2R4OA

Crystal structure of the long-chain fatty acid transporter fadl mutant delta npa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
421
structure length
421
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRGGGLITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 102
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4oA00
3PGSA 3PGUA 3BS0A 3DWNA 2R89A 1T16A 2R4NA 1T1LA 3BRYA 2R4LA 3BRZA 2R8AA 3DWOX 3PGRA 2R4OA 3PF1A 2R4PA 2R88A
chains in the Genus database with same CATH superfamily
1BT9A 1ZHWA 1HXXA 3SZVA 4D64A 4XNLA 5ADXK 4E1SA 4FMSA 3DZMA 2PRNA 2M06A 3BRZA 2MHLA 3NJTA 3PF1A 3PQSA 4O3ZA 4LSHA 5DL6A 1GFOA 2W80C 2XMXA 2N2LA 1Q9GA 2Y2XA 1HXTA 3PQUA 5G3AA 2MNHA 5PRNA 2GE4A 2XE3A 2KXPB 4O3WA 2F1VA 3PGUA 4N75A 4RJWA 3HOLA 5G39A 1OSMA 4AKRA 8PRNA 2XE5A 5GV0A 1Q9FA 1GFQA 1T1LA 2KXPA 3DWOX 3LK2B 2R4OA 4N58A 2R4PA 4LSEA 4XNKA 4RJXA 4Z3TA 1ZHYA 5AFUK 3QRAA 4U9CA 1ZHZA 1QJ9A 3LK2A 2ZFGA 3POXA 2QTKA 1IZNB 2ERVA 2YPVA 2XTRA 3SYBA 4IL6O 4N74A 1YS5A 3WU2O 2K0LA 2F1CX 3PGRA 4FOZA 1MM5A 1GFNA 3POQA 4G75A 3T20A 3A0HO 2XG6A 1HXUA 2JQYA 1IZNA 1ORMA 4CTDA 4RLCA 2FGRA 3DWNA 4GHBA 4LSFA 1BH3A 3TZGA 4AZLA 2Y0KA 3JTYA 4C4VB 1MM4A 1PHOA 2WJRA 3T24A 3LK41 4UB6O 4GCSA 3SY7A 5DL5A 4C4VA 3K19A 3VZWX 2AXTO 3C5OA 4FT6A 4BUMX 3VZUX 4AYDC 5JDPA 3QRCA 1QJPA 3RBHA 3UU2A 4AYMC 1P4TA 1BXWA 4QQ1A 3HOEA 2WJQA 4GCPA 2W81C 4FZNA 4O49A 4O4UA 4K3BA 4PJ0O 5G26A 4AYEC 3KZIO 1MPFA 2Y0HA 2ZLDA 3T0SA 2IWWA 3SZDA 3HW9A 2YNKA 5GTHO 4AYID 5KAFO 4GF4A 3KVDD 2M07A 4KR4A 1PRNA 4K3CA 2J4UP 3A0BO 3FYXA 5D5DA 4KRAA 3LK42 3VE2A 2XTQA 2PORA 2XE2A 5EE2A 5T5FA 3WI4A 3WI5A 4UB8O 2R88A 4G76A 2J1NA 3A2SX 3GP6A 5TISO 3AAAB 4N59A 6PRNA 3NSGA 4RL9A 4RLBA 2LHFA 4C69X 2KDYA 2KZ7B 3G7GA 3AAAA 3O0EA 4B61A 3AAEB 3AA0B 4AUIA 2KZ7A 2R4NA 2X9KA 3BRYA 1ZHTA 4FQEA 2R8AA 4PUXA 3VY8X 5B5EO 4JCHA 4FRXA 3AAEA 4E1TA 3AA0A 3V8UA 5KAIO 2F1TA 2OMFA 1G90A 5ADXL 1GFPA 3PRNA 4AKMA 2XE1A 3SYSA 3EMNX 1E54A 1THQA 1H6S1 3VY9X 3HWBA 1ZHXA 3LK3B 4GCQA 4KR8A 4O3XB 3AA6B 4LSIA 5H2FO 4F4BA 3VE1A 2K4TA 2FGQX 2JMMA 4FZMA 4AFKA 3AA1B 5DL8A 4D5UA 2LFUA 3LK3A 3POUA 3AA6A 3DA4A 1OPFA 1QJ8A 3SY9A 3VZTX 4AYNA 4AKRB 7PRNA 5G38A 5E79O 3AA1A 2R89A 4PR7A 5GTIO 1GFMA 2R4LA 4FZLA 4JFBA 4FSOA 3DA3A 5AFUL 2KC0A 2WVPA 4C00A 4D65A 2X27X 4FUVA 2Y7SA 3PORA 4O3YA 3AA7B 3UAQA 3UPGA 5B66O 3JCUO 2IWVA 2N2MA 3PGSA 4FESA 5DL7A 2O4VA 5IYUA 4FRTA 3AA7A 5FVNA 1S5LO 1T16A 2ODJA 4FSPA 2Y0LA 4O4XA 3BS0A
chains in the Genus database with same CATH topology
3PGSA 3PGUA 3BS0A 3DWNA 2R89A 1T16A 2R4NA 1T1LA 3BRYA 2R4LA 3BRZA 2R8AA 3DWOX 3PGRA 2R4OA 3PF1A 2R4PA 2R88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGS A;  3PGU A;  3BS0 A;  3DWN A;  2R89 A;  1T16 A;  2R4N A;  1T1L A;  3BRY A;  2R4L A;  3BRZ A;  2R8A A;  3DWO X;  3PGR A;  2R4O A;  3PF1 A;  2R4P A;  2R88 A; 
#chains in the Genus database with same CATH topology
 1BT9 A;  1ZHW A;  1HXX A;  3SZV A;  4D64 A;  4XNL A;  5ADX K;  4E1S A;  4FMS A;  3DZM A;  2PRN A;  2M06 A;  3BRZ A;  2MHL A;  3NJT A;  3PF1 A;  3PQS A;  4O3Z A;  4LSH A;  5DL6 A;  1GFO A;  2W80 C;  2XMX A;  2N2L A;  1Q9G A;  2Y2X A;  1HXT A;  3PQU A;  5G3A A;  2MNH A;  5PRN A;  2GE4 A;  2XE3 A;  2KXP B;  4O3W A;  2F1V A;  3PGU A;  4N75 A;  4RJW A;  3HOL A;  5G39 A;  1OSM A;  4AKR A;  8PRN A;  2XE5 A;  5GV0 A;  1Q9F A;  1GFQ A;  1T1L A;  2KXP A;  3DWO X;  3LK2 B;  2R4O A;  4N58 A;  2R4P A;  4LSE A;  4XNK A;  4RJX A;  4Z3T A;  1ZHY A;  5AFU K;  3QRA A;  4U9C A;  1ZHZ A;  1QJ9 A;  3LK2 A;  2ZFG A;  3POX A;  2QTK A;  1IZN B;  2ERV A;  2YPV A;  2XTR A;  3SYB A;  4IL6 O;  4N74 A;  1YS5 A;  3WU2 O;  2K0L A;  2F1C X;  3PGR A;  4FOZ A;  1MM5 A;  1GFN A;  3POQ A;  4G75 A;  3T20 A;  3A0H O;  2XG6 A;  1HXU A;  2JQY A;  1IZN A;  1ORM A;  4CTD A;  4RLC A;  2FGR A;  3DWN A;  4GHB A;  4LSF A;  1BH3 A;  3TZG A;  4AZL A;  2Y0K A;  3JTY A;  4C4V B;  1MM4 A;  1PHO A;  2WJR A;  3T24 A;  3LK4 1;  4UB6 O;  4GCS A;  3SY7 A;  5DL5 A;  4C4V A;  3K19 A;  3VZW X;  2AXT O;  3C5O A;  4FT6 A;  4BUM X;  3VZU X;  4AYD C;  5JDP A;  3QRC A;  1QJP A;  3RBH A;  3UU2 A;  4AYM C;  1P4T A;  1BXW A;  4QQ1 A;  3HOE A;  2WJQ A;  4GCP A;  2W81 C;  4FZN A;  4O49 A;  4O4U A;  4K3B A;  4PJ0 O;  5G26 A;  4AYE C;  3KZI O;  1MPF A;  2Y0H A;  2ZLD A;  3T0S A;  2IWW A;  3SZD A;  3HW9 A;  2YNK A;  5GTH O;  4AYI D;  5KAF O;  4GF4 A;  3KVD D;  2M07 A;  4KR4 A;  1PRN A;  4K3C A;  2J4U P;  3A0B O;  3FYX A;  5D5D A;  4KRA A;  3LK4 2;  3VE2 A;  2XTQ A;  2POR A;  2XE2 A;  5EE2 A;  5T5F A;  3WI4 A;  3WI5 A;  4UB8 O;  2R88 A;  4G76 A;  2J1N A;  3A2S X;  3GP6 A;  5TIS O;  3AAA B;  4N59 A;  6PRN A;  3NSG A;  4RL9 A;  4RLB A;  2LHF A;  4C69 X;  2KDY A;  2KZ7 B;  3G7G A;  3AAA A;  3O0E A;  4B61 A;  3AAE B;  3AA0 B;  4AUI A;  2KZ7 A;  2R4N A;  2X9K A;  3BRY A;  1ZHT A;  4FQE A;  2R8A A;  4PUX A;  3VY8 X;  5B5E O;  4JCH A;  4FRX A;  3AAE A;  4E1T A;  3AA0 A;  3V8U A;  5KAI O;  2F1T A;  2OMF A;  1G90 A;  5ADX L;  1GFP A;  3PRN A;  4AKM A;  2XE1 A;  3SYS A;  3EMN X;  1E54 A;  1THQ A;  1H6S 1;  3VY9 X;  3HWB A;  1ZHX A;  3LK3 B;  4GCQ A;  4KR8 A;  4O3X B;  3AA6 B;  4LSI A;  5H2F O;  4F4B A;  3VE1 A;  2K4T A;  2FGQ X;  2JMM A;  4FZM A;  4AFK A;  3AA1 B;  5DL8 A;  4D5U A;  2LFU A;  3LK3 A;  3POU A;  3AA6 A;  3DA4 A;  1OPF A;  1QJ8 A;  3SY9 A;  3VZT X;  4AYN A;  4AKR B;  7PRN A;  5G38 A;  5E79 O;  3AA1 A;  2R89 A;  4PR7 A;  5GTI O;  1GFM A;  2R4L A;  4FZL A;  4JFB A;  4FSO A;  3DA3 A;  5AFU L;  2KC0 A;  2WVP A;  4C00 A;  4D65 A;  2X27 X;  4FUV A;  2Y7S A;  3POR A;  4O3Y A;  3AA7 B;  3UAQ A;  3UPG A;  5B66 O;  3JCU O;  2IWV A;  2N2M A;  3PGS A;  4FES A;  5DL7 A;  2O4V A;  5IYU A;  4FRT A;  3AA7 A;  5FVN A;  1S5L O;  1T16 A;  2ODJ A;  4FSP A;  2Y0L A;  4O4X A;  3BS0 A; 
#chains in the Genus database with same CATH homology
 3PGS A;  3PGU A;  3BS0 A;  3DWN A;  2R89 A;  1T16 A;  2R4N A;  1T1L A;  3BRY A;  2R4L A;  3BRZ A;  2R8A A;  3DWO X;  3PGR A;  2R4O A;  3PF1 A;  2R4P A;  2R88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...