2R4PA

Crystal structure of the long-chain fatty acid transporter fadl mutant g212e
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
421
structure length
418
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAEILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 108
structure length 418
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4pA00
3BRZA 2R4PA 1T1LA 2R8AA 3PF1A 3DWOX 2R89A 2R4LA 2R88A 2R4OA 3BS0A 3DWNA 3PGUA 3PGRA 2R4NA 3BRYA 1T16A 3PGSA
chains in the Genus database with same CATH superfamily
5DL7A 2IWVA 4FMSA 2Y7SA 2Y0HA 3SYBA 2X9KA 2PRNA 3QRCA 2FGRA 3SY7A 4AFKA 3O0EA 4FZLA 2KZ7A 4RJWA 4C69X 2KZ7B 4FESA 5G38A 2W81C 4FZMA 4RLCA 2R4OA 2XE3A 4AKRA 1GFNA 2KC0A 2KXPA 3JTYA 2KXPB 1T16A 2M06A 1ZHZA 3LK3A 4XNKA 5G3AA 2R89A 3KVDD 1IZNA 5H2FO 4KR8A 4O4UA 4D64A 3AA1A 4O49A 3WI5A 2XE1A 1MM4A 2YPVA 6PRNA 4LSHA 4LSEA 4O3ZA 4KR4A 5EE2A 4BUMX 3POXA 5ADXL 1MM5A 4RL9A 2Y0KA 4IL6O 4AZLA 4U9CA 3AA0A 3PGRA 2MNHA 5D5DA 1HXUA 2ZFGA 4O3XB 3T24A 3AA6A 3AA6B 3A0HO 1ZHTA 5IYUA 2JQYA 4FZNA 3HWBA 3G7GA 4E1TA 4RJXA 1GFPA 3SYSA 5FVNA 4CTDA 2QTKA 4LSFA 2F1VA 5G39A 1ORMA 2Y0LA 5KAFO 2ODJA 4FOZA 3LK42 1MPFA 1GFMA 5JDPA 5G26A 4FUVA 3HOLA 4G76A 4GCSA 2F1CX 3SZVA 3T0SA 2IWWA 2WJRA 2M07A 4B61A 1ZHYA 8PRNA 4K3CA 4AYDC 2GE4A 1ZHXA 3PQSA 2R4PA 4LSIA 3FYXA 3V8UA 3WU2O 4AUIA 1ZHWA 3DA3A 4PUXA 4XNLA 2R88A 2X27X 5B66O 3UAQA 5T5FA 1PRNA 3PGUA 3RBHA 1HXTA 4N59A 1Q9GA 3PQUA 5TISO 3PORA 3NSGA 1HXXA 3GP6A 1S5LO 3HW9A 3SZDA 4C4VB 5DL5A 3BS0A 3POUA 4AKMA 4GF4A 3AAEB 2J4UP 2ZLDA 2KDYA 2LHFA 4FRTA 1BH3A 1H6S1 1QJ8A 4GCPA 4KRAA 3DWOX 2R4LA 2WVPA 4O3YA 4GCQA 4D65A 1E54A 2PORA 2R4NA 3K19A 2W80C 3BRYA 4GHBA 3LK41 2Y2XA 4FT6A 4PJ0O 5GTIO 4AYNA 3NJTA 4N58A 4K3BA 2JMMA 2XMXA 5DL8A 4C00A 5E79O 5AFUL 5PRNA 2WJQA 3C5OA 3LK2A 3LK2B 1G90A 2J1NA 1T1LA 2R8AA 3PF1A 2K4TA 2N2LA 3PRNA 2MHLA 4RLBA 1PHOA 2XE5A 3HOEA 4N75A 2LFUA 3VY8X 2XE2A 2XG6A 2K0LA 3KZIO 3PGSA 3TZGA 7PRNA 3BRZA 4G75A 4F4BA 1GFQA 4C4VA 1THQA 4AYID 3DA4A 2AXTO 3DWNA 5DL6A 5KAIO 4O3WA 4JCHA 3A2SX 4QQ1A 1BT9A 3EMNX 4JFBA 3VE1A 3AAEA 5GTHO 2N2MA 4PR7A 1OPFA 1P4TA 2O4VA 4AKRB 3WI4A 2FGQX 3AAAA 3SY9A 4D5UA 3AAAB 3LK3B 4FQEA 3VZWX 4O4XA 3QRAA 5AFUK 1IZNB 1OSMA 3JCUO 4N74A 3UU2A 3AA1B 5GV0A 4FSOA 3VZUX 4Z3TA 4FRXA 3VZTX 2ERVA 3VE2A 4AYEC 4E1SA 1GFOA 1Q9FA 3UPGA 1BXWA 5ADXK 2YNKA 2F1TA 4UB6O 1QJ9A 1QJPA 2XTQA 3AA7A 4UB8O 3A0BO 3AA7B 2OMFA 3AA0B 4FSPA 3VY9X 4AYMC 5B5EO 1YS5A 3T20A 3POQA 2XTRA 3DZMA
chains in the Genus database with same CATH topology
3BRZA 2R4PA 1T1LA 2R8AA 3PF1A 3DWOX 2R89A 2R4LA 2R88A 2R4OA 3BS0A 3DWNA 3PGUA 3PGRA 2R4NA 3BRYA 1T16A 3PGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRZ A;  2R4P A;  1T1L A;  2R8A A;  3PF1 A;  3DWO X;  2R89 A;  2R4L A;  2R88 A;  2R4O A;  3BS0 A;  3DWN A;  3PGU A;  3PGR A;  2R4N A;  3BRY A;  1T16 A;  3PGS A; 
#chains in the Genus database with same CATH topology
 5DL7 A;  2IWV A;  4FMS A;  2Y7S A;  2Y0H A;  3SYB A;  2X9K A;  2PRN A;  3QRC A;  2FGR A;  3SY7 A;  4AFK A;  3O0E A;  4FZL A;  2KZ7 A;  4RJW A;  4C69 X;  2KZ7 B;  4FES A;  5G38 A;  2W81 C;  4FZM A;  4RLC A;  2R4O A;  2XE3 A;  4AKR A;  1GFN A;  2KC0 A;  2KXP A;  3JTY A;  2KXP B;  1T16 A;  2M06 A;  1ZHZ A;  3LK3 A;  4XNK A;  5G3A A;  2R89 A;  3KVD D;  1IZN A;  5H2F O;  4KR8 A;  4O4U A;  4D64 A;  3AA1 A;  4O49 A;  3WI5 A;  2XE1 A;  1MM4 A;  2YPV A;  6PRN A;  4LSH A;  4LSE A;  4O3Z A;  4KR4 A;  5EE2 A;  4BUM X;  3POX A;  5ADX L;  1MM5 A;  4RL9 A;  2Y0K A;  4IL6 O;  4AZL A;  4U9C A;  3AA0 A;  3PGR A;  2MNH A;  5D5D A;  1HXU A;  2ZFG A;  4O3X B;  3T24 A;  3AA6 A;  3AA6 B;  3A0H O;  1ZHT A;  5IYU A;  2JQY A;  4FZN A;  3HWB A;  3G7G A;  4E1T A;  4RJX A;  1GFP A;  3SYS A;  5FVN A;  4CTD A;  2QTK A;  4LSF A;  2F1V A;  5G39 A;  1ORM A;  2Y0L A;  5KAF O;  2ODJ A;  4FOZ A;  3LK4 2;  1MPF A;  1GFM A;  5JDP A;  5G26 A;  4FUV A;  3HOL A;  4G76 A;  4GCS A;  2F1C X;  3SZV A;  3T0S A;  2IWW A;  2WJR A;  2M07 A;  4B61 A;  1ZHY A;  8PRN A;  4K3C A;  4AYD C;  2GE4 A;  1ZHX A;  3PQS A;  2R4P A;  4LSI A;  3FYX A;  3V8U A;  3WU2 O;  4AUI A;  1ZHW A;  3DA3 A;  4PUX A;  4XNL A;  2R88 A;  2X27 X;  5B66 O;  3UAQ A;  5T5F A;  1PRN A;  3PGU A;  3RBH A;  1HXT A;  4N59 A;  1Q9G A;  3PQU A;  5TIS O;  3POR A;  3NSG A;  1HXX A;  3GP6 A;  1S5L O;  3HW9 A;  3SZD A;  4C4V B;  5DL5 A;  3BS0 A;  3POU A;  4AKM A;  4GF4 A;  3AAE B;  2J4U P;  2ZLD A;  2KDY A;  2LHF A;  4FRT A;  1BH3 A;  1H6S 1;  1QJ8 A;  4GCP A;  4KRA A;  3DWO X;  2R4L A;  2WVP A;  4O3Y A;  4GCQ A;  4D65 A;  1E54 A;  2POR A;  2R4N A;  3K19 A;  2W80 C;  3BRY A;  4GHB A;  3LK4 1;  2Y2X A;  4FT6 A;  4PJ0 O;  5GTI O;  4AYN A;  3NJT A;  4N58 A;  4K3B A;  2JMM A;  2XMX A;  5DL8 A;  4C00 A;  5E79 O;  5AFU L;  5PRN A;  2WJQ A;  3C5O A;  3LK2 A;  3LK2 B;  1G90 A;  2J1N A;  1T1L A;  2R8A A;  3PF1 A;  2K4T A;  2N2L A;  3PRN A;  2MHL A;  4RLB A;  1PHO A;  2XE5 A;  3HOE A;  4N75 A;  2LFU A;  3VY8 X;  2XE2 A;  2XG6 A;  2K0L A;  3KZI O;  3PGS A;  3TZG A;  7PRN A;  3BRZ A;  4G75 A;  4F4B A;  1GFQ A;  4C4V A;  1THQ A;  4AYI D;  3DA4 A;  2AXT O;  3DWN A;  5DL6 A;  5KAI O;  4O3W A;  4JCH A;  3A2S X;  4QQ1 A;  1BT9 A;  3EMN X;  4JFB A;  3VE1 A;  3AAE A;  5GTH O;  2N2M A;  4PR7 A;  1OPF A;  1P4T A;  2O4V A;  4AKR B;  3WI4 A;  2FGQ X;  3AAA A;  3SY9 A;  4D5U A;  3AAA B;  3LK3 B;  4FQE A;  3VZW X;  4O4X A;  3QRA A;  5AFU K;  1IZN B;  1OSM A;  3JCU O;  4N74 A;  3UU2 A;  3AA1 B;  5GV0 A;  4FSO A;  3VZU X;  4Z3T A;  4FRX A;  3VZT X;  2ERV A;  3VE2 A;  4AYE C;  4E1S A;  1GFO A;  1Q9F A;  3UPG A;  1BXW A;  5ADX K;  2YNK A;  2F1T A;  4UB6 O;  1QJ9 A;  1QJP A;  2XTQ A;  3AA7 A;  4UB8 O;  3A0B O;  3AA7 B;  2OMF A;  3AA0 B;  4FSP A;  3VY9 X;  4AYM C;  5B5E O;  1YS5 A;  3T20 A;  3POQ A;  2XTR A;  3DZM A; 
#chains in the Genus database with same CATH homology
 3BRZ A;  2R4P A;  1T1L A;  2R8A A;  3PF1 A;  3DWO X;  2R89 A;  2R4L A;  2R88 A;  2R4O A;  3BS0 A;  3DWN A;  3PGU A;  3PGR A;  2R4N A;  3BRY A;  1T16 A;  3PGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...