2R4PA

Crystal structure of the long-chain fatty acid transporter fadl mutant g212e
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
421
structure length
418
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAEILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
total genus 108
structure length 418
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4pA00
3PGSA 3BS0A 3BRZA 3DWNA 2R4OA 3PF1A 2R4NA 3DWOX 3PGRA 1T1LA 2R4LA 3BRYA 2R4PA 2R89A 3PGUA 2R8AA 2R88A 1T16A
chains in the Genus database with same CATH superfamily
5D5DA 4LSHA 2QTKA 5EE2A 4LSFA 3DWOX 3AA6A 4B61A 2LHFA 3A0HO 5DL6A 3UU2A 7PRNA 4N59A 3EMNX 4LSEA 4RLCA 2ODJA 2WJQA 2XTQA 1ZHWA 2Y2XA 3LK42 4PJ0O 4O4UA 2LFUA 2X9KA 3SY9A 2W81C 2R4LA 3AA0B 2Y0HA 2MHLA 3C5OA 2N2LA 3POUA 4JCHA 4XNKA 1E54A 3LK3B 4FT6A 5G39A 3G7GA 3WI5A 2KXPB 4O3YA 4JFBA 3T24A 3DA3A 4D5UA 3SYSA 4AYDC 1MPFA 3AAEB 5G3AA 4AYNA 3BRZA 2Y7SA 3A0BO 3AA1A 1P4TA 1PRNA 4FSOA 5DL8A 1BXWA 1ZHTA 3AAAB 4O49A 3PQSA 4Z3TA 2K4TA 2WJRA 1BH3A 4E1TA 4FRXA 1MM5A 4O3WA 4PUXA 2F1CX 2ZFGA 4FOZA 2YNKA 4FZMA 4XNLA 3AA7A 5IYUA 4AKRB 2N2MA 2J4UP 3UPGA 2Y0LA 4GCSA 4GHBA 3VE1A 2XE3A 2KXPA 2WVPA 1OPFA 1H6S1 4G75A 5B5EO 3AAEA 2KC0A 4D65A 1ZHZA 3QRCA 4UB8O 2FGQX 4FSPA 3SZVA 3HWBA 3PORA 4K3BA 3LK3A 3RBHA 5GTHO 3VZUX 2KZ7B 5G38A 5KAIO 4C4VB 4N74A 2W80C 2XE2A 1S5LO 2R4NA 5AFUK 4FMSA 1ZHXA 3POQA 4C00A 3PQUA 3JCUO 3DA4A 2XTRA 3A2SX 1THQA 2ZLDA 3KVDD 4GCQA 2PORA 4FZNA 4FQEA 3JTYA 3BRYA 3UAQA 2GE4A 4KRAA 4UB6O 3AA0A 3VZTX 4C69X 3HW9A 3TZGA 1ORMA 4AKMA 5GV0A 3T20A 1IZNA 1MM4A 4QQ1A 3PGRA 4O4XA 2KDYA 5T5FA 4GF4A 1T1LA 5G26A 5AFUL 2X27X 2F1TA 1GFNA 2F1VA 3LK41 3FYXA 3PGUA 2IWWA 4AZLA 5ADXK 2YPVA 3GP6A 2R4OA 2Y0KA 3PF1A 4IL6O 4G76A 3V8UA 4AYMC 3AAAA 3VE2A 4C4VA 2AXTO 4RL9A 5H2FO 2R89A 3WI4A 2R88A 4BUMX 1GFPA 2K0LA 3PRNA 4D64A 2PRNA 3POXA 8PRNA 4LSIA 4AYEC 4PR7A 5DL5A 2JMMA 3VY8X 4AFKA 4K3CA 2M06A 2ERVA 2XE5A 3O0EA 4KR8A 5DL7A 1G90A 5B66O 3KZIO 1BT9A 2J1NA 4RJWA 5GTIO 1Q9FA 1GFQA 3AA1B 6PRNA 3LK2B 2R4PA 3VZWX 3VY9X 1QJPA 2XG6A 3PGSA 3NJTA 3DWNA 1ZHYA 4FESA 1GFOA 3K19A 3SZDA 4AUIA 4RLBA 3HOLA 4AKRA 2JQYA 4N75A 1HXUA 2M07A 2XMXA 3AA6B 3WU2O 2R8AA 4F4BA 1HXTA 4U9CA 4E1SA 1QJ9A 1QJ8A 4KR4A 5KAFO 1HXXA 4FUVA 5TISO 3QRAA 2IWVA 2KZ7A 3HOEA 4O3ZA 3DZMA 4CTDA 1Q9GA 3LK2A 5JDPA 3AA7B 1PHOA 5ADXL 4O3XB 2XE1A 1YS5A 4N58A 2O4VA 1IZNB 3NSGA 3SYBA 3SY7A 1GFMA 3T0SA 2MNHA 1T16A 3BS0A 4AYID 2FGRA 5PRNA 4FZLA 4RJXA 5FVNA 5E79O 1OSMA 4GCPA 4FRTA 2OMFA
chains in the Genus database with same CATH topology
3PGSA 3BS0A 3BRZA 3DWNA 2R4OA 3PF1A 2R4NA 3DWOX 3PGRA 1T1LA 2R4LA 3BRYA 2R4PA 2R89A 3PGUA 2R8AA 2R88A 1T16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGS A;  3BS0 A;  3BRZ A;  3DWN A;  2R4O A;  3PF1 A;  2R4N A;  3DWO X;  3PGR A;  1T1L A;  2R4L A;  3BRY A;  2R4P A;  2R89 A;  3PGU A;  2R8A A;  2R88 A;  1T16 A; 
#chains in the Genus database with same CATH topology
 5D5D A;  4LSH A;  2QTK A;  5EE2 A;  4LSF A;  3DWO X;  3AA6 A;  4B61 A;  2LHF A;  3A0H O;  5DL6 A;  3UU2 A;  7PRN A;  4N59 A;  3EMN X;  4LSE A;  4RLC A;  2ODJ A;  2WJQ A;  2XTQ A;  1ZHW A;  2Y2X A;  3LK4 2;  4PJ0 O;  4O4U A;  2LFU A;  2X9K A;  3SY9 A;  2W81 C;  2R4L A;  3AA0 B;  2Y0H A;  2MHL A;  3C5O A;  2N2L A;  3POU A;  4JCH A;  4XNK A;  1E54 A;  3LK3 B;  4FT6 A;  5G39 A;  3G7G A;  3WI5 A;  2KXP B;  4O3Y A;  4JFB A;  3T24 A;  3DA3 A;  4D5U A;  3SYS A;  4AYD C;  1MPF A;  3AAE B;  5G3A A;  4AYN A;  3BRZ A;  2Y7S A;  3A0B O;  3AA1 A;  1P4T A;  1PRN A;  4FSO A;  5DL8 A;  1BXW A;  1ZHT A;  3AAA B;  4O49 A;  3PQS A;  4Z3T A;  2K4T A;  2WJR A;  1BH3 A;  4E1T A;  4FRX A;  1MM5 A;  4O3W A;  4PUX A;  2F1C X;  2ZFG A;  4FOZ A;  2YNK A;  4FZM A;  4XNL A;  3AA7 A;  5IYU A;  4AKR B;  2N2M A;  2J4U P;  3UPG A;  2Y0L A;  4GCS A;  4GHB A;  3VE1 A;  2XE3 A;  2KXP A;  2WVP A;  1OPF A;  1H6S 1;  4G75 A;  5B5E O;  3AAE A;  2KC0 A;  4D65 A;  1ZHZ A;  3QRC A;  4UB8 O;  2FGQ X;  4FSP A;  3SZV A;  3HWB A;  3POR A;  4K3B A;  3LK3 A;  3RBH A;  5GTH O;  3VZU X;  2KZ7 B;  5G38 A;  5KAI O;  4C4V B;  4N74 A;  2W80 C;  2XE2 A;  1S5L O;  2R4N A;  5AFU K;  4FMS A;  1ZHX A;  3POQ A;  4C00 A;  3PQU A;  3JCU O;  3DA4 A;  2XTR A;  3A2S X;  1THQ A;  2ZLD A;  3KVD D;  4GCQ A;  2POR A;  4FZN A;  4FQE A;  3JTY A;  3BRY A;  3UAQ A;  2GE4 A;  4KRA A;  4UB6 O;  3AA0 A;  3VZT X;  4C69 X;  3HW9 A;  3TZG A;  1ORM A;  4AKM A;  5GV0 A;  3T20 A;  1IZN A;  1MM4 A;  4QQ1 A;  3PGR A;  4O4X A;  2KDY A;  5T5F A;  4GF4 A;  1T1L A;  5G26 A;  5AFU L;  2X27 X;  2F1T A;  1GFN A;  2F1V A;  3LK4 1;  3FYX A;  3PGU A;  2IWW A;  4AZL A;  5ADX K;  2YPV A;  3GP6 A;  2R4O A;  2Y0K A;  3PF1 A;  4IL6 O;  4G76 A;  3V8U A;  4AYM C;  3AAA A;  3VE2 A;  4C4V A;  2AXT O;  4RL9 A;  5H2F O;  2R89 A;  3WI4 A;  2R88 A;  4BUM X;  1GFP A;  2K0L A;  3PRN A;  4D64 A;  2PRN A;  3POX A;  8PRN A;  4LSI A;  4AYE C;  4PR7 A;  5DL5 A;  2JMM A;  3VY8 X;  4AFK A;  4K3C A;  2M06 A;  2ERV A;  2XE5 A;  3O0E A;  4KR8 A;  5DL7 A;  1G90 A;  5B66 O;  3KZI O;  1BT9 A;  2J1N A;  4RJW A;  5GTI O;  1Q9F A;  1GFQ A;  3AA1 B;  6PRN A;  3LK2 B;  2R4P A;  3VZW X;  3VY9 X;  1QJP A;  2XG6 A;  3PGS A;  3NJT A;  3DWN A;  1ZHY A;  4FES A;  1GFO A;  3K19 A;  3SZD A;  4AUI A;  4RLB A;  3HOL A;  4AKR A;  2JQY A;  4N75 A;  1HXU A;  2M07 A;  2XMX A;  3AA6 B;  3WU2 O;  2R8A A;  4F4B A;  1HXT A;  4U9C A;  4E1S A;  1QJ9 A;  1QJ8 A;  4KR4 A;  5KAF O;  1HXX A;  4FUV A;  5TIS O;  3QRA A;  2IWV A;  2KZ7 A;  3HOE A;  4O3Z A;  3DZM A;  4CTD A;  1Q9G A;  3LK2 A;  5JDP A;  3AA7 B;  1PHO A;  5ADX L;  4O3X B;  2XE1 A;  1YS5 A;  4N58 A;  2O4V A;  1IZN B;  3NSG A;  3SYB A;  3SY7 A;  1GFM A;  3T0S A;  2MNH A;  1T16 A;  3BS0 A;  4AYI D;  2FGR A;  5PRN A;  4FZL A;  4RJX A;  5FVN A;  5E79 O;  1OSM A;  4GCP A;  4FRT A;  2OMF A; 
#chains in the Genus database with same CATH homology
 3PGS A;  3BS0 A;  3BRZ A;  3DWN A;  2R4O A;  3PF1 A;  2R4N A;  3DWO X;  3PGR A;  1T1L A;  2R4L A;  3BRY A;  2R4P A;  2R89 A;  3PGU A;  2R8A A;  2R88 A;  1T16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...