2R4PA

Crystal structure of the long-chain fatty acid transporter fadl mutant g212e
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
421
structure length
418
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAEILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
total genus 108
structure length 418
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4pA00
1T1LA 2R4PA 2R4LA 3BRYA 3PF1A 3PGUA 2R89A 2R4OA 2R8AA 3DWNA 3PGRA 2R88A 3BS0A 2R4NA 1T16A 3BRZA 3DWOX 3PGSA
chains in the Genus database with same CATH superfamily
2ZFGA 3PQUA 3KVDD 4D65A 1S5LO 3BRZA 4LSEA 2JMMA 2XE2A 4LSFA 5EE2A 2JQYA 2M06A 3DWOX 3LK41 4D5UA 5H2FO 4AZLA 1H6S1 2YPVA 3HOLA 2WVPA 3GP6A 3NSGA 3SZVA 3WU2O 5IYUA 5B66O 1BH3A 1PRNA 1ZHWA 2O4VA 2XE5A 5KAIO 3AA7A 4O3WA 4FZNA 3A0BO 1GFNA 1QJPA 3A0HO 2W80C 4FSOA 1ZHTA 2MHLA 4N58A 5G26A 3KZIO 2XG6A 4GF4A 2F1CX 4AKRB 4KRAA 2R4LA 4AUIA 3AA6B 4GCSA 2N2LA 5G3AA 3TZGA 5B5EO 2W81C 4O49A 2KZ7B 2ZLDA 5DL5A 2AXTO 2KDYA 3LK42 3T24A 3VY9X 3QRAA 3T20A 5JDPA 3QRCA 2KC0A 3DA3A 3PQSA 3POQA 4O4XA 3VE2A 4XNKA 5DL8A 3SYBA 2K4TA 3K19A 5AFUL 3AAAB 5ADXL 3VZWX 1ZHZA 1ZHYA 3LK2A 4E1SA 2FGQX 3SYSA 2LHFA 3PGUA 1OPFA 1QJ8A 4KR4A 1MM4A 4GCQA 4PUXA 4RJWA 4AKMA 4AYEC 5GTHO 1OSMA 1QJ9A 1P4TA 4GHBA 2OMFA 2Y0KA 3AAEA 4FRTA 2QTKA 4FQEA 4AYID 1YS5A 4O3ZA 1BT9A 3BRYA 3JTYA 3PF1A 3PRNA 4FUVA 3AA1B 4IL6O 3UAQA 3VY8X 5E79O 4D64A 1GFOA 3SY7A 4C4VB 4Z3TA 8PRNA 4O4UA 2IWVA 4N74A 2XTQA 2X27X 5GTIO 1THQA 4K3BA 4FT6A 2J1NA 4K3CA 2R4NA 2F1TA 2KXPB 4FZMA 4FESA 6PRNA 3JCUO 2IWWA 3WI5A 2ODJA 2Y7SA 2XMXA 1PHOA 3O0EA 4JFBA 2R4OA 1HXXA 4CTDA 1G90A 3AA0A 5AFUK 3EMNX 3C5OA 4N59A 1T1LA 4FMSA 4JCHA 3AA0B 4FOZA 4RL9A 4UB6O 4BUMX 2PORA 5ADXK 1MPFA 5GV0A 3AA7B 4B61A 4XNLA 2XE1A 4QQ1A 3VZTX 4UB8O 3RBHA 4PJ0O 3V8UA 2X9KA 5D5DA 3WI4A 1BXWA 4LSHA 1HXUA 2YNKA 2WJQA 3DWNA 4LSIA 4E1TA 1HXTA 4AKRA 1T16A 5PRNA 1Q9GA 2FGRA 4AYMC 5DL7A 7PRNA 3UPGA 3DA4A 4G76A 2KZ7A 2N2MA 2R88A 3PGSA 3VZUX 2ERVA 3AA6A 4KR8A 1ZHXA 3SY9A 2MNHA 4RJXA 3HWBA 1Q9FA 3POUA 1ORMA 5G39A 2R8AA 3FYXA 4RLBA 2F1VA 4FZLA 2R89A 4G75A 5KAFO 4AFKA 2PRNA 2Y0HA 3POXA 5G38A 4GCPA 2M07A 5TISO 1IZNB 3PORA 4RLCA 4C69X 3AAAA 3T0SA 3LK2B 4AYNA 1IZNA 1GFMA 5FVNA 3AAEB 4AYDC 3LK3A 3DZMA 4FSPA 3SZDA 5DL6A 4C00A 4N75A 1GFQA 2Y0LA 3LK3B 3NJTA 4F4BA 1MM5A 3UU2A 3VE1A 3BS0A 2XTRA 1GFPA 2GE4A 4PR7A 2WJRA 3AA1A 2R4PA 5T5FA 4FRXA 3HW9A 4O3XB 1E54A 2KXPA 4C4VA 3HOEA 2Y2XA 3PGRA 4U9CA 2K0LA 4O3YA 3G7GA 2J4UP 2LFUA 3A2SX 2XE3A
chains in the Genus database with same CATH topology
1T1LA 2R4PA 2R4LA 3BRYA 3PF1A 3PGUA 2R89A 2R4OA 2R8AA 3DWNA 3PGRA 2R88A 3BS0A 2R4NA 1T16A 3BRZA 3DWOX 3PGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1L A;  2R4P A;  2R4L A;  3BRY A;  3PF1 A;  3PGU A;  2R89 A;  2R4O A;  2R8A A;  3DWN A;  3PGR A;  2R88 A;  3BS0 A;  2R4N A;  1T16 A;  3BRZ A;  3DWO X;  3PGS A; 
#chains in the Genus database with same CATH topology
 2ZFG A;  3PQU A;  3KVD D;  4D65 A;  1S5L O;  3BRZ A;  4LSE A;  2JMM A;  2XE2 A;  4LSF A;  5EE2 A;  2JQY A;  2M06 A;  3DWO X;  3LK4 1;  4D5U A;  5H2F O;  4AZL A;  1H6S 1;  2YPV A;  3HOL A;  2WVP A;  3GP6 A;  3NSG A;  3SZV A;  3WU2 O;  5IYU A;  5B66 O;  1BH3 A;  1PRN A;  1ZHW A;  2O4V A;  2XE5 A;  5KAI O;  3AA7 A;  4O3W A;  4FZN A;  3A0B O;  1GFN A;  1QJP A;  3A0H O;  2W80 C;  4FSO A;  1ZHT A;  2MHL A;  4N58 A;  5G26 A;  3KZI O;  2XG6 A;  4GF4 A;  2F1C X;  4AKR B;  4KRA A;  2R4L A;  4AUI A;  3AA6 B;  4GCS A;  2N2L A;  5G3A A;  3TZG A;  5B5E O;  2W81 C;  4O49 A;  2KZ7 B;  2ZLD A;  5DL5 A;  2AXT O;  2KDY A;  3LK4 2;  3T24 A;  3VY9 X;  3QRA A;  3T20 A;  5JDP A;  3QRC A;  2KC0 A;  3DA3 A;  3PQS A;  3POQ A;  4O4X A;  3VE2 A;  4XNK A;  5DL8 A;  3SYB A;  2K4T A;  3K19 A;  5AFU L;  3AAA B;  5ADX L;  3VZW X;  1ZHZ A;  1ZHY A;  3LK2 A;  4E1S A;  2FGQ X;  3SYS A;  2LHF A;  3PGU A;  1OPF A;  1QJ8 A;  4KR4 A;  1MM4 A;  4GCQ A;  4PUX A;  4RJW A;  4AKM A;  4AYE C;  5GTH O;  1OSM A;  1QJ9 A;  1P4T A;  4GHB A;  2OMF A;  2Y0K A;  3AAE A;  4FRT A;  2QTK A;  4FQE A;  4AYI D;  1YS5 A;  4O3Z A;  1BT9 A;  3BRY A;  3JTY A;  3PF1 A;  3PRN A;  4FUV A;  3AA1 B;  4IL6 O;  3UAQ A;  3VY8 X;  5E79 O;  4D64 A;  1GFO A;  3SY7 A;  4C4V B;  4Z3T A;  8PRN A;  4O4U A;  2IWV A;  4N74 A;  2XTQ A;  2X27 X;  5GTI O;  1THQ A;  4K3B A;  4FT6 A;  2J1N A;  4K3C A;  2R4N A;  2F1T A;  2KXP B;  4FZM A;  4FES A;  6PRN A;  3JCU O;  2IWW A;  3WI5 A;  2ODJ A;  2Y7S A;  2XMX A;  1PHO A;  3O0E A;  4JFB A;  2R4O A;  1HXX A;  4CTD A;  1G90 A;  3AA0 A;  5AFU K;  3EMN X;  3C5O A;  4N59 A;  1T1L A;  4FMS A;  4JCH A;  3AA0 B;  4FOZ A;  4RL9 A;  4UB6 O;  4BUM X;  2POR A;  5ADX K;  1MPF A;  5GV0 A;  3AA7 B;  4B61 A;  4XNL A;  2XE1 A;  4QQ1 A;  3VZT X;  4UB8 O;  3RBH A;  4PJ0 O;  3V8U A;  2X9K A;  5D5D A;  3WI4 A;  1BXW A;  4LSH A;  1HXU A;  2YNK A;  2WJQ A;  3DWN A;  4LSI A;  4E1T A;  1HXT A;  4AKR A;  1T16 A;  5PRN A;  1Q9G A;  2FGR A;  4AYM C;  5DL7 A;  7PRN A;  3UPG A;  3DA4 A;  4G76 A;  2KZ7 A;  2N2M A;  2R88 A;  3PGS A;  3VZU X;  2ERV A;  3AA6 A;  4KR8 A;  1ZHX A;  3SY9 A;  2MNH A;  4RJX A;  3HWB A;  1Q9F A;  3POU A;  1ORM A;  5G39 A;  2R8A A;  3FYX A;  4RLB A;  2F1V A;  4FZL A;  2R89 A;  4G75 A;  5KAF O;  4AFK A;  2PRN A;  2Y0H A;  3POX A;  5G38 A;  4GCP A;  2M07 A;  5TIS O;  1IZN B;  3POR A;  4RLC A;  4C69 X;  3AAA A;  3T0S A;  3LK2 B;  4AYN A;  1IZN A;  1GFM A;  5FVN A;  3AAE B;  4AYD C;  3LK3 A;  3DZM A;  4FSP A;  3SZD A;  5DL6 A;  4C00 A;  4N75 A;  1GFQ A;  2Y0L A;  3LK3 B;  3NJT A;  4F4B A;  1MM5 A;  3UU2 A;  3VE1 A;  3BS0 A;  2XTR A;  1GFP A;  2GE4 A;  4PR7 A;  2WJR A;  3AA1 A;  2R4P A;  5T5F A;  4FRX A;  3HW9 A;  4O3X B;  1E54 A;  2KXP A;  4C4V A;  3HOE A;  2Y2X A;  3PGR A;  4U9C A;  2K0L A;  4O3Y A;  3G7G A;  2J4U P;  2LFU A;  3A2S X;  2XE3 A; 
#chains in the Genus database with same CATH homology
 1T1L A;  2R4P A;  2R4L A;  3BRY A;  3PF1 A;  3PGU A;  2R89 A;  2R4O A;  2R8A A;  3DWN A;  3PGR A;  2R88 A;  3BS0 A;  2R4N A;  1T16 A;  3BRZ A;  3DWO X;  3PGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...