2R4OA

Crystal structure of the long-chain fatty acid transporter fadl mutant delta npa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
421
structure length
421
Chain Sequence
b'AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRGGGLITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 102
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4oA00
2R89A 3BS0A 3DWOX 1T1LA 3PGUA 2R8AA 3BRZA 3PGRA 3PF1A 3BRYA 3DWNA 3PGSA 2R4OA 2R4LA 1T16A 2R88A 2R4PA 2R4NA
chains in the Genus database with same CATH superfamily
3BS0A 4N58A 5IYUA 2Y0HA 4C00A 2WVPA 3VY8X 3QRCA 4G76A 3LK3B 4RL9A 4C4VA 2X27X 3LK41 5TISO 4JFBA 1ZHTA 3WI5A 3DWOX 4C4VB 2J4UP 5DL7A 1ORMA 2WJQA 1QJ8A 2XE3A 2XTRA 3G7GA 4GCQA 4KR8A 3A0BO 3LK2A 2KDYA 2MNHA 6PRNA 4F4BA 2F1CX 3AA0A 1GFMA 2QTKA 3LK2B 4O3WA 3QRAA 2YPVA 4RLCA 3SZDA 2Y7SA 3TZGA 5AFUL 2XE1A 3NSGA 3T0SA 3AA0B 4IL6O 3EMNX 2PRNA 2MHLA 4XNLA 3UPGA 3DA4A 3SY9A 4B61A 2AXTO 2K4TA 4AUIA 1PHOA 3PRNA 3UU2A 1OSMA 3AA1A 3T20A 4AYEC 4KRAA 1GFNA 4CTDA 2JMMA 4XNKA 3AA1B 3PORA 5EE2A 4D64A 3SZVA 3V8UA 5KAFO 4AZLA 4E1SA 4FZNA 1MM4A 3A0HO 5DL5A 4AKMA 1BH3A 2W80C 4O4XA 1T16A 4PR7A 4Z3TA 5KAIO 8PRNA 3SYSA 4PJ0O 2IWVA 4E1TA 1E54A 1QJPA 3AAAA 4N75A 3PGSA 1S5LO 4KR4A 4LSIA 1ZHYA 5D5DA 5B5EO 1Q9GA 3AAAB 3SY7A 3PGRA 1T1LA 4FSPA 4GCPA 4FOZA 5G38A 2LHFA 5GV0A 2F1TA 4K3BA 3HW9A 2XE5A 1MM5A 3SYBA 2ERVA 5G39A 3DA3A 1IZNA 3JCUO 2LFUA 3PGUA 4FMSA 3PQSA 1G90A 3AA7A 3K19A 3PQUA 1IZNB 4C69X 2XTQA 4AYID 3T24A 2Y0KA 2Y0LA 3AA7B 5DL6A 4GHBA 3VY9X 2JQYA 3UAQA 1BT9A 2W81C 2FGRA 3AAEA 3BRZA 3POXA 2OMFA 4UB6O 5H2FO 1H6S1 4FQEA 3AAEB 2IWWA 2M06A 1YS5A 3HOEA 4LSHA 1HXXA 1MPFA 3KVDD 5PRNA 3RBHA 5JDPA 3BRYA 1Q9FA 2J1NA 3JTYA 4AYNA 2N2MA 2XMXA 1ZHWA 3AA6A 3VE1A 2PORA 2N2LA 3WU2O 2WJRA 2M07A 2ZLDA 3C5OA 4RJWA 3VZWX 3AA6B 3HOLA 5ADXK 2XG6A 4N59A 4GCSA 4AYMC 4LSFA 1ZHXA 2R4LA 3A2SX 4O3ZA 1ZHZA 1QJ9A 2KXPA 4O3XB 4BUMX 3DWNA 2F1VA 4U9CA 5E79O 4GF4A 3LK3A 2KXPB 5FVNA 1GFOA 2Y2XA 2YNKA 3POUA 3O0EA 4FZMA 3VE2A 1P4TA 2KZ7A 3NJTA 4FUVA 5G26A 3VZTX 3DZMA 5AFUK 5ADXL 4JCHA 2O4VA 1PRNA 2R4OA 2KZ7B 4O4UA 3VZUX 2R4PA 2KC0A 2R88A 4RLBA 2R89A 3KZIO 3HWBA 2R8AA 4UB8O 4O3YA 1GFQA 4RJXA 3POQA 1THQA 4FESA 2K0LA 3FYXA 4PUXA 5B66O 2XE2A 2R4NA 3LK42 1OPFA 4K3CA 4AFKA 4FRXA 3PF1A 4D65A 4LSEA 4QQ1A 1GFPA 5GTHO 4FRTA 1BXWA 2ODJA 4FZLA 4G75A 4D5UA 7PRNA 2X9KA 5GTIO 2ZFGA 4AKRA 3GP6A 4AYDC 4N74A 1HXTA 4FSOA 4FT6A 5G3AA 1HXUA 5DL8A 4AKRB 5T5FA 2FGQX 2GE4A 3WI4A 4O49A
chains in the Genus database with same CATH topology
2R89A 3BS0A 3DWOX 1T1LA 3PGUA 2R8AA 3BRZA 3PGRA 3PF1A 3BRYA 3DWNA 3PGSA 2R4OA 2R4LA 1T16A 2R88A 2R4PA 2R4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R89 A;  3BS0 A;  3DWO X;  1T1L A;  3PGU A;  2R8A A;  3BRZ A;  3PGR A;  3PF1 A;  3BRY A;  3DWN A;  3PGS A;  2R4O A;  2R4L A;  1T16 A;  2R88 A;  2R4P A;  2R4N A; 
#chains in the Genus database with same CATH topology
 3BS0 A;  4N58 A;  5IYU A;  2Y0H A;  4C00 A;  2WVP A;  3VY8 X;  3QRC A;  4G76 A;  3LK3 B;  4RL9 A;  4C4V A;  2X27 X;  3LK4 1;  5TIS O;  4JFB A;  1ZHT A;  3WI5 A;  3DWO X;  4C4V B;  2J4U P;  5DL7 A;  1ORM A;  2WJQ A;  1QJ8 A;  2XE3 A;  2XTR A;  3G7G A;  4GCQ A;  4KR8 A;  3A0B O;  3LK2 A;  2KDY A;  2MNH A;  6PRN A;  4F4B A;  2F1C X;  3AA0 A;  1GFM A;  2QTK A;  3LK2 B;  4O3W A;  3QRA A;  2YPV A;  4RLC A;  3SZD A;  2Y7S A;  3TZG A;  5AFU L;  2XE1 A;  3NSG A;  3T0S A;  3AA0 B;  4IL6 O;  3EMN X;  2PRN A;  2MHL A;  4XNL A;  3UPG A;  3DA4 A;  3SY9 A;  4B61 A;  2AXT O;  2K4T A;  4AUI A;  1PHO A;  3PRN A;  3UU2 A;  1OSM A;  3AA1 A;  3T20 A;  4AYE C;  4KRA A;  1GFN A;  4CTD A;  2JMM A;  4XNK A;  3AA1 B;  3POR A;  5EE2 A;  4D64 A;  3SZV A;  3V8U A;  5KAF O;  4AZL A;  4E1S A;  4FZN A;  1MM4 A;  3A0H O;  5DL5 A;  4AKM A;  1BH3 A;  2W80 C;  4O4X A;  1T16 A;  4PR7 A;  4Z3T A;  5KAI O;  8PRN A;  3SYS A;  4PJ0 O;  2IWV A;  4E1T A;  1E54 A;  1QJP A;  3AAA A;  4N75 A;  3PGS A;  1S5L O;  4KR4 A;  4LSI A;  1ZHY A;  5D5D A;  5B5E O;  1Q9G A;  3AAA B;  3SY7 A;  3PGR A;  1T1L A;  4FSP A;  4GCP A;  4FOZ A;  5G38 A;  2LHF A;  5GV0 A;  2F1T A;  4K3B A;  3HW9 A;  2XE5 A;  1MM5 A;  3SYB A;  2ERV A;  5G39 A;  3DA3 A;  1IZN A;  3JCU O;  2LFU A;  3PGU A;  4FMS A;  3PQS A;  1G90 A;  3AA7 A;  3K19 A;  3PQU A;  1IZN B;  4C69 X;  2XTQ A;  4AYI D;  3T24 A;  2Y0K A;  2Y0L A;  3AA7 B;  5DL6 A;  4GHB A;  3VY9 X;  2JQY A;  3UAQ A;  1BT9 A;  2W81 C;  2FGR A;  3AAE A;  3BRZ A;  3POX A;  2OMF A;  4UB6 O;  5H2F O;  1H6S 1;  4FQE A;  3AAE B;  2IWW A;  2M06 A;  1YS5 A;  3HOE A;  4LSH A;  1HXX A;  1MPF A;  3KVD D;  5PRN A;  3RBH A;  5JDP A;  3BRY A;  1Q9F A;  2J1N A;  3JTY A;  4AYN A;  2N2M A;  2XMX A;  1ZHW A;  3AA6 A;  3VE1 A;  2POR A;  2N2L A;  3WU2 O;  2WJR A;  2M07 A;  2ZLD A;  3C5O A;  4RJW A;  3VZW X;  3AA6 B;  3HOL A;  5ADX K;  2XG6 A;  4N59 A;  4GCS A;  4AYM C;  4LSF A;  1ZHX A;  2R4L A;  3A2S X;  4O3Z A;  1ZHZ A;  1QJ9 A;  2KXP A;  4O3X B;  4BUM X;  3DWN A;  2F1V A;  4U9C A;  5E79 O;  4GF4 A;  3LK3 A;  2KXP B;  5FVN A;  1GFO A;  2Y2X A;  2YNK A;  3POU A;  3O0E A;  4FZM A;  3VE2 A;  1P4T A;  2KZ7 A;  3NJT A;  4FUV A;  5G26 A;  3VZT X;  3DZM A;  5AFU K;  5ADX L;  4JCH A;  2O4V A;  1PRN A;  2R4O A;  2KZ7 B;  4O4U A;  3VZU X;  2R4P A;  2KC0 A;  2R88 A;  4RLB A;  2R89 A;  3KZI O;  3HWB A;  2R8A A;  4UB8 O;  4O3Y A;  1GFQ A;  4RJX A;  3POQ A;  1THQ A;  4FES A;  2K0L A;  3FYX A;  4PUX A;  5B66 O;  2XE2 A;  2R4N A;  3LK4 2;  1OPF A;  4K3C A;  4AFK A;  4FRX A;  3PF1 A;  4D65 A;  4LSE A;  4QQ1 A;  1GFP A;  5GTH O;  4FRT A;  1BXW A;  2ODJ A;  4FZL A;  4G75 A;  4D5U A;  7PRN A;  2X9K A;  5GTI O;  2ZFG A;  4AKR A;  3GP6 A;  4AYD C;  4N74 A;  1HXT A;  4FSO A;  4FT6 A;  5G3A A;  1HXU A;  5DL8 A;  4AKR B;  5T5F A;  2FGQ X;  2GE4 A;  3WI4 A;  4O49 A; 
#chains in the Genus database with same CATH homology
 2R89 A;  3BS0 A;  3DWO X;  1T1L A;  3PGU A;  2R8A A;  3BRZ A;  3PGR A;  3PF1 A;  3BRY A;  3DWN A;  3PGS A;  2R4O A;  2R4L A;  1T16 A;  2R88 A;  2R4P A;  2R4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...