2R4PA

Crystal structure of the long-chain fatty acid transporter fadl mutant g212e
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
421
structure length
418
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAEILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
molecule keywords Long-chain fatty acid transport protein
source organism Escherichia coli
molecule tags Transport protein
total genus 108
structure length 418
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4pA00
2R4PA 3PGUA 3BRZA 3PGSA 3DWOX 1T1LA 2R89A 3BRYA 1T16A 3BS0A 3DWNA 2R4OA 3PGRA 2R8AA 2R88A 2R4LA 2R4NA 3PF1A
chains in the Genus database with same CATH superfamily
4K3BA 3BRZA 6PRNA 2WJRA 5ADXK 2N2MA 4O49A 2KZ7A 5DL8A 2K0LA 3VE2A 2R4LA 3BS0A 4CTDA 2Y7SA 2JMMA 4N58A 1MM4A 4XNLA 5AFUL 3AA6A 5GTIO 3WI4A 2AXTO 3POXA 5TISO 1BXWA 1HXXA 2XTRA 4N74A 2IWWA 3DA4A 1ZHTA 2FGQX 3AA1B 3AAEB 3TZGA 3FYXA 3HW9A 2MHLA 1Q9FA 2KXPB 2QTKA 2XE5A 2Y0KA 4PUXA 7PRNA 3AA1A 4RJXA 4O3XB 4KRAA 3T24A 4FMSA 3UPGA 4C4VB 4AYMC 1ZHZA 3T20A 5ADXL 2YNKA 1PRNA 2PRNA 2R4PA 1GFNA 2XMXA 2MNHA 1GFMA 4B61A 2X9KA 3DA3A 4E1TA 2XTQA 4O4XA 3V8UA 4C4VA 4N59A 5EE2A 4G75A 2F1TA 1ZHWA 3T0SA 3UU2A 1ORMA 3VY9X 5PRNA 4Z3TA 1S5LO 3PGSA 3LK41 4GF4A 2ERVA 1PHOA 4JCHA 4FT6A 3SYBA 3A2SX 4FRTA 1E54A 5DL7A 3SYSA 4RLCA 1HXUA 2KC0A 5KAIO 3VZWX 4UB6O 1GFOA 3JCUO 1H6S1 3BRYA 1BH3A 2ODJA 4JFBA 1IZNB 5B66O 2XG6A 2Y0LA 5G39A 5G3AA 3VY8X 2KDYA 3VZTX 3SY9A 1BT9A 2O4VA 2J4UP 2M06A 5DL6A 5FVNA 4AKRB 1IZNA 3AAEA 2KXPA 3A0HO 1GFPA 4FOZA 4AKRA 2Y2XA 2F1CX 5DL5A 4FZLA 3PORA 1THQA 1T16A 2IWVA 4AYDC 3A0BO 5D5DA 4D65A 1QJ9A 2J1NA 4FESA 3VZUX 3G7GA 2W81C 3GP6A 4FQEA 5G38A 3LK42 3QRCA 4LSFA 2WVPA 4AYNA 2GE4A 2YPVA 5E79O 4BUMX 1ZHYA 4KR4A 2R88A 2R4NA 3PF1A 3DZMA 4AZLA 4O4UA 3SZVA 2PORA 4K3CA 4O3ZA 4UB8O 3KVDD 4RLBA 2XE3A 4U9CA 5G26A 3WU2O 3PRNA 3SY7A 3AAAB 4D5UA 4RL9A 1OPFA 1Q9GA 2K4TA 2OMFA 3HOEA 5GTHO 3HOLA 4C69X 1G90A 2KZ7B 1QJPA 2F1VA 1MPFA 3DWNA 2LHFA 3WI5A 1YS5A 1ZHXA 3POQA 4LSIA 5H2FO 5KAFO 5GV0A 3KZIO 3UAQA 1OSMA 3AA6B 3C5OA 4C00A 2M07A 4O3WA 3JTYA 3POUA 4D64A 4E1SA 2R89A 4G76A 4FSOA 1QJ8A 2R4OA 3K19A 4LSEA 4XNKA 2X27X 4QQ1A 2N2LA 3PGUA 4O3YA 3LK3B 4FZMA 4IL6O 4AYID 1P4TA 4AFKA 3LK2B 2R8AA 3O0EA 5AFUK 4FSPA 4GHBA 2JQYA 4FUVA 4PJ0O 3PQSA 5T5FA 4AYEC 2XE2A 8PRNA 3LK3A 4N75A 4AKMA 3DWOX 4KR8A 5IYUA 1T1LA 3PQUA 4F4BA 3LK2A 2WJQA 3AA7B 3AA0B 5B5EO 1HXTA 3HWBA 1GFQA 3NSGA 1MM5A 4GCPA 3SZDA 3NJTA 2XE1A 2W80C 3QRAA 2Y0HA 4LSHA 2ZLDA 3AA7A 3PGRA 3AA0A 3EMNX 4FRXA 2FGRA 4GCQA 4PR7A 4FZNA 4RJWA 3RBHA 3VE1A 4AUIA 4GCSA 2LFUA 5JDPA 3AAAA 2ZFGA
chains in the Genus database with same CATH topology
2R4PA 3PGUA 3BRZA 3PGSA 3DWOX 1T1LA 2R89A 3BRYA 1T16A 3BS0A 3DWNA 2R4OA 3PGRA 2R8AA 2R88A 2R4LA 2R4NA 3PF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4P A;  3PGU A;  3BRZ A;  3PGS A;  3DWO X;  1T1L A;  2R89 A;  3BRY A;  1T16 A;  3BS0 A;  3DWN A;  2R4O A;  3PGR A;  2R8A A;  2R88 A;  2R4L A;  2R4N A;  3PF1 A; 
#chains in the Genus database with same CATH topology
 4K3B A;  3BRZ A;  6PRN A;  2WJR A;  5ADX K;  2N2M A;  4O49 A;  2KZ7 A;  5DL8 A;  2K0L A;  3VE2 A;  2R4L A;  3BS0 A;  4CTD A;  2Y7S A;  2JMM A;  4N58 A;  1MM4 A;  4XNL A;  5AFU L;  3AA6 A;  5GTI O;  3WI4 A;  2AXT O;  3POX A;  5TIS O;  1BXW A;  1HXX A;  2XTR A;  4N74 A;  2IWW A;  3DA4 A;  1ZHT A;  2FGQ X;  3AA1 B;  3AAE B;  3TZG A;  3FYX A;  3HW9 A;  2MHL A;  1Q9F A;  2KXP B;  2QTK A;  2XE5 A;  2Y0K A;  4PUX A;  7PRN A;  3AA1 A;  4RJX A;  4O3X B;  4KRA A;  3T24 A;  4FMS A;  3UPG A;  4C4V B;  4AYM C;  1ZHZ A;  3T20 A;  5ADX L;  2YNK A;  1PRN A;  2PRN A;  2R4P A;  1GFN A;  2XMX A;  2MNH A;  1GFM A;  4B61 A;  2X9K A;  3DA3 A;  4E1T A;  2XTQ A;  4O4X A;  3V8U A;  4C4V A;  4N59 A;  5EE2 A;  4G75 A;  2F1T A;  1ZHW A;  3T0S A;  3UU2 A;  1ORM A;  3VY9 X;  5PRN A;  4Z3T A;  1S5L O;  3PGS A;  3LK4 1;  4GF4 A;  2ERV A;  1PHO A;  4JCH A;  4FT6 A;  3SYB A;  3A2S X;  4FRT A;  1E54 A;  5DL7 A;  3SYS A;  4RLC A;  1HXU A;  2KC0 A;  5KAI O;  3VZW X;  4UB6 O;  1GFO A;  3JCU O;  1H6S 1;  3BRY A;  1BH3 A;  2ODJ A;  4JFB A;  1IZN B;  5B66 O;  2XG6 A;  2Y0L A;  5G39 A;  5G3A A;  3VY8 X;  2KDY A;  3VZT X;  3SY9 A;  1BT9 A;  2O4V A;  2J4U P;  2M06 A;  5DL6 A;  5FVN A;  4AKR B;  1IZN A;  3AAE A;  2KXP A;  3A0H O;  1GFP A;  4FOZ A;  4AKR A;  2Y2X A;  2F1C X;  5DL5 A;  4FZL A;  3POR A;  1THQ A;  1T16 A;  2IWV A;  4AYD C;  3A0B O;  5D5D A;  4D65 A;  1QJ9 A;  2J1N A;  4FES A;  3VZU X;  3G7G A;  2W81 C;  3GP6 A;  4FQE A;  5G38 A;  3LK4 2;  3QRC A;  4LSF A;  2WVP A;  4AYN A;  2GE4 A;  2YPV A;  5E79 O;  4BUM X;  1ZHY A;  4KR4 A;  2R88 A;  2R4N A;  3PF1 A;  3DZM A;  4AZL A;  4O4U A;  3SZV A;  2POR A;  4K3C A;  4O3Z A;  4UB8 O;  3KVD D;  4RLB A;  2XE3 A;  4U9C A;  5G26 A;  3WU2 O;  3PRN A;  3SY7 A;  3AAA B;  4D5U A;  4RL9 A;  1OPF A;  1Q9G A;  2K4T A;  2OMF A;  3HOE A;  5GTH O;  3HOL A;  4C69 X;  1G90 A;  2KZ7 B;  1QJP A;  2F1V A;  1MPF A;  3DWN A;  2LHF A;  3WI5 A;  1YS5 A;  1ZHX A;  3POQ A;  4LSI A;  5H2F O;  5KAF O;  5GV0 A;  3KZI O;  3UAQ A;  1OSM A;  3AA6 B;  3C5O A;  4C00 A;  2M07 A;  4O3W A;  3JTY A;  3POU A;  4D64 A;  4E1S A;  2R89 A;  4G76 A;  4FSO A;  1QJ8 A;  2R4O A;  3K19 A;  4LSE A;  4XNK A;  2X27 X;  4QQ1 A;  2N2L A;  3PGU A;  4O3Y A;  3LK3 B;  4FZM A;  4IL6 O;  4AYI D;  1P4T A;  4AFK A;  3LK2 B;  2R8A A;  3O0E A;  5AFU K;  4FSP A;  4GHB A;  2JQY A;  4FUV A;  4PJ0 O;  3PQS A;  5T5F A;  4AYE C;  2XE2 A;  8PRN A;  3LK3 A;  4N75 A;  4AKM A;  3DWO X;  4KR8 A;  5IYU A;  1T1L A;  3PQU A;  4F4B A;  3LK2 A;  2WJQ A;  3AA7 B;  3AA0 B;  5B5E O;  1HXT A;  3HWB A;  1GFQ A;  3NSG A;  1MM5 A;  4GCP A;  3SZD A;  3NJT A;  2XE1 A;  2W80 C;  3QRA A;  2Y0H A;  4LSH A;  2ZLD A;  3AA7 A;  3PGR A;  3AA0 A;  3EMN X;  4FRX A;  2FGR A;  4GCQ A;  4PR7 A;  4FZN A;  4RJW A;  3RBH A;  3VE1 A;  4AUI A;  4GCS A;  2LFU A;  5JDP A;  3AAA A;  2ZFG A; 
#chains in the Genus database with same CATH homology
 2R4P A;  3PGU A;  3BRZ A;  3PGS A;  3DWO X;  1T1L A;  2R89 A;  3BRY A;  1T16 A;  3BS0 A;  3DWN A;  2R4O A;  3PGR A;  2R8A A;  2R88 A;  2R4L A;  2R4N A;  3PF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...