2R4RH

Crystal structure of the human beta2 adrenoceptor
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
217
structure length
217
Chain Sequence
EVQLQQSGAELARPGASVKLSCKASGYIFTDYYINWVRQRTGQGFEWIGEIYPGSGNIDYNERFKDKATLTADKSSSTAYMQLSSLTSEDSAVYFCVRGFGYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSAVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Beta-2 adrenergic receptor
total genus 30
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rH02
5AAMA 1TLKA 4QHMA 4X8JB 3SY0B 3OHXB 3HC0B 4DQOL 1UM6L 3FFDA 3UYRH 5DMKA 4ONFL 3W9DA 5B39B 1XGYH 1CD0A 1KN4L 1RIHL 1UWEL 1YEGH 5BZDB 1Y6NR 4KVCL 5F7LB 4GSDH 4CU7A 3PWUB 5DMJB 2W0FA 5BV7H 1I3RB 1PAMA 2HTLD 2GAZA 3BYTA 4POZC 4OCRH 2H2SD 4EVNA 2V5MA 4PRPD 4XXDB 4PJEA 1ZXQA 2RHEA 4EN3D 4L8DB 4JRYA 1A1MB 1XT5A 1AKJB 4XX1E 3FFCE 5EU5B 2IBBA 1S7RB 4KK6C 4ZUSA 1A7BA 3N1QC 3MREA 3DUSB 3QI9C 3FB6A 3O6FD 1A6VL 3STZB 1FRGL 3S36L 4YBHA 1KYOK 2DN7A 1L6XA 3IDXH 1TCRA 3TM6A 1HEZA 1C7TA 1UXWA 1UWEH 1CFBA 1YEGL 2GW5A 3AROA 3NIDE 1MJJA 1UH4A 3LKNB 2Q6WA 3FN3A 4JRXD 5CILH 4PJGF 5D5MF 1G9MC 3D39E 1W8OA 2UY7A 3DGCR 3MV8D 5ISZD 1JZ6A 4Z7VE 1I8LA 5I6XB 1U91B 3VMOA 4L5FL 3VD4A 3BN9C 2NY0C 3GBNL 2EYRB 3RVTD 4PJ7A 1ZVYA 4UOW1 2O61A 5M94B 2BOBA 5BW7C 1WAAE 3TNMB 3AAZA 1T1XA 5KTEL 4M00A 3UPRB 1UB6A 4R97B 1Y6MR 5F93C 1KB5L 4XI5D 3BEVA 3DRTB 1AGBB 4UV4L 2VLRB 4GKOA 5GGQH 1KJVB 1GCFA 3L5HA 3EOTH 1CBVL 2F54B 3BZDA 4OIAA 5I73C 1QBMH 3WDHA 2VTFA 1TCMA 1HN1A 1K8DA 4PRPE 4OZFA 3EW3B 4YHOL 1IBGL 5IVZA 4EN3B 1BF8A 3TCXA 5HYIA 3BO8A 3SDAA 3P4LA 1Q0YH 2D7TH 2XKUA 4NWUL 4OLUH 5E4IA 2WBJB 1QQDA 4QY8A 2KL6A 3PHOA 4G9FB 1WZLA 3GNML 4ZUVA 5ALBL 1MHHA 1G1CA 1FLRL 4HZLB 2VOTA 5DJCA 1HIMH 3UJTH 3V0WH 4ZOBA 1F4YH 4AQOA 4PV8B 4PJXB 2VDLH 4X7FC 1GOHA 3QULA 2QSCL 3CX5J 5JOPE 3V0VB 5HDBF 3U30B 1F8TH 1NL0L 1P7QD 3QQ9C 3W5MA 3T1WA 2ZCKH 1TZHB 2DIJA 1YMHB 4M9PA 5CKAA 4EQ3A 3PGDA 5DK0A 3QIWA 3VWKB 4EOWH 1M7DB 3O11A 3MCG1 4ZUTB 4KH2A 3WO3B 2YA2A 4OCWH 4CKVX 3GNMH 1Q9KA 4M7ZC 5I8CA 3ZSTA 5FDWB 1UH3A 1FNFA 3B4NA 1I1FB 3DSNA 2F54E 3SDXA 5EZOH 1J88A 3DRQB 1PEWA 4OLYL 2W60B 1LE9B 2I9TA 5C71A 1N8ZA 1EV2E 2X10A 3LEXB 2DMCA 2H2SC 4GMTH 4MJ6A 1XCQB 1AC6A 3ARPA 4HUUA 4PUBL 2JCCE 3UTPE 2DM4A 2BCKA 5DHVB 1Y18B 2R1XA 4NN5C 3UTTA 2XWJB 3FRUA 2DM2A 5DT1H 5HDQH 1BOGA 3VG9B 4LPWA 4YC2C 1KC5L 4GW4A 2AV1A 2Z35B 2A38A 3WN5C 4QO1A 4FTVD 3O2VL 3I6LD 1Z9SA 4Y5YC 2HMID 3OKMA 4GW5B 2A6KA 2WLYA 1LDPL 3NIGE 3VRJA 1HSAB 4N5EC 3HMXH 4N8VB 5JW3H 3TEUA 5C0BB 4G6AD 4LK4A 3DXAE 4UAOB 4GAYB 3AVEA 3OAZK 3IFNL 2R1YA 2MCPH 1DUZA 4ZTOL 2AQ1A 1IAIL 2HFGL 2C3HA 4HSQA 2ITCA 1GVIA 3CSYB 1S9VA 5AZ2H 1JGDB 2V6HA 3UTSB 4ODVL 2NX5E 4KUCF 4U6XB 5HVWA 5LG1A 3W9EB 5DTFA 1ES0A 5F7KC 4G8GD 3U79A 4DFIA 5IBUB 5I1LB 2WINB 2X4OA 1EAJA 2NR6D 3VRIB 3KPTA 2PTTB 4U2YA 3SE4C 1T89A 3CSBA 1ZA3A 5HYSA 4TOYL 3S35L 3KYMA 4CMHC 3GSWA 3IDIB 1L0QA 1PX4A 3HE7C 3V7AG 4JY5L 1YPZA 2JK5B 3ZL4L 5JXED 3THMH 1CDJA 2HVJA 4YXKL 1U8MA 4N8PA 5FM5M 4QRPD 1HCFX 3WHXB 3P0YH 4M5YL 3RGVD 5F7YC 5F6HI 4P5TC 1GGYA 4NNXA 5EN2A 1EHXA 1NSNH 2O26U 2QSTA 1BFOA 4L3CB 1EGJA 5IGXH 3C6LB 3TJEL 4AIZB 3RWJB 2E7LA 1X4YA 4X9BA 4HXAL 1IKNC 3JWDL 1BLNB 1FFPB 3MLSL 2C3WA 5B38A 3DO7A 1NH6A 1TJHH 3DURB 3VXSE 1H8OA 3DNKA 4NJAL 3MRCB 2Q86A 3BHBB 3B2UD 1S7TB 4Y19B 3P0VL 5D71H 4NM8H 5JHDD 1W2KT 2VAAB 3BRGC 3X17A 2EDYA 4TUKL 2CIIB 3MLRL 3W0WA 1UH2A 3HNVH 1S9WA 2Y5EA 4DGVL 4M7JH 3VGGA 3TFKC 1JTOA 3GBML 1L9NA 3EBAA 5B3JE 1B9ZA 3TBVB 5ANME 1G1YA 4HWZA 3FZUC 1NPUA 1YEFH 1QLEL 1SYSB 3PDOB 4P46D 4K94L 2AJXL 4BSWA 1JV5B 6FABL 4MNQA 3CUPB 1JF1B 4IJ3B 4DCQB 2XN9A 5HGHA 3SDDA 1MAKA 2Q8BH 4JN2A 3AU1A 3CXDL 5IBTH 2GTZA 4M1DL 1JGLL 4RIRB 1OGAE 5I74B 2P8MA 5JLZB 1NEZG 1YEKH 5LXGL 3TGXA 1WBXA 4H20L 2EC9T 4PB0L 4HIJA 4ETQA 1EUUA 3WS6C 4QXTA 2ESVD 5MEND 5MEQB 5FYJD 4RGOL 1SVZA 5I71C 2ZG3A 4HJJL 4LPTA 1GHFH 2V5SA 3TBWB 1S9YA 3TA3C 1NGWB 3EO0B 4PFEA 1T5XB 3MRQA 5DJXA 3NIFF 1GGIL 2WM0A 3SBWC 1FL5B 4HDIA 2XTJE 4NO0D 4NO3B 4HT1L 3INUL 1JPGA 1QFWL 4RAVA 1XZ0B 3W11D 3NH7H 3FONA 4NQVB 3HPJB 5HI4D 3ZTNL 5I8OH 3MRMB 1GZQB 1VPOL 1KJMB 1WBYA 1U8QA 3DSFL 2RFXA 3ZKQD 1G9MH 3NCMA 2FL5B 1LD9B 4KJYA 1CGSL 4MD5B 2P44B 4KKLD 2F53B 5LQBH 4ZS6C 1TVHB 3D25A 3P0GB 4ETYA 4ONHA 1VFAB 1KFAH 1JN6B 1PQZB 3K1DA 2BFVL 3L5XL 3KXFA 3L7FB 1ZANH 1H8SA 4OCNC 5GS1A 1V3LA 4JPVH 1R5IA 3W81A 2WSKA 5ADOH 5E08L 3SE8L 2W1NA 4LQ1A 2VXQH 2A6JA 4R7NA 2GT9B 3INUH 1GOGA 3DLQR 4LLYA 1I4FA 2CKBB 5K9OA 2EIEA 4OZGF 5EC2A 4ODSL 1UM6H 1KOAA 4HJJH 2R0ZH 4L9LA 4M62H 4OBSA 3G6JA 5DMIL 3LN5A 1VACA 2NY2D 3ARDD 4XPGL 4FQCL 4JDTL 3QA3B 5LWYH 2ZUSA 1CE6B 4MS8D 4PS4L 3MBEA 3TIDA 4CL7A 2GJZA 4JRYD 1INEH 3WFHB 3HZYB 2YD9A 1X5IA 5C0BD 3KPLB 4I3GA 3ULSA 4N9GB 1MCDA 4I2XB 3IDMB 5DQDH 5GRZA 2VISB 2HRLA 3M17A 4KXZH 1EK3A 4YFLF 5K9KA 2AEQL 2NYYD 2LFGA 2IH1A 1DEEB 4YHMH 2BNQE 3TIDB 4P2QB 1RHHB 1XGYL 3BP4A 3GSXB 4HKBB 3MRRB 1MCQA 4PRID 3OKDB 3S37L 5DJ0A 1KLGA 4NPYB 4MB3A 1VACB 1I9JL 3MBXH 4LVOC 2AEPH 1A3LL 1MHPL 4S11A 1YDPB 1ORSB 3FL7A 4Y4FA 3MRLA 3DGGA 2QHRH 3H7BA 3NFPB 1JWMB 4FXKB 4JFXB 4G8GA 4NKMA 4AL8H 5KN5A 4XT1C 4W4NA 4UIMA 1FVEA 5L6YH 1JWSA 1DBBH 4J6RH 2EC8A 1ZVSA 3NIGF 4MMZC 2BVEA 5DYOA 4XP4H 5AWNH 4U1GC 4PLOB 3QUMB 3AS3A 4HCRL 1R5IB 4HKJB 4FOMA 2MKLC 5BOZG 5DJDB 2YA1A 5FUZL 4R0LB 4PJEF 2R29L 5F96L 3ARFA 1D7FA 5HPMA 4GBXC 2NY7H 2YXFA 3IB4A 4M4RA 2E6QA 2Y7QB 3C8HA 4N0FA 3FQNB 5IW3A 3P4OB 2H32B 4L4VE 4G43A 4NQDD 4GRLA 3V6ZA 1KCRH 5FYKH 4MAYB 2VR4A 1U8QB 2CLRA 4R4FL 4UB0L 1V7ML 1Y6KR 3FT2B 2VDLL 3JV5A 2DLEA 5C07A 4J3VA 4J3UA 3QDGE 4XPGH 4JZJA 1HIML 1A47A 3QUYB 3EYQD 2R9HC 2YD3A 3L1OL 5E8EA 1AO7D 2NTFA 4R3SA 5C70A 4X6FB 2VDOL 3BPCA 4HIEB 5CJBA 1MAML 2N1KA 3TIEA 3IFLL 5JOFB 2J8UA 2IQAA 5IQ7H 2ZPKL 2J5LB 4KPHH 5GS2D 5DI8A 5L2KE 2GSIB 3S35X 3GIVB 3P3YA 4LCWB 2B1HH 4QHUA 4XP9L 4NP4L 1OAUL 2CK2A 5T1KA 3ULUD 2P8MB 25C8L 4MQ7A 5BVPH 1NMBH 4P9ML 1ZGLP 1SY6H 1Q1JH 1OARH 4KI5F 4LVNC 1S7SB 1G7HB 5I1JH 4H1LA 5JTWA 5T3ZE 2ZOKA 5J0BA 4P3DA 5EZJB 5TDOA 1FSKB 5C0JB 3TA3A 3IFPA 4JRXB 3QQNA 1Q1JL 3WE6A 1TENA 2NXZC 2IPTL 4L4VD 3QJFB 3RZCA 5KZCB 4HLJA 3BH9A 4G5ZH 2VH5L 4RFEA 5E2VH 5D1QB 5FV1L 1A1OB 4XP9H 4PP1D 3WHE0 3SE9H 2MPAL 4FQLH 4XVJL 1DQQB 1LK3H 1I9RH 3F7QA 3F65A 4JHAH 2P1YA 3ULVD 3QJHA 1QA9A 4Z7WA 3QUYC 4HUWB 4XBPA 4MA7H 4JREB 3EDKA 5EU6B 1NQBA 3I6LE 4I9WE 4D3CL 2DS4A 2DQDH 4G42A 1J8KA 4OSUL 4F7CA 1TJIL 2EE6A 4NJ9H 3BXNB 1E4JA 1G7IA 4D0CA 1VCAA 2CR6A 3HG1E 3QEHB 1BBJB 1RI8A 2W92A 5ILTL 2GFBB 2IWGA 1IAOA 3VFUB 3FHAA 1NLDL 4HS6B 4Q6IB 3ZDYF 4XCCH 1U3ZA 3MLWH 2NW3A 1RK1B 1UEMA 3GBNH 1PKOA 3U9PL 5D93C 4AG4L 3DROA 4XBGA 4P48A 1Z5LA 3QISA 2E27L 3BZFA 3QXWA 1RJYA 4HFUH 4Y88A 4DAGH 5D72L 5ACZA 1I1YB 3KDMA 5J1AA 1CXEA 2XRAL 2OR8A 4QCIA 4NZUL 2J12B 3RKDC 3LSOA 2ICEA 4TQEH 3IJSB 3VH8B 3BGMB 1SJHB 3MO1B 2XQYG 4XBGB 5DZOA 1FH5H 2YMXH 4GG6B 1D5MA 2H2PD 2MQ3A 1IAKA 1FO0H 1U0QA 1I9IH 4G8IA 3GI9L 3P0YL 4M5YH 3JTSB 3TZVC 1U93B 1AR1C 4WU5B 3IETB 2R0KL 4UIKL 1FYTB 3ARDC 1L7IH 5E9DD 5T3ZH 1WWCA 4WFFD 5INCB 4H25B 1OP5K 1JI2A 1S8DA 5EU6D 4OF6A 5MENB 4IMLA 4YJZL 5H8DA 1XGUB 4YHZH 3MBED 3CSGA 1JHKH 3QXTA 4HUWA 2R4SH 2HFEA 4HEPG 2EIZB 4QXGL 5DRXB 1TMCB 4JKLA 3OKNB 2W60A 2G2RA 5DJAB 3RAJH 3S5LB 3IJHA 4LSUL 4P2RE 1EIBA 5CIPH 4AIOA 3R4DA 1JNJA 1IMHC 4P4RA 1WWAX 3T0AA 3QJFA 3RZCB 4YDKL 3GSNH 4B50A 3HI1B 3QXAB 1IC5H 3A6BH 5D2LE 5F3BA 4KVNL 3BD3A 4IMLB 3CVHL 2P5EE 3WIIL 4ZUTA 6CGTA 4IOFC 1C1EL 5FA3B 1AXTL 4WWID 1KLUA 1J0JA 4HD9A 3PNWA 3S4SB 4WWKB 5JMOC 2X4NB 2J1KA 1ZS8B 4I2XE 2YSSA 4G8IB 1IKFH 1JRHI 3EOYG 3FMGL 2ICWI 1IAKB 5HPOA 1A22B 1OSZB 2P24A 2X4QB 1QG3A 4K3GA 4LCWA 4LCCA 2PR4L 3BGMA 3GIZL 3LS4H 5TPWL 2QQNL 1MCJA 2FH8A 3VG0H 2BY1A 1NBZA 4UOJA 2CLVB 1BX2B 3QUZD 2G75A 3L5XH 4LQFL 5HDLA 5KSUB 4UT9L 5K59F 4DKAA 1T3FA 4N0UA 4EDWH 4OKVB 2A6IA 2J8HA 4IMKC 4KROB 3LQAH 3ELAT 4M43L 4F58L 1K8DB 5AG8A 1LO0L 3L6FA 3GMMA 1T2QL 4TVPE 2Y07L 1ZT1B 2DKMA 5D6CB 2ED8A 4NZDA 2ADIA 1RMFH 3LB6C 4RGNE 3ZT7A 1C16A 2NLJB 1RK1A 1JGUH 4U1JA 3C2AH 2A6DA 2NW3B 3QUXD 1T0MB 2QR0B 3CFBB 2VR9A 4NZRH 2YUXA 1EFXB 1KPVA 4GRMB 4JO1H 3H9HB 5JIPA 1H3PL 4BKLA 5CZXD 4AH2B 5E2UH 5D7LE 2ENYA 3MLYH 3N9GL 2CDFA 1MQKH 5E1AA 3W0WE 2Z92A 1HILB 2WUCL 1JP5A 4OZGB 3ZT6A 1QA9B 3DVGA 4PS4H 3UEZA 2VJXA 4Z7WB 5KANI 3LS5H 4BFIA 1MIMH 1R3JA 4P2CG 5HHOB 4UT6L 2Z31B 3QP3A 4QRRE 1VB9A 1XF3B 2P8PA 3SKJH 4LLVA 3EYSH 3L9RA 4QTIL 5D1ZA 1G9NH 4XC3L 4MJ5B 3RWGB 1A5FH 4C56D 4GG6F 3FB6B 5GGRB 5IR1A 1FC1A 1LO0H 3O81A 4KI5E 3OKDA 4ZPTA 3QIBB 5GGUB 5EOCJ 2JELL 3U0TB 4P49A 4XC3H 5BS0A 1RMFL 2QLVB 4IHOB 1PG7X 2IH1B 4EVNB 4HBCH 4WI4A 3GSNA 5DRZA 2AK4A 2IH3A 5GISL 3NA4A 1FORL 3B6SA 3S88H 4JFFD 3KPMA 4IRSD 3QFJB 1U3HD 2OTWA 1KXVC 5EU7C 1C08A 1FG9C 5JDSB 1F11B 4GAGH 2CO6B 4XPBL 3WBDA 3WFHA 4R3SB 2NTFB 2WMPA 2CKBH 4G6KL 5L2JA 3ET9F 4P2OD 1YN7B 4PJDF 1FC2D 5KVDL 4CDGC 3LY6A 5I1IH 2H8PA 5L88L 3VFTA 1AHWB 1HSBB 4GKZA 3SN6N 3X3FL 2MTPA 2WIMA 2WQRA 3FQRA 4EBQL 3F6LA 1UT9A 4LVHC 3ZDYE 4HQQH 1AFVL 3MV01 1IILE 4NQDA 4ZD3L 1G7QA 5T5FL 4TSBH 1K6QL 2DOCA 3U36A 1W72A 3RPIB 1UADC 4BH8A 5I1DA 5LWYL 2DD8L 1DBMH 4QRRA 4WI2A 2YUWA 3D0LA 3G5XB 4JB9L 4NKOB 1W0VB 2DLTA 3EJJX 4G6JL 1CGVA 2I5YH 3NIDF 2APWA 4N5ED 1U9KA 3C08L 2J8OA 3EFDH 2AV7A 5CBAB 1FIGL 4F7TA 3CVIL 4AENB 5H2BB 3S37H 4TRPH 4CVXA 3BGAA 5JW4N 5IT2L 2OTWB 4X4ME 4L1DA 1ODAA 1CXKA 3DV6B 3D9AL 1MFDL 3O9WA 1GZPA 4PR5A 1JWUA 2Y6SD 2RJMA 1HH6A 3U83A 1MRDH 3GSNB 1Q0YL 5E7FA 4NM4L 4TPRH 1IAIM 4KQ4H 3WJLA 1YDPA 2WUBH 3R0NA 3UJIL 43C9A 5D1XB 3IT8D 5EWIH 3PL6A 3KNBA 4NRZB 2A0LD 2Z91B 5GRYA 4QGTA 1OLZA 4QF1B 4BFBD 5IHZA 4YFEA 2ZCHL 3C60A 2R9HD 4HWUA 3E6FA 1KTKE 4KQ4L 5KSAA 4P0DA 5J6HA 5H37H 5MP6H 5K9KB 1WJ3A 5IMOA 3WIFB 4XX1G 4KV5E 2DWEA 3N1MC 1VERA 3LKRA 3M1BA 4Y4FD 2DQIL 1NC4B 3U7YH 4R6UA 4P23D 4HWBA 1LP9F 3B9KC 3O2DL 2RCSH 2VLKD 3AU1B 3IFLH 1RZ8B 1JTPA 2Y9RT 3BDBA 3CVIH 5EU6E 2BNQA 4HKZB 4KHXL 4Z76A 3P9MB 3TCLB 3LHPH 1GH7A 2X6MA 4TUOB 3IDNB 5DWUL 5SV3A 3GSOA 4AK1A 4LKXA 1IGCL 1U8IB 3FTGB 1KIQA 5ID0B 4HJGA 1A4KA 5ALCL 2DI8A 1NCCH 3KPSA 4XCCL 4DKDC 2FHCA 3DI3B 1AH1A 2CK0H 3ZKND 1N0XH 1QLFB 4JVUA 3MV7A 4I0PA 1PKQB 4ZMAT 5IMOB 4NFDA 3T3MF 3O4LB 3L3JB 3H9SA 3QWOB 1FZMB 3M8OL 3L6FB 2HTKC 2ZUWA 1QOKA 2GT9A 5D7IA 4WI7A 1NUDA 1NC2D 2D0FA 1FNGA 2GCYA 5ALBH 4KHXH 3RX5A 3K4DA 3SCMA 2WZPD 1MCWW 4QF1A 4H88L 3LKOA 2BHZA 2VXUH 4QRPB 2ZJSH 1QSEA 4FQIH 1IM3A 5C0EB 3VFNB 4MXQD 1Q9OA 4U1IB 5D2NC 5DS8A 5D7LA 3BKJH 4LGSB 4Y7MA 1JWUB 3V9FA 2P45B 4I77L 3IDIA 3MV8E 1MHCB 2WQ8A 4G7YH 4X4YB 3EDEA 4K2UH 4FP8L 4ZDHB 5CEZL 3A67H 2E7MA 2WAHA 4NBZB 1OB1A 3FZUD 1ZS8A 2YSSB 4MNQD 5J4MA 1R0AL 3U6RA 2AJ3A 3QEUB 1FL5A 2NY0B 4HDIB 4UB0H 5I9QC 2Q76B 5C0CE 2Y6SC 4U6XA 3MNVB 2AJUH 2O5ZH 2VIRA 3V2AR 1WV7T 5F70A 4D3CH 4P9MH 5I8EA 4GLRI 2YBRB 5I75C 5C0AD 2ADJB 4XVUC 2B4CC 2C1PA 2P8LB 2OP4H 1BF2A 3OGCB 1MFEL 4XVJH 1EGJH 1XR8B 1FFNA 2PTUA 5IK3A 1I8MA 1TJGH 1P2CB 4U6HA 2CLZA 1T7VA 1OQXA 3Q5TA 3LN9A 1PZ5B 1ZTXH 3CFDA 3JUYA 32C2B 3DJ9A 4JJ5B 4YXHL 4HPOH 4P4KA 1QVOA 4EXPX 1CLOL 3NVQA 2AXJA 3HS0A 1JV5A 2KUTA 2IFGA 4G7YL 4PG9A 4HPYL 1HKFA 3O45B 4YHLL 2F5BL 3RL1A 3V4VL 1F11A 3BYYA 2EDOA 1KLFA 1CXLA 5KSAD 1FCGA 5C0CA 1BIHA 1H3UA 3VD5A 4XMPL 1F97A 2YZ1A 4JHBA 2GUOA 4PJBF 1U93A 4JZOA 3B6SB 1JGUL 1KF9B 4W70A 4HIXL 2XN9E 3LEXA 3SO3B 1LE9A 5AYUH 3EHBD 3EUUA 5EOTA 1YZZA 5DRZB 1PY4A 3F58H 1IKFL 1I8KA 3CDGA 1PVHA 4KKCC 4LNRA 3SGEH 3VH8A 1MI5A 3DHMA 1CBVH 2DL9A 2QQKL 4FQ2H 4K3EL 1A0QL 3T0ED 5EOQH 5EIIB 3UX9B 3A6CH 1E0OB 3QDMB 1AGEB 3RPKA 5J1AB 4N0CC 1OAXL 1AY1L 5D7JD 4K7PY 3VWKD 3KXFD 3U0WL 2BY0A 1U8MB 4U3XA 1PKQE 2FGWH 3P40A 1DQTA 2XZQL 3O3AB 4QHNA 1JYVA 3DYOA 1RURH 5FECB 3VXRE 2VLKE 3RX8A 4CU6A 3VFMA 1M05A 2Z31A 4M6ML 4LKCA 5HYSB 1F4YL 1IC4H 4TVPH 1ZA3B 5HHOA 3WYRA 3RAJL 2AEIT 3VWKC 3BSZL 3OG6B 1A7NL 3ZL4H 3P9LA 3RRQA 4PV8A 2BVPA 1NGYA 3STBA 3C2AL 1ES0B 2I07B 4KRPD 1XGPA 1UWXK 3MROB 3ARDA 2VLRE 1JHTB 3PHOB 4G9FA 3AUVA 4HGWB 3DI2B 3OR7A 2YEZB 3MJGX 4DVBB 1EFXA 3D39D 2EEAA 1EHNA 2ZUYA 2AXHA 1YN6A 3TVMA 3GK8L 5BV7C 4MNGE 1EFQA 1KENH 2P42B 3WV0A 1D9KA 5KVFH 4NCDA 3N50A 3BEWB 3KLAA 4RDQG 3MCLL 1VGKB 5L9DH 1BBDL 3BH9B 3QDME 1NC4D 4XBEL 3P30H 1RJLB 3WE6B 4OKVA 3VD7A 5DQ9A 4HUXA 1BOGB 2BDNL 1JUFB 5F9WC 3SQBA 3EDDA 2YC1A 5DFVD 4NIKB 4S2SB 3RWIB 1MH5A 2FATH 5TDOB 3VXME 3T2QA 5IMLB 2BNQD 5EBWA 4PJXE 4KJPC 2O61B 2LTQB 4HUVB 4H1LB 2E7CA 4HV8A 2ZG1A 2C4FU 4GQPH 4PRDB 5GS0H 1F4XL 1XIWA 3R06A 2VO5A 1WBZA 3LRSB 5MEOB 1OT1A 2K7PA 1DDHB 1XGTA 1Q72L 5D9SB 1CFTB 4UTAH 2DD8H 3WXWL 1TITA 3MLXL 3GSRA 3HRZA 3FB7B 4WWKA 2H32H 2AK4D 4X7CC 4WW2A 3T3PF 3B9DA 5LBSH 5CZXC 4LRNL 5FA3A 2IQAB 2X4SA 3H9SD 4KKAD 4OD2B 5E8OB 4K9EL 2VZ1A 3MX0A 2PR4H 2OL3A 3MLVL 3E1F1 4YZFE 3HI1A 3QUYA 1A02N 1HOCB 1U8KA 2AW2A 1A1MA 4BK4A 1VFMA 4JZJB 3PGDB 3PWPB 1C5DB 2QJDA 3ZKSD 5GGTH 1A5FL 2XZCH 2DBJA 5C9KA 1NANI 2I26N 1JGEB 2ADGA 5C07B 5AG9A 5I18H 3BZEA 4K3DL 3KYKH 1A6WL 1KBGL 3HE7B 4KZEH 1B4RA 1MWAL 3KS0H 3DOSA 5SWQB 3D85D 5EH1A 1P5UA 4EI5B 3WIIH 3W9DB 3PIQA 3QIUA 3GI9H 1XGUA 3L3IB 2Y7QA 4NJAH 4MB5A 5T5FH 5FKPA 4P9HL 5T1KD 3WFEH 4Q2ZB 5A2IH 3HCVB 4FMFA 3C6LC 2XKNA 4L8BB 4M61B 2X9WA 4EBQH 5FA4A 5TE7H 1T6VN 6FABH 3JTSA 3NZ8B 4M6OH 1MPAL 4PJBB 5C08B 1LO3H 4QXWA 1T66C 3CFCH 3CXDH 4P2OB 5IBTL 3PWJB 3HC4L 4KTDH 3PV6B 1JF6A 5GJTH 2XT1B 3IYLW 4YUEH 2WK2A 1YEFL 2PNDA 3QXDA 3EYOA 3DX9B 3MO1A 1QFWH 4JO3H 3WS3A 1U3HB 1NCBL 1EEYB 3DETC 4OQTL 4QRRD 4KK6D 4ZOCA 2YZ8A 4WO4C 3OXRA 5ESAB 3F6IA 1JPFB 1ZHNA 3UBXB 2OJZH 4K71C 4FQXA 3WNPA 1T1ZB 1BOYA 1AP2B 1YUHA 1IRAY 4PJ9D 2IG2H 2N4IA 4JZJC 4KI1A 3MJ9A 4WW1A 3F5WA 1RHHA 2F5AH 2AJZA 4YWGL 5FYLL 2ERJB 4OZIB 3GFUA 1RAMA 1N64H 5DRNA 3MBXL 3LKSB 3T0BA 4BFGA 1U36A 3TPUA 1AGDB 1CGSH 3O6FA 4K8RD 4IDJH 3O3EB 1MCWM 3QZWG 4MDJA 1UXWB 5C09E 5IF0A 3UTTE 1MCOH 3HKFA 3ZTJH 4LHQB 4NUGH 1MELA 1BVKA 1F42A 1I1CA 3GHEL 4OB5L 2JCCA 3MOAH 1IVLA 4LDLB 2VDOH 3KPLA 5SWSE 2BK8A 4ZYKA 2PF6A 3MGTA 1ZSDA 3HNTH 4HULB 3QH3A 3LAFA 3ECBA 1NUNB 5ADOL 5LGJA 4WI6A 1JBJA 3LD8B 4JPKL 1GHFL 1MHEA 5BJTA 4EDWL 4HHAA 2BOCB 4P3CH 2C9AA 3E8UH 1IT9L 5C0CD 5HHQA 2EDQA 5J9PB 2B5IB 5IOPB 2ED7A 5DJ6B 5FUCC 2HKHH 1TETH 5ID1B 1FGNL 1WGOA 3CFEB 4YWGH 5FYLH 4LP5A 3BWAA 2XZAL 1E6JL 4NGHH 3E6HA 2AAVA 2XWTA 2BRRH 3IRZA 1JMZA 5CJQL 4DKFH 3C60C 3D18A 2C7UB 5LVEA 3U46A 5F7MC 5GS1B 2ZOKB 4N8CL 3KPNA 2HLAA 5ECJE 3ROOA 2C1OB 4Z77B 5BCAA 4J3OC 3WJLC 4Z8FL 5I16A 1GRWA 2VXUL 4Z0XA 2Y72A 5DQDL 5FO9B 5F9JB 2EDFA 2Y5TA 2F53A 2MHAA 3K4AA 1S7XA 3MJ6A 3UTOA 1N2RA 4KAQH 2E5EA 3FQWB 4MQXC 2DTMH 4TVPD 3GMNA 1I85A 4KDVA 3A67L 3VXMD 5FHAH 3SDCB 3MV11 1WK0A 3WFDH 5F7NC 4I9WD 3TO2B 5E5UB 4OSUH 3FCTB 3EZ8A 1G7LA 4GJTB 4WY7H 1T5XA 2JKXA 3KYAA 4R96B 4PIRF 1MLCA 5DWUH 2ZUXA 4NP4H 4PJIB 5I17A 4JDVA 1EGJL 2DQTH 3Q6GL 5F7DA 3S97C 3QQ4A 1VEMA 4Q7DA 2I60L 4GG8B 5HVGB 4AG4H 4TTDD 4WUUA 2EE9A 1MCOL 3CSPA 2H26B 4LLMA 4XNZB 1HHHA 5TH2A 1JPSH 3VFGL 4XZUB 3KPPA 4OCLC 4RAUA 2WWKT 4FQXD 5A2KH 5GS1C 2C5DC 4C58B 5FYLE 4BSVA 1A14H 4PP2B 1S7QA 3BIAX 4Z78B 1TZIA 1S7WB 4OV5A 3S7GA 3PHSA 3TV3L 5IESH 4PGJA 2DL2A 1IGJA 2VN4A 5ICXA 5DD1L 3VW3L 3IFNH 4UIMB 4C83B 1UZ6E 2D03H 4JHAL 5E6ZA 1E4WL 1KN4H 3L3KA 1FLRH 2GTWA 5E5RB 1R3HA 2DQIH 2CRMA 1G7JA 1YYMH 2ADFH 3FAXA 4JG0L 1CDUA 4KDWA 3ARSA 1WUNT 4LEXH 4HLZG 4ZO7A 2QL1A 1F2XK 4LAJH 4QRSA 1E4WH 2JJVA 5I75B 4IRSA 4JB9H 5HDQL 1RUAH 2B0SH 1QFUH 3IJYB 1XCTA 3SGKA 4NQEB 2EECA 3WUZA 1J1OL 1P84K 5GGRY 2ZCKL 1DEEA 1VFBB 3B43A 1WWBX 3TNNB 3WS6A 5E8PB 5DQJA 2XQBL 3X3GH 4NO5A 1CZ8H 2UZIL 4X9FA 4WHCA 5GRVL 3QO1B 4GKNA 2WWMD 1WCQA 4G6AC 5GGVY 5M7QA 4O58L 1QSFE 4DOHE 2FJGB 4PY8I 3SDDC 3A6CL 1J05B 2JCCF 2DQFA 3SDCD 5HYQB 2OSLA 1J0IA 2V2TA 2BXYA 1DR9A 3BKCH 2WINA 2X4OB 2VB5A 4JY6B 4F33B 2GJZB 4GT7A 3MGOB 4F9PA 1OTSC 3S6CA 1AI1H 4ODXB 5E8NB 1S9VB 4OCWL 4YZFF 3RWCB 1HQ4B 4JFDD 2D03L 4NSKB 4BH7B 4CAGA 2ITCB 2QADC 3T8XB 4Y1AE 3G5VA 2VH5H 4PBXA 1MJ8H 5BV7B 5AZEH 1OCWL 2VDNH 3NZHH 1I9IL 2XA8H 3NA9L 2R1WA 3HZVA 3X14A 1DSFH 4ZSOE 3L3GA 2E7LC 1X5AA 4LSPH 1FLTX 3P73B 1MJ8L 4MA7L 4TQEL 1J1OH 3ULUC 2AV1B 4GW4B 4LU5H 4YXKH 4DN3L 1T1YA 1V3KA 3HG1D 1MCPH 1OF2B 3I84A 1MSPA 3O8XA 5JW3L 4YC2B 2M2DA 3BI9X 4L4VB 4U1KA 1YPZF 1A7OH 3WN5B 2GK2A 4ONHB 4MX7A 5BO1H 2XPGA 4HS8L 1RVFH 2HG5A 5JPMB 2D7PA 1BJ1H 3HPLA 4PRNA 4Z7UA 5C6WH 4EKXA 3OF6D 3NFNA 5GGSA 1KJ2H 2I9TB 4XWOD 4LHJB 1W0YT 3MA7A 1FL6A 1L7TL 4MWFA 4Y4HB 5FYKU 3MJ7A 5I1JL 3RL2A 5JOEA 3ZE1F 5FM8A 3FO0H 1AIFA 5AZEL 4PJ8A 1H15B 4LIQE 1DQDH 1AE6H 5AZ2L 1F6AB 5L2KB 3UTZB 2V2TB 3MTRA 4EI6A 4U1SA 1IAII 2VL5A 1CQYA 2VRAA 2ATKB 4JHZA 4OF5A 3RGHA 3GB7B 1RIUL 4RFOH 3X11A 1HI6A 4YFDB 5T33H 4NZTL 3ZYJA 3O4OB 2FEDD 1AXSA 4YE4H 4GH7B 3GI8L 4CMMA 5CEZD 5FGBC 5T1DL 5DUMH 4CGTA 2KQMA 1CYGA 5I1KH 2E6PA 1T2JA 3QBTB 3LKQB 2EZ0D 5CP3A 1SMOA 3TZVB 5L7XH 1KYOJ 4KTYA 1JNNH 4RGMC 4BQBA 3P77A 4M6MH 3RWFB 3FO0L 2WWKO 3RVUC 2X7LB 1S78D 1T83C 4S1DC 1P9MA 3RI5K 3HNSH 5CP7A 4O51B 1N64L 4M6AA 5F1NB 4LBEB 5TPWH 4KZDH 2H6PA 5CEZE 5HY9B 4FS0A 5GRUH 3WCYA 3GHBH 1BQUA 1KXQE 1J1PH 1FAIH 4GG6E 3T65A 3P11L 1AQDA 5E8DL 4XNQA 4C83A 1OCWH 2VDNL 3ARUA 4G80A 3T65B 5GS0L 1T03L 5B38B 1BLNA 2X70B 4EIZC 2NX5B 5T1LD 3PWVA 2E27H 2HA1A 1M7IA 4H1LG 3PV7A 1GGIH 5DEFA 1TZIB 4FQ1L 1LEKB 2ZCLH 3O6MH 1UJ3B 3QCUH 3X13A 5IB4A 4XNUH 1ORQB 3LPGA 4PTUB 4GLRH 5MENE 3BGFB 1RUQH 2EH7H 1KTRL 5J12C 1WFUA 1EAPA 5HI4C 5L9DL 4MAUH 3MRFB 2BOBB 5JQHC 1GXEA 1YC8A 1IZJA 3LKQA 5BVJA 3PQYA 1CICD 3BZ4A 3C60D 3V6OE 1F3DH 1AJ7L 1IFHL 4ZAKA 1UZ8A 1QFWI 2ZUVA 4ZD3H 2L0DA 4HQQL 2PTTA 3IDGB 4KZEL 3QDAA 2FJHA 5C92A 4L3EB 5I8OL 2BNRD 1NFDB 3L5WB 2FHBA 3RNKA 2DJUA 5SWSB 2DQEL 1FFOA 1ROWA 4QLRA 4I5BA 5HYJB 5E6IB 4DK6A 4WCYH 2A73A 4L29B 2Y25A 4LLDB 5C86A 1C5CH 3TH2T 4M48L 1I7UA 5DJ2A 4ZUWB 3CVHH 4JRYB 4NZTH 1OWRM 4OFIA 1NC2A 4OZHF 4OZFH 4XP4L 1CE1H 1MPAH 1T21A 1X5JA 3MLVH 3SPVB 3QUML 2MHAB 3HPLB 2HWZL 2UUDH 4DEPC 3PHQA 1DLFH 1LNUA 4ZO9A 5EO9A 5H94B 5D2NA 3WFBL 1ZLVK 2R8SH 4RFNC 1CVSC 3L3HB 3QG6A 3OMZA 1YEEL 4HBCL 5IG7A 5KBNC 1JZ7A 2ZCHH 3HC0A 3MUY1 4YAQB 4YHIB 3FRUB 2C7UA 4PGEA 4QHMB 3L3OB 3QQ9D 3VFSB 3LS4L 1F3DJ 1ZLUH 1KULA 5EU7E 1WTLA 2R1XB 2IAMB 5ETUA 4M5ZL 3OGOE 4HMEA 4YLQT 2YPLA 2A9MH 4I48B 4HUUB 3CFEA 4I4WA 5FCUH 1H5BB 4UQ3A 3LVEA 4JFQA 4I0PC 2I60H 2F19L 3NACH 4G6ML 2FGZA 2ZSWB 4IEFB 1D6VL 4OF3A 3IKKA 4LCYB 1NEZA 4CUCA 4NKIH 2YWZA 3DRQA 4QRUA 5KOMC 5CBEA 3G9AB 1B0RB 5E9DA 3VE0A 4PJHA 4ELMF 2EYTB 3V6FA 1JTTA 4WEUD 1I1FA 2Y4SA 3SDCC 4EUPG 5C0DA 4OUOA 2MQCA 3MGTB 3MCLH 2YUVA 1Q9KB 1ZEAL 4GAFB 1WZ1H 1FQ9C 4Y19E 1EJOH 3O11B 4OZGE 5C0ND 4NKDB 4OCMC 5HHME 1LDSA 1EXUA 4O00A 3C2SA 3LMJH 5JXEA 3LN4B 2BZDA 3BWUC 4YO0B 3LPWA 5JHDA 5FV2A 3CU1A 1YJDH 4N90E 3K2UL 5CJXA 4ISVA 4GRLC 1UKSA 4DWHA 4GKSA 5KSAC 5ICZA 1MY5A 3KWWA 5HYEA 1LO4H 5D5MB 3D2UA 1QBAA 1X5YA 3MYJA 1J11A 4AEFA 3QIBC 4OLXH 3HNVL 3TO4B 4L8CB 4GBXA 1MCEA 1OGAB 2CKBL 4WJ5B 2Z4QB 1OY3B 2AJSL 4PTTB 3O4LE 2IFFL 1GGTA 1R5VA 4KDTC 4X0KB 1T7WA 5KS9A 3QB7C 1R3HB 3I75B 3TBTA 4JZNA 3L3KB 3DYMA 2PXYD 1A14L 5IVZB 4J1UB 2HKHL 4PGDA 4YHPA 3WFDL 4R26L 4W6WB 3PWNA 1FFRA 3KPSE 4U6YA 2A74B 4YGVA 5TJWK 4LDEB 5C8JB 3QFJE 1S7WA 4CW1B 1A6WH 1KBGH 3GSUA 5BVPL 1CIDA 1FN4B 5JXAH 2XTJB 5KS9B 4RQQA 1QLRB 2PYFA 3DRTA 5IFHH 3G5YA 5HDBE 4L8BA 4WU7A 2G60L 2MJWA 1U8HA 3L7EB 4WJ5A 1MFDH 2IALB 2XI9A 3V5HA 3S3SA 5FKPB 5J89A 3D2UB 1BWMA 4XGZA 3C6LD 4FXLA 1IQWL 4PJ8D 1HXMB 2W65A 2F53E 5DEGA 3ZKNC 2VLJE 2GJ6D 5F44A 3ZHDA 2W07A 4GG8A 5GRJL 1KCSH 5SWQA 1C12A 4ODUB 3NFSL 5GGVL 1BPVA 2D7MA 3LKNA 4DW2H 5K9JL 5IEHA 4PLJC 1OVZA 3VXSD 3DETD 3CFJB 2V5RA 3H7LA 1UACL 5E9DE 1EXUB 2EIBA 3FO2B 5D7LD 5JW5A 3VCLA 5E99H 2APBA 3H0TA 4FP8H 4MS8C 1QRNA 3ZDXF 3D3VA 4K7FB 1B90A 1QUNA 4FQJH 1S7RA 2X4SB 2JB6B 4FQIL 1RIHH 2BNUB 4KKLC 4G7VL 2MSPA 5CSZA 4M3KB 4L4JA 1INDL 1RZ7L 1N2RB 1P6FA 5IIEB 2QADB 3FB7A 5I73B 2LU7A 2VXQL 3O6FC 4CADA 4O2FB 4HKXA 4RMUA 5CD5D 2OP4L 2I9LA 4Z0XB 3S36H 4OQTA 4APQB 1MCFA 2VLLB 3NA9H 2C1OA 1DP0A 1WC7A 5AD0A 4HV8B 4PJ5B 4JO2H 4PRHB 4RMQA 3T0WA 4LCUA 4PJGA 1LO2H 3GDBA 3TA3D 3PDDA 5D8JH 4FQHB 2PKDA 3UYPA 3QXVA 1VGEL 1MH5B 3FKUS 2IALA 5T5NF 5T3XE 1ZOXA 1A21A 1Z0NA 4TPRL 3CAFA 5CCKH 3RNQB 4WGVB 2DI7A 1OTSD 1FN4A 4X99A 5FOJA 5GRVK 1MFCH 4RA3A 3EZJB 1CD1A 4YGVB 1LQSR 3BQUB 3BKCL 4MQSB 4C55A 2N7BA 3K81A 4HF5H 1S5HB 4PJ9A 4X83A 3CIQA 4OLZH 4OGAD 4W81A 4X6BA 2HJLA 2YD6A 3UYRL 3SKOA 1R6VA 3RWEA 4PRAA 4YPGA 3F62A 2V9RA 3ISWA 4F2MB 1JZ2A 1G9NC 4FQQB 4HJ0C 4RMVA 1R5VB 4ZUUB 2J6EH 4LFHG 1UQSB 3TN0B 1CT8A 4IBLT 3BAEL 2VLKB 3RIAK 1YNTA 4V1DE 2BVTA 5FGCB 3GJEA 2F5BH 3TO4A 4BZ1H 4O2EA 4A6YH 1T1WA 2V17H 3ESUF 4RWYH 4KC3B 3JTTB 5C7XL 4GUPB 3X3GL 1TPXB 1CDCA 5FK9B 4XPFH 2PYEA 5KAQF 4RZCA 1YEJH 4KK8C 1JFQH 4MNHA 3DV4B 4JY4B 5GS2H 4Y2OA 1XR9A 2QQQA 4PRIA 2NY3B 1S7UA 3FT3A 2FH6A 2CR3A 3QT2A 4NNYB 5ITFB 2X1OA 4QHNB 3MUZ1 1R3LA 3K0WA 1ZMYA 4POZD 4LCIL 3D69B 3D5OF 3TYFA 1WIUA 1JYXA 5EIIA 1CD8A 5SWZD 1UEYA 2H9GA 4QRTA 4E0RA 4LLUB 3MLSH 4PJDE 1T0NB 4RNRA 3DWTA 4K8RC 5ENWB 3IU3A 5DC9B 4WWKC 2NY6B 2VE6B 5GQBA 1QFUL 1VKXB 3VWJD 3O2DA 1I7RA 1HYRC 3F7YA 3QHZL 3QUXC 3WLWD 1GIGH 4XCNB 2GSGA 2MQ0A 2CDGB 1MY7A 1QSFA 1XIWC 4PJFB 3TBSA 1JYNA 4LBEA 4WFEE 4M93C 5ETUB 4Q2ZA 1BZ9A 1KT2A 2Z8RA 3KPRE 4AEEA 1F13A 4TVSa 2ATPA 4ELME 4A2MA 1R3IH 1C5CL 2BJMH 2EDNA 5IJVB 2D9QB 4XC1H 1YNLL 1FBIH 1ZT7B 2XNAB 1SY6A 5DUPH 3L3HA 1NGPL 2MPAH 1LGVA 1FZJB 4JFHD 5CP3H 4U31A 4NNPH 2JB5L 5GGSY 4KTEH 3VA6A 3KLSA 3VI3E 3SPVA 1NMCB 2ADGB 2CD0A 4Y2DB 1RUMH 1P2CA 5CUSL 4YDJA 3SJVA 3X11B 2IPUG 1FVDA 3V5KB 4DTGL 4LRIC 1JRHL 3EFFA 1UWXH 1ZHLA 2O5XH 3EJZC 1EZVY 5I9QB 3WO4C 2P8LA 2W0LA 4OD2A 3HB3C 4P5TB 3RUGB 4LIQL 1I1AD 3QEUA 2BNRB 1LDPH 1D6VH 3IDGA 5TFSL 2YKLL 4JRYE 1QPPA 3EJZD 2D7NA 2OQJB 1UXSB 3GSQB 2ZCLL 3LRSA 3NFNB 2Z31C 1K2DA 1FYTE 4IIQC 3HTLX 1K2DB 5EUOA 4LU5L 4N68A 4O02L 3O0RL 3G6DL 1M71A 3LEYL 2V7NA 4ELMB 4QTIH 4MX7B 3SKNA 4PJBE 2EDLA 4RFNB 3WN5A 5C0EA 3ZYZA 3QWQB 3ARGD 4OFVA 2ENSA 5IW6A 1N3NB 4Y5VC 1AQKH 3SCMB 3LEYH 3OKYA 5EBMA 5DEFB 3T77B 1KJ2L 1RZJH 3QWOA 1FNEB 3KPOA 1AGFA 5IROC 4KFZC 1OD7A 3QUXA 1D5IH 1J8HB 3C9NA 4XNQB 4TOYH 1R5WA 4ZXBD 4EDXB 2VDKH 2APTA 4MXQC 4WVRA 5T1DH 2EO9A 4ODXA 4PJDB 2CUMA 5FYJU 4F7PA 5JW4Q 2XNAA 1CLZH 2I07A 4TNVK 5IJVA 4F80A 1IC7H 2B7DT 2J88L 3RWHA 4F33A 3HE6D 1QRND 1WZ1L 5BMFL 2OSLB 5MI0C 2CUHA 4MJIB 2ITDA 3FT4A 3MV9B 3S34L 2FD6L 4P4KC 3TESA 3WDIA 4GKNB 4QOKE 4F7EA 3ULVC 2WUCH 3DX6A 1XF2B 1FIEA 2J88H 1PBYA 3V7MA 3M1BB 4JO1L 5F1OB 4OZHE 2HH0L 2DWEB 1Z6JT 3GB7A 4JPIA 3IDYB 3FQUB 3KLHD 5FM5O 3RKDD 1MRCH 2V7HB 4OF8A 4M7JL 3D6GA 1XIWD 4JPWL 4PJ8B 5DHYA 5A2FA 2H9GB 3MRGA 4XVSH 2FBOJ 4YPJA 4K9EH 3IF1B 4P2RB 4PJCF 4TULH 5HYFA 1LE5A 4FZ8H 2GIYA 43C9B 3MJ7B 1I8KB 1BAFL 3CDGB 3DBXA 4JANB 4PRBA 3VXRB 4UT9H 5JZ7C 1ZA6A 1K8IA 1SHMA 3SDAC 2FD6H 2OTUB 3V5DA 2IFFH 1JF5A 2XACC 3BIKA 1BZ7A 2J7LA 1A6TB 4PJEE 3IKCB 3WFBH 1ZGLA 2Q7NA 5H37G 5IGXL 1XR9B 2DYPA 2P5EB 3O0RH 4Z7UB 1X7QB 4Z7WF 5JPMA 3MRJA 4LQFH 5GGTA 1V5JA 5I1AA 5BXFA 1A9EB 4FG6C 1MCIA 1L4IA 2VLJA 3GZKA 4PP2A 4NQTA 4LEOA 5I71B 3D0VB 3QG7L 4ZS6D 4HT1H 5JIHA 1H3TA 4KKCD 2AI0L 1LO5B 2R23A 1HINL 1CN4A 4FXGB 1G6RH 2A9NH 2W9EL 5I1HL 2DJSA 2YK1H 32C2A 4KJPD 4XPAH 3FOMA 1BJ1J 1U95A 2H2PC 1RIVL 2IGFH 3H42H 3RQ3A 1RK0B 4LVHB 5F7DB 4ENED 4YK4C 5J11B 5E08H 3GJFB 2DTSA 3ZYIA 4WEBH 4XMLL 5BRZD 3T8XA 1HDMA 2APXA 4BH7A 4Y16D 4XP6H 1U3HC 4LRNH 4D8PB 3MFFA 4PJIE 4BM7A 1OTTC 1CU4H 5F3HA 3CGTA 3KHQA 3LRGA 4FTVE 4K7PL 1YMME 4JHWL 3SGDH 4XCEA 4S1RL 1KCSL 1HHIA 1OGTB 1ADQH 1PSKL 1QLEH 1WF5A 5LQBL 5C3LD 2HYMA 2JELH 1DBJL 5EOCH 3T1FB 5E2TL 1U6AH 1NCUA 4X7SL 1P7KA 4IRJD 4J8RB 1I9EA 4NUJA 3QO1A 5AD0B 2IMNA 1HNGA 2VLLA 2NR6C 5DD1H 4NO5B 2IH3B 4U7SA 1EDQA 2I9LB 4JM2B 4JFZH 4HS3B 1JL8A 3QR2A 4X6DF 2ZNXA 3VRLF 1VFBA 1QSEB 1DVFB 1PZUB 1KELL 4AJ0A 1NCDL 3DECA 4PRHE 1RUPH 3P2TA 5MEPB 5CMAA 3MRNA 4DK3A 1N59A 4JO4L 1D5BB 3OX8A 1YNKL 3U0TA 4AEHH 4K7PH 1MUJA 3DHJA 3PL6C 2XN9D 1K3ZA 1RV6X 2C3VB 4JPKH 3MRBB 3MQIA 1GGUA 4YDLB 4GMSH 4PJHE 3FO2A 2P8PB 2PO6C 4FFVC 5IV2B 3IS0X 4FZEL 3JV6B 1ADQA 4M7LT 1EO8L 2B5IC 4NN6C 5C09B 4YNYB 4POYA 3OTTA 3W39A 5E2TH 3MZGB 2BSED 3DVGB 4NRXB 1ZK9A 4U1LB 2EH8L 2Z92B 3IDNA 3KPQB 3L1OH 5DJZA 4NFCA 1MFCL 3OJVC 4Z76B 3SOBH 4MD0B 2N56A 3WIHH 1IC1A 4BKLB 4MCYA 4GXVL 5D1QD 3MXWH 1S7VB 1O5DT 3H9HA 4I8DA 1A6VH 2ZUQC 3EOBB 1RZIB 4G6JH 4X4MA 4WUUB 5HBBA 5KVGH 3O3EA 3DUUA 3GSUB 1AGDA 1MLBA 4F3FB 3VFRB 3BDYL 3WIHL 3ZKXC 1FNSH 1EEQA 4APQC 4PY8J 3SDAD 4YHPB 3QUZA 4KHTH 1MRDL 5JHLL 4JG0H 1BQHA 4HG4J 2Z91A 3Q1SH 1AD9A 1LWRA 5H35A 4D9RD 1EO7A 3QI9B 2W91A 1JPFA 3BPOC 4OLZL 3K8KA 1BX2A 3ZHKA 2ARJQ 4FZEH 3SDCA 1MOEA 2AS5M 4OZIE 4KK5D 3RTQB 4P23C 5GSVB 1V3MA 4OGXH 3CPLA 2EDKA 3FQWA 4FQJL 1R0AH 4P59L 3L3DA 1A4JA 3HMXA 3DV6A 1S7XB 4NN6B 2X4QA 2Q87A 2R0LL 3ARED 1AO7B 1U58A 3VXPA 3PWJA 3BN9D 1YMMB 4E5XA 5TGBB 1T20B 3NCYP 1FJ1B 5F89A 1KB5H 2OX5A 1ITBB 3SOBL 2AEWA 5FA4B 2HVKB 3VFVB 4UI2A 3PNWB 3U46B 5I1CL 3KPRB 5T1MB 5EZOL 4QYOB 1X44A 1LO4L 2YRPA 1M6OB 3GRWL 5B4MD 1AI1L 5J6GA 2ZPKH 1OD9A 4KPHL 4N8CH 4NZJA 1NLBH 2WW8A 2RIKA 3E6HB 4FN0A 1I9RL 3U36B 4PGCB 5DC4B 1FPTH 4NQDB 2B1HL 3QUKA 3F7VB 4X5LA 3HE6A 1E4XL 1ND0B 2R29H 3CVHB 3QNYB 1SBBA 2GITA 1FE8H 4PYHA 1JNHA 1N5AB 4IOSD 4WTWA 2XFXB 3H9YA 3OKNA 5CCKL 4GKZB 2D4FA 5IJKA 2NY1B 5AWNL 2ZSWA 2YPVL 5DT1L 3VFTB 4U3HA 5M95B 4DTGH 1FH5L 2X89D 3T4AA 5HGBA 2ESVA 2HFGH 2V17L 4QKXB 1IGCH 3MUGB 4KMLB 3RWDA 4XHQA 1QFHA 3IXAB 2JCCB 2R2EB 3DXAD 3VGHA 1NJ9A 3SKMA 5HHXL 4RCAA 1X9QA 2ZJSL 5HHNA 5IVXE 5IG7B 4XCFL 4WW2B 3WD5L 1YYML 3BP6A 3OZ9H 2NXZD 4OAWB 2R39A 1E28B 4Z7VB 3LQAC 1DDHA 3AM8C 1DFBL 4ELKB 1DLHA 2A83A 4ZAKC 2HFTA 3REWB 1T21B 1N5YL 1XIWB 2V2WA 3NCEB 1SQ2N 4YEFA 1ONQA 3LSOB 2X4TA 5C0BE 1I7UB 5DJ2B 1TZGH 2XOTA 4AEIH 1YEIH 4D9RE 1A6ZA 5LJYH 4PJFF 4YHYB 4NQDE 4OLVL 3VXOB 5F9DC 4OT1H 4HUXB 3VD3A 1QBLH 2OTPA 3EYFB 3C8KB 3L9RB 4GRLD 1TQCB 4LCCC 1F4XH 1D5ZB 2FJFA 4ODHH 5DF0A 1R3KA 5EU4B 4KTEL 5HGAB 4Y4KB 1F2QA 4LLAA 1QEWB 3A0OA 1N5YH 4APQD 2VQ1A 1CGUA 2YEZA 2YPKA 3F7PC 1DZBA 5C0NC 5CJ5A 5E2JA 1T0PB 3U4AA 1PFCA 2LE9A 3PQYB 3QEHA 5ESQA 1P9MC 3GJFK 5IVXB 5ESQB 5KSBF 5FB8A 1XF4A 4DGIH 1J8HD 3AREB 1NGYB 4O2CB 1F8TL 3QIUB 2AKRB 2HJFB 4LLWB 5MI0B 1MFBL 4Z6AT 4GAJL 4U1JB 4FFZH 3RKPA 1F3RB 1M7IB 5DVNA 1LP9E 4AIXA 4ZSOA 1I7ZB 1DQJB 1CZ8L 5GSRB 3NOIA 3BZEB 3SCMD 1JRHH 2HN7B 4R4ND 3VFMB 5HHMD 5J3HD 1Q94A 4AEIL 4P57A 3HE7D 4Q9QH 5D96B 1AQDB 5CZVL 4RMWA 4RMRA 5CZKA 5HGDB 3VXSB 5ICYA 1KJ3H 5HD8D 5C2BH 3LQMA 5F1NA 3VFPB 4JRXA 4HH8A 4JQVC 4M7ZB 5CP7B 4OQ1A 5C0JA 1QR1B 4NZRL 4PJ8C 3NCFB 1TXKA 1IJ9A 1K3IA 3PP3K 4Q9BA 2APFA 5TFSH 3QCTL 5JPNB 5A3ID 1G0XA 1G7HA 2YD5A 4PGZA 4PJ7F 4LCCB 4IDLA 3OL2A 5CKGA 1KC5H 3ARRA 3HRZB 4N0YH 4JFYA 4NQUA 2CRZA 1IGFH 2HT4C 3BP5B 3W82A 1BMGA 1F6FB 4I13B 2FGWL 4PJAB 3OR6A 4UU9B 4PLKD 5D1ZD 4UDTB 1LK2B 3GIVA 2RGSA 1RHFA 5HHNB 5B3JF 3SKMB 12E8H 3QFDA 4IS6B 2J8UB 1NBYA 5IMLA 3VXTB 1JNNL 3OKKB 3O8XC 5E5MB 1RJZB 2X42A 3MUGA 1MRFL 3BJLA 4YHKL 5LAXA 5E8EB 2PW1A 3UZEA 5KSBB 1RJLA 1CLYL 4KJWD 2DI9A 2HTKD 1E27B 1YY9D 3AMLA 1GL4B 1QVOB 5JUEH 3B2UC 3TO4D 1FHGA 4MWFB 1EO5A 1XMWA 3FT2A 4Y4HA 2AGJL 3RY5A 5GIRA 4XH2A 4GS7B 4UQ2A 4ZSOB 2CLZB 2Q3AA 5SX4I 3MLTB 1BD2D 3RY6A 3ARTA 4G43B 5DMYA 4LL9A 3QXUA 1Z3GH 3CLFL 1TNMA 4Y5XC 3QHZH 2HG5B 2V2XB 1PG7L 3E2HB 3MNWA 1FAIL 4X6CB 5I8EB 4A6YB 3CDYA 3ARFB 1NCTA 2EDBA 1XGPB 2AXFA 2HLFC 2I27N 1C5BL 4JVPA 1QEWA 1H3PH 4WENB 4MA8H 5K59E 1OB1B 4IRJB 4G8FA 3TJHD 5IVNA 2FECI 1MCCA 2H1PL 4TYUA 3ZTNH 2R1WB 4OZIF 5CJ8A 5JO5A 4NO2A 1YEDB 5GHWL 4WCYL 1P4LA 3H7BB 3SQOL 1A1NA 1W0WB 3RZCC 2A9ML 3P11H 3SGKC 1OAZL 3VXOA 4Y16B 1NGZB 3LKOB 4QRPA 5E95B 4ZQKB 5IB5B 2HH0H 1A6AA 1K5NA 5BRZB 2NY3D 5BW7A 3F8UB 2XXMB 5GISH 2X4TB 2X9XA 3MGOA 3BP4B 5ERWA 4QNPE 5DK2B 2OR7A 3AS2A 4LNRB 4JY6A 1CFVH 4OIIL 3REWA 4I18C 1KCVH 3UAJD 5CHNB 5DK3A 3GUTB 2DQUH 1Z9LA 5EZIL 5DJ8B 2PXYC 5IFAH 3DUHA 5GZND 4LHUD 4M48H 1OW0C 3MNZB 2JIXA 4L4TE 4XCYA 4KKNA 4MD0A 3TNNA 2DQJL 3BXNA 3GSOB 1UJ3C 3ILQD 4POUB 1ETZA 2UWEE 4MLSA 5IHUL 3GGWA 1QO3B 4UUJA 1CE6A 5EUOF 4OB5H 3UO1H 1CFNB 3QA3A 3IDXL 3VGBA 1JZ4A 3T0EE 2IAMC 4YQXL 2XYCA 3EDJA 2J4WL 2AK1L 2VDML 3G6JB 3IXTB 3QUZC 4WHYH 3DXAA 2ZUQB 4HWBH 4JJ5A 2MWCA 5E94A 1OTUD 3CFDB 1T04B 3JV6A 2QV2A 1ZEAH 3BVNB 2DQUL 3S88L 2J8UE 4RMTA 5D1QA 4HXAH 4FA8A 1KCRL 4KXZI 3V95A 2NNAA 4X6EB 3TWCH 4Z5RB 1QFOA 4S0SD 1DTUA 4FQCH 5EC2B 4PGCA 5CLWA 2WUBL 4AMKL 3K8LA 3OGCA 3NFSH 5JORA 3VFOB 3BE1L 1IGYA 3OB0H 2CGRL 2YS4A 3C5ZA 3I2CL 3IDUA 2EIDA 3ZZ1A 3FQXA 3KPRA 5C07E 4YHNA 5EU3B 4NT6A 4BSVB 2DLFH 1XAUA 1DVFA 3EO9H 4ONFH 2FIKA 4R9HA 1FJ1A 1CL7L 3Q1SL 2OXGA 3QG7H 5DD6A 1A2YA 2J2ZA 1I85C 1Y0LB 1EPFA 3MV9D 3ALPA 4DZ8A 1ZWIB 4NQEE 5BZWB 4ZDHA 4NCC2 1DANU 4KJWC 1SM3L 3VDAA 3L3DB 1HWGB 4X4YA 1CFSA 2DDQH 2PO6A 5T1LB 1WT5A 1VSCA 5JHDE 1FV1A 3QIUD 4P5MB 3JZ7A 3MACL 3VWJA 4OV6F 2ESVE 4WV1C 3MODL 1UFUA 1G6RA 2AV7B 2DM3A 1HHIB 5C08E 5CBAA 5EU3A 3PQYD 1P7QB 3W11C 1BQHB 1MFNA 3ZE2F 4Z7QF 4LFHD 5IFJB 1SJVA 4X4XB 3IDJA 4XVSL 2X40A 3CJJA 1EO8H 2GY7B 4P5MA 1QSVA 1RK0A 5IB3A 5KVDH 4HX1B 1WBXB 4ALAH 1CDBA 4GRLB 3TZVD 5IKCB 1CLCA 2EO1A 3EOBA 5IM7A 1ZWIA 1S7VA 4LCWE 4XNZC 3JWOC 5F9JA 4JN2B 5DD6B 5HGHB 1ZLSH 2BC4A 1CDIA 8CGTA 1SYSA 1UC6A 3MODH 3PDOA 4TUOA 2AK4E 4UUJB 1VA9A 3GKWH 4GXVH 2HLAB 4NQCB 4NT6B 4R0LC 4R97C 4LEOB 4HXBH 4YHNB 5DLMH 2F54D 2X1QA 1GOFA 4R4FH 4U1HA 3MLUL 5BXFB 5GS0D 3BAEH 1NMBL 5I15L 4F57H 1IEBB 1VESA 3B9AA 1X7QA 5DEZA 2VLRD 1HK6A 3H2WA 4Z5RA 4LASL 4N0CD 4JFXA 3O2DH 5DGRA 5GXBB 4LSSL 1DFBH 5CHNA 3V7AE 4Y4FB 3V8CA 1T04A 4Y4HD 5KS9E 4IOIB 3DXAB 1JFQL 3PXJA 4Z7NF 3MCKA 3ARQA 1DUYB 1KLGB 4NPYA 3ZO0A 4NNXB 4R4NC 5EN2B 2VWEE 3MRRA 1IEAA 5KW9L 3W5NA 2FWOA 2D31A 4FQXC 1JHLH 1L9MA 5DSCB 4NWTH 4YDIL 2V7HA 1J1XH 1FP5A 5F72S 4MJ4A 4ZOEA 1QFWM 3QNZB 1A1NB 3ABZA 1DQMH 1DSFL 3J7HA 5A3IC 1NCCL 3FO1B 1SY6L 4HXBL 1NGQH 1A9BB 3O6FB 4BZ1L 3OQ3B 1CG9A 1P53A 4OM0L 3HHRB 3LKSA 3GUTA 4MJIA 1SJEA 1LK3L 4OZIA 1PG7W 5AUMA 3WMSA 3MA9H 4F7TB 2NXYC 2YPLD 3SBWA 2Q8AL 1OOAA 3KPRD 4YHML 3DO3A 1LEGB 1K5NB 5BRZA 1W0VA 4K94C 5CIPA 5IB5A 2I24N 4D8PA 1TTFA 3WL9B 2VN7A 1ZHNB 2DKUA 3QIUC 2Y36L 3Q5YA 5FYKD 3JV4B 1W72L 2X05A 2ZKHL 2BY2A 4CNIB 1FAKT 1J0ZA 1NAKH 5D7KD 1SEQL 5JO5B 5C0BA 1NDGA 1ZT1A 4UTBL 4JN1H 1I4FB 2OYPA 5K9OB 1BGXL 1K4DA 2DQDL 4PJ5E 5JA8B 2FX8L 3T77A 4GBXD 4U0QB 1S9XB 5HGGS 5HI3D 3QCVH 3LEVL 2K7QA 3ZE1E 5LAXB 3FAWA 4M61A 5L2JB 3L7FA 2P5WE 3HI6H 3IFOB 1J18A 2E7HA 5E5MA 3RJDA 1X5KA 3VGFA 1PQZA 3NCJL 1FBIL 1E6OH 1NBYB 4MYWB 4UINH 1IE5A 4UILH 1G0YR 1INDH 1M71B 3WSQH 2DYPB 2P5EA 3PIQB 3FB8B 1XCQA 5B8CA 4UU9A 5I0DA 5FFLA 5E7BA 2F74A 1A6TA 3VXQB 3GHBL 3MLTA 3V5DB 3ARBB 1T5WA 4WUUD 4UQ2B 4HW6A 5IROA 5CGTA 2EDTA 2JTDA 3GMOA 4IHOA 5MERA 4JO2L 4XPFL 1Q8MA 2OLDA 2QSCH 4S1SL 4PREA 2FR4B 4CJ1A 4ZPTB 4ODVH 4Y5VA 3ILQC 3DMMD 4H0GA 3Q5OA 3QO0A 3BKMH 1RJZA 5DD3L 2EDXA 3B2VL 3MJ8B 5MEQA 4Z0BH 3QFDB 2ZUTA 3SJVB 5F7EH 3D1MC 1A6UL 1XF3A 1X4XA 4IIQA 4PJAA 1RIUH 2WWMC 2RR3A 2BSSA 4O9HH 4MA3A 2EIZA 4N1EA 4UIKH 1C1EH 4MJIE 4YHKH 1KGCE 4U4BA 2VSCA 2OMBA 4BSWB 3NCJH 3FB8A 4PRDA 5B8CB 1MCNA 4ODHL 5C9JB 5MENA 3CH1B 3BPLB 3SEPA 4Z18A 5EBWB 2YHGA 5C0AB 4CVUA 3HUJF 2LTQC 3GMLA 3S98A 3IFOA 1SYVB 3TPKA 2C3XA 5DQ9B 4GRMA 1T80A 2GSGB 1RUAL 2A6DB 3RUGF 2VMFA 1VGKA 1A0QH 3G6AA 5FHBL 3AS0A 1K4DB 4P57B 3RJQB 1NCBH 2HN7A 5K9QG 3KPOB 2JLLA 1D9KB 4D94A 4HFUL 4DAGL 4HGKC 2QTEA 1SJHA 1KJVA 4Q74A 1KCUL 5EBMB 1VFUA 3JV4A 4K3DH 4LLWA 1V7NH 1D3CA 3BEVB 3AB0C 2NCMA 3PGFL 3S35H 2R0KH 2X4PB 5BO1L 3BGFC 3O6LL 5F7EL 1SYVA 1JHTA 1XF4B 5CZVH 5IHLB 4N9OB 2NXYD 4JRWA 3U7WH 4PJ7B 3CH1A 2V7NB 4OGYL 1QR4A 1Z5LB 3DYPA 2PCPA 3L5IA 2AJVL 3GSWB 2R8SL 4Y2DC 3VG0L 1SJEB 4U49A 4JY4A 1DLHB 3KJ4B 3PXHA 4XWGH 1QKZH 1NSNL 2B2XL 1MQKL 4NKIL 1MEXL 2XTLA 2AJXH 2BNRA 1G9ML 4Q97A 3IAGC 1IGFL 3O3AA 1PYWA 2F8OA 3VMPA 4O2EB 2XTJD 1B2WH 2P43B 2UWEB 4FMKA 4F7CB 4JCLA 3UPCA 1U8JB 4XMKH 3TN0A 2FWOB 5F3BB 4Z7QE 4AYFA 4ZO8A 3T4AB 2FR4A 1SBSH 3V5KA 4LSRH 1NCWH 3MCKB 4XXDA 1NMCC 1DCLA 3SE8H 2G2RB 1T5WB 4GW5A 1CF8L 2AXGB 5DVKA 1PGRB 2WIIA 2WNGA 1ZV5A 2VZUA 2F74B 3P9WB 2FSEB 1IGTA 2GUOB 4GFTB 4M1DH 5MHSD 4Y8AA 1KENL 3E3QE 3U7WL 3O3UN 2NY4B 3T0EA 2ATPB 4X8JA 4JO4H 4UNVA 2FO1A 1OP3H 1U41A 4PLNC 1JE6A 4PY7B 4LCUB 4PJGB 4NQCA 4OLWL 2HVKA 3VFVA 2Q7YA 3QCUL 1QZ1A 4OD1H 1FDLH 1J5OL 2E9JA 1XGRB 2D0GA 2DWDA 5D1XD 2PYEE 4M5ZH 4BZ2L 1YMMA 5J3HC 5GGTL 5F88A 5IM7B 2VC2H 1PZ5A 1KSRA 1MNUL 2CJUL 4LSQH 2ICEB 3CVHA 1ND0A 3QNYA 3F7RA 3WJJC 5F7WC 3HE6B 1IFHH 1QACA 3OKEB 4XBEH 2XY1A 4EI5C 3HAEA 3R8BB 3NPSB 3IDJB 4YDKH 3MLUH 3WL9A 4ZFFA 3D69A 5CIPB 1BD2E 3LKPA 1RZKH 4NRYB 2IPKA 1WITA 4PRPA 1RZGB 3R1GL 4WW2F 1R24A 3ARFD 5DZLA 3KG5A 1IQWH 3FOLB 3DVFA 4RGNB 1HKLL 3RDTC 5L88H 1I8LC 5TGBA 3DV4A 4TSAH 1JK8A 4K8RL 5FKAA 4K94H 4F3FA 1RY7B 4XNYL 1OP3K 4M4PA 4TUKH 3LIZH 2IADB 3QQ3A 4GAGL 5C2UB 3P4OA 5DRWA 1J5OH 3CPLB 3JTTA 3FQNA 4HFWA 1Q9OB 4U1IA 1BBJA 5GZOC 4HZLA 3PL6D 3ES6A 3QI9D 1G7IB 5D6DC 1DBBL 4XVUD 1BQLH 4KKBC 3RU8L 4F8QA 4ZUVB 1QHOA 4NQCE 4LNVA 4R0LA 2R2HA 4E42A 4C54A 1G6VK 5FHAL 3TV3H 4OUUA 2EEDA 1CVRA 5J13C 2W59A 4R8WH 1EEZB 4KKAC 5JORB 5C8JA 4MAUL 2FZ3B 2ERJC 4QRPE 3H9SB 4L3EE 1FVEB 4JFFB 5TE6L 4PJCA 2DTML 5HYJD 3AS1A 5LGKA 1PY9A 5ADPL 3KHOA 5MHSE 3RNQA 4ONOA 5E2WL 3RVWD 1IEBA 3RVTC 3LOWA 5FUZH 4YUEL 5EBGA 3G9VA 1OGAA 2FRGP 2HLFD 1MUJB 4P3DB 5EZJA 3TNMA 4FQHA 2GJJA 2KKQA 3KYOB 3EJYD 5CGYD 1QO3A 2VLME 4MNQE 2FB4H 1ETZB 3DVIA 5DFVC 3P9MA 2CGRH 2J5LC 3MRKA 4DKFL 2JIXB 4UMGA 4XCYB 4CN6A 1URLA 2RBLA 3W39B 4HKXB 4XPTH 4TNVF 5HD8C 3O9WC 4H5SA 4YNYA 4OFKA 1E4KC 3MLZL 1MHPH 1TCRB 1FVCA 3LKRB 2GSIA 1D5XB 2Z31D 4WHTA 4NKDA 1JHLL 3QUMH 2VABB 2AJYH 4CBPA 1OGTA 2CH8A 1H3XA 4XCEB 4HC1H 1JZ5A 4Z8FH 3MRNB 2X5PA 1QSED 5B22A 1BP3B 1G6RB 3B5TA 1T22A 3KNBB 5DJYB 3UZQA 4DVRH 5I1CH 4YHOH 2LABA 5IEHB 1J0YA 5IWLA 5E4EB 2IEPA 1CFVL 1YEHH 4MAYA 4J3WA 2ICCA 3MOBH 5C0RH 2Q1EA 4MD4B 5I2IB 4I48A 1KPUB 4XNMA 1BEYH 3F12A 3GKWL 1TTGA 1A2YB 3ARVA 1J87A 4QEGA 4YHIA 4YAQA 5HPMB 3JWDC 3U2SB 1VHPA 4JQXA 4WU7B 3REVA 4KAQL 1TVBA 4K2UL 5DJDA 4RQQB 3FQXB 1X6LA 4CW1A 3ZSSA 4AQ1B 4Z95H 1CFQA 5F6IC 2IQ9L 1EA9C 4KU1A 2HKFL 2NW2B 3PHQB 4OLUL 1B0GA 5CEXB 2PTVA 4IOFD 4MD5A 4WUKL 1BVZA 4PGDB 4KJYB 5J8OA 3LDBB 3MOQA 4X6EA 2NY4D 1C8PA 2OTUA 4XXCA 3WD5H 3ZKXB 4P4KD 4LLDA 3D3VE 1ORSA 1G7PB 3HR5A 4W4OA 2IANA 4NDMB 4JQIL 4AL8L 4KHTL 2BRRL 4NO3A 3IXTA 2OJEB 3ARXA 1AHWA 3VJ6A 1WZKA 3O3BA 3MRQB 3BDYH 5D2LB 5DHYB 5MP6L 1T7ZA 2FLRT 5DMGC 1FSKC 4KKBD 4UNTA 5IW1A 1YN7A 4PB9H 4X5WB 4FFWD 1NEUA 4P2QA 3T09A 5GZOD 1PJ9A 1FG2B 3QNXA 4GKSB 1BM3H 4JN1L 4QXGH 4JLRB 4YBLC 5SX4H 2L7JA 4JGJA 1NGPH 5I1AB 1B4JH 5L8JB 4HK3J 4YO0A 4UDTA 5HI5C 4B41A 3Q2CA 3S36X 1ACYL 3CZFA 1U8PB 5DXWA 1GC1L 2A0LC 3Q6FB 5CJOL 4I2XA 1K8IB 2ITDB 4N9GA 2C4XA 3FFCB 2V9QA 1BD2A 5EUKA 2H41A 4HWZB 4LPUA 5JXAL 3IF1A 4BJLA 5EORH 5CGMA 1RZJL 3LEVH 5GGUA 4CVZB 5IR1B 4Y16A 1K4CA 1N0XL 1RUML 5E9DB 3VE0B 4U6VL 2CIIA 4PUBH 4PJAF 5LGHH 5GGQL 2C3GA 2FO4B 3RY6C 1G7MB 1YEIL 1J8HA 1QSFD 2NY0D 3C9NB 4LLVB 5K9QI 4J2XA 4ZXBB 2FX9L 2X4UA 2FCBA 1L7TH 1WLHA 1FNEA 5I6XC 3BP7A 3QZWA 3RVVD 5DVOA 5F6HJ 5FM4A 3SGEI 4XNUL 4BFIB 3TF7C 3QPQD 3CCHB 2M1KA 1D9KD 3EYQC 1UM4L 4IMKA 4EI5D 5C0IA 5I1KL 3D85B 1T6WA 3WFZA 3HMWL 1SBSL 4HIXH 5E1AB 3CX5K 1OTTD 3WHXA 1B4JL 2CDFB 3UBXG 1X5GA 1AGCB 1IGIH 5IVXA 1CLYH 5C07D 5INDB 3BSZH 4EOWL 3JBG7 2DF3A 4RWYL 3PABA 3L95A 1S5IH 1OAQH 5ISZA 3PDGA 4Y4KA 4HIIA 3X12B 3O6KL 1HI6B 1RURL 4KY1H 3WFCL 4Q9QL 1WBYB 4U1MB 3M07A 1WIPA 5EORL 1PG7H 4TUJA 5CUSH 1XZ0A 3FN0H 1NAKL 4HPOL 2BVQB 3ZLQC 5L2KA 1PDKA 3CFIC 3DX7A 3BPLC 3HLAA 4HH9A 4MXVE 3DTXB 2ORBL 4OD3L 5C0GA 1I1AB 1BAFH 2PW1B 4JQVA 2A1WL 4J12A 3T2OA 3I6GA 2G75B 1V8HA 3DMMA 3T3ME 1ZHLB 4QXUL 3SKNB 1OP9A 2KDGA 1UM4H 1Q9WB 1KCUH 5E8DH 1EHAA 3CFKB 3SE9L 2W0PA 4HWNA 3QEQE 2FEEL 1II4E 5JLZA 4Y2DD 4ELKA 4X4ZA 2A6KB 1AQKL 4K3HA 2OQJA 3OKMB 1GIGL 1NGQL 1NBQA 2FEDC 1JF1A 4L4VA 3BP6B 1N7ML 2P49B 5L0QC 1LILA 3T0DA 3RUGA 3D85A 3I6KA 3VFWA 5IBLC 1ZKAA 1I3VA 1U42A 1L0XA 5TQ2L 1BECA 5HGBB 2WV3A 5B39G 5FIEA 5DUML 2R69H 4K55A 1I7RB 5ITBL 4YDJB 4YE4L 4Y4KC 2EC9U 1NCNA 1JI1A 3G5VB 1A7RL 3N1PC 1N5AA 1JNHB 4JFFE 5DJAA 3S5LA 3MLPA 2E6JA 1K4CB 4O51A 3D87B 4UAOC 4G9FE 5GRUL 1KJ3L 1FZJA 2P47B 3AC0A 1ADQL 1PSKH 5BOPA 1I1AC 1T2QH 2HJFA 1ZLVH 3EYSL 2EDEA 2UUDK 3N0PB 4R8WL 3RIAF 3U4EA 5FB8B 1R3LB 5DC0A 2HVJB 5CWSB 2JK5A 5HHPB 5DVMA 3LS5L 1D6EA 3IETA 1EVUA 4LSQL 3QIWD 1KEGH 3TT3L 4BFEA 2YD1A 3CMOH 4KGLA 3WSQL 1RIVH 3T2NH 2CQVA 2QQNH 2ATKA 1RZJC 2VE6A 4U1SB 4EI6B 4CMHB 1S3KL 4M8QB 1FG2A 3QNXB 5IP4A 1CD9B 4L4TD 4OD1L 4RNRB 4X5WA 5JIKA 5SWZB 5T3ZL 3FMGH 3RTQA 1AR1D 1LO3L 4X80L 1QSEE 4B53A 4ZNEE 4AT6A 1DQDL 1YNTB 3RL2B 4LSVH 1QQDB 4FTVA 3N85H 2WBJA 3PG2A 5FHBH 4ODWB 2XG5A 1NANH 1G7PA 3HR5B 3OAUH 5J13B 1EHLH 1ONQB 4YPGB 2GYSA 4GAYA 3JWDH 3Q48A 3LV3B 4OZFB 4YX2H 5I66A 1A7PH 3MR9A 4N8VA 1CGTA 1EBPA 3CU7A 3UJIH 3BQUD 3HA0A 4Z7VA 1KIRB 3HE6C 4YBQD 5EFIB 4U1KB 2FDBP 3OAYH 3ULUE 4P9HC 2JJSC 1NMAL 4WDIB 1AGBA 1GPOL 3VFUA 4ZS7H 4J3XA 3UPRA 4X80H 4L3ED 4TSAL 1KEMH 4RAUB 2XWJA 4KTDL 2DQEH 1IL1A 1F4WL 4PV9A 3VGDA 3SQOH 1QFPA 3CFCL 1MJUH 3KXFE 1KPUA 4PJ5A 1I8IA 4OZHB 3KPQA 3C5ZD 3HZVB 3WNMA 1BIIB 3I9GL 1I1RA 4U0RC 4AM0A 4KUZH 1GGCL 2R4RH 5I30L 3PUCA 4CRPA 4GMSL 1E6JH 4NGHL 2Q6WB 4O2FA 3SKOB 4FFVD 1CK0H 2HFFB 4OBRA 1DQQA 2OK0L 3QDGA 1ZT4B 2DLGA 3OWEA 2GITB 3SDYH 1KB9K 1HQ4A 2DJ4A 5EC1A 1NFDF 12E8L 1MCRA 4XHJC 2XG4A 4P23A 4X6CF 3ARGA 4TNWK 1GGCH 5DD5L 1Q38A 5I8CB 4LVEA 4MJID 3ZE0F 5HHOD 3GMRA 4OGXL 1QRNB 4JDTH 3TA3B 1M6OA 2A9NL 2XZCL 5EU5A 5FYJE 5FO7B 2YPLE 2VXVH 4X98A 4O4YL 4OF7A 4LASH 4Q58C 3CFJA 4ZS7L 5DQJB 4FFWC 1UKQA 4URTB 4HBQA 3UTQB 1AO7A 1U58B 3PWUA 4C56E 2OI9C 2VXVL 4P3WA 1EFXD 2QHLA 5T1KB 3HRPA 2GQHA 3CDFA 3ROOB 4BSJA 1QKZL 5DMKB 4Y4KD 1VGEH 1PX3A 1TETL 1P7KB 5GSVA 4DKEL 4QRSB 3SY0A 4YXLL 2PW2A 1Q9LA 5FO7A 5DD5H 3D2UD 2OBGA 1UCBH 4KMQA 4UV4H 2XWTB 4KMTL 4CJ0A 1AD9B 3G5YB 4P3CL 3ARGB 1FE8L 5ID1A 4G9DA 5EC1B 4LHUA 4X5XA 5BV7L 4OLXL 5KVEL 4ESKA 5EWIL 5KG9A 3QHFH 1E4KA 1P7HL 4G7VH 2DLFL 3EO1B 4NN7B 2W9EH 5I1HH 1ZHKB 1MWAB 4ODUA 4RX4A 2BSRA 1EEZA 1IZKA 5BJTB 2GJ6B 4JZNB 1BJ8A 3V6ZB 3FOMB 4NCC1 1RZIA 3BE1H 5DEGB 4MCYB 4NO0B 3IU4H 4WWKD 3TWCL 3MYJB 4S1RH 4KMTH 4TSBL 1HHHB 5B21A 5DRWB 1GGBL 4XPTL 5J57B 3QQ3B 5EFIA 3V6OC 4OGZA 4LSDA 3OSKA 4UZGA 3V4PL 2OI9B 3MV8B 4LMQI 3QPXL 4PJIA 3MRHA 5HDOA 3LHPL 4HAFA 5I66B 2PXYB 1HEZB 3LV3A 5KG9B 2NY1D 2Z0BA 4JFZL 4ORGB 3JWOH 1JWMA 4U1GB 4N5UA 4V1DA 5I1EH 4MMXC 4X0KA 1G7LB 3LKPB 4NRYA 4PRBB 5IFHL 4K7PX 8FABB 4ZFFB 2MKWA 1DQLH 3MREB 3U7YL 2QQLH 4EIGB 4AMKH 5I1IL 5C0DB 4Y0GA 1AD0B 3LD8C 3H3BC 3OX8B 5KJRL 1UJTA 4EUPB 5F6IB 5D5MA 2JJTC 5CBEB 4M8QA 4ZFZA 1JIBA 2JJWA 3OAZH 4U33A 1EUTA 2F5AL 2VSDA 5F88B 3BPNB 4GMTL 4J3TA 5CEZH 4ODBD 3ZYOA 5JHDB 3RHWF 1JZ8A 1F3JB 1XF2A 1YNKH 3RDTA 1K6QH 2EKSB 2QQKH 1W72H 3CLEL 4Z7OF 3QRFM 1CXFA 1KN2H 2YPLB 4P2QE 4X98B 1ZLSL 3HCVA 3FT4B 1VDGA 4L5FH 3AMKA 1DQLL 4QXUH 3ZKMC 4EJ1C 5I76A 5J06A 4WO4A 1SEBB 1RZ7H 4EI5A 4F7PB 5IMKB 3MFFB 2AXGA 5H94A 3LN5B 3PF2A 2ICWB 5IOPA 1TQCC 4TVPL 3HR6A 2HFFA 1UVQB 1JGEA 4HCRH 4DZBB 2VLMD 2X4RB 4MXWL 2BOCA 2O5XL 2DQHH 3SE3A 4HC1A 4AM0B 5IB2B 4DN4H 4OI8A 5F9OL 5C7XH 3CLEH 2P5WD 3OF6A 3QH3B 2VAJA 4NOFA 1U8JA 5E6IA 1U2CA 2Z9TA 3QEGH 1IGML 2A6JB 4R7NB 1TDQA 1LO5A 2R23B 2UWEA 1F00I 4WGWB 5E6ID 3VFWB 3QAZC 5KW9H 1E4XH 3TBYA 3AREC 4WDIA 2VDQH 4X7TA 4YHZL 2GHWB 2VITB 4S10A 1HHKB 3TN0D 2Q8AH 3SO3C 3TPUB 1TVHA 3D25B 1UZ8B 5MEOA 4PGBB 3RX7A 4ZAKB 1P1ZB 1YECH 5DR5H 2VDQL 3BIKB 1ZGLB 1HYSD 5TDNA 1GZQA 4K23L 1M4KA 3K7UA 1TQBC 3EYVA 3HPJA 3T04D 4ODWA 3RWIA 1JPGB 4RAVB 3TN0C 1JUFA 4PTUA 3GMQB 1CGXA 5C0GB 1ZLUK 4ERSH 3L5WA 3RNKB 3NAAL 5KS9F 2UYLB 2D2OA 35C8L 1WQVT 1S9YB 3PWVB 3TBWA 2R0LH 3H8NA 5HVFB 4L8SB 1F6LL 4NHCL 4ACPA 3MRDB 2ZKHH 4U1MA 3VRLE 3OPZL 4RSVA 1RVFL 5D72H 1MJ7H 1DBAH 5D93B 4UINL 4PJBA 4Y2DA 2G5BB 1DVFD 1U92B 2DQTL 3Q6GH 5ESVB 1A7RH 4ZNEA 1IKNA 1YNLH 4JM4H 5DHXB 3BZ4B 2XKNB 1H3WM 2VZ3A 3GMLB 5CD5C 3S3PA 3DVNB 2VQUA 3QCVL 3QAZB 3CUPA 1ZT7A 4PG2C 5C9JA 4X6CE 4XNXL 3VXMB 5IB4B 1WAAA 1AO7E 1RSFA 5KSVB 4OJFL 3SO5A 1KV3A 2E9BA 3HE7A 4ODTH 1FL3A 1QSFB 2BERA 4DOHB 5ESVA 1CDYA 3CH8A 4P46C 4CMMB 4BZYA 4ZXBA 5JA9A 1R5WB 1AXSB 1IGIL 2IBZX 2VL4A 3BHBA 4JKPH 4P59H 2Q86B 3ZKMD 3RVWC 2FO4A 1HOCA 1U8KB 1F58H 4OCXL 1OAZH 3MRDA 1TQBB 3SE4A 1RUQL 1VKXA 2VL5B 4PLJD 4L8SA 2OL3B 2DLHA 3QO0B 3VXNA 1F4WH 4RISH 3OJDA 4E41A 4N1HB 3HFMH 4E0RB 3KR3L 1G9EA 1DBAL 2ADFL 1DEDA 4JGUA 3NH7L 4JCMA 3GMQA 3RWFA 3FFCD 3P77B 1QRNE 1WSST 3GMOB 5A16B 5MERB 4H0IA 1RULL 3EYVB 4PYGA 1CFTA 3P30L 4YHLH 4ELMA 4FFYH 1HQRA 1U8PA 3RVXC 5C0FA 4PJGE 4MLIA 1BGXH 3BMVA 4R4BA 1FO0L 2M8XA 2VXTH 2BFVH 1UXSA 1HHKA 1UWGL 4Q9RL 3GK8H 3GSVB 3IVKA 3UTZA 4GUPA 3I6GB 4PG9B 4OCSH 3KR3H 4O4YH 1AIFB 4HH9B 5FAAA 1A7NH 1OGAD 3VJ6B 2P4AB 1KXTB 2EH7L 1T4KB 2HT2D 4P4KB 5DD0L 2BVQA 2GI7A 3EGSB 4NHUA 1U3YA 1J10A 1F58L 1FZKA 4OCXH 4ZUUA 3TT1L 3X14B 4I18B 1G9NL 3MA7B 4JKMA 2OR9H 4GS7C 3UAJC 4F2MA 5C6TL