2R4RH

Crystal structure of the human beta2 adrenoceptor
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
217
structure length
217
Chain Sequence
EVQLQQSGAELARPGASVKLSCKASGYIFTDYYINWVRQRTGQGFEWIGEIYPGSGNIDYNERFKDKATLTADKSSSTAYMQLSSLTSEDSAVYFCVRGFGYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSAVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 30
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4rH02
5GGUB 1OQXA 1NEZA 3EJYD 5T1LA 5CP3A 3K2UH 1YNTB 4PLKC 3BDXA 3OXSB 4F7CB 2PN5A 4JM4L 3QJFA 3N1QC 3NFNA 2L7UA 1DZBA 4LCCB 2VL5B 3LIZH 3RDTD 3MRPB 5SWSB 4Q58C 4OGYH 1JV5A 4F7PA 3VXUA 4OZHA 5KN5B 4HLZG 4ODWB 4Z7NF 2DQCL 5BW7A 3L3IA 3EYFA 1AD9B 2VC2L 4GKSB 3RKDD 3T1FA 5I18L 5L88H 2DWDA 1FO0H 1KCRL 4M4PA 5H2BA 2MCPL 1TENA 3UTQB 5B8CA 3ULUC 4R2GD 4FQJH 2FB4L 1KLGA 4OM0L 2IADA 3D0LB 5FHAH 1J1XL 4Y5VA 1OLLA 5DFWH 5I1LB 5MHSD 3BKML 4L9LA 1IGTA 5GSVA 4YZFF 4XWGH 3MOBH 5CWSB 3PGFL 2EH8H 3MODH 1B6UA 3GK8H 5CBEA 1YEJH 2R4RL 4FQPA 3MYJB 3VWJD 5IVXB 3DUUB 1C5BL 2EDRA 5EBLA 1HQ4B 4N0UB 4WHCA 3B2VH 1UGNA 3PIQA 5C0AE 5J89A 5C07E 4WW1A 2YEZB 1CFQB 3QIUD 3T09A 4JFZL 4K94L 4UOW0 2Y5TB 4MS8D 4QRSB 3FT2A 2I26N 5FYKE 3WN5C 2I9TB 2CSPA 4ZPVB 4D9LH 1P4BH 4DKFL 4JFXA 1HYSC 3QPXH 4WEMB 2VDMH 3NZHH 3TV3H 1YPZA 2KZWA 1UH4A 4NN6B 5CEXA 5D96B 2F9BT 3CSYB 1N2RA 2XKNB 1FIGH 2ICWI 3DBXA 3RHWK 2OI9B 5ISZA 1TQCC 3EYQC 4Z77A 3TA3C 5C08E 3NTCH 3SGJA 3P0GB 3PL6D 4KMTH 4DW2L 1INQB 5EOCL 3GGWA 4PREB 3KJ4B 4MAYC 4OFIA 4DTGH 2BSTA 3VI3F 3A6OA 3JUYA 4K94C 4WCYH 4Y5YB 3T3PE 1K8IA 4JPIB 3ULUH 2DIAA 3L1OH 4KJPC 2VIRA 2VLJD 5EORH 3GMMB 2EH7H 3FZUD 1XGPB 4DQOL 4PRHE 1I8MB 5IFJB 1BD2D 2H32A 1BQUA 1AP2A 3RUGB 3PWVB 4G6AC 1T4KB 5BZDB 4MX7B 2R1WA 4GUPA 4RNRA 1QBAA 3D39A 4JM4H 4QOKB 5GRVK 2E8YA 4D9QE 3WBDA 4LSTH 4Q7DA 4WNQA 1Z9OA 3UYRH 5A2KH 4LDEB 5I66B 4AJ0A 4LCCC 3DVGA 4AEFA 1ITBB 4AIXA 1XR9B 2DQCH 3TBTB 1M6OA 2VC2H 3EYUL 5I18H 1WIUA 1KCRH 3SDXB 2MCPH 1JF1B 3N06B 2AJUL 2FB4H 4Y2DD 4OM0H 1VADB 3DX8B 3FQUB 1A9BA 3ZTNL 1PG7W 3BKMH 4JFOA 5MENA 4UOW1 1MUJA 1H3WM 1TQBB 5DSCB 3PGFH 4NCC1 1DLHA 2R4RH 4ODXA 3QUYD 4HS3A 4MGXA 3FRUA 2CMRL 5D71H 4GRLB 2BVEA 4L8CA 2R2BB 4GXVL 4IRSD 3O3EA 4X6FB 5CP7B 1UH3A 4P23D 4ZNEA 5D7LD 4JFZH 3T65A 5FYKU 5T5NF 3A0OA 4E41E 5INDB 4KKBC 2HJFA 4I4WA 3WLWD 3HHRB 3C8DA 2YR3A 5J12B 4NKIL 3GKZA 4CW1B 5B38A 4XBEL 4DKFH 4W70A 4KC3B 3KXFE 5EO1A 4NN5B 4PJ5B 1GXEA 2UV3A 1XT5A 3LKPB 4ZO6A 5IMMB 1A9EA 3G5ZA 1BAFL 1VSCA 2EYTB 3MV8A 4M48H 1BQLL 5L8JB 3CFKB 5MI0B 1F3RB 1ZOXA 2A0LD 4NN6C 1MCLA 4HT1L 5D96C 4PJEA 2OI9C 4PJBF 5DD1L 4DW2H 4UTAL 5T5FL 5EOCH 2D7TL 1DEEA 2DLHA 2CRIA 5I76A 2GY5A 5I17B 1T89C 1IAOB 3KJ4C 3QXAB 3IRPX 3ULSA 1JZ3A 2Z0BA 1YDPA 1AGBA 4DQOH 3M45A 4BZ1L 5CUSL 2AV1A 3ARBC 4F7TB 3OB0H 1RIUL 4WUKL 1AY1L 3BMVA 4L8BB 4Y5XC 1OGAD 4DZ8B 3IJHA 3ULVC 4PB9L 2PXYB 5F1OB 1IC4L 2AKRB 1RZFL 1ADQL 1JGEB 2NY6B 1U3JA 1VACB 2ID5A 2NLJB 1QFWM 2AK4E 4IEFB 2C3WA 3VFGL 2FZ3A 5T5NG 1ZHBA 1JPFB 2QADB 1ZGLA 1FHGA 1SY6L 3D25B 4K8RL 1WCBB 5D2NE 1T3FB 2NXYD 3VFVB 1D5MA 1UENA 3IU3B 1M7IA 3EYUH 2D7OA 4PJDB 2YPLB 2H1PL 2P8LB 4TVPE 1DVFA 2AJUH 2I60L 3NVQA 5D1QD 3ZTNH 3EJZD 4WW2B 3SBWC 4CVZB 2O61B 3AS0A 1DUYB 2P7TA 1FN4B 1FZKB 4KTYA 5I74C 1TQBC 2H2SC 5HD8C 1I8IB 2DS4A 2CMRH 3LKRA 2XZQL 1OY3B 4MJ4A 5K9KA 3RQ3A 4GXVH 4FA8A 2ADJB 4P5TB 3KPRB 1HHIB 1P2CB 1Z5LB 4G9DA 4M8QA 4LGPB 4YDKL 5FGRA 3CX5J 4HK3N 1LILA 3PP3K 3ZYOA 3STLB 4K8RC 1PY9A 3K2MC 1IMHC 4NKIH 2BSSA 3L3DB 4XBEH 3JSSA 3TYGL 5J12C 2R4SH 1BM3L 1QYGL 4UV7L 1JGUL 2BERA 2XNAA 4NBZB 5E6ID 1N5AA 4FG6C 1BAFH 1IM9B 1BQLH 4PJ9A 5HPOA 3P4MA 2PO6D 2VN7A 4N0YL 4HT1H 4RAVA 5MI0C 3O2VH 1HHGA 3KGRA 5DD1H 5FYLL 4UTAH 5T5FH 5DJCB 4KJYA 2D7TH 2OS7A 2BCKA 2LFGA 3ECBB 3RVXD 4CU8A 3BN3B 4GG6B 1PZUB 4GRWE 3VMNA 4BZ1H 1EA9C 5CUSH 1RIUH 4WUKH 1AY1H 5DO2C 4BFBD 1OL0A 5EOTA 3MUZ1 5IBUG 4Y89A 3DWTA 3HPLA 1W0VB 1A7OL 4XBPA 2X05A 4PB9H 2FHCA 1IC4H 2CLVB 1RZFH 4CVUA 5IROC 1ADQH 3RNQA 3BP4A 1RJCA 1I3UA 2PXYC 4Z7VF 1I7TB 3VFSA 2YMXL 4HJGB 3LMJL 3VFGH 1RJZB 1B0WA 2D31A 4LSQL 1E4KA 4IIQA 5GS3A 5HXMA 4TYUA 1CE6B 4K8RH 5C0BE 5DHVB 3NPSB 4NHUB 2QADC 3RWHB 2YA0A 1U3YA 2IF7A 4NQSB 1GPOL 2H1PH 1RJLA 4L8SA 2HLAB 4PRID 2DWEA 3S96A 1PQZA 1Z9MA 2I60H 3MJ8A 2CO6B 2MHAA 3HZVA 1VFUA 1FV1B 2WMPA 2FO4A 3Q6FB 5K9OB 4UUJB 1DQDH 1FL5A 2ZNWA 4WW2C 3VFPA 4JZNA 1EBAA 3DUHA 4NSKA 5I8OL 3V6ZB 1IKFL 4QGYA 1FFOB 2XZQH 3H9SA 4PJIE 4QT5A 2AK4A 2O93L 3F12B 5C0IB 3OGOE 1U95B 4PGBA 1YMMA 4WVRA 4D0BB 4YDKH 4QXWA 5DJ0A 4ZSOE 4I3GA 2VABB 3DX7A 3MCKA 5DFVC 3CFEA 1IGYB 5E00B 4NM4L 3L3KA 4OIIL 4CL7A 5I8KL 1T2JA 5LJYH 3PJSA 1J9CT 1BFVL 1SYSA 3QUKA 2A6KB 43C9A 5F6HJ 4F7PB 4F8TA 1BM3H 1QYGH 3OKDA 3S34H 4QRPB 3JWDL 4UV7H 5ICXA 3RVTC 1JGUH 3QXDB 4P49A 5BV7B 1TFHA 4PG9B 1KCVL 3G6JB 2X42A 1J10A 2PTVA 3MO1B 1ZLUK 4N0YH 4NQCD 4PJ7F 3KYMA 4FTVD 4OGAC 1HKLH 2QSCL 3QCVH 5FYLH 1TCRB 1YEHL 4AT6A 2E9BA 1RMFL 1IEHA 1I1YA 2XN9E 5SX5K 1MCKA 4ZUVB 2QHRL 1LO2L 2HN7B 4QHKJ 3DJ9A 1NCUA 3HFMH 2VLRD 3VFWB 4HWNA 4MDJA 4LQ1A 4PJFA 4YAQB 4LF3B 1I1AD 3PIQB 2PR4H 3LZFH 4LLDA 3U46A 5DGQA 1OW0A 3RX5A 1F42A 5FOBA 4P2QB 2R0WL 1A7OH 3JWDC 4QRRA 3FT2B 1UWXH 4YDJA 3ZDXF 5HGBB 3RGVD 6CGTA 1QHPA 3V5DB 2DQTL 5CIPB 1BZ9A 3VXPB 1B0RB 1JHTA 3LMJH 4U6YB 5IVZA 4FXGA 4LSQH 5JPMA 1S8DA 4MD5B 1VENA 1R24B 4V1DB 2HVJA 5ICZA 1HQRB 4Z7QF 5DEGB 5C0FA 4OCRL 4WI6A 3NPSC 4F15C 5ISZB 1GPOH 3I6GA 3OKMA 1FE8H 5CSGA 3TCXA 3VFOA 4H88L 2XTJD 4PG2C 1QRKA 1QP1A 2EEAA 5D7IE 2XZAH 2ZG1A 3HZKA 3S5LA 2IANB 1ULVA 3TJHC 5BV7L 3W11C 1LEKA 3TPUB 3LY6A 2APBA 1BGXL 2IMNA 4XNMA 5I8OH 1JWMB 3OGCA 1IKFH 2E6PA 1K85A 3GMPA 3BESR 3U48A 1UACL 2MPAL 1JCKA 2O5ZL 2V9TA 5C0BA 3UCRA 1OTUD 2ZUYA 3B9VA 4N68A 4NNYA 3MRNA 2R2EB 5DJDA 4NM4H 1FDLL 4OIIH 5CHNB 5JDSA 3DVFA 3TCLB 5CLWA 5I8KH 2FR4B 1BFVH 3OKEB 2OR7A 4PJXB 3BIKB 2UZYB 3DURA 1OT2A 2WANA 1L6XA 1YY8A 2PYEE 3IT8D 5ITFB 1M6OB 1KCVH 4I0CC 3CSPA 2ZCKH 3BW9A 2FD6L 2GQHA 5LXGL 1UH2A 4WU7B 5BW7C 5C3TA 1I8KA 4J3UA 5C0NC 4BM7A 2P8MB 3BKCL 1EHNA 1U93B 4HXBL 2QSCH 2CIIB 5FHBL 4DOHB 4PJIA 2BHUA 4X98B 1YEHH 1WAAF 4PJ8D 4KKCD 1RMFH 5DF0A 5CSZB 5L8KB 3UJIL 5DHVH 4Y5VC 2QHRH 1LO2H 4ZSOA 1DE4A 4F9LA 1ZSDA 1MCDA 2UVEA 3WDIA 4L8CB 1QACA 1A6TA 5IESL 3MV01 4I18A 2LAAA 1UKSA 3O8XD 2WNGA 2AK1L 1KBGL 1A1MA 2XWBB 3BHBB 2GHWB 3C5ZD 3WIFA 1KPVA 2IPUG 2R0WH 3ALWA 5IHZB 3LEYL 1GZQB 5DQDL 5LCVL 5HYJA 3FO1A 2DQTH 1T80A 4M7LL 5IUSA 1QBML 1JGDB 3U9UB 5IW6A 2BVPA 4NOBA 1IEBA 1L7IL 4K3HA 4RFEB 3MMEB 4LCWA 4IOFC 4OCRH 4K07A 4H88H 1BFOB 3T04D 4R6UA 2X70A 1WBZA 2ZOKA 4TTGA 3MLWH 2OMNA 4G43A 4PJHF 5C0AB 5C07B 3EDFA 1YYLL 3EOYG 5SV4A 3SGJC 3UXFA 2VXSL 5BV7H 2NXZB 3CCHA 3DETD 4UZGA 1BGXH 3ILQD 4WFEE 1NCDL 5HVWA 1JF5A 3VXRE 2VZ3A 1UACH 2MPAH 5IR1A 2O5ZH 1C7TA 3HZYB 1S7SB 4J3WA 4J6RL 1KGCD 3HR5A 3ZT7A 2FECI 5CZXD 3X14A 1T1YA 3ABZA 3ARZA 3T0EB 3HCVB 1ZT4A 1FDLH 3VG9B 2R0KH 5IW1A 1ZWIB 5C08B 3MV9A 3Q3GA 4YC2B 3G5VB 1FYHB 5GIRB 5C9JA 1V7NL 3PUCA 5IEKB 3EDEA 1J1OL 1D5MB 3QZWG 4JVUA 4U7MA 1OP5H 1X44A 2FD6H 5LXGH 2XY2A 5JNYA 3U9PL 3MNWA 2F53A 4EN3B 1DBKH 5CIPH 3BKCH 4GBXD 4PRHB 1MFAL 4RMVA 2R23B 4HXBH 5FHBH 4QNPE 1HH9A 2G60H 4UQ2A 5C09D 1W2KT 2GJ6A 3UJIH 2V6HA 5D2LF 2AQ3A 1E4JA 1JK8B 4RDQF 1HZHL 3O6FB 4LEXL 1DN0A 5IESH 5C0CB 4C56E 4NWUL 3QCUL 2AK1H 1KBGH 4L3AA 1LO4L 1N0LA 4G9DB 1NEUA 4X6DE 3QULB 1F11A 3C6SA 2ARWA 4XCEA 3TEUA 3LEYH 1TZHA 4MNGE 1I1RA 4TTDD 5DQDH 5LCVH 2NW2A 2BSSB 3BQUD 5FYKL 4P57B 4WI5A 1F4WL 1JUFA 1QRNE 3CFJB 4LPTA 3UTSE 1QBMH 1TTFA 3Q6GL 1I9JL 2XNAB 2X4NA 5DA0B 1I7ZA 4XBGA 1L7IH 1DR9A 4NO5B 2LU3A 1U8OA 3G08A 1ONQA 4RZCA 4BQ8A 2BHZA 1ZLWK 4JM2A 4HKBB 5TDNB 3OKYA 3K0WA 4OQTL 5EBWA 3RAJL 2DBLL 2VXSH 1UJ3B 3HB3D 4WEBL 3VFUB 3WUWA 4E41B 1QR1A 5T1KA 2YUXA 4M7KL 4QRQA 4JFDA 1K9TA 2FIKA 5E1AA 2NXZC 4LPUA 4LLWB 2NY3C 4LIQE 3ZT5A 3KXFB 3LCYA 4YE4L 3NIFE 3ARFA 1G7MB 4PP1C 5E2VL 4XBPB 5T1MB 3C9NB 4J6RH 1IRAY 1MY7A 2JKXA 4JRYD 4S1DC 4F3FB 3VGHA 4D2NA 3B6SB 3VFSB 2COQA 3WS3B 4KZDL 1W72B 2W07A 2X4TB 3MBEA 3VG9C 3BUYB 3DXAD 4XCFL 5FK9A 3L5WA 1V7NH 3DUSA 1J1OH 4PGZA 2NY0D 3QWOB 5L0QC 4Y16B 5HYSA 4N8CL 3DRTB 3DV4A 4OZIE 5HVHB 1MFAH 3DO7A 4OF5A 2YZ8A 3S6CA 5HDBF 3RVVD 3S3PA 4Z0BL 1DVFC 3VXQA 1ZS8B 3FT4A 4R4NC 3VXRA 2VZTA 4NQEA 1T66D 5AEAA 1JP5A 4GSDL 4R0LB 5IB3B 2MKLC 4DUWA 4NQVA 1HZHH 1RUPL 3QDJD 4RRPA 3BZDA 1YN6B 4ZQKA 3DROA 4QT5B 2AK4B 1M7DA 3O6FC 2NYYC 3KPQB 3ZZ1A 4NWUH 4BZ2L 3QCUH 3CDYA 1LO4H 4MA8L 5D2NB 1A1NA 1NC4A 1J8KA 4HWBL 2VERN 2JB6A 5D7JA 3VXNB 5DJXB 4O2FA 3L3KB 1EHLL 1XF4A 2FEDC 4NQXA 1CGYA 4Z7NE 4K7PL 4NO0D 4WIQA 4J4PD 3DTXA 1F4WH 2JIXB 2X1WL 4NO2A 43C9B 3BZFB 2NY7L 3THML 4BKLA 3Q6GH 1I9JH 3ARPA 4PFEA 3UTZA 3H9HA 2QQLL 4LVHC 2OQJB 4YGVA 1S9XA 3SCMA 4XWOC 4YZFE 2GITB 2R0ZL 3PXHA 4PJ9C 3KYMB 4BQ9A 4DJMA 5CD5C 1W72L 1H3TA 1HK6A 1CICA 1A22B 4OQTH 1JTPA 4XNYL 3LOWA 4J1UA 4Q6IB 3UBXA 3P4OB 3RAJH 2DBLH 4WEBH 4X7DC 4HUMB 3IJSA 1XCTA 1KIPA 3B4NA 4K3EL 3VWKA 3ZE0F 5HYQB 4NFDA 3DX9A 3KPSD 4M7KH 3IDMB 5DJAB 5FKPB 3VRLF 4KK8D 2ITCB 1AD0B 2ATKA 2X4UA 2Z91A 4LRNL 4QCIB 1S9KC 1CS6A 4YE4H 1Q0XL 1P5VA 3UTTA 5E2VH 3C6LA 1G7LA 1VHPA 4L4TE 4F37F 3WFDL 3BDBA 5GRVL 4O4YL 5F9DC 2I07B 3W39B 4XVSL 1ZA6A 2AQ1A 1JGLH 4DEPC 4KZDH 1CYGA 4FXGB 3IDNA 4XCFH 1DBJL 4LFHD 3MRKA 3MACL 2R1YB 4IIQC 3QDGD 3FO9A 1D6VL 3D0VA 3VFOB 2DJSA 4N8CH 2HAZA 1UT9A 2EIEA 3VI3E 4TVPL 3KLSA 4ZS6D 4QHMA 3QG6A 2AEPL 2XA3A 4U1NA 5HVHC 4Z0BH 2E8ZA 4HKZB 2ZUQB 4JRXD 3K4AA 4RISL 1LEKB 1EH9A 1LHZA 1ACZA 1TVBB 4GSDH 5D1ZD 1DL7L 1T0MB 5A16A 3WXWL 2VLLA 2CLRB 4P46B 1RUPH 4PTUA 4R0LC 1F6AB 5I1JL 1B4RA 3WKNA 5C86A 1PGRB 3QFJB 1CVSC 4WTXA 4HGWA 4BZ2H 1I1FB 1SMAA 4WEUD 3JWOC 1QEWB 4MA8H 2E5EA 3T08A 2VITB 4XXCA 4HWBH 3QI9A 5T3ZE 1AQDA 1EEZA 4IOIA 2C3HA 4JZOB 4MDIB 4YBQC 5DJYB 1EHLH 4K7PH 1YEGL 3EW3B 3FTGA 2W9EL 2IBZY 2M26A 4D0CA 4OFYD 3GSXA 2NY7H 3THMH 1U0QA 3LSOB 3DURB 3VU2A 1IEAB 5BQ7A 5HY9B 2QQLH 1FQ9C 3QNYB 3PWJA 4TUOB 5HI3C 4JQXA 1ORSB 3L6FB 2R0ZH 3REVB 5GHWL 3Q2CA 5C6TL 3GJEB 1W72H 4PJIB 4U1KA 4CMMA 1X6NA 4WWKD 1QLRA 2XG4A 4NKDA 4XNYH 3F7VB 4XZUB 3MRCA 1UZ8A 4Y7MA 4GG8A 3O11A 4L1HA 2EXWC 4ZSOB 4K3EH 1KN4L 1LEIB 5JXEA 5IQ7L 1ZT7B 5B3JF 2VLKE 2YKLL 4O2CA 5GGTA 4LRNH 3QUZA 1K8DB 2X4PB 2EICA 3MOQA 5F7DA 3PV6B 2QSTA 1NJ9B 1C8PA 4X83A 4I48A 3EBAA 1JI1A 3WFDH 4O4YH 2CLZA 3WXVL 4LKCB 1S7UA 4ZFGL 4FFZL 1ZVHA 1QSEE 3HNTL 4XVSH 1MHCA 2DQGL 5GISL 5F1NB 1D5ZB 4LASL 1FJ1B 1QO3A 3L7FB 1GOFA 3BXNB 4JLRB 4G6JL 3G9VA 1DBJH 4M93B 3EDDA 4PJBE 3MACH 1X9QA 2YD3A 4NQDD 2I27N 2XN9B 3F62A 1D6VH 1EUTA 1VKXA 1C1EL 1HH6A 4RQQB 4X4ZA 5IV2B 2FBOJ 1YEKL 4TVPH 2ZOKB 2WSKA 1FG2A 3KHOA 4G43B 2AEPH 1H5BB 1U8LB 1EHAA 2IQ9L 2CDGA 2GK2A 1CGVA 4RISH 5I1DB 3EFFB 2ZUQC 4L4TA 4UAOB 5I1AA 1DL7H 4KK5C 1GGTA 2ZJSL 5D93C 3WXWH 5I1JH 1MCSA 4JREB 1SMOA 4YFLI 5KSAB 3TLRA 4BK4A 5GZOD 2V7HB 4X5WA 4WJ5A 1CGTA 2FEEL 2YWZA 3BVNB 4W6YB 1IAIH 1KTDA 5TPWL 1YEGH 2P8PB 2W9EH 4HLJA 1XGUB 4Z8FL 5D7IB 4IDLA 1J0YA 4BH7B 3UAJC 2FH8A 3VXSD 3RY6A 4H0GA 1K3ZA 1H15A 3FN9A 2AXHA 2XACC 1A5FH 3BH8A 3MV7D 4U1MB 5GHWH 5TH2B 3TO2B 5C6TH 1E4XL 2X4QA 1OP3K 1OAZL 3O41A 3WFHB 1NMBL 2HT4C 5E4IA 1HH9B 3KPPB 3LEVL 4WHTA 1O7SA 2R9HC 3VD7A 3P77A 3ZHKA 1KN4H 1G9NL 5IQ7H 1U8JB 4I5BB 5ETUB 4L4VA 4F9LC 2YKLH 2P42B 4U33A 3UJJL 1JFQL 1CLZL 4I18C 4BFIA 4APQA 4I0PB 1X5KA 2PYEB 3WXVH 1UA6L 3P4NB 4ZFGH 4FFZH 3K80A 3HNTH 4U6HA 2DQGH 4ERSL 4X9BA 5GISH 4LASH 5D6CB 3JV4B 3TO4A 4G6JH 1EERB 5KSBF 4BSWA 3QCTL 4NUJA 2VLJE 1CFTB 1IM3A 2NX5E 1QNZL 4LLVA 1T5WB 3RWIB 3CDCA 3V6OE 3ROLA 1C1EH 3LPGA 4X5XA 3AS1A 5B39G 5HI5C 3I9GL 1YEKH 4KKAC 3WHE0 1WIPA 2IQ9H 4Q9QL 1VDGA 1TNMA 3KNBA 2H3NA 1QR1B 3CC5A 3ILPA 3CFDB 2ZJSH 2PYFA 1QSEA 4UQ3B 4TOYL 3O3BB 1YUHA 4K7PY 3RWDA 1LDPL 5FB8B 4Z7VE 3ZKMD 1NCBL 4RMUA 4UU9A 2CKBB 4NO3B 4JHAL 3PP3H 5KSVB 5DS8A 4PJBA 1T0NA 2A6IB 2DQHH 5EUOA 1QLEL 1REIA 1U42A 2AJ3A 2JTDA 5TPWH 4JFED 4Z8FH 2VDPL 5DRWA 1WWBX 3TT3L 3G6AA 3VRIA 5FK9B 3FCTB 4U1SB 3L5WB 3I6KA 1F13A 4LFHG 4MJ5B 1JPST 4OGXL 5I0DA 3NN8A 3QWRD 1FVCA 1LQSR 4PLOB 3RDTA 4HGMA 5D7LE 1CD1A 4AENB 1E4XH 1OAZH 2HA1A 3RX7A 2HVKB 1FLTX 4WU5A 3AU1B 1MVUA 2DJ4A 2ZP0T 3VXRB 1R3HA 4CADB 1RZGA 3ARGD 3BRGC 4WI9A 4JY4A 3FB5B 1G9NH 4XPHL 4Y19D 5J13B 4NQVB 2XKSA 1F5WA 4JPKH 5TJWK 1M7DB 1XFPA 2WV3A 5DUBB 2BNRE 1A4KB 4IRJD 3UDWC 1JFQH 1XF5A 5E8PB 1CLZH 4KROC 4J8RA 2FX9L 1P1ZB 3VWJA 1T6WA 1UA6H 3GKWL 5IJKA 4O2FB 4ZFFA 3O9WB 4EVNA 2A74A 3MQIA 4OCLC 4ERSH 5L8LB 2IWGA 3QIUA 4NO2B 5DEZA 4QHNA 2CKBL 5ERWA 3QCTH 4PJ7E 1S5HA 2F8VA 3MUJA 4XC3L 1QNZH 3RVUC 3TGXA 2YPVL 3CVHA 3G5XA 2BVOA 1BEYL 1T21B 2X4OB 1WIOA 3I9GH 3BP7B 4KFZC 4M1GL 4C56B 4CRPA 2HWZL 3H3BC 3UBXB 4X6DB 3IJSB 3WDHA 1U8PA 5E99L 2P5ED 4MNGB 3PL6A 1DSFL 5D7KD 1N8ZB 1MIEL 3ZDXE 4TOYH 5AYQA 1LDPH 3ARRA 3LKNB 1QRNB 3UTSB 3ZYZA 1NCBH 1N6VA 3AUVA 3MNVB 4JGMA 4YLQT 4JHAH 3L3GA 2VLJA 3ARFC 3DARA 1TDQA 4MLIA 2Q87A 2HLFD 5EUKB 1QLEH 5IBLD 3TN0D 1E28A 4Z7QE 2VDPH 4XTRD 2QJDA 3TT3H 1NC2B 4YO0A 1RHHB 5GGRA 4MCYA 1HSBA 5GGSY 3S7GA 1ZLUH 1C5DA 4UT9L 4OGXH 1P7KB 2FL5B 2C1OB 1FRGL 1T6VN 3RBSA 2P5WD 1FL3A 2AQ2A 2FHBA 3QG6B 4FOMA 5MERA 4U3XA 5KANG 1NDMB 4X4MA 4X4YB 5SX5H 3MRJB 4K23L 5J6GA 1DQJB 2XI9A 4F9PA 2UUDK 3KR3L 4XPHH 5CINL 2XIDA 4MD0B 4MQTB 4Y2DA 1Z2KA 5J13C 4MA3A 1KPUB 4RIRA 4P5KB 3FOLA 1YEDB 4FFWC 4K7FA 4HMEA 4M6OL 3TH4T 2ZUUA 2FLRT 1IGJA 2FX9H 3QUYA 3QWQB 3KG5A 4WI8A 1R3KA 3I02A 3GKWH 1EEZB 5HGDA 4KDTC 1EFXD 4IRSA 5D7JC 3CXDL 4P23A 5D7LA 3K8LA 3P9LB 5KVDL 5IFAL 4OZIB 3VD5A 1F02I 4HIEA 5I6XC 2CKBH 4XC3H 4Z76B 3EOTL 1WAAE 2YPVH 1BEYH 5F97E 4KDVA 2EZ0D 4L3EE 4OZFB 1XGQB 3HAEG 5CJQL 4PP2A 4LSVL 4M1GH 4YHKH 1UFUA 2PW2B 4N5ED 2BDNL 1NGWA 2HWZH 1CICC 4LGSB 3V4UL 4BUGA 5DMKB 2H9GA 4PJGF 2D7MA 4YQXL 5E70A 5IEHA 5E99H 5ESQA 4FNLL 3VGFA 2OSLA 5EZLA 1DSFH 1NANH 4LIQL 3D9AL 2C3VA 1NFIB 3C2SA 4P4RA 4MYWB 1TZIB 5IIEB 3RVWD 4P2OB 1NQBA 5F96H 4PJ7A 4R7NA 2LQRA 1NDGA 4PRIE 1AKJD 3N0PB 3C6LC 1Y6NR 3GM8A 3QJHA 3REWA 3ARTA 4XX1G 4O51A 3S98A 1JNJA 1UB6A 1OGAA 3MGOA 2FCBA 4ISVA 2JCCF 3MOAL 4ZAKB 4LQFL 4HFUH 3TYFA 2CH8A 2I9LB 1KYOJ 4UT9H 1QBLL 2DYPD 4PJHE 3VXME 2OXHA 3WS6C 1XGTA 4ELMF 5DURB 4GKOA 4J3OC 4MJ2A 2RIKA 4LMQE 4BSVA 4WV1B 4K23H 3QO0A 2BC4B 1TJGL 5TGBA 4WDIB 3KR3H 5CINH 3MFFB 3WJJC 3R8QA 3OJDB 5D1QA 4HEME 4KMQA 4KGJA 5SWQA 1A14L 4M6OH 1QG3A 4P4KB 3LB6C 3HS0A 2NNAB 3AFLA 5LAXA 3PNWA 4XXCC 3OAYH 3QI9C 3BGMB 1GGBL 3CXDH 1KLUB 5IFAH 2VDRL 2YK1H 3WD5L 3FONA 5A2FA 5HI4C 4OLVL 1F2XK 1IGCL 3EOTH 2VLRE 5DWUL 3IDIA 3JTSA 4JQXC 3R06B 5D2LE 1ZHKB 5CJQH 3RWFB 1B0GB 4LSVH 5E6IA 4J2XA 3B83A 2HRPL 5IB5A 2BDNH 4CJ1A 2B2XL 4WHTB 2PO6A 5GRXG 1LK2A 3V4UH 1CDBA 3NPZB 4PPTA 5GQBA 1J0KA 3T0WA 1JYWA 4FNLH 1EXUA 1S78C 4M61B 5JXEC 3GSNA 3IF1A 3FFDB 4KK9D 1S7RB 1W8NA 3IDYB 4HLZH 1CDJA 3D9AH 3UJTL 1IAII 1ZHLA 5JORB 3BZ4A 3V8CA 5EO9A 4NN7C 4KH2A 1HHHB 1KFAL 1SM3L 5DC9B 4M02A 1JNHA 4R97C 4HBQA 4P2OC 2D0GA 5ACMA 4G9FE 5J1AB 1WAAA 1U8NA 1VA9A 1CD0A 1NUNB 1WV7T 3L5IA 3U0PB 4L3EA 4HUXB 1A6WL 1PYWA 3MOAH 4LPCA 4LQFH 4P48A 2HFFA 5GGSA 5C6WH 2GK0B 1QBLH 2YS4A 2Y06H 4EDXA 3RZCD 2FJHB 4EBQL 3ROLB 2V5TA 1AHWA 1BVKA 3OQ3B 1JMXA 2GT9B 4G8EB 3MBXL 5ID1A 2VLKB 5KVFL 2XQYG 3PG2A 3QZWA 3RTQD 4CBPA 2UZIL 2DN7A 3E6FA 2MNUA 2FJFB 2W0LA 3CC5B 4HXAL 1TJGH 3PWUB 4PRIA 1A7RH 3MRDA 1QSEB 5IK3A 3QXWA 4OZFH 4OCMC 4WFHD 5DYOB 2V2TA 5L2KD 5KZCD 4PJCF 3RWDB 3X12B 5JZ7C 1A14H 4UU9B 4G8IA 3W0WE 3B5TA 3HKFA 4U2YA 1AI1L 5FEBA 1XF3B 2L4OA 4XB8A 4PJBB 3OG4B 2J5LC 4P4KC 5T3ZL 3PHOA 4Q9RL 1ZLVH 1GGBH 1ZMYA 2OR8A 2IAMD 2VDRH 3OJMB 3PQYE 4R9HA 3CPLA 3TBSB 1CBVL 3HE7B 1CG9A 1L7TL 1XMWA 3LKSA 4OLVH 1IGCH 3F7RA 1KIQB 5DWUH 4HFWA 5HDBE 3P30L 3RY6C 4XPTL 3HNVL 3SDCD 1TITA 1ZLWH 4TUKL 1CD1B 3CH1B 3DGGB 4JEGB 1FZOB 4MAUL 4C4KO 2HRPH 1C16B 2J8UF 3MA7A 1ZA3B 2LV4A 4KRPC 2B2XH 4S10A 4BQCA 4NQCA 4FTVA 1I85A 3LRSB 3TIDB 1T7VA 2FEEI 5DRNB 5CJXA 3DMMB 3UJTH 1NBYB 1KJVB 1MLCB 5E7FA 1KFAH 1OAQL 5TDOA 1SM3H 3HI1A 1ZEAL 4ZUWA 1OTTD 1S9VB 5E94B 4Z5RB 5J9PB 2VLRA 3VDAA 4APQC 4ZFFB 3GIVA 3QIWB 1I1AA 5I71C 3AAZB 1K5NA 4YJZL 1T20B 3N1FC 1X5GA 5IBUB 1A6WH 2D03L 1AXTL 3QEQD 4NGHL 1PZ5B 4MD4A 7FABL 1NCNA 1YEEL 1AR1D 3RGVA 1E4XI 2VE6B 3TO4C 4YFEA 2WBJB 2AXFA 3RWEA 3BD5A 3GNML 4EI5B 1XGRB 3EYOB 1KG0B 2YN3A 4IJ3C 4EBQH 4KQ4L 5E2JA 4F33A 4FFVC 2WUCL 3VRJA 3MBXH 1IZKA 5EU6D 4PY8J 3ZE0E 3QHZL 5KVFH 4PRPD 1KGCE 3FB7B 4ONGL 4AH2A 2R39A 2UZIH 4HIJA 5EU4A 3VRLE 4OI7A 2HYMA 4X6BA 4LLUA 4NJAH 3T4YA 5CBAA 4XMLL 4HXAH 1G7QA 5KSUB 3PDOB 5HYEA 2CIKB 3ARWA 4UNUA 2DMKA 4NPYB 1FYTE 2BSRB 4M6AA 3V7MA 4EXKA 2A83A 3O4LE 1OWWA 4LEOA 3F7YA 5T3XD 5CJ5A 2Z92A 1AI1H 3GB7B 2NX5B 5BZWA 4XP9L 5EA0H 3KYOB 4PBVC 3TNNB 4KU1A 5T3ZH 3MROA 5DR5L 4HJ0D 5EDXA 4Q9RH 4LLQB 1L4IA 1CFVL 3QEHB 1CBVH 1L7TH 3GSRB 1FFQA 2AV7A 1QHOA 3JTTB 1QFHA 4XI5D 3LN9A 3P30H 1Z3GL 4XNXL 4XPTH 3HNVH 4HIHA 1ZV5A 4TUKH 3QNXA 4HS6A 4DVRL 3RDTC 4XPAH 4JAMA 4R4BB 4MAUH 2VDOL 3SJVE 4G6FD 4U6TA 2VQ1B 1JJUA 4Y4HA 4Z7VB 3V79C 2PTUA 5J6GB 4E5XA 1FNEB 2FDBP 3RKDC 1NBVL 4LCIL 5J06A 4OZHF 3EOBB 3SDAB 1E6OL 3IFOA 3HG1D 1HHKB 3OWEA 4HCRA 3FHAA 5FDYA 4PJ8A 1KTLA 3M1BA 4JFQB 3UYOD 3DMMC 1ZEAH 43CAA 3I75B 2F74B 4DK6A 4JFHD 3GHBL 3JV6A 4OCSH 1MH5B 4NZJA 5DEFB 3O8XA 5IJKC 2B39A 3QIWC 3UTPE 1MFDL 3B3IB 4Y4FA 2BVUA 3C5ZA 2YD7A 1AXTH 3FFCD 4NGHH 5BS0B 3K74B 4L8DA 4U1IB 4KVCL 1XH3B 7FABH 1X4XA 1YEEH 4MS8C 4PR5B 1QA9A 4GLRH 3GNMH 1H9VA 4YPJA 2WBJC 1I3GL 1MELA 4KQ4H 4H5SB 4EI5C 3EGSA 4M5ZL 2WUCH 3T2NL 4R3SA 4OLYL 1SJHA 5CEZD 3OAZK 3QHZH 1A6AA 4ONGH 5B3JE 2EYRA 2BNRB 4Z0XB 3L9RB 1KJMB 2O26U 3GUTB 2H9GB 3ARQA 1BIIB 5CJBA 5DQJA 3IVKA 3QUMA 4JO1L 4I0KA 4XMLH 5F7WC 5MEQA 5AWNL 5I8EA 1NEZG 1RU9L 1DN2A 5FECA 4RMTA 2XA8L 3GMQB 1YPZF 1PAMA 4JGJA 1MLBA 3PL6C 5DLML 4FN0A 5JW5B 4TN9A 2A38A 2YD2A 4Z78A 2Q7YA 3JBG7 4C83A 4FXKB 4R7NB 5IMOB 2X41A 4RWYL 5FO8A 5DA4A 4XP9H 2WAHA 4JG1H 1KCKA 5DR5H 3FZUC 1MI5E 1R0AL 4YHIA 1UB6B 3SKMA 3V6OC 1D9KA 2YD9A 4N9GA 1CFVH 1NMAL 4YNYB 2JJVA 5AUMA 3C60B 4HKJB 3V8OA 1Q9LB 4UIKL 2XWTB 1Z3GH 1FVDA 4XNXH 3HUJA 5DHYA 1OM3L 3CDGA 1AFVL 4DVRH 3T3MF 4UT6L 5DMGD 3GSVB 4BA8A 5TFSL 2VDOH 3ETBF 3O4LA 4S0TD 5CGTA 4YWGL 1Y6MR 3X11B 3D69B 1T7YA 3BWAA 4NDMA 1NBVH 2R1XB 4XH2B 5E2WL 2OMBA 4LCIH 5TGBB 4P3DA 4GBXA 2F8XC 1OB1A 1F4HA 1E6OH 4F9PC 2NR6C 5KS9A 1NGPL 2B5IC 2XXCB 3SDAC 5DJ2B 1U8QA 5EO0B 3DX6A 3ARSA 3LD8C 4AEIL 2WWKT 3VH8G 5LAXB 2GCYA 5LQBL 1U8IA 3GHBH 3QUYC 5D9SA 4I2XE 4LL9A 3N1MC 1OAXL 3ISWA 3MRIB 5TDPB 1CFBA 1X7QB 4IRSC 3TBWB 4ZFZA 3WL9B 4P23C 3WYRA 3E6HB 1QPPA 5FGSA 3LPWA 4KVCH 2QSQA 3GMNB 5DD5L 4HWUA 4IS6A 1QSFE 2GUOB 1BF2A 3BQUA 4MB3A 1FGVL 4OAWB 3WLWC 4HDIA 1I3GH 4RBPH 5J0BA 5GRWA 4ZPTA 1M05A 4U1LB 4M5ZH 5F7MC 5AD0B 1T1WA 3T2NH 1G1YA 4M6ML 3A6CL 1N26A 4OLYH 4LLYB 1JZ5A 1J8HD 5LGJA 3DGCR 1BFTA 4BJLA 3TH3T 3B8SA 4Z7OF 5E5MA 2KQMA 4OBRA 5F9JA 4JO1H 1AGDB 3O3AA 5F7FA 5AWNH 2A0LC 3UBXI 1RU9H 3QRGL 2B0SL 3PHQA 3IF1B 4JJ5B 4POYA 1HDMA 3RL2B 5DLMH 4FQXD 1EEYA 3P73B 1JMZA 3QDGE 2D9CA 1KCUL 5J56B 3P3YA 1JZ2A 1WZMA 4PJEF 3LKQA 3LHPL 4RWYH 5BVJA 4KKLD 5EC2A 4M9PA 5KSBE 2ZSWA 2BNQE 2HJKA 4L3EB 3RWGB 1R0AH 3K81A 4QRTB 1U3HA 4OT1L 1J87A 1N6UA 1PYWB 1VEOA 3MRHA 3Q1SL 4LVNC 3PWNA 2BOBB 1T5XA 4ZXBB 2BVQA 4QHUB 3V0VA 4JRYA 5DGRA 4CMHC 1RZ8B 3BPCB 4UIKH 1S7XB 4G80B 1OM3H 1OP3H 3N50A 4X8XA 5IT2L 4ZUTA 3DXAA 1AFVH 4UT6H 2C7UB 4HSQA 5GJTL 3BGFC 3QZWB 5TFSH 5C0GB 3BYYA 5IF0A 5J6HA 2NXYC 3QDMB 5I1KH 1FZJB 1RZIB 3S36X 1GOHA 5DQ9A 1T22B 5BRZD 5E2WH 4TNVK 1BBJB 3ZYJA 1MJ8L 5IK3B 4UTBL 1EDQA 5I9QB 1FFRA 1NGPH 1MI5A 4HULB 3KYKL 3FOMA 4Q2ZA 4X7SL 5D1QC 1LO5B 2DI7A 4AEIH 4I8DA 1OGTA 3EJZC 1XAUA 5B38G 3CFBA 2JF1A 4P2RD 5GS0H 2BP3A 3L7EB 2RHEA 5FA3A 3NGBC 3QDJA 4KJWD 5LQBH 4PJHB 3SE4A 1OAXH 3VXMB 5I8CB 2R8SL 3OJVC 4EUPG 4F2MA 3JVGC 5J7CC 1ITCA 2YC1A 4M3KB 5DD5H 3RPKA 2AABL 5KTEL 5IB1A 2AEWA 2AEIT 5I16A 1I3RB 1FGVH 4J4PA 3SQBA 1VEPA 2BVTA 3MUY1 4OCYL 1MHEA 2VZSA 2HTLD 1NMCB 4M6MH 5GS1B 3NIGF 4JANB 5JO5A 3IXAB 3O45A 1XZ0A 2Q76B 1J5OL 3KLAA 4H25B 4HG4J 4JDZA 4NKMA 5IJVB 1BQHB 1BX2B 4R7DA 1T7ZA 2PO6C 2DMBA 3QRGH 4I2XA 1IQDA 5K9JH 2B0SH 1EEQA 4OKDA 2IPKA 4NQDE 1A1OA 2VXQL 3BEWB 4U1JA 1KCUH 5E7BA 3PABA 4Y0GA 3G5YA 3OB0K 3KPSA 3RVXC 3LHPH 3QIBB 1GL4B 4GS7B 4JQVA 1V3JA 2EDKA 1JNLL 5DVNA 2G75A 4GQ9L 1NGZB 4OT1H 5D2LB 3C5SA 4A6YB 5SWZD 2MQ3A 4RFNC 1OAKL 3Q1SH 3ULUD 1UXWA 3RWEB 4R8WL 4ZXBC 5DZNA 5HHNA 4X8JA 4WUUD 3MRMA 1TJIL 3HMXA 4KI1A 5IT2H 1DQQB 2WIMA 1JTOA 3ES6A 3PP4L 3HRZA 2P43B 4X6CF 3X17A 3HLAB 1YY9D 2ESVD 5E5UB 1KIRA 5ANME 5GJTH 1CWVA 3QDGA 4G42A 2X5PA 3GDBA 3PGDB 2ZCHL 1NUGA 2AAVA 3T4AB 3U36B 3V5KA 4G9FB 5HHMB 1MJ8H 4UTBH 2F54D 1YN7A 3BZEA 3KYKH 4JRXA 4JVPA 1HXYA 3D3VE 1RIVL 3BRFA 4MA7L 4GAYB 4KZEL 5GRJL 1HYSD 3MV7E 4YPGB 3IGAA 1IGFL 3IAPA 2AEQL 4HC1H 1RZJL 1V8HA 3VXTA 3ZDZF 2W60B 3MRFA 2R8SH 2YSSB 4U49A 4JZJA 1FC1A 1NGYA 1GAFL 3PWLB 4RGMB 5E8EA 4PJAF 5EIQA 3NZ8A 2AABH 4UINL 5KTEH 4I3RL 5ICYA 2Z8VC 2NY4B 4YBHA 1LNUA 4OFYA 4OCYH 3F7QA 2PTTA 3LDBB 1RK1A 2CRZA 4A6YL 2C4FT 4KJPD 3EYVB 3FQRA 1EFQA 5GS1C 4BSJA 3KWWB 3WE6A 3W0WB 5J1SC 4XX1E 4MJID 1FFPA 3L5XH 2IH3B 1A4JA 1J05A 3KPOB 1LD9A 2WP3O 4LPXA 4NQTA 1LP9B 1S9YA 4WWKA 1RZJC 4NT6B 1SBBA 1ZT1A 2VXQH 3PQYB 3CGTA 4OGZA 5CJXC 3FO2A 3L95A 1IL1A 1B90A 4M7LT 2NY1B 1S7VA 2VJXA 2DI8A 4PD4J 1JNLH 5SWSD 4GQ9H 4GS7C 2CDFB 4XCYB 3MRRA 2EDWA 3AB0B 3DYOA 4Y4FB 3DHMA 1G6RA 1FAIL 1OAKH 3BDYL 1SYVA 5HHXL 4IOSD 3WMSA 2JJSA 4P2YA 1QLFB 1ODAA 2ERJC 4PJFF 4R8WH 3QEQB 5D1XB 5FA4A 3RGVC 2BMKB 3WO4B 3OF6D 3U6RB 3EGSB 5EU5A 4Z7UA 1TJIH 2N7AA 3PP4H 1PX4A 3STZB 4PJGE 1KYOK 1YC8A 4NQDA 1OT1A 1WFTA 2A6DA 2UUDH 2PF6A 5HGAA 4UDUA 1Q9OB 4TSBL 3HC4L 3DRQA 1GC1C 2FIRT 3OXRB 3ROOA 3GMOB 4KAQH 2V5YA 4KKBD 5I17A 4IRZL 1N4XH 1F3JB 2GYSA 2W59A 4HBCL 1RIVH 2A9ML 3WNLA 4O2EB 3I3DA 3SY0A 4KZEH 5GRJH 4MB4A 5ILTL 2JCCE 2QKIB 1IGFH 3RNKA 2AEQH 2JJUA 3SDDB 2R0LL 4WHDA 5JPNB 4GLRI 3FQWA 4HCRL 4U1HA 3SKMB 4B7IA 1D9KB 2OZ4A 1GAFH 3ULVE 1U58B 3O6ML 4NKQB 1MOEA 3BYTA 3GHEL 5ANMA 5E8NB 5AUMB 2J2ZA 3C8KB 3LS5L 4ELME 4UINH 1SVCP 4RGMC 4I3RH 2C1PB 5EN2A 1OTUC 5FDWB 2Q20A 1FVDB 4WENB 2Y07L 2P4AB 3NOIA 5HHQA 2BOCA 2NY4C 4QXGH 3T8XA 1FYTB 4A6YH 1PFCA 2V2WB 3VXSA 3LDBC 3KDMB 3OJ2C 4B7LA 4XCCL 2R29L 1N64L 3O4LB 5DTFB 4LBEA 5C71A 4E0RB 3KAAA 4Y4HC 3R1GL 4F7MB 1IAIM 3IDGA 3HAEA 3MV7A 3KYNB 3TWCL 1OB1B 1U2HA 1RK0A 3GSOB 4MWFB 3D18B 1U8QB 3IAQA 3MZTA 3U4EB 2AJYL 4PJ8C 4KKCC 5DMJB 4QOKD 4NBYB 5DRXA 2DM7A 2Y36H 4U0RC 2NY1C 5EZJA 3D85B 4ONFH 1UWXK 2CUIA 4Y88A 32C2B 3DSFL 4URTB 1BP3B 5TE4L 4JFFE 2HJLB 1AIFB 3O8XC 4X4XA 1FAIH 3BDYH 1XF2B 2OBGA 3AB0C 4XAKD 4Y4FC 3SJVB 5HHXH 3C5ZC 2P5EE 1E0OB 4GW1A 4H1LB 3S3SA 2NY5L 2OR9L 5EBGA 2OXGA 1N6QL 4UMGA 3S5LG 12E8L 5D1XC 2V9RA 4ONOA 5DJ8B 1LEGA 4NRZA 4HZLA 4M9OA 1T2XA 2Q7NA 1K4DB 3IS0X 5F3BB 4OFDA 4MQXD 1A6UL 1JPSL 1R6VA 2ARJA 1JPTL 1RZ7L 4C4KT 4GRLD 3E3QE 1H3VA 2MSPA 4HWZA 2VISB 3HC4H 5F6IC 5DVMA 2ZCLL 1CF8L 1RD6A 3GRWL 4NZRH 4IRZH 2DOCA 4G8GE 4K8RD 1EEYB 4HBCH 2DL2A 3L3OA 4PRDB 3EUUA 2A9MH 1OVZA 3CFIC 2GAZB 1G7IA 4WI2A 5ILTH 3GSQB 4EDWL 3HZMA 3STBA 3DETC 5FCSH 2NY5C 4GAJL 4WO4B 4PJ5D 2R0LH 3R0NA 4FQIL 1BMGA 2X7LA 2Q1EA 4L29B 1U3HB 3SDDC 2AJZB 5FF6B 5CEYA 4PJGA 3EOAB 4FMKA 4LPVA 3GHEH 3EIFA 1D9KC 3OKLB 3LS5H 1KJ2A 5CZXC 2Z8RA 2Y07H 1VGKA 5DVKA 2YBRA 5JHDE 4HH8A 5H37G 2ZUXA 3C08H 3KPMA 4FQHA 4XCCH 2R29H 1N64H 5AZEL 1MRDL 1ED3A 4CUCA 1EGJA 3QWRA 4HUWA 4PJCE 4KTDL 3R1GH 4XVUD 2JCCA 3TWCH 3ZKXB 5M94B 2OTWB 3E8UL 1MI5B 4GBXC 3SGKA 5E4EC 3MRQB 3X13B 1IVLA 2AJYH 3ARGA 2FWOB 2PXYD 5E1HB 1AXSB 2HH0L 4XMPL 1AGFB 2NY6D 1INEL 3D2UB 1G0XA 4HIIB 4GJTB 4LCUA 3LEXB 1U8HA 2VUOA 3FB8A 5DC4B 4AMKH 5FYLD 4F7EA 3DSFH 4NRXA 4IRJA 2QADD 5BCAA 5FO7A 5TE4H 2DQFA 4UDTA 3RL1A 4ODUB 1UB5A 5HTSA 4XHQA 5ALBL 2RFXA 5E0QA 5FGBA 2YPLD 1N6QH 2NTFA 2G5BA 3BH9B 4QWWD 4UIMB 4TTDC 3SE3C 5EC1A 12E8H 1K4CA 5IVXF 2J8UE 3GBNL 1ETZA 1R3JA 1HEZA 5EIIA 2DLEA 1A6UH 1JPSH 4F58L 4ZYKA 1JPTH 5E2UL 1G7PB 1P7QB 5B39B 1RZ7H 4NNXB 3MYZA 1B6DA 1RZKL 3TBVA 1JHKL 3DVNB 1MEXL 1P84J 4P5TD 4AEHL 3KPRD 1WWWX 2ZCLH 4HIXL 1CF8H 2Q8AL 3GRWH 4MNQE 3QUXA 4Z7WA 5DFVD 3WIHA 1CT8B 4MB5A 1VFAA 4MCZB 1FFNA 1AGEA 1NLBL 2WLYA 3DIFA 2DD8L 3VFTA 1FSKB 2X4RB 3HB3C 2P5EA 4XP4H 4HUVA 4JM2F 2H26B 4TSCL 1QSFB 4CN1A 4EDWH 1U8KB 4GAJH 2ADIA 3KPLB 5GRUL 3OR6B 1TVDA 3GMRB 4N0CC 3HI5L 4IDJL 1BZ7A 1OAUH 1IM9D 3FAWA 1U3HC 4QXTA 2ZUTA 1D6EA 3CMOL 4OGAD 4PGEA 3V4VL 5F7HA 1W0WB 2BY3A 4YK4C 4AEEA 3RWCB 3TN0A 1WWCA 5BXFA 3MRMB 2QR0A 4YFDB 1Y0LA 3SKUD 1GGUA 3HE6B 1OP5K 2DTSA 2G9HA 3ES6B 4HUNB 3U82B 4OTXL 1HI6A 2CXGA 2DICA 4HW6A 1I7UB 4RFOL 4X7TA 3B9KB 3BUTA 4H1LH 5AZEH 1MRDH 2YWYA 5K33A 1MJUL 4KTDH 4NRYA 2P5WA 1FGNL 1BIHA 4IMLA 3V5KB 3VJ6A 5KSBB 3E8UH 2R2CA 3KPTA 3V0WL 1I7RB 2BNQB 4HV8A 4KGLA 3IJYB 4AYFA 4CVXB 3JWNC 1C08A 3A67L 3JV5A 1CN4A 3RVVC 3D6GA 2HH0H 3MJ7A 8FABB 5DDHA 3EKCA 4XMPH 1INEH 1L9MA 4PYHA 4AL8L 2X4SA 1T66C 1WQVT 4FXLA 4ELKB 4NKOA 4G7YL 5ENWB 5F6HI 5A2IH 2ZG2A 3SE4C 5DK2A 3PWPE 5JOFB 4PTTB 4W68A 1K2DA 5ALBH 4UV4L 2HFEB 4C58B 1XIWB 1KTKE 1EFXA 2J6EA 1C12A 5A43C 1M71A 4OI9A 3GBNH 3VFNA 2P1YA 5EU3A 2V7NA 3W11D 4J4PC 3VXOB 4OZHE 1PSKL 4F58H 4KRMB 3TNMA 3WFBL 1QPXA 5E2UH 4QHKI 5KG9B 5CJOL 3W9DA 4JN2B 3AREB 4QRUA 5ESVB 1LD9B 1RZKH 3D5OF 1JHKH 4HH9B 1MEXH 4PV9A 4AEHH 3M17A 4YDIL 4HIXH 1CVRA 4K3DL 2Q8AH 1WZLA 1EIBA 1BFSA 4AIOA 5IFHL 2FYYB 5CD3A 3X3GL 1MRCL 1ZT1B 2HRLA 3VFRA 1NLBH 4UB0L 1G7HA 2DD8H 4PRAB 1QQDA 4TSCH 2J4WH 1NGXA 1FIEA 5FYJE 5GRUH 4KK8C 5ID0B 1R5VA 1KB5B 4JFYA 3HI5H 4JQVC 4NNPL 4QRPD 4IDJH 2NW3A 1LE9A 5C0RL 3MRLB 5IGXH 2GTZB 3OMZA 3U0TB 5C7XL 4LU5H 1AKJA 3CMOH 3O3DB 35C8L 3V4VH 3AVEA 4JDTL 4POZD 5C0JB 4ACPA 3BKJL 5E9DE 1HHJA 2XPGA 5ELIA 5IBTH 2APVA 2XV6B 1T7WA 2OJEA 4OTXH 4MNQA 1YNKL 3OR7A 4AIZA 3MRGA 1KN2L 2A6DB 1YPZE 2DYPA 2GFBB 3WNKA 3KPNB 5DZOA 1MJUH 1FGNH 2YZ1A 4KWUA 3LV3B 5IOPA 4YDLB 4JG0L 3V0WH 3WFCL 1WK0A 4XXDA 4N8VA 4XRCB 4ZS6C 4OLZL 4P2QD 3A67H 4JE4B 2EDQA 1AGCA 1CLOL 3AXLB 1KB9J 3CDFA 1CXHA 5H35A 3QPQC 1MQ8A 4G7YH 1LMKA 3MJ9L 3D87B 5DZLA 4V1DD 5GZND 2XWJA 4JZJC 4D8PA 4KY1L 4UV4H 4YH6A 3RPIA 3T3ME 5ISZD 4P9ML 3D39E 3V95A 4S2SA 1TQCB 1LE5A 4LMQI 3TA3B 2G2RB 3C8HA 3F65A 1KB5L 3S4SB 2IAND 1NCAL 4TUJA 2EYSB 4NIKB 1AQKH 1PSKH 2LAGB 3D3VB 4MAYB 5HDLA 3U2SA 4CNIA 3WFBH 1QFWL 4QTIL 5CJOH 3O2DA 3IDGB 3HAEB 3UZQA 3U83A 3AREC 4U6XA 3GMLB 5ALCL 2AJXH 4YDIH 4K3DH 5L7XL 5C0DA 5IFHH 4R96A 2E3VA 3X3GH 2A9NL 5IB2A 1A02N 3IFPB 3ZHLA 2OTPA 4YR6A 4UB0H 5FYJU 5MENE 1CDGA 1MCOL 5EU6E 1SJXA 3FN3A 2EXYC 4PRPE 3MR9B 4NNPH 3BRDA 4OZ4A 4HKXA 3L3HA 4JFPB 5C0RH 1BVLB 4ZNEE 3BSZL 2IBBA 3RKPA 4ZDHB 5C7XH 1JWUB 1O0VA 4JKPH 4FS0A 4M1DL 3ZKND 1CQKA 35C8H 4JHWL 4JDTH 2JJSC 4OKVA 4M03A 3VA6A 4Z7OE 1T03L 2D4FA 3BKJH 4N5UA 1X5FA 2Y7QB 1D5BB 5JOPE 1UCBL 2EDNA 1JPGA 1EAJA 2C4FU 3SKOA 1KN2H 3MV8E 3RZCA 4YIQB 1UM6L 3UPRA 3J8F7 5IM7B 4E9LA 5E56A 3MGTA 1KPRB 4P59H 2H8PA 4RAUB 2IH1A 2YPKB 4JG0H 4P9HL 3WFCH 4PJEE 3RTQA 4YDLC 2XFXB 4HS8L 4OLZH 5EPMA 1IARB 4MQ7A 2X1OA 1CLOH 5MEPB 4GRMA 5F9AC 2EKSA 2N1KA 3ESVF 4LCYB 4PRBB 2MCG1 1DBBL 5L2KA 3IAGC 3MJ9H 1Q94A 5E9DA 2PCPB 3P9MA 5F71A 3MXWL 4KTEL 5CEYB 4PJGB 3VH8A 3OX8B 3QQ3A 3NAAL 3U7YH 1CLYL 1HN1A 4KY1H 3EO0A 5GZOC 2FJGA 4P9MH 4CN4A 4XCNA 5LGHL 4LPYA 1CFNB 2ICWA 4S11A 5IG7B 3O4OB 1OHQA 1A3QA 1S7WA 4QHLB 5C0AD 1KB5H 5C07D 1HWGB 4QY8B 1NCAH 4P9HC 3W9EB 4ORGB 3LN5A 3KJ6L 4FQHB 2NXZD 2Z4QA 2SEBB 7CGTA 4JGUA 4IHOA 1QFWH 2VAAA 3SDCA 1UCTA 4QTIH 1FORL 2J3SA 1KLFA 2GJZB 3WFZA 2R2HB 4J23A 1UVQB 3ARBB 5ALCH 1KULA 5L7XH 2VB5A 3TZVA 3QNZB 4Y5XB 3G04A 2A9NH 3ARDA 3RY4A 3RWJA 2Q86B 3T0ED 2OTUB 3G6JF 4ELMB 3OKKA 5GRYA 1MCOH 3U7AA 5C08D 4F7EB 4JRWA 1HSAA 4Z95L 3TVMB 1NAMB 3FT3A 2EDTA 4O9HL 3SKJL 2E7CA 3AC0A 4WHYG 5F88B 4M1DH 4EN3D 2H41A 1KEGL 4EI6A 4JHWH 5EC1B 4PRHD 4FZEL 5JQ6L 4S1RL 4R4ND 5K9QG 4YHNB 1R3JB 1N59B 1T03H 2IJ0C 4FQQA 1ORQB 3IKCA 2QSVA 3MJ6A 3MNZB 3BPNC 3CXHJ 3VD4A 1J1XH 4ZYKB 2E9WA 1A8JH 5I74B 3NFPB 2JJWA 1I3VA 3O6FD 4D9QD 1UM6H 5J11C 1R5WA 5HGHB 4OV6F 3TBVB 4MMXC 4QTHA 5EU6A 5GSRA 5C0CD 4P9HH 1H0DA 4PRPA 1MHHB 2KUTA 4R90L 1C5BH 3QUXB 4MSWA 5DJZA 1T04B 4HS8H 4JFFB 2ATPB 2WP3T 3DIFB 5F1IA 2HTKD 4K94H 2GTWA 1EGJL 1T1ZA 1QTYT 3QA3B 4ODSL 4BFGA 1WBXA 4PY7B 3HAEH 1CDHA 1DBBH 5IHUL 1MJJB 1TTUA 2B8OT 3MXWH 2YUWA 3OKOA 2Q3AA 3QDHA 3ZKMC 3NAAH 3F8UB 3ULVL 1CLYH 1H3GA 1I9RL 3TH2T 4X6CE 4WRLA 1TVHA 5A3IC 5LGHH 2QL1A 3EO9L 4EUPA 1BECA 2G9HB 1I8LA 4OD2A 4D0DA 3O4OC 2YRLA 1NAML 4UOJA 3DHJA 3LVEA 4G8GB 3KJ6H 5EUOF 4E41D 5HPMA 1Q9KB 5E03A 1MIML 3IDXL 3OHXB 2VQUA 5LGKA 3QDAA 4HK0A 4JR9L 2ITDA 3KXFD 1WITA 4JY6A 2BVYA 3H42L 1C08B 2KKQA 5IQ9A 4BH8A 3SGKC 2Z8WC 4TQEL 3ZDZE 1FNGB 1SEBA 3ARGC 2OCFD 3MRBB 3GSWA 5DD6B 3HG1A 2YD8A 1CFSA 3IETB 3OV6A 4NKOB 5JLZB 3K4ZA 4YUEL 4PJAE 3MCG1 1J8HE 1S9WB 2WINB 2WIIB 4H26B 4XC1L 4X6EA 4G8FA 3S3JA 3H9SE 2VQTA 4QYOA 1S7QB 5JHDB 4GKNA 4PD4K 4PGCA 4IRJC 4PV8B 4O9HH 5F89A 3TVMC 3SKJH 1YMME 3BP5A 4Y16D 1E27A 5MEOA 3SDYL 1KEGH 5FGBC 4PJCB 1TMCB 2F58L 4FZEH 5JQ6H 4S1RH 3FQXB 1JZ7A 5FM5M 4W4OA 3FFCA 3DOSA 4LHUB 5CGYD 1F45A 1CI5A 3SKNA 3QB7C 5IWLA 3HC0A 4GKZB 1IE5A 3H2WA 5JIHA 2LTQB 2F15A 3QSKB 3B2UC 1GHFL 5INCB 2QV2A 2UYLB 2AK4D 1D5XB 4Q0XL 4LARL 5BJTA 5IHBA 1IC1A 3CUPA 4R90H 4U31A 2A73A 3L3JB 3H6JA 1MQKL 2FRGP 4YBQD 3LQZB 2IQAB 4EKXA 1XR8B 3QUXC 4NYLB 1EGJH 1YMHB 2EDOA 3QH3B 4ODSH 4N9OB 3OKNA 3AMKA 4TVPD 2JIXD 1WVZA 2VXVL 1U92A 1ND0B 5IHUH 2J8UB 2MQ0A 4PGJA 1VB9A 1BLNA 4PJFE 2NW3B 5D5MB 5E5RB 1DDHA 1IT9L 1F8TL 3BWUC 3QEUB 4WI3A 5E8OA 5BRZE 3ULVH 4JY5L 3ZTJH 1PG7L 1ZHNA 1J11A 1I9RH 4QRRE 1T1XA 3EDJA 2XXMB 3WV0A 4KRLB 1QVOB 3CU1A 3EO9H 1BOGA 1XF1A 4GXUN 5IBLC 3TN0C 1KEML 1S7TB 1KELL 2EXWD 3E3QC 4LKXA 3CZFA 4DZBB 4XTRC 4DCQA 1NAMH 1A6ZB 4MNQB 3VCLA 2ADGA 5FCUL 1RIHL 1MIMH 1FL6A 3BPOC 1I4FB 3FQTB 1G7JA 2OL3A 2F5AL 1HXMB 4JDVA 4JR9H 4DK3A 2X89D 2FSEB 3GBLA 4F8QA 3QRFM 4N1EA 4HEPG 3CX2A 3H42H 1KNOA 2KL6A 4RMWA 4FQ2L 2H45A 2WW8A 4TQEH 3QO1B 4YHPB 3V6BR 4X6CA 2DLTA 5HHOB 4YUEH 1J0IA 1DUZB 4XC1H 2AXGA 5JMRA 2W65A 3BO8B 4W81A 3SPVB 2CDEA 4DKAA 5H94A 3MXVL 1WC7B 1SY6H 1IILE 2YOCA 4E42B 3DSNA 4F15B 4S2SB 2GSGB 1OSZA 3GI8L 2F58H 1F6FB 1EPFA 2DL9A 5FUOL 2DKSA 4JKKA 4LNRA 3LKOA 1PKQA 5B3NA 3GBML 2JELL 4HK3J 3V6FA 4OIAA 4YDVA 4P46D 4NP4L 5D6DA 4PRNB 4AM0A 1JWSA 5C0EA 1GHFH 2V2XB 2LTQC 2JJTA 2XT1B 3MUGB 3QFJD 4M5YL 2OYPA 3VFMB 1WBYA 4PJAA 4Q0XH 1J8HA 4LARH 1L0YA 4FZ8L 4K71C 3PWPB 1MQKH 4N5EC 2FO1A 4X7FC 4YR6B 1J0JA 4I77L 4WUUE 1NEZB 3UROR 4U3HA 5T1LB 1X5LA 2GSIA 2H2PD 5TQ0L 5IMKA 2VXVH 4DUVA 3QJFB 5I2IA 4FQXA 1P6AB 3NFNB 1A21A 2A6JA 1IT9H 1F8TH 3TYGH 4P2CG 1JV5B 3VXUB 5HJ3A 3E2HB 4OZHB 5JW4M 3RVWC 1PG7H 1OF2A 1H8OA 1CU4L 2H6PA 3R8BB 3L3IB 3EYFB 4ONHA 3T1FB 2HT4D 5HYJE 2DWDB 1UKTA 5H2BB 1LDSA 4DVBA 1KEMH 2X9XA 5B8CB 1OWRM 1KLGB 1ZVSA 4P5MA 1TXKA 2IADB 2A2QT 2RAMA 4Y5VB 3MLTA 2DQDL 4L9LB 4RGNE 1IGTB 5GSVB 5FCUH 1RIHH 2VTFA 4XNZB 1FVEA 3OSKA 4LCWE 5CBEB 2F5AH 1L6ZA 3QQ4A 1IAKA 1AH1A 3FAXA 4X99A 15C8L 5EBLB 1G9EA 1U91A 4OUUA 4FQ2H 4WW1B 3MLSL 2HMIC 5C3LD 5BRZA 3ZSTA 4XNQA 1SJEA 4UNVA 3ARUA 2EKSB 4X9HA 8CGTA 1JYNA 5EB9A 5E9DB 3TBYA 2YMXH 1YNLL 4JFXB 3TIEA 1FO0A 3VH8B 4P2RA 5IMLA 2XQBL 2XN9D 2EIDA 3MXVH 1YPZB 4KKAD 1FNFA 5CEXB 3GI8H 1N2RB 3WJLA 3DBXB 2ZZUT 2VLME 1G84A 1UM4L 4Z77B 1AO7E 2I25N 4MNHA 3F58L 5EBMA 2RJMA 3MV9E 2B20A 3GGWB 3GBMH 1QSVA 2JELH 1KOAA 3VGDA 2BSTB 4OIBA 1FAKT 4NP4H 3MLRL 1K8IB 1Q9WA 2F53E 2Y6SC 2VIRB 4M5YH 3LN4A 2DQUL 4OSUL 5KSAD 5ESAA 2X9YA 2DKMA 3TZVB 4FZ8H 3ARDB 2H32B 1AP2B 4I77H 2GJ6E 1P84K 1DJSA 3I3BA 1MAML 2R1WB 4GUPB 4RNRB 5JA9A 3D39B 5TQ0H 3QP3A 4JPVL 4RMSA 5FYJL 3GJFA 5FOJA 3ELAT 2DMCA 4WNQB 5IKCA 5IVXE 5CMAA 4ZUSA 4NFCA 4OUOA 3JWDH 3DVGB 3WLBA 2XTLA 3E2HC 1CU4H 4KMLB 3NMEA 4PGDA 1DQLL 4POUB 4Z6AT 2JK5A 1WCQA 2ZSVA 4KQ3L 3NCBB 5SWZA 1QFWI 5F44A 5EFIA 1CTOA 3CSBA 5F9WC 3EHBD 4MXWL 5B8CC 1A9BB 2QQQA 5H8DA 4JFOB 4WUUA 5FO9A 5MENB 1MUJB 1N3NA 5B4MD 1RHFA 4L9LC 3O3UN 1DLHB 1M4KA 3RZCC 4XNZC 4ODXB 2E9JA 1EK3A 2MOVA 5GSRB 4HS3B 3UP1A 5L9DL 5FGCE 5ABDE 2ESVA 2IGFL 2KDGA 3FRUB 2EEDA 4YBLC 15C8H 4D9RE 1TNNA 2XICA 5HHPA 3O3EB 4I0PD 4QF1A 2PYED 5KANI 3MLSH 5L2JA 3T65B 3CD4A 4MQSB 1T1ZB 2M2DA 1NBZA 2EC9T 2F54A 1XGYL 2HJFB 4JFDE 4I4WB 3QFDA 2FNBA 4YHOL 5B38B 5KAQG 3WN5A 4X7EC 2VZVA 1YNLH 3OAYK 5EO1B 1JRHL 2XQBH 2IEPA 4MA1B 1A9EB 3G5ZB 5AAMA 3GM0A 5CP3H 3MV8B 4EUPB 4ZNCD 4H8WL 1UM4H 3F5WA 3F58H 4D0DB 4PJEB 4QOKE 5HPMB 3MX0A 3CK0L 2P24A 1MAJA 4M7ZC 5FM4A 1DEEB 1VPOL 3P11L 1YZZA 5I76B 4L9DA 3RIAK 4PBXA 5JDJA 4JB9L 4OFVA 4HUUA 3MLRH 5TE6L 3PGCA 2WZPD 3H7BA 2NY3B 3ULSB 4OSUH 3BP6A 3BEVA 1YDPB 1AGBB 2AV1B 3TZVC 3FO0L 1HILA 1RUQL 3VD9A 3ARDC 3IJHB 3ET9F 4B41A 1MAMH 4NQEE 1CFSB 5GGUA 2J8HA 4JPVH 2LU4A 5FYJH 5C9KA 1YNTA 1AO7A 4H8WC 1TJHL 1CXFA 3OXSA 4F7CA 1A2YA 4PGCB 2FZ3B 4ZUUA 1ZHBB 2Z31A 1F4XL 1ZGLB 1OTTC 2VL5A 3MRPA 5IB4A 5SWSA 5L0QB 1DQLH 4OZGF 1M7IB 5KN5A 4KQ3H 1N5YL 4ODWA 1KV3A 2PKDA 1AD9A 3VXRD 4GKSA 4R26L 1DVFB 4MXWH 5C2UB 3DNKA 3UTQA 4HAGA 1RUAL 3OF6A 4M1CC 5KW9L 3T77A 2P7TB 1U6AL 3D0LA 1OTSC 4FFWD 5I1LA 5L9DH 1F90L 2IGFH 5I1CL 5CWSA 3LKRB 5K9KB 5DHXB 1NAKL 4U7KA 2L7JA 4M6NL 5IVXA 1EZVX 2R56L 4M8QB 1HQ4A 3O9WD 4ODHL 4N0UA 2EE2A 1SEQL 2YEZA 1CFQA 1U92B 1YJDL 2XY1A 2Y5TA 4YHOH 4QRSA 1H8NA 4ETQA 1KB9K 4M7LH 1ZLVK 1JRHH 1NFKA 2H32H 2I9TA 3UTTE 4ZPVA 1N5AB 4LVHB 5BOZG 4MA1C 5F93C 2N56A 4PJ9B 2VZOA 3P4MB 2R69L 4HJ0C 4EEEA 2VKXA 4H8WH 4H0IA 4C56D 4RAVB 3CZFB 3CSYA 2XKNA 1HHGB 1I8LC 1HIML 4WFFE 3I6LE 4KJYB 3X3FL 3CK0H 1YYLH 1VPOH 3P11H 4AG4L 2BCKB 3EJJX 1L0QA 4M4RA 4JB9H 4XI5C 1INQA 5TE6H 2HKFL 4PREA 1EAPA 2ED9A 3ZDYF 2FX7L 1QRND 3UTSD 1A6VL 1YJDC 4Y5YA 2YXFA 4XHJC 5D7IF 1NCDH 4JPIA 4LLMA 4RX4D 3GMMA 1XGPA 5EOTB 3FO0H 1I8MA 1RUQH 5IFJA 3HPLB 5DUPL 1GH7A 3RNQB 3BP4B 3RUGA 3PWVA 4DEPB 1T4KA 1MAKA 4MX7A 5BZDA 3LQAL 1NC2D 2VUYA 1CE1L 1TJHH 4QOKA 4DKEL 2D31B 3S36L 2E7LA 4IIQB 1F4XH 1FNSL 1GGIL 4I9WD 1QFOA 5I66A 1RUKL 1GYAA 3U9PH 5I75C 1N5YH 1RJLB 4L8SB 3TBTA 4NZDA 2DWEB 3S96B 4R26H 1EMTL 1PQZB 1PLGL 3MJ8B 4W4OC 2MHAB 3CFCL 3HZVB 3LKOB 3SDXA 4B50A 2FO4B 2IFFL 1JF1A 1WTLA 5IWLC 3BD3A 1RUAH 5KW9H 1VADA 4CVWA 1FL5B 3DX8A 3FQUA 4I3SL 5J3HD 5GGVL 1U6AH 2EDLA 3QQNA 3VFPB 4JZNB 4EUPH 4NSKB 4RMQA 1F90H 2FBJL 3AM8A 4LEXH 5I1CH 5DSCA 3H9SB 3KLDA 1ADQA 3LQAC 1NAKH 3LPFA 4M6NH 5GS2H 2HFTA 4GRLA 2R56H 1BZQK 4PGBB 1YMMB 4ODHH 2K9UA 5DJ0B 4X6FA 5CP7A 2OL3L 2RQ8A 3DX7B 1SEQH 3MCKB 5IMKB 1YJDH 3CFEB 2NY2B 5HI4D 5FYKH 3PJSB 1SYSB 3QUKB 3OKDB 1O7VA 5ICXB 1KJ3L 2DTML 4CW1A 4PJ5A 2AXJA 1CIDA 3LKPA 4HQQL 5KVGL 4NFBA 1IC7L 5IMMA 2R69H 4WFGD 2UY6A 2EYTA 2KPNA 3H8NA 3W5MA 4XB7A 3CFKA 1HIMH 1QSZA 1EO5A 5FM5O 1S78D 3X3FH 4AT6B 5JXED 4AG4H 1WFNA 1MCRA 1I1YB 5K93A 4KPHL 4ODVL 2E7HA 2HKFH 2V9QA 3BN9D 4GMTL 2FX7H 1IGIL 1A6VH 1RUML 2YD5A 4MDJB 4PJFB 5DMGC 2DI9A 3UZEA 4P2OD 4F57L 4KUCD 2B4CL 3QXAA 4LLDB 4MVBD 3U46B 3HUJF 4XNQB 2CKNA 5FOBB 5DUPH 4QRRB 4YDJB 4F7TA 1TCMA 1C5CL 3HMWL 4L8BA 4DZ8A 5IROA 4UT7L 4ZAKD 3LQAH 1F4YL 2PXYA 3TBYB 1BZ9B 2AKRA 1CE1H 2CO7B 2NCMA 4N90E 1JGEA 1JHTB 3U7WL 1V05A 4PLNC 3JWOL 4DKEH 2Q3ZA 5IVZB 4YXLL 3S36H 1S8DB 1VACA 5JPMB 1ZXQA 1FNSH 2NLJA 5KS9F 4CDGC 2XOTA 2HVJB 5ICZB 5ECJE 1GGIH 1E4KC 4OF6A 4PS4L 1RUKH 2W38A 5C0FB 4LSSL 5DURD 1JPFA 1UKQA 3D25A 3I6GB 1WCBA 3OKMB 3TESA 1T3FA 1INDL 3VFVA 3IU3A 4GRWB 4NUGL 1EMTH 4PJDA 1PLGH 4L8SC 1P4IL 2K7PA 3CFCH 2YPLA 3HZKB 2APWA 2P8LA 3S5LB 2IFFH 2B4CC 5CLTA 1MFNA 3QQ9C 5D93B 4I3SH 5GGVH 5JTWA 3CXHK 4WW2A 4XNMB 4Y1AE 4CVZA 3G6JE 3OGCB 2O61A 2JJTC 1DUYA 4P4KD 1FN4A 1FZKA 2CRMA 2VXTL 3F6LA 3GMPB 1I8IA 5TQ2L 4XT1C 5C0BB 4CAGA 2ADJA 4P5TA 3KPRA 4NNYB 1P2CA 1Z5LA 3MRNB 4L4VE 5DJDB 3GJFB 5JDSB 3B5GA 2NY2C 3STLA 3QISA 3K3QA 4LDLB 1KJ3H 2DTMH 3L3DA 1YY8B 4KKLC 4LSRL 2JK5B 4HQQH 3BW9B 2L0DA 1IC7H 5KVGH 2ZSVB 1E6JL 1I8KB 1CGUA 4OBSA 3GFUA 2C4XA 1WFUA 5T3ZD 3CVIL 1JBJA 1DTUA 1N3NB 2Z93A 4KPHH 1NKOA 5DJCA 4ODVH 2QTEA 1DE4B 1ZSDB 4XWGL 1IGIH 1RUMH 1PVHA 3ECBA 3K7UA 3MODL 1A6TB 4F57H 1YEJL 4I18B 1Q0XH 1EVUA 1SVZA 1A1MB 3WIFB 4JO2L 1KC5L 1KPVB 3B2VL 1OW0C 1JGVL 2WQRA 5DMYA 1KXQE 2HG5A 2BSED 3HMWH 5HYJB 3FO1B 3MUHL 4K3GA 4UT7H 1W0VA 1F4YH 2CLVA 3U7WH 3JWOH 5IW6B 4YXLH 2BVPB 4KJQD 1I7TA 1IEBB 1U3ZA 3Q0HA 4HJGA 2V5MA 4RGNB 1RJZA 3Q48A 4KJWC 4PS4H 4LCWB 4XVJL 5EUOE 1JI2A 4LSSH 1CE6A 2VLKD 2W9DL 1INDH 3WJLC 1TPXB 1ZANL 4NHUA 4JO3L 3RWHA 2X70B 4RBPK 4NUGH 1WBZB 4KRNA 2D7NA 4NQSA 1P4IH 3BIBX 2YD1A 2EE9A 1A3LL 1IKNA 1QSED 3SEPA 1FV1A 1G0DA 3CCHB 4U1GC 3Q6FA 4UUJA 1KTRL 4BZYA 1AC6A 4PBWD 2VXTH 2W0KA 4KI5D 5A1AA 3BI9X 3V6ZA 1B4JL 3OAUL 1FFOA 5TQ2H 5IR1B 1Y18A 3HR5B 3F12A 3X14B 1T1YB 5C0IA 2OJZL 1ZT4B 1U95A 4D0BA 1CK0L 1HCVA 1KCLA 3HE7D 4ZO9A 1AO7B 5IW1B 5MHSE 2NZ9C 2VABA 3PXJA 1A2YB 3CX5K 3MV9B 3Q3GB 1IGYA 5E00A 4ZUUB 4LSTL 2Z31B 5C9JB 1EJ6A 4RA3A 3UYRL 2A6KA 5IB4B 4J12A 4LSRH 4QRPA 3KLHD 3MSPA 3QXDA 5JNYB 3BX7C 1NGQL 3MNWB 2F53B 1E6JH 4PY8I 4Y1AA 4PG9A 1FCGA 3G6JA 4XPBL 1UG9A 3MO1A 4YEFA 5FV1L 1F3DJ 4KUCF 1U8MA 3CVIH 4UQ2B 2GJ6B 3T77B 3UPAA 1TCRA 3DMMD 2C26A 4ZUVA 4GRWH 2HN7A 1DN0B 3I2CL 1YY9C 4KROB 4OLUL 2BHYA 5D71L 4XAWL 3VFWA 4YAQA 3QIWD 4LF3A 4JO2H 1F11B 1KC5H 3UYPA 3C6SB 4YHZL 1JGVH 4XCEB 4J3XA 2FLBT 4H20L 1TZHB 4C59B 1DP0A 2NW2B 4P2QA 3O0RL 1NH6A 4ETQB 5DUML 1JUFB 5HGBA 3T0BA 2WBJD 4UILL 5C2BL 3T0VA 1D7FA 3V5DA 2Y1VA 3VDBA 4EI5D 5CIPA 2X4NB 4MHHI 1I7ZB 4G5ZL 4XBGB 3VXPA 4KK6D 1B0RA 3FB6A 4U6YA 4OZFG 2FECL 4XVJH 1U8OB 3G08B 4MD5A 1R24A 4RGNC 2AJVL 1ONQB 2W9DH 3NCMA 3GJFH 1BD2E 1CGXA 4RZCB 4V1DA 5GGVY 1ZANH 5FGCB 4JO3H 4M48L 3T0EE 4JM2B 1HQRA 5DEGA 1TPXC 1O5DT 1A3LH 4Y4KA 4JKLA 3M07A 3BGAA 3KS0H 5EBWB 1BJ1J 3WUWB 3SE8L 1LK3L 5T1KB 4CN6A 1EAPB 4QRQB 4JFDB 2FIKB 2WM0A 5E1AB 2IANA 4S1SL 1H3UA 2NZIA 3TPUA 2HT3C 3VGGA 5SX4H 4LLMB 1GGYA 2NX5D 4X4ME 1JWMA 1B4JH 3ARFB 3OAUH 4Z18A 4ZTOL 5MP6L 2ZUSA 3V9FA 3FMGL 1JRHI 5EIVA 4H0HB 2EC9U 2OJZH 5H37H 1CK0H 3MBEB 2R2EA 5CHNA 3S37L 3TCLA 3WO3B 2FR4A 3LQMA 3DUSB 5C0CE 2Z31C 1J0HA 3OKEA 1NGQH 4PJXA 3BIKA 3ZKSD 2ZPKL 5HYSB 5ITFA 3DV4B 3OBAA 3NFSL 5I19L 1M1SA 3DO7B 3O81A 4XPBH 1BBDL 4WU7A 2GIYA 3VXQB 1NMBH 2VOTA 2NR6D 5K59F 2P8MA 3FT4B 2IPUK 3RBGA 1OD9A 3SDAD 1U93A 2CIIA 3LEVH 4X98A 5F7EL 4NQEB 2BX5A 1NCCL 2A77L 2ICEA 5CSZA 4ZQKB 3DROB 3I2CH 2IMMA 2C5DC 3UJJH 4OLUH 3B9EA 2D2OA 4Z7UF 4XAWH 1OARL 2VL4A 4YHZH 1A1NB 1NC4B 5JW4N 3G9AB 2JB6B 4H20H 5D7JB 3WNPA 2UWEF 2XWBA 3BHBA 1XF4B 3IB4A 4NQXB 5BS0D 3O0RH 5IHZA 3DTXB 5DUMH 5I6XB 1GZQA 4JCLA 4UILH 5C2BH 2CXKA 4M62L 4BKLB 4LVEA 5FM8A 4G5ZH 4HJJL 3NCJL 2R4SL 3UTZB 3H9HB 4WTZG 1JGDA 3U9UA 3ZO0A 4YGVB 1S9XB 3SCMB 2EIZA 3OG6B 2AJVH 4NZTL 4RFEA 4DFIA 3MMEA 1OGAE 2BNRD 3KVQA 1FLRL 3V4PL 5GS0D 1CICB 4DWHA 4JM2C 4KI5F 1BFOA 2WWMC 3O2VL 4J1UB 4Q9QH 3SE8H 1XCTB 1LK3H 1KIPB 3DECA 5C0AA 5C07A 3VWKB 4MXQC 3DX9B 1X5XA 4S1SH 3MJGX 1P69B 4PLJD 1ROWA 2ATKB 2X4UB 2Z91B 5DJ6A 4Y5YC 4ZTOH 5MP6H 3UTTB 3C6LB 1G7LB 4M3JA 3FMGH 2HFGL 1C7SA 1MWAA 1ZA6B 5ACLA 3HNSL 3HZYA 3MLXL 1BD2A 1S7SA 2EKJA 3T0EA 3C60D 3HCVA 4NC0B 3IDNB 4BQ6A 3S37H 1BOYA 2C3GA 4OCWL 3MBEC 3MRKB 1ZWIA 4CJ0A 2E7LC 5C08A 3G5VA 2MMXA 4OQTA 5AAWA 3FO9B 5GIRA 3D0VB 5IEKA 2ZPKH 2EIBA 1NKRA 2BY1A 3NFSH 5I19H 4QHMB 3RJQB 1BBDH 4U1NB 4EN3A 4ALAL 3RIFF 4PRHA 2R23A 2BXYA 4N0FA 5F7EH 1DQTA 2YN5A 2AS5M 1NCCH 5A16B 2A77H 2VLLB 4PTUB 1DQDL 1JK8A 1PJ9A 4MQXC 5D7SL 3AM8C 4HGWB 2ZKHL 3O6FA 1OARH 3TT1L 1VESA 2AERT 3U30B 5C0CA 4GRLC 3QI9B 1AQDB 4ZO7A 2EO1A 5IP4A 4IOIB 3QULA 4DN3L 1N0XL 4TRPL 3FTGB 1WTGT 3GI9L 4D0CB 4M62H 1NUFA 1ZGLP 4LSDA 5AYUL 3GSXB 4P57A 4HJJH 3NCJH 2ZOLA 3S34L 3CFJA 5BQ7B 1X3DA 2RR3A 5EZOL 3PWJB 4AQ1B 5C70A 4NN5C 4Y8AA 4NZTH 4NO5A 3SCMC 1EX0A 1FLRH 1T2QL 3QXUA 3V4PH 3T1WA 3W5NA 4U1KB 4CMMB 1QLRB 1OOAA 4NKDB 1HKLL 3QCVL 4ETYA 2Z93B 1UZ8B 3MRCB 4GG8B 4HKBA 5TDNA 3O11B 3ARYA 1WICA 5I1EL 1PY4A 1UJ3A 3VWKC 3VFUA 3WHXA 4E41A 4DGYL 1MIEH 4NN7B 4HWBA 4O2CB 3QUZB 1MFEL 5F7DB 3HFML 5EWIL 4R97B 4LLWA 2CPCA 4I48B 4EQ3A 2DDQL 2PR4L 3LZFL 3GSUA 3KXFA 3R0MA 2HG5B 2CLZB 2HFGH 4L3ED 4XVUC 1S7UB 2WUBL 1L0XA 1G7MA 1MHCB 5T1MA 3C9NA 3HNSH 3MLXH 1QO3B 4OLXL 4ZXBD 2GJJA 4EXPX 4F3FA 4FMFA 1J0ZA 3B6SA 4HMDA 3QFJE 4OCWH 3WS3A 1KXVC 2NY6C 1W72A 3JZ7A 2X4TA 3BUYA 5F7NC 2Z9TA 3CAFA 1VKXB 1FRGH 1HH6B 3C5JA 5I0ZA 3QWOA 1II4E 1FG2B 3QDMD 4JO4L 4Y16A 1FE8L 3DRTA 1BJ8A 4ALAH 2CDGB 2XZAL 4QWWC 5I30L 4L4TB 5I1AB 3FQNA 1ZS8A 3WIIL 3D1MC 5IB3A 4R0LA 3ZKQD 5D7SH 2ZKHH 4KUZL 1Q72L 2J5LB 1EVTC 1YN6A 1Y18B 1BPVA 3TT1H 3UO1L 3VXMD 4NQCE 3KPQA 4WJ5B 4X5WB 5CSBA 2B1HL 4FTVE 3W81A 1CQYA 1KTDB 3I84A 1R3LA 4P5TC 3BD4A 3U30C 5D2NA 4DN3H 1N0XH 4TRPH 4OZGE 5KVDH 3VXNA 5GGTL 5DJXA 3GI9H 5HGGS 4M7JL 5AYUH 3H7LA 1Z6JT 2JIXA 1RFDL 1H15B 3BZFA 4Z7WF 3ZE1F 1VGEL 4HX1A 5EZOH 3T2QA 5E6ZA 4V2BA 3BH8B 3I50L 4Y1AB 2FX8L 2X4QB 2ZCKL 3VA2C 2OQJA 1T2QH 3O41B 4KRPB 3INUL 2GITA 1U8MB 4HPYL 1ERNA 1N7ML 3E1F1 4NM8L 3P77B 1PG7X 4YQXH 1IQWL 5I1EH 3VG0L 4P3WA 4Q6IA 3P4OA 1IAMA 4L4VB 4HAFA 4DGYH 5I1HL 5HYQA 2DBJA 4LIQH 2J88L 1MFEH 3IDMA 5DJAA 3QIBD 5FKPA