2R4OA

Crystal structure of the long-chain fatty acid transporter fadl mutant delta npa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
421
structure length
421
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRGGGLITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
total genus 102
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4oA00
2R89A 3PF1A 3PGRA 2R4NA 2R88A 3PGUA 1T16A 3BS0A 2R4LA 2R4OA 1T1LA 3PGSA 3BRYA 3DWOX 3BRZA 2R4PA 3DWNA 2R8AA
chains in the Genus database with same CATH superfamily
3HW9A 2X9KA 1QJPA 3PQSA 2GE4A 5KAFO 3SYBA 5ADXL 3HOLA 4U9CA 5FVNA 2K4TA 4N59A 4KR4A 4CTDA 2R8AA 3LK2B 8PRNA 3A0BO 2PRNA 3T20A 4C4VB 4K3CA 4GCPA 4RLBA 1BXWA 5AFUL 4GHBA 3K19A 4FZLA 2R4NA 4O3YA 5D5DA 1GFPA 1T16A 1ZHWA 2YNKA 3VZTX 4N58A 1ORMA 3VE2A 1G90A 3PQUA 2XE2A 3DWOX 2AXTO 4C00A 3DWNA 5DL5A 3UPGA 1Q9GA 3HWBA 5KAIO 1IZNB 1S5LO 3JCUO 3LK41 4FRTA 1GFQA 3BS0A 3SY7A 3AA0B 5AFUK 4FOZA 2R4OA 1T1LA 5B5EO 4FMSA 3SZDA 2KZ7B 3LK3A 4LSFA 2XE3A 2KXPA 2XMXA 4FZMA 4FUVA 3C5OA 4IL6O 4AZLA 5GTHO 4FRXA 4D64A 1QJ8A 2Y0LA 4AYEC 5B66O 1IZNA 2J4UP 4JFBA 1HXTA 1E54A 2JQYA 5E79O 4KR8A 3PF1A 4C4VA 3V8UA 3NSGA 3AA1A 4G75A 2ZFGA 4XNKA 3LK42 5GV0A 3AAAA 3WI5A 4G76A 2R4PA 3GP6A 4AYNA 1PRNA 1HXXA 3WI4A 4XNLA 2W81C 2YPVA 1YS5A 3WU2O 1ZHTA 3AAEB 4O3XB 1MM5A 2XTRA 3AA6A 3POQA 4RL9A 3G7GA 4UB8O 4K3BA 4AYID 2K0LA 3DZMA 1HXUA 3KVDD 4O4UA 4PJ0O 4BUMX 4E1SA 1OSMA 2XE1A 3KZIO 5IYUA 2X27X 2Y0KA 4RJXA 3JTYA 4LSEA 4GCSA 2LHFA 4AKRA 4AKRB 2FGQX 3VY9X 4AUIA 4C69X 2F1CX 3PGRA 5G26A 2LFUA 2FGRA 2MHLA 3UAQA 7PRNA 1MPFA 2XG6A 2Y7SA 3SY9A 4D65A 3DA4A 4F4BA 5EE2A 5T5FA 4D5UA 3AA7A 3AA1B 1PHOA 4N75A 1OPFA 4FQEA 4FSPA 3PGSA 3QRCA 1ZHXA 4O4XA 5DL6A 1BT9A 2KC0A 1GFOA 1THQA 2W80C 5DL7A 3SYSA 4FT6A 3VE1A 2XE5A 3VZWX 2KXPB 3AA6B 1ZHYA 2IWVA 3A2SX 1H6S1 2OMFA 2KDYA 2R4LA 2F1TA 3AAEA 3LK3B 3FYXA 3POUA 3AA0A 2F1VA 4FSOA 2O4VA 3QRAA 4RLCA 4AKMA 3PRNA 5TISO 4KRAA 3VZUX 2WJRA 2Y2XA 3T24A 5PRNA 4AFKA 2N2MA 1Q9FA 2M06A 2ODJA 3AA7B 4GCQA 3AAAB 2J1NA 3BRZA 4LSIA 1BH3A 3T0SA 4Z3TA 5DL8A 2ZLDA 5G39A 4AYMC 2IWWA 4UB6O 3A0HO 4O3WA 3SZVA 3POXA 1GFMA 1P4TA 3TZGA 4AYDC 4RJWA 5G38A 4B61A 4GF4A 1GFNA 1QJ9A 2MNHA 2PORA 2R88A 2QTKA 3LK2A 2KZ7A 3O0EA 1ZHZA 5G3AA 2WJQA 4LSHA 2ERVA 2M07A 2N2LA 1MM4A 5H2FO 6PRNA 4QQ1A 3DA3A 2R89A 2XTQA 3UU2A 3PGUA 3VY8X 4PR7A 4N74A 3NJTA 5JDPA 2JMMA 2Y0HA 4O3ZA 4E1TA 2WVPA 3BRYA 3HOEA 3EMNX 4FZNA 4PUXA 5ADXK 4O49A 4JCHA 3RBHA 3PORA 4FESA 5GTIO
chains in the Genus database with same CATH topology
2R89A 3PF1A 3PGRA 2R4NA 2R88A 3PGUA 1T16A 3BS0A 2R4LA 2R4OA 1T1LA 3PGSA 3BRYA 3DWOX 3BRZA 2R4PA 3DWNA 2R8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R89 A;  3PF1 A;  3PGR A;  2R4N A;  2R88 A;  3PGU A;  1T16 A;  3BS0 A;  2R4L A;  2R4O A;  1T1L A;  3PGS A;  3BRY A;  3DWO X;  3BRZ A;  2R4P A;  3DWN A;  2R8A A; 
#chains in the Genus database with same CATH topology
 3HW9 A;  2X9K A;  1QJP A;  3PQS A;  2GE4 A;  5KAF O;  3SYB A;  5ADX L;  3HOL A;  4U9C A;  5FVN A;  2K4T A;  4N59 A;  4KR4 A;  4CTD A;  2R8A A;  3LK2 B;  8PRN A;  3A0B O;  2PRN A;  3T20 A;  4C4V B;  4K3C A;  4GCP A;  4RLB A;  1BXW A;  5AFU L;  4GHB A;  3K19 A;  4FZL A;  2R4N A;  4O3Y A;  5D5D A;  1GFP A;  1T16 A;  1ZHW A;  2YNK A;  3VZT X;  4N58 A;  1ORM A;  3VE2 A;  1G90 A;  3PQU A;  2XE2 A;  3DWO X;  2AXT O;  4C00 A;  3DWN A;  5DL5 A;  3UPG A;  1Q9G A;  3HWB A;  5KAI O;  1IZN B;  1S5L O;  3JCU O;  3LK4 1;  4FRT A;  1GFQ A;  3BS0 A;  3SY7 A;  3AA0 B;  5AFU K;  4FOZ A;  2R4O A;  1T1L A;  5B5E O;  4FMS A;  3SZD A;  2KZ7 B;  3LK3 A;  4LSF A;  2XE3 A;  2KXP A;  2XMX A;  4FZM A;  4FUV A;  3C5O A;  4IL6 O;  4AZL A;  5GTH O;  4FRX A;  4D64 A;  1QJ8 A;  2Y0L A;  4AYE C;  5B66 O;  1IZN A;  2J4U P;  4JFB A;  1HXT A;  1E54 A;  2JQY A;  5E79 O;  4KR8 A;  3PF1 A;  4C4V A;  3V8U A;  3NSG A;  3AA1 A;  4G75 A;  2ZFG A;  4XNK A;  3LK4 2;  5GV0 A;  3AAA A;  3WI5 A;  4G76 A;  2R4P A;  3GP6 A;  4AYN A;  1PRN A;  1HXX A;  3WI4 A;  4XNL A;  2W81 C;  2YPV A;  1YS5 A;  3WU2 O;  1ZHT A;  3AAE B;  4O3X B;  1MM5 A;  2XTR A;  3AA6 A;  3POQ A;  4RL9 A;  3G7G A;  4UB8 O;  4K3B A;  4AYI D;  2K0L A;  3DZM A;  1HXU A;  3KVD D;  4O4U A;  4PJ0 O;  4BUM X;  4E1S A;  1OSM A;  2XE1 A;  3KZI O;  5IYU A;  2X27 X;  2Y0K A;  4RJX A;  3JTY A;  4LSE A;  4GCS A;  2LHF A;  4AKR A;  4AKR B;  2FGQ X;  3VY9 X;  4AUI A;  4C69 X;  2F1C X;  3PGR A;  5G26 A;  2LFU A;  2FGR A;  2MHL A;  3UAQ A;  7PRN A;  1MPF A;  2XG6 A;  2Y7S A;  3SY9 A;  4D65 A;  3DA4 A;  4F4B A;  5EE2 A;  5T5F A;  4D5U A;  3AA7 A;  3AA1 B;  1PHO A;  4N75 A;  1OPF A;  4FQE A;  4FSP A;  3PGS A;  3QRC A;  1ZHX A;  4O4X A;  5DL6 A;  1BT9 A;  2KC0 A;  1GFO A;  1THQ A;  2W80 C;  5DL7 A;  3SYS A;  4FT6 A;  3VE1 A;  2XE5 A;  3VZW X;  2KXP B;  3AA6 B;  1ZHY A;  2IWV A;  3A2S X;  1H6S 1;  2OMF A;  2KDY A;  2R4L A;  2F1T A;  3AAE A;  3LK3 B;  3FYX A;  3POU A;  3AA0 A;  2F1V A;  4FSO A;  2O4V A;  3QRA A;  4RLC A;  4AKM A;  3PRN A;  5TIS O;  4KRA A;  3VZU X;  2WJR A;  2Y2X A;  3T24 A;  5PRN A;  4AFK A;  2N2M A;  1Q9F A;  2M06 A;  2ODJ A;  3AA7 B;  4GCQ A;  3AAA B;  2J1N A;  3BRZ A;  4LSI A;  1BH3 A;  3T0S A;  4Z3T A;  5DL8 A;  2ZLD A;  5G39 A;  4AYM C;  2IWW A;  4UB6 O;  3A0H O;  4O3W A;  3SZV A;  3POX A;  1GFM A;  1P4T A;  3TZG A;  4AYD C;  4RJW A;  5G38 A;  4B61 A;  4GF4 A;  1GFN A;  1QJ9 A;  2MNH A;  2POR A;  2R88 A;  2QTK A;  3LK2 A;  2KZ7 A;  3O0E A;  1ZHZ A;  5G3A A;  2WJQ A;  4LSH A;  2ERV A;  2M07 A;  2N2L A;  1MM4 A;  5H2F O;  6PRN A;  4QQ1 A;  3DA3 A;  2R89 A;  2XTQ A;  3UU2 A;  3PGU A;  3VY8 X;  4PR7 A;  4N74 A;  3NJT A;  5JDP A;  2JMM A;  2Y0H A;  4O3Z A;  4E1T A;  2WVP A;  3BRY A;  3HOE A;  3EMN X;  4FZN A;  4PUX A;  5ADX K;  4O49 A;  4JCH A;  3RBH A;  3POR A;  4FES A;  5GTI O; 
#chains in the Genus database with same CATH homology
 2R89 A;  3PF1 A;  3PGR A;  2R4N A;  2R88 A;  3PGU A;  1T16 A;  3BS0 A;  2R4L A;  2R4O A;  1T1L A;  3PGS A;  3BRY A;  3DWO X;  3BRZ A;  2R4P A;  3DWN A;  2R8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...