 3CCJ3 3STDA 3DGMA 1K9M4 3BNDA 1US1A 2BT3A 3BNEA 5FGOA 3MG2A 2K0MA 3HIIA 3NX0A 1K41A 1G96A 4IT7A 3DY5A 1IT8A 2PZVA 3BB9A 3T0UA 1GS3A 2XF3A 2Z76A 3G8ZA 3LOYA 1AV4A 2XR8B 2W2CA 3X3ZA 1R4CA 3X3XA 4MMXB 2OOVC 2CG0A 4LZIA 1DMNA 2INXA 4HJLB 1IQ8A 6STDA 3G0KA 1STDA 2B24B 3N8BA 1ULJB 4OUQA 3DZLA 3KSPA 4PEJA 3B7CA 3LT8A 1IV9A 2E2TA 4MMZB 3IJEB 3V98A 1GD3A 3KZTA 1EKMA 2CFWA 2UX0A 2D1WA 5CF1A 2A15A 1CEWI 3ECFA 4JRFA 5LC6A 1OGZA 4GB5A 1VQ63 4O8SA 3X40A 1O7HB 2XFTA 3CCL3 3NHXA 5STDA 1HU9A 5AIGA 5D82A 4X2HA 4R9KA 1GYBA 5IG4A 4HZ9B 4FMDA 3OXAA 5CF2A 3DXOA 2W56A 3CCS3 3JUPA 2XH9A 3CPOA 3H3HA 3CC43 1OHSA 5IERA 2C11A 3EQQB 1UI7A 3WA3A 1F8NA 4K1UA 3VF1A 1W6GA 3ROBA 3WOFB 4N6LA 1VQP3 1BUQA 2CWVA 3J7Yd 1QVF2 1WNHA 1Q864 1MOLA 1N5PA 1W7CA 4OK0A 1WQLB 2WGQA 2XFSA 1ASKA 4K61A 1J2BA 1E97A 1RJOA 5AI1A 2KXGA 2QIYA 3FG1A 3GRDA 4OVMA 2O9UX 3NV0A 1RRLA 2W03A 1D6UA 4O02B 2OQEA 1JKGA 3RGRA 1TU5A 2HMOB 4HM2B 1IVXA 1IT7A 1EG9B 1TFOA 2RGQA 2CWTA 2RCDA 4FCZA 4R4KA 3D9RA 3NBBA 1N9EA 1D6ZA 4HYZA 3LTDA 4O2HA 8CHOA 3G4S3 5EEOA 2ML5A 2WGOA 1QALA 4HVNA 3X41A 3F7XA 4N6NB 1AR0A 4LEHA 3TDGA 4MJDA 4G1MB 3EJVA 3LT9A 2IMJA 4U13A 3X42A 4WYKA 1IK3A 1VQ83 5KP4A 4N6OB 1GD4A 3UB1A 2HMNB 1GY6A 3UL6A 1O7GB 2HMMB 2Q07A 2QGUA 3JUOA 1TFKA 1CQSA 3VGNA 4J9AA 3LYGA 3U1WA 4CCVA 3SOYA 2GBXB 3EBYA 3EHCA 3Q1CA 2W9PA 1JB4A 2OWPA 3MPHA 3QK9A 4N6V0 5AIIA 3E99A 3S27A 2CWUA 3CME3 2FGTA 1N8QA 2CC3A 4EYCA 3NXJA 5CK6A 3V92A 3DMCA 5AIFA 4BTYA 2CKFB 3N54B 1ZX2A 4R9LA 1QAKA 4X2OA 1DVCA 3RGAA 3F8HA 2BNGA 2GBWB 3CPW2 1YGEA 1DMQA 3GZXB 2GU1A 1RN7A 1Q40B 4NREA 4O3VA 3NM7A 3OW22 1DYUA 4STDA 5AEWB 1VQ73 3CD63 3SOAA 3EBTA 4L8OA 1W02A 4WHAA 2OTL3 1CYUA 4KFEA 3H51A 3ALAA 3KKGA 4BTWA 1QJGA 3OX9A 4N6TA 2QEX3 4KFFA 3K9MC 1IQXA 3UL5A 3PGBA 4NHFA 4AEQA 4K90B 1LXEA 3NQZA 1O7PB 2M7OA 2D42A 3MG3A 1ROAA 3L0RA 4MEIA 5JBSA 3S28A 2RFRA 3MWZA 4EC6A 2BMQB 2W0QA 3IMAB 3SVAA 3M8CA 1YIJ3 2HMJB 4WFOA 2O3OA 2CG1A 4HM1B 1WMOA 2XEPA 4HM0B 2B1XB 3GZBA 1UUWB 4CDLA 1GY5A 4QWTA 4IPBA 2E2VA 1OPYA 3FZWA 4H61A 3KIIA 4N6MA 3HIGA 3PCSA 2CW9A 3K5TA 4RBNA 2P0MA 1OF5A 5FW5A 3WDGB 1IV7A 1ULIB 4R80A 1FGTA 5A0OB 1N9JA 1OUNA 4RNZA 1W6YA 2Z77A 3RDEA 1W01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q53 A;  1C7H A;  3A76 A;  3F9S A;  1OH0 A;  1WQL B;  3MKI A;  4WP5 A;  5AEU B;  4XBY A;  1EA2 A;  3MG1 A;  1ASK A;  1E97 A;  3DUK A;  5AI1 A;  3KE7 A;  2QIY A;  1OHO A;  3GRD A;  4OVM A;  4I4K A;  3NV0 A;  1OCV A;  3JUQ A;  4H3U A;  3CU3 A;  3JUM A;  1E3R A;  3F7S A;  3MYT A;  4FCM A;  1DMM A;  1JKG A;  1JKG B;  1NWW A;  3FF2 A;  3RGR A;  1JN5 A;  1ISK A;  3FLJ A;  2HMO B;  2R4I A;  4HM2 B;  4L7K A;  3HK4 A;  4N3V A;  3ROB A;  5KP1 A;  1EG9 B;  2RGQ A;  2XSH B;  3EN8 A;  3BLZ A;  2RCD A;  1HKX A;  4HM6 B;  1IDP A;  3D9R A;  3FH1 A;  5IG3 A;  1O7N B;  8CHO A;  1NDO B;  2GXF A;  1BUQ A;  5HGR A;  4J8T A;  5D81 A;  3OWU A;  1O7W B;  4HVN A;  1O7M B;  2I9W A;  2YFI B;  3F7X A;  4XBX A;  5JPP A;  1AR0 A;  4LEH A;  3VSY A;  4MJD A;  5IEO A;  5IEP A;  3HZP A;  3EJV A;  4U13 A;  2IMJ A;  3CNM A;  4WYK A;  4K1V A;  5KP3 A;  2YFJ B;  1JB2 A;  3ER7 A;  1U5O A;  5CF1 A;  5KP4 A;  3EC9 A;  2Z7A A;  2BMO B;  1NU3 A;  2HMN B;  1GY6 A;  3F8X A;  1O7G B;  2HMM B;  2QGU A;  1TUH A;  3EX9 A;  3HX8 A;  3JUO A;  3UJM A;  1CQS A;  2HMK B;  3MHE A;  1OGX A;  3S5C A;  4KVH A;  4J9A A;  3LYG A;  3VGN A;  5IG5 A;  5DRE A;  3SOY A;  2GBX B;  3EBY A;  1SJW A;  3EHC A;  3EN1 B;  7STD A;  3OWS A;  3NUV A;  2CHC A;  1JB4 A;  2OWP A;  3SED A;  3NBR A;  3K0Z A;  5AII A;  3E99 A;  2XSO B;  1ZO2 A;  5G2G A;  4WWU C;  1VZZ A;  3FGY A;  3NXJ A;  1UUV B;  5CK6 A;  3WMD A;  1TP6 A;  5EVH A;  3DMC A;  5AIF A;  1E3V A;  3STD A;  2JQ5 A;  2CKF B;  3FKA A;  2STD A;  5BVB A;  2F98 A;  1ZX2 A;  4R9L A;  3G16 A;  4X2O A;  3RGA A;  3F8H A;  2BNG A;  2GBW B;  3MG2 A;  1DMQ A;  4HM5 B;  1K41 A;  3GZX B;  1Q40 B;  3LZA A;  1A2K A;  2PZV A;  3BB9 A;  4RZM A;  5IF6 A;  1GS3 A;  4HM8 B;  4STD A;  2Z76 A;  3G8Z A;  3Q90 A;  3NV0 B;  4XDV A;  3EF8 A;  2XR8 B;  3SOA A;  5IEN A;  2W2C A;  5DRV A;  3EBT A;  3I0Y A;  4L8O A;  4LMI A;  4XB5 A;  1W02 A;  1Z1S A;  3DM8 A;  3B4P A;  4L8P A;  3H51 A;  1QMA A;  1Q42 A;  3KKG A;  3B4O A;  1QJG A;  4XDW A;  3OX9 A;  1DMN A;  2INX A;  4HJL B;  5CLK A;  5AEW B;  2XRX B;  6STD A;  4LGQ A;  3G0K A;  1STD A;  2B24 B;  2K54 A;  3B8L A;  4WYK B;  1ULJ B;  1W00 A;  4XM4 A;  4OUQ A;  5JPU A;  3DZL A;  3NM2 A;  1O7P B;  3F14 A;  3KSP A;  3MG3 A;  5IG0 A;  2BMR B;  1Q40 A;  1OF5 B;  3B7C A;  4PEJ A;  2F86 B;  3T8N A;  1OHP A;  4HM4 B;  2RFR A;  3MSO A;  2BMQ B;  4R1K A;  3KZT A;  3IPT A;  2HML B;  2UX0 A;  3M8C A;  3CNX A;  5AIH A;  2A15 A;  1GY7 A;  2HMJ B;  3ECF A;  3OV4 A;  1OGZ A;  4GB5 A;  4HM1 B;  4ORL A;  4HM0 B;  2B1X B;  3GZB A;  4HZB B;  1O7H B;  1UUW B;  3NHX A;  4HM7 B;  5AIG A;  2Z77 A;  4XBT A;  5STD A;  3UNL A;  3FF0 A;  1GY5 A;  5D82 A;  4CDL A;  5BXQ A;  3K7C A;  1OPY A;  2F99 A;  3FZW A;  3T8U A;  3OWY A;  4IIA A;  4X2H A;  4HKV B;  4HM3 B;  5TGN A;  4R9K A;  2YFL B;  1GYB A;  5IG4 A;  3GWR A;  4HZ9 B;  3OXA A;  4FCJ A;  3DXO A;  3JUN A;  1OF5 A;  3F40 A;  5FW5 A;  5CF2 A;  3JUP A;  1ULI B;  1JN5 B;  3CPO A;  2GEX A;  3H3H A;  3FSD A;  3GZR A;  1OHS A;  1S5A A;  1OUN A;  3EQQ B;  5IER A;  4K1U A;  5CXO A;  1W6Y A;  5D83 A;  3GZY B;  2GEY A;  1JB5 A;  1W01 A; 
#chains in the Genus database with same CATH topology
 5ELJ A;  1B3S A;  3MKI A;  4WP5 A;  3LXU X;  3BU4 A;  1BIR A;  1KC8 4;  2WOF A;  1M90 4;  3D3L A;  2P38 A;  1OHO A;  3K63 A;  1B27 A;  4H3U A;  1HYF A;  1E3R A;  3MYT A;  3I55 3;  3KFQ C;  1X1Y A;  4ZM8 A;  1JN5 A;  1YIT 3;  1T5Y A;  1UCJ A;  3FLJ A;  4L7K A;  1VQ4 3;  4N6U A;  1FGO A;  2BHM A;  3BLZ A;  1HKX A;  1LVN A;  4HM6 B;  1IDP A;  1LNI A;  4DKI A;  1IU7 A;  1UGI A;  1L5G B;  2GXF A;  4J8T A;  1I0X A;  5D81 A;  4LSO A;  3OWU A;  5IW9 A;  3BNB A;  2YFI B;  5JPP A;  1BSD A;  4XBX A;  3N9H A;  1M9G A;  2OQE C;  5IEP A;  1JZD A;  1I2G A;  1A2V A;  1Q9E A;  2CIU A;  1CYV A;  3SLU A;  1VQM 3;  2CX1 A;  2CFL A;  5G1K A;  3FG4 A;  1JJ2 2;  3CCR 3;  1TIJ A;  1UI8 A;  2FXT A;  1OGX A;  4LYL B;  7STD A;  3LH4 A;  3NUV A;  3OWS A;  3SED A;  1B20 A;  1V74 A;  3AHS A;  3K0Z A;  2P09 A;  2XSO B;  1ZO2 A;  2RBI A;  5G2G A;  2F5W A;  3DGN A;  1YJ9 3;  1VZZ A;  1EUI C;  2ZL8 A;  1K28 A;  1TP6 A;  1AVL A;  3KSE D;  5BVB A;  1NNV A;  2F98 A;  1SIH A;  1GOU A;  3G16 A;  1B2S A;  2C10 A;  1LNH A;  1VQN 3;  1FUW A;  1JNQ A;  1RRH A;  4NPB A;  3LML A;  1BRJ A;  3LZA A;  1M1X B;  2SBL A;  3G71 3;  3X3Y A;  4RZM A;  2E2U A;  5IF6 A;  4HM8 B;  3CCM 3;  4XDV A;  3WHO A;  3NV0 B;  3WOE B;  5DRV A;  1HZ1 A;  4XB5 A;  1NB3 I;  4LMI A;  1I70 A;  4EBG A;  1Z1S A;  2GU3 A;  1RGC A;  1QMA A;  1Q42 A;  1V57 A;  3D79 A;  3B4O A;  1OAC A;  2IUK A;  3CC7 3;  5CLK A;  1Q82 4;  1NO3 A;  2XRX B;  1IVU A;  4LGQ A;  5IG0 A;  2K54 A;  4ILF A;  3B8L A;  3G6E 3;  1W00 A;  1X1W A;  5AYS C;  3NM2 A;  1BNE A;  1MGR A;  2W56 B;  2P0X A;  1BGS A;  1RKY A;  2F86 B;  1M1K 4;  2CH9 A;  4HM4 B;  2GSP A;  2H0H A;  4FMA A;  3MSO A;  3CC2 3;  1W2Z A;  2HML B;  2KF6 A;  5HOH A;  1I2E A;  2V1L A;  3CNX A;  1VQO 3;  4BL3 A;  1WMP A;  3LTA A;  1C54 A;  1TJD A;  2CFD A;  4EXR A;  2PNC A;  3WOD G;  1VQ5 3;  4HM7 B;  5BXQ A;  1AQZ A;  1AY7 A;  3K7C A;  3FCS B;  2W6J H;  1LOX A;  1BRG A;  1RGF A;  3OWY A;  2Y74 A;  4IIA A;  5TGN A;  3CXC 2;  4KFD A;  2YFL B;  1PU4 A;  1UW1 A;  1RGK A;  1T2I A;  1BSC A;  3Q2P A;  1GOV A;  1RSN A;  2UUG C;  3PYJ A;  1MNL A;  2H0G A;  3GZR A;  5CXO A;  2ML6 A;  1YVB I;  1JB5 A;  1SQW A;  4EV2 A;  5ELU A;  4RNT A;  2MC8 A;  1WMN A;  1C7H A;  2OCT A;  3A76 A;  1OH0 A;  3F9S A;  3A5E A;  1VQK 3;  1LOV A;  3DUK A;  3HI7 A;  3U97 A;  1TTO A;  1N8R 4;  4I4K A;  3JUQ A;  3JUM A;  2ZDJ A;  1JV2 B;  1FA3 A;  1BNF A;  3PS8 A;  1DMM A;  2L4V A;  3FF2 A;  1ISK A;  1AVK A;  2R4I A;  5KP1 A;  1KSI A;  2BO9 B;  2XSH B;  3V99 A;  2KRT A;  2XGL A;  1YGW A;  3FH1 A;  3LTC A;  3PXM A;  1IVW A;  1FGR A;  1NDO B;  3SXX A;  1KD1 4;  1W6C A;  1O7W B;  2I9W A;  4BL2 A;  1VQ9 3;  1YJN 3;  3VSY A;  5IEO A;  1LRA A;  3DGO A;  3HZP A;  1FW7 A;  4RNY A;  4K1V A;  5KP3 A;  2YFJ B;  1JB2 A;  3ER7 A;  1TRQ A;  3ZG0 A;  1WTH A;  2Z7A A;  1FGQ A;  6RNT A;  1NU3 A;  3EX9 A;  2KAA A;  2HMK B;  1NB5 I;  1CH0 A;  5IG5 A;  5DRE A;  1W5Z A;  3EN1 B;  3PZW A;  3CCE 3;  4FMB A;  2IUJ A;  6GSP A;  2UGI A;  1BSE A;  1JBT A;  4WWU C;  1FGM A;  7GSP A;  1UUV B;  3QRD A;  5EVH A;  5M1A A;  3ZFZ A;  1E3V A;  1RGE A;  2CFG A;  2JQ5 A;  3FKA A;  2STD A;  1NJI 4;  3EE1 A;  1TRP A;  2MF7 A;  1STF I;  4TX4 A;  4HM5 B;  5BU4 A;  3CCQ 3;  3GSP A;  1RTU A;  1A2K A;  1BRS A;  4EV5 A;  1B21 A;  5I97 A;  1RN1 A;  3Q90 A;  1YHQ 3;  3EF8 A;  2SAR A;  2XGN A;  5IEN A;  1RHL A;  1A90 A;  1SII A;  3I0Y A;  4KZ1 A;  2BIR A;  1YNV X;  3DM8 A;  3B4P A;  3KN4 A;  4L8P A;  1JBR A;  1U8C B;  1Q7Y 4;  4XDW A;  1KWI A;  3S29 A;  1SPU A;  1RGG A;  4GSP A;  3AMO B;  1T3B A;  2OTJ 3;  1V58 A;  4XM4 A;  4HAA A;  4GHO A;  1PFP A;  4WYK B;  1RDS A;  5EQL A;  5GSP A;  3WR2 A;  4AKY A;  1QAF A;  7RNT A;  5JPU A;  1K8A 4;  1JBS A;  3F14 A;  1ROV A;  2BMR B;  1Q40 A;  1OF5 B;  3CMA 3;  2WOH A;  3I56 3;  3T8N A;  1IVV A;  1OHP A;  2OOV A;  1N5H A;  1YJW 3;  1A2P A;  1JRQ A;  2L1S A;  3IPT A;  4R1K A;  1W2B 2;  1VQQ A;  5AIH A;  1I2F A;  1GY7 A;  4FMC A;  3OV4 A;  4ORL A;  1Q81 4;  4HZB B;  3GAX A;  3UNL A;  2P05 A;  4XBT A;  3BIR A;  3FF0 A;  4J5K A;  2Y73 A;  2F99 A;  3T8U A;  3Q3F A;  1I8V A;  4HKV B;  4HM3 B;  3NQY A;  4J5G A;  3GWR A;  1VQL 3;  1W4N A;  1ZGX A;  3JUN A;  4FCJ A;  3F40 A;  1BU4 A;  1JN5 B;  2LQV A;  2GEX A;  1FUT A;  2FNQ A;  3FSD A;  5LC7 A;  1S5A A;  1BVI A;  4AKZ A;  4JF8 A;  5D83 A;  1K73 4;  3DGY A;  3GZY B;  2GEY A;  3SX1 A;  2QA4 3;  1KQS 2;  1YVS A;  2CK3 H;  4Q53 A;  1D6Y A;  3CCU 3;  2YX9 A;  1LOY A;  5AEU B;  1Y4K A;  2RNT A;  1LOW A;  1EA2 A;  3MG1 A;  4XBY A;  1BUJ A;  1QVG 2;  3KE7 A;  3FG3 A;  2IA7 A;  2RSX A;  3LTB A;  1OCV A;  1YI2 3;  3CU3 A;  3D5I A;  2Z6B A;  1BNI A;  3F7S A;  4FCM A;  2W04 A;  1JZO A;  2WO0 A;  1JKG B;  1NWW A;  2F56 A;  1DET A;  1MWT A;  3CCV 3;  1I3I A;  3O8Y A;  3HK4 A;  2ZA4 A;  4N3V A;  1IQY A;  1BOX A;  3EN8 A;  1R4Y A;  3DGL A;  4FR9 A;  1LQM B;  1UCL A;  5IG3 A;  2KF3 A;  3S67 A;  1O7N B;  4I5Q A;  3JVC A;  5HGR A;  4HBR A;  1O7M B;  1DVD A;  1T2H A;  3CNM A;  1GSP A;  1ZS7 A;  2J8X B;  5AYR B;  8RNT A;  1U5O A;  3EC9 A;  2BMO B;  3F8X A;  1TUH A;  1EQK A;  3HX8 A;  1GOY A;  4GL6 A;  2CFK A;  3UJM A;  3MHE A;  3NBJ A;  3S5C A;  4KVH A;  1S72 3;  3URP A;  2LYX A;  3AMO A;  1SJW A;  1I3F A;  3WA2 X;  4BIR A;  2KCD A;  2CHC A;  2JDI H;  3NBR A;  1A67 A;  1Q7H A;  4BTX A;  2W9Q A;  3EB8 A;  3FGY A;  2ZHX B;  3PCR A;  3WMD A;  4CPK A;  3BNC A;  4MMY B;  3CCJ 3;  3STD A;  2H0I A;  3DGM A;  1K9M 4;  3BND A;  3SYU A;  1US1 A;  2BT3 A;  3BNE A;  5FGO A;  3MG2 A;  2K0M A;  3HII A;  3NX0 A;  1K41 A;  1G96 A;  4IT7 A;  3DY5 A;  3D4A A;  1IT8 A;  2PZV A;  3BB9 A;  3T0U A;  4CJN A;  1GS3 A;  1BSA A;  2XF3 A;  2Z76 A;  3G8Z A;  3LOY A;  1AV4 A;  2R41 A;  2XR8 B;  1MGW A;  2W2C A;  3X3Z A;  1R4C A;  1RLS A;  3X3X A;  2KF4 A;  4MMX B;  2OOV C;  1BNJ A;  2CG0 A;  2BU4 A;  1DMN A;  2INX A;  4HJL B;  4LZI A;  1IQ8 A;  2F4Y A;  6STD A;  3G0K A;  1STD A;  2B24 B;  3HOH A;  1ULJ B;  3N8B A;  4OUQ A;  3DZL A;  3KSP A;  1G02 A;  4PEJ A;  3B7C A;  3LT8 A;  1IV9 A;  2E2T A;  4MMZ B;  1B2Z A;  3IJE B;  1RCK A;  3V98 A;  1GD3 A;  3KZT A;  1RGL A;  1EKM A;  2CFW A;  2UX0 A;  2D1W A;  5CF1 A;  2A15 A;  1CEW I;  3ECF A;  4JRF A;  5LC6 A;  1OGZ A;  4GB5 A;  1VQ6 3;  1BNS A;  4O8S A;  3D5G A;  1X1U A;  1O7H B;  2XFT A;  3X40 A;  3NHX A;  5STD A;  1HU9 A;  5AIG A;  3CCL 3;  1FZU A;  4HOH A;  5D82 A;  1B2X A;  4X2H A;  1RNB A;  4R9K A;  1GYB A;  5IG4 A;  4HZ9 B;  2K3D A;  4FMD A;  1BNR A;  3OXA A;  5CF2 A;  3DXO A;  2W56 A;  3CCS 3;  3JUP A;  2XH9 A;  3CPO A;  3H3H A;  3CC4 3;  1OHS A;  5IER A;  2C11 A;  3EQQ B;  1UI7 A;  3WA3 A;  1F8N A;  4K1U A;  3VF1 A;  1W6G A;  3ROB A;  3WOF B;  4N6L A;  1VQP 3;  1BUQ A;  2CWV A;  3J7Y d;  1QVF 2;  9RNT A;  1WNH A;  1Q86 4;  1UCI A;  1MOL A;  1N5P A;  1W7C A;  4OK0 A;  1WQL B;  2IYJ A;  2WGQ A;  2AAE A;  1ASK A;  2XFS A;  4K61 A;  1E97 A;  1J2B A;  1RJO A;  5AI1 A;  2KXG A;  2QIY A;  3FG1 A;  3GRD A;  4OVM A;  2O9U X;  3NV0 A;  1GMQ A;  1RRL A;  2W03 A;  2IY2 A;  1D6U A;  4O02 B;  2OQE A;  1JKG A;  1RMS A;  3RGR A;  1B2U A;  1TU5 A;  1GMP A;  2HMO B;  4HM2 B;  1IVX A;  1IT7 A;  1BAO A;  1EG9 B;  1TFO A;  2CWT A;  2RGQ A;  2RCD A;  4FCZ A;  4R4K A;  3D9R A;  3NBB A;  1N9E A;  1D6Z A;  4HYZ A;  3LTD A;  4O2H A;  8CHO A;  5M19 A;  1UUG B;  3G4S 3;  1BAN A;  5EEO A;  4KT3 B;  2ML5 A;  2WGO A;  1QAL A;  4HVN A;  3X41 A;  3F7X A;  4N6N B;  1AR0 A;  4LEH A;  3TDG A;  4MJD A;  4G1M B;  3EJV A;  3LT9 A;  2IMJ A;  4U13 A;  3X42 A;  4WYK A;  1IK3 A;  1VQ8 3;  5BIR A;  5KP4 A;  4N6O B;  1GD4 A;  1UDI I;  2HMN B;  1GY6 A;  3UB1 A;  1O7G B;  2HMM B;  2Q07 A;  2QGU A;  3JUO A;  3UL6 A;  1TFK A;  1CQS A;  3AHW A;  2HOH A;  3VGN A;  4J9A A;  3LYG A;  3U1W A;  4CCV A;  3SOY A;  2GBX B;  3EBY A;  3EHC A;  5RNT A;  1RGH A;  1GMR A;  2W9P A;  3Q1C A;  1JB4 A;  2OWP A;  3MPH A;  1MWS A;  3QK9 A;  4N6V 0;  5AII A;  3E99 A;  3S27 A;  4BU4 A;  2CWU A;  3CME 3;  2F5M A;  2FGT A;  1N8Q A;  2CC3 A;  4EYC A;  3NXJ A;  1EEJ A;  5CK6 A;  1G0T A;  3V92 A;  3DMC A;  5AIF A;  4BTY A;  2CKF B;  3N54 B;  1MWR A;  1SAR A;  1ZX2 A;  1QAK A;  1RNT A;  4R9L A;  4X2O A;  1DVC A;  3RGA A;  3AGN A;  3ZG5 A;  1RGA A;  3F8H A;  2BNG A;  2GBW B;  3CPW 2;  1YGE A;  1DMQ A;  1B2M A;  3GZX B;  2GU1 A;  1RN7 A;  4EW5 A;  1Q40 B;  4NRE A;  4O3V A;  3NM7 A;  3OW2 2;  1DYU A;  2C4B A;  4STD A;  5AEW B;  1VQ7 3;  3SOA A;  3CD6 3;  3EBT A;  4L8O A;  2KF5 A;  1W02 A;  4WHA A;  2OTL 3;  1CYU A;  4KFE A;  3H51 A;  3ALA A;  1MWU A;  3KKG A;  4BTW A;  1QJG A;  3OX9 A;  4N6T A;  2QEX 3;  4KFF A;  3K9M C;  1IQX A;  3UL5 A;  3KCH A;  3PGB A;  1BRI A;  4NHF A;  4AEQ A;  4K90 B;  1LXE A;  3NQZ A;  1O7P B;  1RN4 A;  1FUS A;  2D42 A;  1PY3 A;  1ROA A;  2M7O A;  3L0R A;  3MG3 A;  1FYS A;  1RCL A;  4MEI A;  5JBS A;  3S28 A;  1UGH I;  2RFR A;  3MWZ A;  4EC6 A;  2BMQ B;  2W0Q A;  3AGO A;  2CX0 A;  1I0V A;  3IMA B;  1BRK A;  3M8C A;  3SVA A;  1YIJ 3;  2HMJ B;  4WFO A;  2O3O A;  2CG1 A;  4HM1 B;  1WMO A;  2XEP A;  4HM0 B;  2B1X B;  3GZB A;  1UUW B;  1BSB A;  4CDL A;  3RNT A;  1GY5 A;  4QWT A;  4IPB A;  2E2V A;  1OPY A;  3DH2 A;  3FZW A;  1BNG A;  3KII A;  4H61 A;  1BRH A;  4N6M A;  5M18 A;  3HIG A;  2AAD A;  3PCS A;  2CW9 A;  1PYL A;  3K5T A;  4RBN A;  2P0M A;  1LQG C;  1OF5 A;  5FW5 A;  3WDG B;  1IV7 A;  1ULI B;  4R80 A;  5G1L A;  1X1X A;  1FGT A;  5A0O B;  1DE3 A;  1UCK A;  1N9J A;  1OUN A;  4RNZ A;  1W6Y A;  1IYY A;  1BRN L;  2Z77 A;  3RDE A;  1W01 A; 
#chains in the Genus database with same CATH homology
 5ELJ A;  3MKI A;  4WP5 A;  3LXU X;  1KC8 4;  2WOF A;  1M90 4;  3D3L A;  2P38 A;  1OHO A;  3K63 A;  4H3U A;  1E3R A;  3MYT A;  3I55 3;  3KFQ C;  4ZM8 A;  1JN5 A;  1YIT 3;  1T5Y A;  3FLJ A;  4L7K A;  1VQ4 3;  4N6U A;  1FGO A;  2BHM A;  3BLZ A;  1HKX A;  1LVN A;  4HM6 B;  1IDP A;  1IU7 A;  1L5G B;  2GXF A;  4J8T A;  5D81 A;  4LSO A;  3OWU A;  5IW9 A;  3BNB A;  2YFI B;  5JPP A;  4XBX A;  3N9H A;  1M9G A;  2OQE C;  5IEP A;  1A2V A;  2CIU A;  1CYV A;  3SLU A;  1VQM 3;  2CFL A;  3FG4 A;  1JJ2 2;  3CCR 3;  1TIJ A;  1UI8 A;  2FXT A;  1OGX A;  7STD A;  3LH4 A;  3NUV A;  3OWS A;  3SED A;  1V74 A;  3K0Z A;  2P09 A;  2XSO B;  1ZO2 A;  5G2G A;  3DGN A;  1YJ9 3;  1VZZ A;  2ZL8 A;  1K28 A;  1TP6 A;  1AVL A;  3KSE D;  5BVB A;  2F98 A;  1SIH A;  3G16 A;  2C10 A;  1LNH A;  1VQN 3;  1FUW A;  1JNQ A;  1RRH A;  3LML A;  3LZA A;  1M1X B;  2SBL A;  3G71 3;  3X3Y A;  4RZM A;  2E2U A;  5IF6 A;  4HM8 B;  3CCM 3;  4XDV A;  3WOE B;  3NV0 B;  5DRV A;  4XB5 A;  1NB3 I;  4LMI A;  4EBG A;  1Z1S A;  2GU3 A;  1QMA A;  1Q42 A;  3B4O A;  1OAC A;  2IUK A;  3CC7 3;  5CLK A;  1Q82 4;  1NO3 A;  2XRX B;  1IVU A;  4LGQ A;  5IG0 A;  2K54 A;  3B8L A;  3G6E 3;  1W00 A;  5AYS C;  3NM2 A;  2W56 B;  2P0X A;  1RKY A;  2F86 B;  1M1K 4;  2CH9 A;  4HM4 B;  4FMA A;  3MSO A;  3CC2 3;  1W2Z A;  2HML B;  3CNX A;  2V1L A;  1VQO 3;  1WMP A;  3LTA A;  2CFD A;  4EXR A;  2PNC A;  3WOD G;  1VQ5 3;  4HM7 B;  5BXQ A;  3K7C A;  3FCS B;  2W6J H;  1LOX A;  3OWY A;  2Y74 A;  4IIA A;  5TGN A;  3CXC 2;  4KFD A;  2YFL B;  1PU4 A;  1UW1 A;  3Q2P A;  3PYJ A;  1MNL A;  3GZR A;  5CXO A;  2ML6 A;  1YVB I;  1JB5 A;  1SQW A;  4EV2 A;  5ELU A;  2MC8 A;  1WMN A;  1C7H A;  2OCT A;  3A76 A;  1OH0 A;  3F9S A;  1VQK 3;  3HI7 A;  3DUK A;  3U97 A;  1N8R 4;  4I4K A;  3JUQ A;  3JUM A;  2ZDJ A;  1JV2 B;  1FA3 A;  3PS8 A;  1DMM A;  2L4V A;  3FF2 A;  1ISK A;  1AVK A;  2R4I A;  5KP1 A;  1KSI A;  2BO9 B;  2XSH B;  3V99 A;  2KRT A;  2XGL A;  3FH1 A;  3LTC A;  3PXM A;  1IVW A;  1FGR A;  1NDO B;  3SXX A;  1KD1 4;  1W6C A;  1O7W B;  2I9W A;  1VQ9 3;  1YJN 3;  3VSY A;  5IEO A;  3DGO A;  3HZP A;  4RNY A;  4K1V A;  5KP3 A;  2YFJ B;  1JB2 A;  3ER7 A;  1WTH A;  2Z7A A;  1FGQ A;  1NU3 A;  3EX9 A;  2HMK B;  1NB5 I;  5IG5 A;  5DRE A;  1W5Z A;  3EN1 B;  3PZW A;  3CCE 3;  4FMB A;  2IUJ A;  4WWU C;  1FGM A;  1UUV B;  3QRD A;  5EVH A;  1E3V A;  2CFG A;  2JQ5 A;  3FKA A;  2STD A;  1NJI 4;  3EE1 A;  4TX4 A;  2MF7 A;  1STF I;  4HM5 B;  3CCQ 3;  1A2K A;  4EV5 A;  5I97 A;  1YHQ 3;  3Q90 A;  3EF8 A;  2XGN A;  5IEN A;  1A90 A;  1SII A;  3I0Y A;  4KZ1 A;  3DM8 A;  3B4P A;  3KN4 A;  4L8P A;  1U8C B;  1Q7Y 4;  4XDW A;  1KWI A;  3S29 A;  1SPU A;  3AMO B;  2OTJ 3;  4XM4 A;  5EQL A;  4WYK B;  1PFP A;  4AKY A;  5JPU A;  1K8A 4;  1QAF A;  3F14 A;  1ROV A;  2BMR B;  1Q40 A;  1OF5 B;  3CMA 3;  2WOH A;  3I56 3;  3T8N A;  1IVV A;  1OHP A;  2OOV A;  1N5H A;  1YJW 3;  1JRQ A;  4R1K A;  3IPT A;  1W2B 2;  5AIH A;  1GY7 A;  4FMC A;  3OV4 A;  4ORL A;  1Q81 4;  4HZB B;  3GAX A;  3UNL A;  2P05 A;  4XBT A;  3FF0 A;  2Y73 A;  2F99 A;  3T8U A;  4HKV B;  4HM3 B;  3NQY A;  3GWR A;  1VQL 3;  1W4N A;  4FCJ A;  3JUN A;  3F40 A;  1JN5 B;  2LQV A;  2GEX A;  2FNQ A;  3FSD A;  5LC7 A;  1S5A A;  4AKZ A;  4JF8 A;  5D83 A;  1K73 4;  3GZY B;  2GEY A;  3SX1 A;  2QA4 3;  1KQS 2;  2CK3 H;  4Q53 A;  1D6Y A;  3CCU 3;  2YX9 A;  5AEU B;  1Y4K A;  4XBY A;  1EA2 A;  3MG1 A;  1QVG 2;  3KE7 A;  3FG3 A;  2IA7 A;  2RSX A;  3LTB A;  1OCV A;  1YI2 3;  3CU3 A;  2Z6B A;  3F7S A;  4FCM A;  2W04 A;  2WO0 A;  1JKG B;  1NWW A;  3CCV 3;  3O8Y A;  3HK4 A;  4N3V A;  1IQY A;  3EN8 A;  3DGL A;  4FR9 A;  5IG3 A;  3S67 A;  1O7N B;  3JVC A;  5HGR A;  4HBR A;  1O7M B;  1DVD A;  3CNM A;  5AYR B;  1U5O A;  3EC9 A;  2BMO B;  3F8X A;  1TUH A;  1EQK A;  3HX8 A;  4GL6 A;  2CFK A;  3UJM A;  3MHE A;  3NBJ A;  3S5C A;  4KVH A;  1S72 3;  2LYX A;  3AMO A;  1SJW A;  3WA2 X;  2KCD A;  2CHC A;  2JDI H;  3NBR A;  1A67 A;  4BTX A;  2W9Q A;  3EB8 A;  3FGY A;  3PCR A;  3WMD A;  3BNC A;  4MMY B;  3CCJ 3;  3STD A;  3DGM A;  1K9M 4;  3BND A;  1US1 A;  2BT3 A;  3BNE A;  5FGO A;  3MG2 A;  2K0M A;  3HII A;  3NX0 A;  1K41 A;  1G96 A;  4IT7 A;  3DY5 A;  1IT8 A;  2PZV A;  3BB9 A;  3T0U A;  1GS3 A;  2XF3 A;  2Z76 A;  3G8Z A;  3LOY A;  1AV4 A;  2XR8 B;  2W2C A;  3X3Z A;  1R4C A;  3X3X A;  4MMX B;  2OOV C;  2CG0 A;  4LZI A;  1DMN A;  2INX A;  4HJL B;  1IQ8 A;  6STD A;  3G0K A;  1STD A;  2B24 B;  3N8B A;  1ULJ B;  4OUQ A;  3DZL A;  3KSP A;  4PEJ A;  3B7C A;  3LT8 A;  1IV9 A;  2E2T A;  4MMZ B;  3IJE B;  3V98 A;  1GD3 A;  3KZT A;  1EKM A;  2CFW A;  2UX0 A;  2D1W A;  5CF1 A;  2A15 A;  1CEW I;  3ECF A;  4JRF A;  5LC6 A;  1OGZ A;  4GB5 A;  1VQ6 3;  4O8S A;  3X40 A;  1O7H B;  2XFT A;  3CCL 3;  3NHX A;  5STD A;  1HU9 A;  5AIG A;  5D82 A;  4X2H A;  4R9K A;  1GYB A;  5IG4 A;  4HZ9 B;  4FMD A;  3OXA A;  5CF2 A;  3DXO A;  2W56 A;  3CCS 3;  3JUP A;  2XH9 A;  3CPO A;  3H3H A;  3CC4 3;  1OHS A;  5IER A;  2C11 A;  3EQQ B;  1UI7 A;  3WA3 A;  1F8N A;  4K1U A;  3VF1 A;  1W6G A;  3ROB A;  3WOF B;  4N6L A;  1VQP 3;  1BUQ A;  2CWV A;  3J7Y d;  1QVF 2;  1WNH A;  1Q86 4;  1MOL A;  1N5P A;  1W7C A;  4OK0 A;  1WQL B;  2WGQ A;  2XFS A;  1ASK A;  4K61 A;  1J2B A;  1E97 A;  1RJO A;  5AI1 A;  2KXG A;  2QIY A;  3FG1 A;  3GRD A;  4OVM A;  2O9U X;  3NV0 A;  1RRL A;  2W03 A;  1D6U A;  4O02 B;  2OQE A;  1JKG A;  3RGR A;  1TU5 A;  2HMO B;  4HM2 B;  1IVX A;  1IT7 A;  1EG9 B;  1TFO A;  2RGQ A;  2CWT A;  2RCD A;  4FCZ A;  4R4K A;  3D9R A;  3NBB A;  1N9E A;  1D6Z A;  4HYZ A;  3LTD A;  4O2H A;  8CHO A;  3G4S 3;  5EEO A;  2ML5 A;  2WGO A;  1QAL A;  4HVN A;  3X41 A;  3F7X A;  4N6N B;  1AR0 A;  4LEH A;  3TDG A;  4MJD A;  4G1M B;  3EJV A;  3LT9 A;  2IMJ A;  4U13 A;  3X42 A;  4WYK A;  1IK3 A;  1VQ8 3;  5KP4 A;  4N6O B;  1GD4 A;  3UB1 A;  2HMN B;  1GY6 A;  3UL6 A;  1O7G B;  2HMM B;  2Q07 A;  2QGU A;  3JUO A;  1TFK A;  1CQS A;  3VGN A;  4J9A A;  3LYG A;  3U1W A;  4CCV A;  3SOY A;  2GBX B;  3EBY A;  3EHC A;  3Q1C A;  2W9P A;  1JB4 A;  2OWP A;  3MPH A;  3QK9 A;  4N6V 0;  5AII A;  3E99 A;  3S27 A;  2CWU A;  3CME 3;  2FGT A;  1N8Q A;  2CC3 A;  4EYC A;  3NXJ A;  5CK6 A;  3V92 A;  3DMC A;  5AIF A;  4BTY A;  2CKF B;  3N54 B;  1ZX2 A;  4R9L A;  1QAK A;  4X2O A;  1DVC A;  3RGA A;  3F8H A;  2BNG A;  2GBW B;  3CPW 2;  1YGE A;  1DMQ A;  3GZX B;  2GU1 A;  1RN7 A;  1Q40 B;  4NRE A;  4O3V A;  3NM7 A;  3OW2 2;  1DYU A;  4STD A;  5AEW B;  1VQ7 3;  3CD6 3;  3SOA A;  3EBT A;  4L8O A;  1W02 A;  4WHA A;  2OTL 3;  1CYU A;  4KFE A;  3H51 A;  3ALA A;  3KKG A;  4BTW A;  1QJG A;  3OX9 A;  4N6T A;  2QEX 3;  4KFF A;  3K9M C;  1IQX A;  3UL5 A;  3PGB A;  4NHF A;  4AEQ A;  4K90 B;  1LXE A;  3NQZ A;  1O7P B;  2M7O A;  2D42 A;  3MG3 A;  1ROA A;  3L0R A;  4MEI A;  5JBS A;  3S28 A;  2RFR A;  3MWZ A;  4EC6 A;  2BMQ B;  2W0Q A;  3IMA B;  3SVA A;  3M8C A;  1YIJ 3;  2HMJ B;  4WFO A;  2O3O A;  2CG1 A;  4HM1 B;  1WMO A;  2XEP A;  4HM0 B;  2B1X B;  3GZB A;  1UUW B;  4CDL A;  1GY5 A;  4QWT A;  4IPB A;  2E2V A;  1OPY A;  3FZW A;  4H61 A;  3KII A;  4N6M A;  3HIG A;  3PCS A;  2CW9 A;  3K5T A;  4RBN A;  2P0M A;  1OF5 A;  5FW5 A;  3WDG B;  1IV7 A;  1ULI B;  4R80 A;  1FGT A;  5A0O B;  1N9J A;  1OUN A;  4RNZ A;  1W6Y A;  2Z77 A;  3RDE A;  1W01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...