2R4PA

Crystal structure of the long-chain fatty acid transporter fadl mutant g212e
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
421
structure length
418
Chain Sequence
b'AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAEILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 108
structure length 418
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4pA00
3BS0A 2R4OA 3DWOX 1T1LA 3BRZA 2R89A 3PGUA 1T16A 3BRYA 3PF1A 3PGRA 2R4PA 2R8AA 3PGSA 3DWNA 2R4LA 2R4NA 2R88A
chains in the Genus database with same CATH superfamily
3VZTX 3C5OA 4JFBA 3AAEB 4XNKA 4AFKA 3AA6A 3DWOX 3KVDD 3POXA 4AKRA 3LK2B 3WI4A 3K19A 3JTYA 4G75A 1HXUA 2LHFA 3VZWX 1ZHXA 1THQA 4UB6O 3POUA 5G39A 5AFUL 4O4UA 4FESA 4O3YA 1G90A 8PRNA 3BRZA 2J1NA 3DA3A 1BH3A 1H6S1 1PRNA 1QJPA 1YS5A 2M06A 2MHLA 2R8AA 3PGSA 3A0BO 1IZNB 4N75A 2KXPB 1HXXA 1GFPA 1HXTA 3HOLA 3HW9A 3VE2A 4FZMA 2FGRA 2M07A 2LFUA 3LK42 4LSHA 4N58A 2Y0LA 4FQEA 2XMXA 3AAEA 4FMSA 4O3WA 2ERVA 2ODJA 3A2SX 4RJXA 3BS0A 3LK2A 2K4TA 2X27X 4KR8A 5DL7A 2WJRA 5KAFO 2XE5A 5DL5A 1T16A 5ADXK 3PGRA 4RJWA 3TZGA 2KDYA 4FZNA 5EE2A 2K0LA 5DL8A 1ZHWA 2F1CX 1IZNA 2KXPA 2PRNA 4N74A 4RLCA 2O4VA 3UU2A 2XE3A 3PQUA 4D64A 3DZMA 2YPVA 5T5FA 3VY9X 3A0HO 4E1SA 2N2LA 4PJ0O 3KZIO 4PR7A 2XE1A 1ZHYA 2F1VA 3RBHA 4Z3TA 2QTKA 3T24A 3AAAB 4AYDC 2WVPA 3T20A 2KC0A 4FUVA 3PORA 4RL9A 4G76A 3UAQA 3POQA 4O3XB 3HOEA 5G38A 2W80C 2X9KA 4AYMC 4GCSA 2OMFA 3JCUO 4AKMA 2Y0HA 3PF1A 2R4PA 3PQSA 4AYID 2IWVA 5AFUK 2R88A 2N2MA 3QRCA 3PRNA 5IYUA 1GFMA 3PGUA 4KRAA 3AA0B 4D65A 2ZLDA 3SY7A 3V8UA 4FRXA 2Y0KA 4O49A 1GFOA 3FYXA 1Q9GA 3NJTA 3VE1A 2XTQA 1MPFA 1T1LA 3NSGA 4LSIA 3AAAA 4LSEA 5DL6A 3BRYA 3QRAA 4GCPA 4N59A 5E79O 5TISO 2GE4A 2IWWA 6PRNA 4RLBA 2Y2XA 1MM5A 2FGQX 3O0EA 5G3AA 1OPFA 1ZHTA 3LK3A 5FVNA 5KAIO 5PRNA 2J4UP 1E54A 2W81C 2KZ7B 2R4NA 2Y7SA 2F1TA 3G7GA 1OSMA 2AXTO 4FSPA 4FT6A 5G26A 3AA0A 2R4OA 4E1TA 2YNKA 5B66O 1P4TA 1GFQA 5GTHO 3AA1B 3SZDA 2XTRA 3WI5A 2PORA 3VY8X 4AZLA 5GV0A 3LK3B 1Q9FA 3LK41 4XNLA 3SYBA 3T0SA 1GFNA 4KR4A 2XE2A 3DA4A 4GF4A 1QJ9A 3EMNX 1MM4A 4O4XA 1BT9A 1ORMA 7PRNA 4O3ZA 2KZ7A 4FRTA 2R89A 4FSOA 3AA7B 4C4VB 3UPGA 2XG6A 5GTIO 2R4LA 4JCHA 3WU2O 3SZVA 3SYSA 3AA1A 4UB8O 1BXWA 4D5UA 4AYNA 3AA6B 1PHOA 5JDPA 4FZLA 1S5LO 3DWNA 4PUXA 4AKRB 5ADXL 3GP6A 3VZUX 5B5EO 4AYEC 2MNHA 4GHBA 4FOZA 2JMMA 4LSFA 4F4BA 4B61A 4BUMX 4C00A 4CTDA 2ZFGA 1QJ8A 4IL6O 4K3BA 4GCQA 1ZHZA 3SY9A 3AA7A 4QQ1A 4C4VA 2WJQA 4K3CA 4AUIA 5D5DA 4U9CA 3HWBA 2JQYA 4C69X 5H2FO
chains in the Genus database with same CATH topology
3BS0A 2R4OA 3DWOX 1T1LA 3BRZA 2R89A 3PGUA 1T16A 3BRYA 3PF1A 3PGRA 2R4PA 2R8AA 3PGSA 3DWNA 2R4LA 2R4NA 2R88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS0 A;  2R4O A;  3DWO X;  1T1L A;  3BRZ A;  2R89 A;  3PGU A;  1T16 A;  3BRY A;  3PF1 A;  3PGR A;  2R4P A;  2R8A A;  3PGS A;  3DWN A;  2R4L A;  2R4N A;  2R88 A; 
#chains in the Genus database with same CATH topology
 3VZT X;  3C5O A;  4JFB A;  3AAE B;  4XNK A;  4AFK A;  3AA6 A;  3DWO X;  3KVD D;  3POX A;  4AKR A;  3LK2 B;  3WI4 A;  3K19 A;  3JTY A;  4G75 A;  1HXU A;  2LHF A;  3VZW X;  1ZHX A;  1THQ A;  4UB6 O;  3POU A;  5G39 A;  5AFU L;  4O4U A;  4FES A;  4O3Y A;  1G90 A;  8PRN A;  3BRZ A;  2J1N A;  3DA3 A;  1BH3 A;  1H6S 1;  1PRN A;  1QJP A;  1YS5 A;  2M06 A;  2MHL A;  2R8A A;  3PGS A;  3A0B O;  1IZN B;  4N75 A;  2KXP B;  1HXX A;  1GFP A;  1HXT A;  3HOL A;  3HW9 A;  3VE2 A;  4FZM A;  2FGR A;  2M07 A;  2LFU A;  3LK4 2;  4LSH A;  4N58 A;  2Y0L A;  4FQE A;  2XMX A;  3AAE A;  4FMS A;  4O3W A;  2ERV A;  2ODJ A;  3A2S X;  4RJX A;  3BS0 A;  3LK2 A;  2K4T A;  2X27 X;  4KR8 A;  5DL7 A;  2WJR A;  5KAF O;  2XE5 A;  5DL5 A;  1T16 A;  5ADX K;  3PGR A;  4RJW A;  3TZG A;  2KDY A;  4FZN A;  5EE2 A;  2K0L A;  5DL8 A;  1ZHW A;  2F1C X;  1IZN A;  2KXP A;  2PRN A;  4N74 A;  4RLC A;  2O4V A;  3UU2 A;  2XE3 A;  3PQU A;  4D64 A;  3DZM A;  2YPV A;  5T5F A;  3VY9 X;  3A0H O;  4E1S A;  2N2L A;  4PJ0 O;  3KZI O;  4PR7 A;  2XE1 A;  1ZHY A;  2F1V A;  3RBH A;  4Z3T A;  2QTK A;  3T24 A;  3AAA B;  4AYD C;  2WVP A;  3T20 A;  2KC0 A;  4FUV A;  3POR A;  4RL9 A;  4G76 A;  3UAQ A;  3POQ A;  4O3X B;  3HOE A;  5G38 A;  2W80 C;  2X9K A;  4AYM C;  4GCS A;  2OMF A;  3JCU O;  4AKM A;  2Y0H A;  3PF1 A;  2R4P A;  3PQS A;  4AYI D;  2IWV A;  5AFU K;  2R88 A;  2N2M A;  3QRC A;  3PRN A;  5IYU A;  1GFM A;  3PGU A;  4KRA A;  3AA0 B;  4D65 A;  2ZLD A;  3SY7 A;  3V8U A;  4FRX A;  2Y0K A;  4O49 A;  1GFO A;  3FYX A;  1Q9G A;  3NJT A;  3VE1 A;  2XTQ A;  1MPF A;  1T1L A;  3NSG A;  4LSI A;  3AAA A;  4LSE A;  5DL6 A;  3BRY A;  3QRA A;  4GCP A;  4N59 A;  5E79 O;  5TIS O;  2GE4 A;  2IWW A;  6PRN A;  4RLB A;  2Y2X A;  1MM5 A;  2FGQ X;  3O0E A;  5G3A A;  1OPF A;  1ZHT A;  3LK3 A;  5FVN A;  5KAI O;  5PRN A;  2J4U P;  1E54 A;  2W81 C;  2KZ7 B;  2R4N A;  2Y7S A;  2F1T A;  3G7G A;  1OSM A;  2AXT O;  4FSP A;  4FT6 A;  5G26 A;  3AA0 A;  2R4O A;  4E1T A;  2YNK A;  5B66 O;  1P4T A;  1GFQ A;  5GTH O;  3AA1 B;  3SZD A;  2XTR A;  3WI5 A;  2POR A;  3VY8 X;  4AZL A;  5GV0 A;  3LK3 B;  1Q9F A;  3LK4 1;  4XNL A;  3SYB A;  3T0S A;  1GFN A;  4KR4 A;  2XE2 A;  3DA4 A;  4GF4 A;  1QJ9 A;  3EMN X;  1MM4 A;  4O4X A;  1BT9 A;  1ORM A;  7PRN A;  4O3Z A;  2KZ7 A;  4FRT A;  2R89 A;  4FSO A;  3AA7 B;  4C4V B;  3UPG A;  2XG6 A;  5GTI O;  2R4L A;  4JCH A;  3WU2 O;  3SZV A;  3SYS A;  3AA1 A;  4UB8 O;  1BXW A;  4D5U A;  4AYN A;  3AA6 B;  1PHO A;  5JDP A;  4FZL A;  1S5L O;  3DWN A;  4PUX A;  4AKR B;  5ADX L;  3GP6 A;  3VZU X;  5B5E O;  4AYE C;  2MNH A;  4GHB A;  4FOZ A;  2JMM A;  4LSF A;  4F4B A;  4B61 A;  4BUM X;  4C00 A;  4CTD A;  2ZFG A;  1QJ8 A;  4IL6 O;  4K3B A;  4GCQ A;  1ZHZ A;  3SY9 A;  3AA7 A;  4QQ1 A;  4C4V A;  2WJQ A;  4K3C A;  4AUI A;  5D5D A;  4U9C A;  3HWB A;  2JQY A;  4C69 X;  5H2F O; 
#chains in the Genus database with same CATH homology
 3BS0 A;  2R4O A;  3DWO X;  1T1L A;  3BRZ A;  2R89 A;  3PGU A;  1T16 A;  3BRY A;  3PF1 A;  3PGR A;  2R4P A;  2R8A A;  3PGS A;  3DWN A;  2R4L A;  2R4N A;  2R88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...