2R4OA

Crystal structure of the long-chain fatty acid transporter fadl mutant delta npa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
421
structure length
421
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRGGGLITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
total genus 102
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4oA00
2R8AA 2R4PA 3PGUA 3DWOX 2R4OA 3BRZA 3PGSA 1T1LA 1T16A 3DWNA 2R4NA 2R88A 3BRYA 3PF1A 2R89A 3PGRA 3BS0A 2R4LA
chains in the Genus database with same CATH superfamily
2K4TA 3C5OA 3BRZA 4F4BA 2PRNA 4FSOA 1T16A 2ZLDA 1GFMA 1E54A 3AAEB 3VE2A 3WI5A 4UB8O 5PRNA 2XE1A 4LSEA 2XE3A 4LSFA 3DWNA 4N75A 3PF1A 5G38A 2GE4A 2N2LA 5GTHO 3HOEA 2LFUA 3LK2B 4JFBA 2F1CX 5EE2A 3AA0A 3UAQA 1T1LA 3SYSA 3PGRA 5AFUL 3AA7B 4D65A 1YS5A 5DL8A 1ZHXA 1BXWA 4KRAA 3UPGA 1OSMA 1ZHTA 1QJ9A 3A0HO 3AAAB 4G75A 4U9CA 2IWVA 3LK42 4PR7A 5TISO 5IYUA 4C4VB 2W81C 5G3AA 2XMXA 1ZHZA 4D5UA 5JDPA 2PORA 1G90A 4FZMA 4FT6A 2OMFA 3AAEA 1GFPA 4FUVA 4GCPA 4GCSA 4C4VA 4AYMC 2J4UP 4XNKA 4Z3TA 4RLCA 5AFUK 1HXXA 5H2FO 4FRXA 4K3CA 2ZFGA 5ADXL 1BT9A 3KVDD 1MM4A 2F1VA 2N2MA 4FQEA 4FZLA 4O3XB 4O3YA 2X9KA 4N74A 3SZVA 3HW9A 4GF4A 2F1TA 2ERVA 3AA0B 3JTYA 4RJWA 5GTIO 5ADXK 2FGRA 4AYID 3V8UA 3POUA 3HOLA 2ODJA 5KAIO 4AFKA 5T5FA 3VZWX 3BS0A 3PORA 6PRNA 1MM5A 4O4XA 4GHBA 2R88A 2XE2A 2MHLA 1ZHYA 2XTQA 5KAFO 2KXPA 4FZNA 3T0SA 5E79O 1IZNB 3G7GA 3JCUO 2R4OA 4PJ0O 3DA4A 2KZ7B 2W80C 4O3ZA 4E1SA 3A2SX 4C69X 4UB6O 5B5EO 2KXPB 2X27X 2Y7SA 3AA6B 3UU2A 3LK2A 4FSPA 2WJQA 3SZDA 3QRCA 2M06A 3T24A 3SYBA 2WVPA 3RBHA 1GFNA 3K19A 4O49A 4RJXA 2Y0LA 1HXUA 1QJ8A 3FYXA 4N59A 1GFOA 2Y0HA 5D5DA 5G26A 2XG6A 2XTRA 2R4PA 3DZMA 2YPVA 3HWBA 2JMMA 3AA1B 3O0EA 3PGUA 4B61A 1MPFA 4N58A 2LHFA 3BRYA 3POQA 4O4UA 4G76A 3VZUX 3LK3B 3T20A 3DWOX 2R8AA 3NJTA 2XE5A 2KC0A 5FVNA 2FGQX 2IWWA 4K3BA 1ZHWA 2R4NA 4AYEC 5B66O 1Q9GA 4AKRA 4AKMA 3VY8X 2Y2XA 1P4TA 3PQSA 1QJPA 3GP6A 3AA6A 2WJRA 2R4LA 3QRAA 4D64A 1HXTA 1GFQA 1ORMA 1BH3A 4AKRB 2O4VA 3SY9A 3A0BO 3POXA 4GCQA 3EMNX 1IZNA 4XNLA 3LK41 5G39A 3WI4A 4FMSA 7PRNA 3PGSA 4FESA 4AZLA 3VZTX 2J1NA 4BUMX 2KDYA 2R89A 3WU2O 2M07A 2YNKA 3AA1A 4LSIA 1H6S1 3PRNA 1PHOA 2K0LA 4AUIA 4AYNA 4C00A 1OPFA 4CTDA 3AA7A 8PRNA 4RL9A 4LSHA 3NSGA 2AXTO 3SY7A 1THQA 3AAAA 4QQ1A 1Q9FA 2JQYA 3VE1A 1S5LO 3PQUA 2MNHA 4FRTA 3TZGA 4KR8A 2QTKA 4IL6O 5DL7A 4AYDC 4PUXA 4FOZA 4JCHA 3DA3A 4KR4A 4E1TA 5GV0A 2KZ7A 3KZIO 4RLBA 5DL6A 5DL5A 3VY9X 3LK3A 2Y0KA 4O3WA 1PRNA
chains in the Genus database with same CATH topology
2R8AA 2R4PA 3PGUA 3DWOX 2R4OA 3BRZA 3PGSA 1T1LA 1T16A 3DWNA 2R4NA 2R88A 3BRYA 3PF1A 2R89A 3PGRA 3BS0A 2R4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8A A;  2R4P A;  3PGU A;  3DWO X;  2R4O A;  3BRZ A;  3PGS A;  1T1L A;  1T16 A;  3DWN A;  2R4N A;  2R88 A;  3BRY A;  3PF1 A;  2R89 A;  3PGR A;  3BS0 A;  2R4L A; 
#chains in the Genus database with same CATH topology
 2K4T A;  3C5O A;  3BRZ A;  4F4B A;  2PRN A;  4FSO A;  1T16 A;  2ZLD A;  1GFM A;  1E54 A;  3AAE B;  3VE2 A;  3WI5 A;  4UB8 O;  5PRN A;  2XE1 A;  4LSE A;  2XE3 A;  4LSF A;  3DWN A;  4N75 A;  3PF1 A;  5G38 A;  2GE4 A;  2N2L A;  5GTH O;  3HOE A;  2LFU A;  3LK2 B;  4JFB A;  2F1C X;  5EE2 A;  3AA0 A;  3UAQ A;  1T1L A;  3SYS A;  3PGR A;  5AFU L;  3AA7 B;  4D65 A;  1YS5 A;  5DL8 A;  1ZHX A;  1BXW A;  4KRA A;  3UPG A;  1OSM A;  1ZHT A;  1QJ9 A;  3A0H O;  3AAA B;  4G75 A;  4U9C A;  2IWV A;  3LK4 2;  4PR7 A;  5TIS O;  5IYU A;  4C4V B;  2W81 C;  5G3A A;  2XMX A;  1ZHZ A;  4D5U A;  5JDP A;  2POR A;  1G90 A;  4FZM A;  4FT6 A;  2OMF A;  3AAE A;  1GFP A;  4FUV A;  4GCP A;  4GCS A;  4C4V A;  4AYM C;  2J4U P;  4XNK A;  4Z3T A;  4RLC A;  5AFU K;  1HXX A;  5H2F O;  4FRX A;  4K3C A;  2ZFG A;  5ADX L;  1BT9 A;  3KVD D;  1MM4 A;  2F1V A;  2N2M A;  4FQE A;  4FZL A;  4O3X B;  4O3Y A;  2X9K A;  4N74 A;  3SZV A;  3HW9 A;  4GF4 A;  2F1T A;  2ERV A;  3AA0 B;  3JTY A;  4RJW A;  5GTI O;  5ADX K;  2FGR A;  4AYI D;  3V8U A;  3POU A;  3HOL A;  2ODJ A;  5KAI O;  4AFK A;  5T5F A;  3VZW X;  3BS0 A;  3POR A;  6PRN A;  1MM5 A;  4O4X A;  4GHB A;  2R88 A;  2XE2 A;  2MHL A;  1ZHY A;  2XTQ A;  5KAF O;  2KXP A;  4FZN A;  3T0S A;  5E79 O;  1IZN B;  3G7G A;  3JCU O;  2R4O A;  4PJ0 O;  3DA4 A;  2KZ7 B;  2W80 C;  4O3Z A;  4E1S A;  3A2S X;  4C69 X;  4UB6 O;  5B5E O;  2KXP B;  2X27 X;  2Y7S A;  3AA6 B;  3UU2 A;  3LK2 A;  4FSP A;  2WJQ A;  3SZD A;  3QRC A;  2M06 A;  3T24 A;  3SYB A;  2WVP A;  3RBH A;  1GFN A;  3K19 A;  4O49 A;  4RJX A;  2Y0L A;  1HXU A;  1QJ8 A;  3FYX A;  4N59 A;  1GFO A;  2Y0H A;  5D5D A;  5G26 A;  2XG6 A;  2XTR A;  2R4P A;  3DZM A;  2YPV A;  3HWB A;  2JMM A;  3AA1 B;  3O0E A;  3PGU A;  4B61 A;  1MPF A;  4N58 A;  2LHF A;  3BRY A;  3POQ A;  4O4U A;  4G76 A;  3VZU X;  3LK3 B;  3T20 A;  3DWO X;  2R8A A;  3NJT A;  2XE5 A;  2KC0 A;  5FVN A;  2FGQ X;  2IWW A;  4K3B A;  1ZHW A;  2R4N A;  4AYE C;  5B66 O;  1Q9G A;  4AKR A;  4AKM A;  3VY8 X;  2Y2X A;  1P4T A;  3PQS A;  1QJP A;  3GP6 A;  3AA6 A;  2WJR A;  2R4L A;  3QRA A;  4D64 A;  1HXT A;  1GFQ A;  1ORM A;  1BH3 A;  4AKR B;  2O4V A;  3SY9 A;  3A0B O;  3POX A;  4GCQ A;  3EMN X;  1IZN A;  4XNL A;  3LK4 1;  5G39 A;  3WI4 A;  4FMS A;  7PRN A;  3PGS A;  4FES A;  4AZL A;  3VZT X;  2J1N A;  4BUM X;  2KDY A;  2R89 A;  3WU2 O;  2M07 A;  2YNK A;  3AA1 A;  4LSI A;  1H6S 1;  3PRN A;  1PHO A;  2K0L A;  4AUI A;  4AYN A;  4C00 A;  1OPF A;  4CTD A;  3AA7 A;  8PRN A;  4RL9 A;  4LSH A;  3NSG A;  2AXT O;  3SY7 A;  1THQ A;  3AAA A;  4QQ1 A;  1Q9F A;  2JQY A;  3VE1 A;  1S5L O;  3PQU A;  2MNH A;  4FRT A;  3TZG A;  4KR8 A;  2QTK A;  4IL6 O;  5DL7 A;  4AYD C;  4PUX A;  4FOZ A;  4JCH A;  3DA3 A;  4KR4 A;  4E1T A;  5GV0 A;  2KZ7 A;  3KZI O;  4RLB A;  5DL6 A;  5DL5 A;  3VY9 X;  3LK3 A;  2Y0K A;  4O3W A;  1PRN A; 
#chains in the Genus database with same CATH homology
 2R8A A;  2R4P A;  3PGU A;  3DWO X;  2R4O A;  3BRZ A;  3PGS A;  1T1L A;  1T16 A;  3DWN A;  2R4N A;  2R88 A;  3BRY A;  3PF1 A;  2R89 A;  3PGR A;  3BS0 A;  2R4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...