2R4SL

Crystal structure of the human beta2 adrenoceptor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4sL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4sL01
3GMNB 1WZKA 4PJIA 4KUCF 1MIMH 1SJEB 3HUJE 1SJHA 3E0GA 1BQUA 1UZ6E 4HQQL 3F7YA 2IFFL 1QRNE 4HLJA 1SY6L 5CD3B 3FN0H 4NCC2 3DX8B 3HCVB 4LBEA 1MCFA 1YQ2A 2UV3A 3QH3A 1XF3B 4F9LA 3SJVA 5JQ6L 3EO1B 2Z92B 4I77H 4D9QE 1ZXQA 2EICA 5EO1B 3AREA 2AXGB 3VXOA 1GZQA 3DSFH 4FQCL 1UFUA 3FQNB 3UJJH 4ZPVB 3MRJA 4BZ1L 2X4OB 1U8LA 3CSGA 5E8DH 4M6NL 4UB0H 2R69H 3PDDA 4U1HA 1NAML 1YEIL 3IXTA 2ORBL 4XTRD 5C08B 4RAVA 3QUZC 1FL5A 1I8LC 3GMOA 4G8GE 3KYKH 4AL8H 4OGYL 4HKJB 2Z9TA 3U4EA 4Z7WF 5ITBH 3UBXG 1SJXA 4X4ME 4PP2A 5JPNB 4I0PB 3OKYA 4P4KA 5FYJU 3STZB 43C9A 2LE9A 3I9GH 1FN4B 2DTMH 4TVPL 5HDQH 3RNKA 4KXZH 1G6RL 3GSWA 4X6EB 2CK0L 3NH7L 4JDTH 5HGGS 3ZT7A 2K9UA 4NJAH 3RHWK 5I1GL 4OLYL 1UB5B 2C4XA 2G5BA 3LKNA 3M1BA 2L7UA 4Z0BH 2W1NA 4PG2A 4TSAL 5ABDE 4UTAL 4XCEA 5MEQB 2NY7L 4KROC 4UT6L 1UCBH 5ACMA 2ESVA 1I4FA 2JCCF 3TN0B 3S5LB 4P9HL 5DVMA 1AGFB 2FJHA 1ZANH 2C3VA 5MHSE 1FNHA 1FE8L 1OM3H 4KKLC 2KL6A 2IAND 4ELMA 5JLZB 2EE9A 3O8XC 5H94B 1AKJB 3HNVL 5EC1A 1JYNA 1DQJB 3O4OC 1T1YB 4GLRH 4EBQL 4MA7L 2VKWA 2PN5A 4ETQA 3X3FL 4JJ5B 4OIBA 4NQDA 2XIDA 3OJDA 2IAMC 2ZG3A 4HKBA 1NKOA 2EDFA 3W0WE 3EYFA 4J4PC 3WFDL 4XX1G 1RZFH 2YRZA 3HNTH 4KRPB 4HUUB 1TVBB 4BQBA 1H3WM 1CF8H 4PR5A 4XPGL 3QWOA 1E4WH 5IHBA 2VLJE 5D1XB 4L4VB 1S5HB 4MD0A 4MQSB 1UQSA 2WIIB 5IQ9B 4D8PB 4WUUD 1RMFH 1M7IA 4HCRH 4DEPC 3MRIA 3CFEA 1ZHKB 5DA4A 3O6KL 1N7ML 1O7SA 1CGYA 4XMKH 4PJXA 1ZEAH 3QUYA 4XRCA 3I75A 3PHSA 4LFHG 3QNYB 1SY6A 1IT9H 1CXLA 2ICCA 4MYWB 1N8ZB 5EN2B 3UZQA 2HVJA 4X5XB 3F6IA 3TNNB 4K3JL 3Q6GL 1RZJL 3D3VB 3CDCA 3FB5A 1ZHLB 2B2XL 3BDYH 5M94B 1CL7L 2BFVH 3MYJA 3MZTA 4Y5XC 1TCRB 4G80B 1WBXB 1A6VL 4K8RD 1CLYL 5FOJA 5L7XL 1UXSB 3MZGB 3PQYA 4LARH 1F13A 3ESVF 1QFPA 5BV7L 1BD2A 3VD7A 4J6RH 4Y1AA 2CIIA 3F62A 4I4WB 3LQAL 5EOCJ 4OUUA 5JW4M 4NHCL 3B43A 4XP1L 1P4IH 2WINA 2ICWJ 1BZQK 4FXKB 5IVXA 1EZVY 1NAMA 1T22A 4NPYA 3RWFA 5FM4A 5BZWB 3LN5A 1VEMA 4CVXB 2DWEB 4U3CA 4ODVH 3MRQA 5KSAB 3FONA 2NY1C 1BBJA 3FFCB 4TUJA 5DT1L 3U79A 2D31B 2Q20A 1QO3B 4EI5A 4X6CA 2WV3A 3FT3A 5ICXA 2BHUA 3OZ9L 1Q0YL 4QTHA 3SKUD 3MRHB 1IGIL 2DQCL 3IDXH 1G6RA 4E0RA 4K9EH 4YGVB 2BNUB 1KOAA 1A7OL 4HT1L 3OKEA 2C3WA 4G8EA 2ZNWA 3E6HB 5HHME 3WIIH 2H1PH 2IPTL 4E42A 5IMOA 4JFEE 4MCYB 4YHPB 2X70B 1JWMA 3WJJA 1D9KB 3X12A 2NXZB 5C0BE 1DBAL 3BP6A 4XWGH 2IFGA 3JSSA 5FGBC 1XGQB 4PRHE 4UZGA 3OB0K 5C3LD 3D85A 5CKGA 3MV8E 3NGBB 3BAEL 1MVUA 4AQ1B 3DVNB 5EZIL 2XICA 3FZUC 2BRQA 1Y6KR 3VFMA 4ZG1A 1RULH 3HAEH 1DQQA 3MLSL 1VADB 3OKDB 3ZO0A 3HZMA 35C8H 1OARH 4H1LA 1U8KB 3WL9B 5LQBH 1KG0A 4L4TA 4G8IB 1MQ8A 2NNAA 5LGHL 2K3TA 5KVGH 4R2GD 5J13C 3T4YA 2IG2H 4DTGL 4HLZG 4IHOA 3I6GB 3TT1L 1KJMB 3GSNH 3D39A 1YUHA 3HUJF 4Z95H 4M7JH 3FO2B 2NY1D 1JCKA 1FIEA 3KWWB 1JHKL 1QLRA 2Y07H 2A6KB 1NJ9A 5JNYA 2ZUWA 1A4JB 3PWUB 4Y19A 3B8YA 1CFBA 4Z0XB 4FQ1L 5IBLD 4UAOB 2GCYB 4AK1A 3GUTA 4AMKL 4F9PC 5F9OL 1JNHB 4FQXC 1MFEL 2VITB 3GKWH 3P9WB 4JY6A 4K2UL 4DKFH 1IBGH 1MHHB 3SQOL 3C5ZC 3NCYS 5F9JA 5HYJE 3CAFA 1NUDA 1PZ5B 1RZ7H 3VA2C 1EEQA 1RIUL 2YPLA 3VXSD 5CBAA 4MXWL 4WRLA 3V6OC 4HWBA 3JTTB 4PJEA 1FZKB 2AJZB 4MB5A 3TC9A 3MROB 1NMBL 5CEZH 4AQOA 4MJIA 4OSUL 5IOPA 5GS0L 5SX5K 8FABA 4MWFB 1HHIB 3T4AA 4YHLL 3WJLC 3LIZL 1G9MC 3V2AR 1CFVL 2UYLA 4DW2H 3QEGL 2XPGA 2P44B 5JW4N 2R4RH 4PJ8C 4U31A 1FZJA 2ITCA 4CU6A 4OCMC 5GRUH 3V6ZB 5L88L 4Y7MA 2VLLA 2YXFA 3ZSSA 4U1NA 1C16B 1FG2A 4KPHH 3A6CH 3VCLA 4EN3B 4FABH 3ZMRA 4MNQA 1JN6B 2F54E 1Q9LA 2EDBA 3U7WL 3F8UB 4YE4H 5INCB 1LEIB 4LEOA 3PWPE 1PLGH 4ONHB 5IB5B 1MAML 3P30L 1ZLUH 1JHLH 4GS7C 2Z8SA 3MV9B 3SDDD 2MCG1 1EJOH 5TF0A 3TVMC 1NEZA 4JPWL 4PGDA 1KLUA 3CDYA 3SE3C 1NMCC 4UV4L 3ARFD 2ZSVA 2QQNH 5HVHB 2VZ1A 3BPNB 3NTCL 5DK2A 2WUBL 4P5KA 1Y18B 3TJHD 3TLRA 3ZKXB 3G6DH 3B9DA 1F90L 1LO4L 4OQTH 2FIRT 1JZ6A 3KLHD 2ADJA 2QHRH 5C07A 1G7HB 1KYOK 3MQIA 1I1YA 1QFWL 5KN5B 4R9HA 1JYXA 3RA7L 2CXGA 1B4JL 3ILQC 4YK4B 1MAKA 4KHTH 5I8EB 4U7MA 2XXCB 5I2IB 3BEVB 3U1SH 2KDGA 5JXEC 3TNMA 1TZIB 3VXTB 1KCRH 4OGXH 4LCYA 4ODSL 5I16B 2N4IA 3ULVH 4KKNA 3V52L 2A6DA 1OT1A 4G5ZL 5FIEA 2X1WL 4NWUH 1LEGB 3MYZA 2Z8VC 1BQLL 3FQWB 3ARWA 2CRIA 5F7YC 3I84A 3PUCA 2R56H 2A2QT 3C2AL 1AGEA 2HT3D 5JIIA 3Q1SH 1ND0B 3AVEA 4BFEA 1S7SB 1FYTD 4F3FA 4IOSD 4Z6AT 5F7NC 2VDNH 1NFIB 4DQOH 1U91B 3X11A 2DJSA 1BZ7A 2ZCHL 5KVFL 2R0LL 5GIRA 2WBJB 2XFXA 4M6AA 1HI6B 5HTSA 5EUOF 5D7LE 5EO9B 4U1LA 3DO7A 1MNUH 2DQUL 1IC7L 1HZHL 3GJEB 1CQYA 3QUXC 4UINH 1Z5LB 1HE7A 2ICEA 5I1JL 2YD4A 5IW6A 5FM5M 1NANH 1A1NA 1A2YA 1DSFL 4D3CL 5DS8B 3DX7B 4P57B 1S78C 4H8WL 5DEGB 3QG7L 1FL3B 3SGEH 3WNPA 1LE9A 4HEME 1KPRA 5IF0A 2R0WH 3NZ8A 1KTDB 3EOBB 3H9SA 4PLJC 1VFAB 2QADC 2QKIA 1FGVL 2BOBA 2DBLH 2DB8A 5C0GA 1JPFB 4DN3L 1GZPA 4N1EA 1TJGH 2X4PB 3HRZA 2VE6A 1T3FA 4MQ7A 4UOW1 1FVCA 1EO8L 5D1QC 5GGRB 4GG6F 4KGLA 5GS1C 1NGZB 1ZLVK 3QUML 4MNGB 4QRRD 5T1DL 1QNZH 2NY3C 5DQJA 1WISA 4ZXBD 1KLGA 2BNQD 1GOFA 3RTQD 1CG9A 2D9CA 2F9BT 4I9WD 4JVPA 3T3ME 5E8OA 1WV7T 5IMLB 1WAAA 1VESA 1QSFD 1K8DA 1S7QA 3T09A 5HPOA 2WBWB 3P0VL 5CIPH 4HFUH 1UACH 1N6QL 2V5YA 1FFPB 4EDWL 3V5KA 1ZHNB 4XP5H 1IC4H 5TDNA 3RAJH 4X6DE 4NQEB 2VSDA 1KIUA 4OF3A 4MD5A 3VGAB 3N9GL 4QY8A 4HWZB 4K8RL 4X4XB 3ULUD 3BZFA 5DRZB 2F74A 1SHMA 2HJKB 5I8OL 5A43C 3DURB 1XF2B 1YEJH 5C0ND 5JUEH 5IHUL 2OR7A 2VMFA 1JMXA 4PLKD 5JMOC 2HKHH 2EZ0C 2GY5A 1NBYB 1BREA 1CDBA 1U93B 5C09D 4GW4A 4PRNA 3I3BA 1JGUL 3RIAK 5IFHL 3BGFB 3V4PL 1I9JL 3DIFB 3DV6B 3WN5C 2Y7QA 4JHWL 3DHMA 3S7GA 4MA3A 1L7TL 3QDHA 1NCWL 3V5DA 2HFEB 2IH1B 1CVRA 3ALXA 2A6JA 4RGMC 3TO4A 4Y4HD 1IM9B 3E6FA 1OL0A 5ALCL 5IJVB 3OGCA 4NN6C 4WU7A 2NYYD 5B38G 5HJ3A 4L8CA 5KZCD 5DRWA 1DEEB 2DYPB 3PGFL 2DQEH 4B41A 1JPTL 3PDOA 1U8OA 3TBVA 4GRWH 3ECBB 1BVLB 5J6HA 1OP5H 3QFJA 4UIKL 4P46C 4KMLB 3MA9L 4G9FD 4X6BB 1N0XH 1A9BA 4OV5B 4LSTH 4QHNB 3CUPA 1GJIA 4AIXA 1LO5A 1HQ4A 5CLWA 3MREA 4KJYA 4Z7QF 5HYIA 2WQRA 1T7WA 4WU5A 1LK3H 4LLUB 1LK2B 1CFSB 2A9NH 2OBGA 2VLKA 2IANB 1BZ9B 3HPLB 3FFDB 3G5ZB 4L8DB 5FA3A 2E7BA 4HIHA 3VFRA 3N1MC 5HDBE 4K23L 3OTTA 1VEOA 1AO7D 4W68A 5L2KE 3P4MB 3V5HA 1CU4L 4HGKC 1XF1A 2QLVB 3L5IA 3P4NB 4E41B 2LVCA 3BQUC 5GRXG 1D6EA 5HY9B 1I9RL 1FVDA 2YMXL 3VXNB 4JZJC 3ZTJH 4ISVA 3LEXB 3O81A 4M7KL 1PG7X 4HZLB 4IRJD 2HWZH 5DD1H 5I73C 4P2CG 3QUZB 3ME0A 3HI5L 3PXJA 3QUMA 1NC4D 3P77A 2C3XA 2VQUA 4I48B 4FQPA 4MNHA 3TBYB 4QRQB 1UWXH 2AV7A 2OR8A 5GRJH 2Y36L 1OAZH 4WUUA 2P42B 3C9NA 4PRDB 1PFCA 1H3PH 2O61A 2H26A 4P49A 3SKJH 5IB2A 4UNVA 3EGSA 4ZUUB 1HKLH 1FP5A 2DQIL 3VGFA 4CL7A 3F6LA 3MLRL 1PAMA 4HKZB 1J9CT 4OCWH 2ZUTA 3LD8C 3GM8A 4N0CD 5AUMB 5C0IB 1IKNC 3VWKD 5JHDB 2QSCL 1EJ6A 4H25B 4M62H 4M6ML 2KQMA 1BQHA 3M17B 2V2TA 4HMDA 4KROB 1YNKH 1MJJB 1U3ZA 4OFIA 5KSUB 4F37K 1WZLA 5C0DA 4QXTA 4WFGD 3PHQB 2OQJB 9CGTA 3PWLB 4U1SB 3N1GC 2YKLL 2VC2L 2VZUA 3PWJA 1WWBX 1NUGA 3U2SB 1Q0XH 3O8XB 2HN7A 5IV2B 2IQ9H 4WY7L 5I71C 1AQDA 1YJDC 3O4OB 3SDAD 1U3HC 1A3RL 4ODXB 2X4NB 3UTPE 4NO2B 4S1QH 3GB7A 2VO5A 2JK5B 4XBPA 5MERB 4MD4B 5A2KH 4D2NA 3RKPA 2IBBA 1Z9LA 1P84K 4ONFL 1S9VB 4PJIE 4S1DC 3VI3E 2VH5H 2GI7A 3QDMD 5EBWB 3FRUA 4OBRA 2BNRD 1DBBL 4HBCH 4YR6A 4KI1A 1P53A 5JTWA 5BO1H 1UZ8A 3QHFH 2XA8H 3BH9B 3WO4C 4B50A 3FN3A 1FZOB 3G5YA 3N1PC 4X9GA 3V0WL 4R26H 3GRWL 5I9QC 4MS8D 4APQC 3QWRD 4LL9A 2VLME 3NIFE 1HILA 4MDJA 5DJDB 3DROB 3ZTJG 4DEPB 1TTFA 1YNLH 4QT5B 4ZOBA 3E8UH 1CTOA 1AIFA 3RX7A 1KGCD 3DXAD 4ZOCA 3QJFB 4Z5RA 1EHLH 1RZ8B 3GIVA 2WIMA 2JF1A 2WBKA 5E7FA 3WS6A 3TBSA 2DLFL 3DYMA 4K07A 3LKPA 2O5YL 1T20B 3DX9A 4Y5XB 4EI6A 3QEQD 3S3SA 2Y6SD 4JY5L 4XVUC 3WSQL 4HQQH 5D7IE 4Y4FC 2IFFH 1AXTL 4D94A 1N5AB 1UH2A 3T3MF 1SY6H 1HHGB 3NN8A 4H26B 2Q76B 1SJVA 5FEBA 2YSSA 4GFTB 2QQKL 5IB3B 5IVNA 3SEPA 1FLRL 3FAWA 5JQ6H 1H3VA 1JUFA 1Q94A 4HIXL 1HYSC 3IKCA 2NY1B 4FQCH 1TETL 5ESVB 2ESVE 1A4KA 4JAMB 4PG9B 4X6DF 4GBXC 1I3VA 4M5YL 4BZ1H 4PRPB 2CSPA 3BHBB 4M6NH 1NAMH 4XCNA 5GZND 2ORBH 3VE0B 3GJFA 4ELME 4PREB 3FAXA 5BOZG 3VXSA 3LRSA 4F7EA 5HHNA 5T3XL 3EO0A 2FYYA 4OGYH 2JJSA 4X9HA 1XZ0A 5F3HA 1CLCA 4Y16D 5T1KD 1AD0A 4NQDE 5GHWL 4M43L 1RJZB 2JLLA 5J7CC 5E8NA 3IJHA 1RIVL 4TVPH 5FO9B 4I3GA 1C7TA 1G6RH 3S36L 3KGRA 5I8KL 3T1WA 4N8VB 1HOCB 2CK0H 1U58B 2AS5M 3NH7H 1LO2L 2M8XA 4HS6A 2RR3A 1BGXH 5KOVC 4KQ3L 2XTJD 2R4SL 4TSAH 3L6FA 3WDIA 4UTAH 2NY7H 4UT6H 5CWSA 5F7DA 1UYWH 2LV4A 1XGUA 4R4NC 4P9HH 4C4KO 1R3HB 1R3KA 3WLWC 2HKFL 5T1LB 4EKXA 4Q6IC 4P2QD 1ORSA 1FE8H 5CAYB 3ZKNC 5J13B 4PJXE 4C83B 4MQXD 3HNVH 1MLBA 1E6JL 1W0WA 3RWDA 1LHZA 2FLBT 4MA7H 4OFVA 5L8JB 3O2VL 1HYSD 5EU6D 4LGPB 4HKXB 3X3FH 3WNOA 3J8F7 4OI9A 4YHOL 1G7LB 1MPAL 1RVFL 1J1PL 2AXHA 3GRWA 4ORGB 1T2XA 3RDTA 4JFPB 2IMNA 3WFDH 1ZA6B 4L8SA 3W5NA 1JPGA 4U0RC 1BD2E 5HDBF 4FQXB 3U6RA 2VDRL 1WFNA 3WEXB 3EOTL 3C5ZB 3KLAA 2IC2A 3T65A 4XPGH 1B0WA 3D2UD 5IVXE 3BP4A 1R3LB 4LCUA 2R2HB 3CX5K 2ERJC 2DM4A 3MJ7B 3KPPA 1FFOA 3EIFA 2HRLA 3SKOA 2OJZL 3I2CL 4WFEE 1E0OB 4JPVL 4P2RB 3PNWA 4XWOC 1N7MH 2P43B 4X6CE 2APXA 2MOVA 4DZBA 3QZWB 4OZIB 3TZVC 4PJ7A 4W6WB 4Z7OE 3P9MA 3UTZA 1PYWA 4PJ8B 5EBLB 4K3JH 3Q6GH 4XH2B 1WEJL 1TTUA 5I1LA 2ADIA 3O3AB 4KZEL 1F3DH 2B2XH 43CAB 1FYTA 1CL7H 3MLUL 3F65A 5L7XH 1A6VH 1CLYH 2G9HA 1H8SA 2YEZB 5FO8A 5DZNA 5BV7H 5D1ZD 5HGHB 2Y06L 2PCPA 5DD6B 3LQAH 4WO4C 2XNAA 4IMLB 3C6SA 4XP1H 3QO0A 5GGQL 5IK3A 3NFPA 2Z93A 4XCYB 3QHZL 1KJVB 4MJ6B 3QNXB 2YUXA 4GS7B 1BFTA 2H6PA 2B20A 2AGJL 4B7IA 3TVMB 1S7XA 2QV2A 3OGOE 5DT1H 5DC9B 2FEEL 2C26A 3UEZA 5LG1A 3QO1A 3MJ8B 2W65B 4N0UA 4UUJB 2HJLA 2XZQL 3OZ9H 5T5FL 4YBLC 5A2IH 3CDGB 1IGIH 2DQCH 1ACYL 1MCRA 2RIKA 1A7OH 5E94A 4MVBD 4HT1H 4PJIF 4QRRA 4ZXBA 3DUUA 2IPTH 5TFSL 1UJ3A 3RTQA 2BCKB 1CDCA 1KPUA 4U1JB 1J0HA 4WVRA 2FNBA 2ZG1A 1HSAB 4Y19E 4I3RL 3GBNL 2BNQB 5TGBB 1DLHA 1QSFA 4PBWD 1DBAH 4QXWA 5DDHA 2B5IB 3Q6FA 3WHXB 4AEFA 2CXKA 1NBZB 1QEWB 5GRVK 3OMZA 3C87A 3NIFF 3BAEH 5EZIH 3QAZC 1MCJA 1QLFB 1NCTA 4PJCB 1VENA 4PRAA 4F2MB 2VIRB 4HFWA 3MLSH 4ZD3L 1ETZA 3MJ9L 2D7PA 3NPSC 3S4SG 4QCIB 2YC1A 3SE4C 1HINL 1OAXL 5LGHH 1WIOA 1UGNA 5IT2L 4KU1A 5DURD 1X5IA 4DTGH 1CLOH 3TT1H 3EYQD 3SY0B 5DLMH 4LSRL 4U1GC 4TNVK 4Z7UA 5C09A 3DARA 2DIBA 1I85C 3QUXB 4KDTC 1ZA3B 5D7IF 5IB4B 3CSYB 4NT6B 4PJFA 4P9ML 4LGRB 5J1AB 3RGVD 1JHKH 4NOBA 3X3GL 3ABZA 2EIEA 4FQ1H 3N06B 2B4CC 3GSRB 4NQVA 4W4NA 4AMKH 1H3UA 1I1FA 5F9OH 4MNQE 1MFEH 1FCCA 4K2UH 1C08B 2QADB 2QQLL 2Q7YA 1OF2B 4R7NA 3GMNA 4Y4HA 2Z91A 3HI1A 4ZAKD 2X4RB 3HZVB 1RIUH 5D1QB 5FK9A 5GS1B 4MXWH 4O2CB 3GMMA 3WE6B 2JB5L 5CD3A 2NY3B 4GLRI 3DX8A 1NMBH 4ELMF 1HK6A 4G6ML 4OSUH 5GS0H 4G9FA 1XF3A 1OAKL 3TO2B 4YHLH 3LIZH 3CLFL 3RP1A 1BQSA 1NDGA 1CFVH 3W39A 3UYRL 3IU4L 5FUZL 3QEGH 4JJHA 2R29L 2XA3A 1NEZG 2W9DL 3CVIL 1NC2B 2I07B 5GGRY 4K55A 3MCG1 4KK6D 2X4OA 4U6TA 1QP1A 5L88H 1T2QL 3WCYA 3LKOB 4AIZA 4HIIA 3IDMB 5EIVA 1XFPA 4N0YL 3HN3A 1C5CL 1EEUA 4XB8A 4NRZB 4LNVA 1U8JB 5JPNA 3U7WH 3K4AA 1M6OA 4OF6A 3DPBA 5HSFA 2AABL 12E8H 4U1KA 5TH2A 4NFBA 5FGSA 3STLB 3T0VA 1MAMH 3P30H 4U6HA 3VG0H 4IRJA 3RWGB 1B0RB 1BEYL 1NC4A 4JPWH 2PW2A 2JJTA 1UXWA 1X6LA 5CKAA 4UV4H 3WKNA 2PNDA 4UQ3A 3FQXB 3X13B 3NTCH 2Z31A 2WUBH 5E5MB 3KPSD 3TIDA 2VR5A 4GKOA 3WIFA 1F90H 1LO4H 4NKIL 2APFA 5MEQA 3TA3C 2RCSL 4LPTA 1QFWH 2VLRD 2CUHA 3KPLA 3S5LA 3RA7H 3IAQA 1B4JH 3SKMA 3IXAB 2FR4A 3VWKA 4RMTA 4NN6B 1KXQE 5MEPB 5JLZA 1OGAD 3H7BB 5ADPL 5JW4R 4M8QB 1T1YA 5ESAB 2DKSA 1U92B 4ODSH 5IM7A 3MJ9A 5J11B 4LRIA 1NFDB 4P46B 3V52H 3CZFA 4G5ZH 3BKYH 2D7NA 3IJSA 1FFRA 5F7MC 1G9NL 4OCRL 4TSCL 1BQLH 5ESQB 2J6EH 2V17L 2ZJSL 1IQWL 2VZVA 1A1MA 3C2AH 2GY7B 3SDAA 1VACA 3R8BB 1T04B 3EJZC 4M1GL 5HGAA 5DJXB 4Z7OF 5FA4B 4HUWA 1IGCL 1KELL 3CFBB 3GMPA 3MRRB 4S1SL 5D1XA 1JVKA 1X5ZA 1S5HA 5KVMC 4YDLB 1RPQA 1W72B 2ZCHH 4AH2B 4PRBB 1G7JA 2WWMD 1X7QA 1WAAE 5IQ9A 5KVFH 2R0LH 3KXFD 1KCKA 2CDFA 3BQUB 2XZZA 4QRPD 4LPYA 5DD5H 5DZLA 3GMLA 1E4KC 4CRPA 3ALWA 4JZJB 3QDMA 4ZFFA 2DQUH 1IC7H 1HZHH 1ADQA 4OT1L 4GRMA 2BNRA 5I1JH 4Q97A 2EH7L 1RK1A 1LGVA 1DSFH 4D3CH 5I73B 3QNYA 4H8WH 3TNNA 3QG7H 4AENB 4DKEL 4I5BB 1AJ7L 3IU3B 3U0PB 4OF8A 3OKLB 2GTWA 5CZVL 3SKNB 4NKOB 3DSNA 5E5RB 5I76B 1WCBB 3GO1L 4KK9C 1UXSA 1FGVH 3H9HB 2EEBA 1KCLA 3O6ML 3QG6B 4DN3H 4JVWA 1P4LA 5I8CA 3DXAA 1NCBL 4I4WA 3LD8B 1EO8H 1AP2A 2DJUA 2EDKA 3QUMH 1MCBA 5T1DH 1DFBL 1WBZB 3PHOA 4LSUL 1KIQB 5BS0D 4BUHA 1TTGA 2B8OT 4PP1D 4NC1C 1CDUA 3QEQA 5KS9A 4L9LA 3EDKA 2PYEB 5KSAA 3DRTB 4YO0B 3HZKB 4FXLA 2ZZUT 1IEAA 1QSED 2D31A 3LN4B 1L0QA 2FZ3A 1QO3A 2UWEA 3B9VA 5K9OB 2H3NB 5DHVH 3ZHDA 1E27B 5CSZB 1N6QH 2EIDA 1J7VR 4EDWH 2HT2C 2CKBB 2X05A 1INQB 1YN6A 5C0FA 1RUAL 1K5NB 3HC0B 1CFQA 4LIQE 3BO8A 1U3HB 2NMSA 3WV0A 3QEUB 5I8OH 4K7PY 4LCIL 4MCYA 1AGDA 5IHUH 3OAZH 4YHPA 4QHMB 3CXDL 4N90E 5D2LA 4HGWB 1Q9KB 1KB5A 4YHKL 3OG6B 3BFOA 2IANE 1BIIB 4MZ3A 3HR5A 3LKSA 4WI8A 5SX4H 4JKKA 1JGUH 3P0GB 4JPIA 5IFHH 3F7PC 4U0QB 4O4YL 3V4PH 1I9JH 5TE7L 1VERA 3WO4B 2FBOJ 2VDPL 3WXVL 4OF0A 4JHWH 4YZFE 3BDBA 3VXUB 5JDSB 4Y16A 5T1KA 1Q72L 4BQ6A 1N64H 1L7TH 4LPXA 4AM0A 1SEBA 1NCWH 3BJLA 3CSBA 3EYVB 4UILL 5I9QB 3SPVB 4NRYA 4APQB 1F02I 3FO1A 3NA9L 1R3IL 2NY0C 2H32A 3EO9L 1U8KA 1H0DB 1MCOL 2ARJQ 4L5FL 4UOJA 1RZGB 5FF6A 5ALCH 1H15B 1JPTH 3PGCB 2AK4B 5CSGA 1PKQA 1KJMA 3PG2A 5CD5D 3L3JA 5DHYB 4DUWA 2M1KA 3V4VL 4PPTA 3Q2CA 4UIKH 2EEAA 3MA9H 4P2OC 4RGNC 2NY5C 1PKOA 4WUUE 4NO3A 1MCCA 3TWCL 3VFVA 4P2QA 2BP3A 1A4JA 1PY4A 4G6JL 5F93C 1YY9D 2GCYA 4Y4FB 2E9BA 1AXIB 3CVHH 1G7IA 3FB8A 4WCYH 4NQTA 2H8PB 4YDVB 3RVTC 2EXYD 4X7DC 5EU6A 3DI3B 1PZ5A 4GW1A 1RZKL 2IADB 5SWSB 1CXIA 3IETB 4K23H 1JGDB 4F33B 1MCPL 1CU4H 5CHNA 4L8BA 2HLAB 4W4OC 5F97E 4GBXB 1I9RH 2YMXH 3OJMB 3FTGB 4J3TA 5IWLA 4DOHB 4M7KH 5JOFB 3LQZA 4HV8A 4TNWF 3D2UA 2J12B 4LP4A 1LEKB 2APVA 2GAZB 3LB6D 1BVKB 3HI5H 4JZNB 1YDPA 2VL5A 1B0GA 1UA6H 4JO4L 3OR7B 4XPFL 1UWGL 2XN9D 2Y36H 3V6ZA 3MRFA 5F7KC 5IEKA 1MWAH 4E5XA 3TYFB 3FOMB 4OKVA 1T7ZA 1A6AA 1QR1A 1FO0A 4I1NB 4KKBC 5GGTL 2DQIH 1KNOA 1MLCA 3A6OA 4QXUL 4UQ2B 3D0VB 5E8EB 3BIKA 3GJFH 4QRUA 1JF1B 4LU5L 1UKTA 1AC0A 4YXHL 2QSCH 2CDEB 1I1AC 1MFBL 4P59L 3HTLX 5K9KB 4R3SB 1Z2KA 5BRZB 3RX8A 3BWAA 2AJUL 4GUPB 2VXVL 4M1CC 3I85A 2E3VA 4RDQG 2R2BA 1CFNB 4Q6IB 3BI9X 4OIIL 5F1KC 3SGKC 3O9WD 4UIMA 2YKLH 2VC2H 1NGXB 1A6PA 1RV6X 4OZFB 4WY7H 3C6LC 4YUEL 1A3RH 3SGDH 3SDXA 1Y0LB 2X4TA 3MFGB 3B2UD 4XI5C 4X4YB 3RVVC 4J1UA 3S37X 3MTRA 5J1TC 4XP6L 2ICES 2NW2B 4HUVB 1G0DA 2YPKA 2IMMA 4ONFH 4WV1A 3ARBD 3U46A 5GGUA 1TLKA 5I16A 4U0RB 1UKSA 2EDWA 3GSXB 1LDPL 4HH8A 4KTDL 3IDNA 4NO5B 3LCYA 1CS6A 3JWDL 3LPFA 5FECB 4MHHI 1DBBH 1WAAF 2P8PA 3QXVA 1BVZA 2EDEA 1B2WL 3O3DA 3B6SA 1IFHL 2VDLL 2ERJB 2FLRT 5CUSL 3V0WH 4YJZL 4XP4L 3GRWH 2AQ1A 5IKCB 1S9YA 2FEDC 2R1XA 2OL3L 2O93L 1NFIA 2YD1A 3MRBB 4GRLC 3TZVB 2OS7A 1RQ5A 4G6FD 1YMMD 5CJXA 4YDJA 3TBWB 5HI3D 4X5WA 1KYOJ 2DLFH 4M9OA 3VXSE 4LLVB 2G2RB 2O5YH 4FTVB 1WCQA 2OMBA 3JV4B 5DS8A 4BSWB 2RQ8A 4P57A 4XPTL 4ZODA 4JY5H 1AGCB 5SWQB 1I3GL 3WSQH 4NO0D 2F53D 1AXTH 4BJLA 4JDVA 4N9GA 4WO4B 1KIRA 1VFAA 2OMNA 1Q9WA 2QQKH 4CJ1A 3C5JB 2FIKA 1FLRH 3QB7C 4MXQC 3OKNB 3RGVA 2E8YA 1SYSA 4FQHB 4JQXC 4HIXH 3V7AG 2OX5A 3HI6L 1JWSB 1OAQL 3PP3H 4JFFA 5T3ZL 5JW5B 1J11A 1TETH 1WZMA 5DHXB 4B5EA 3ET9F 4M5YH 2X1OA 2OTUA 5GGTA 1I9IL 3REVB 1MHCA 3VGBA 3T77B 3MR9B 5IMLA 4YBLB 5IW1A 4L3ED 3EJJX 5MEND 4ZAKA 1WITA 4DN4L 3C2SA 4RISL 5T3XH 4DWHA 5DYOB 1KSRA 1JF6A 2AJSL 4DFHA 1D5BB 1KV3A 2ZUQB 4ZQKA 1BWMA 1V3KA 4OZ4A 4QYOA 2VB5A 5GHWH 4M43H 4KMQA 1RIVH 4OBSA 1J87A 2VUYA 3BUYB 5K59E 3S36H 2FX7L 4YZFF 4UU9B 5I8KH 1BMGA 1OSPL 4P5TA 4K7PL 1QUNA 1LO2H 1Z0MA 1LNUB 1LD9B 2XWJB 4KQ3H 2R4SH 2WMPA 1I7TB 5GGVY 5DMKB 4NRXB 5ACLA 2XWBA 1EPFA 3O11B 1V7NL 3NPSB 4HJGB 4I2XB 2EE6A 3SCMC 2HKFH 3DIFA 3VWJC 1GVIA 4GJTB 2BY1A 3B4NA 4OGAC 3ZYIA 2NY4C 3UTTD 5D6CA 3T0DA 1IL1B 4PY8J 3KPRD 3VFPA 4YFLI 2VDML 4UNUA 1E6JH 4PJ5B 1ZV5A 2GJJA 4U1GB 1U2CA 4RBPH 5E0QA 5GS2H 3H42L 4GXUM 3O2VH 4KUZL 1KLFA 1ZGLP 5EH1A 5FYLL 4P5MB 1QPXA 1FYTE 4QKXB 4YHOH 2E7CA 5T33L 3KPSA 3JBG7 1MPAH 1RVFH 4LLQA 1J1PH 4NHUB 1RJYB 3B9EA 5FKAB 1FV1A 5BMFL 2BVPB 2EKJA 2OL3A 2R0KL 3JVGC 3DLQR 2VDRH 4X6BA 4QGTA 3EOTH 2GJZB 3BD3A 1VPOL 3KPNA 3KYOB 3PGDB 2X4UB 3EYOA 2VLRB 1TJHL 2H2PC 1YEGL 4MDIB 5H35A 4V1DD 1T0MA 3U4BL 5FB8A 3BRGC 4WWKD 3VXMA 1RJLB 3FB7B 1I8IB 1Q9OA 1M7DB 4LDEB 5EO0A 2OJZH 4M9PA 5T1MA 3G5ZA 3I2CH 4JPVH 3T0WA 3TBTA 1ORQA 1A3LL 4N0UE 2J5LC 5C0RL 3O6FC 1FL6A 3P4NA 1NBQA 5JW3L 1I9EA 3U83A 1T0PB 5CEXB 1WEJH 4UNTA 4KZEH 3LEXA 3CMOL 5IVZB 2CLVB 1OWWA 3KNBB 2EKSB 4QRRE 1CIDA 3MLUH 1YPZA 3MRLB 1A3QA 4NNXB 4JHBA 3SCMD 1OTSD 2BNQE 3FT2B 3NBNA 4I9WE 4QRQA 4OZGB 3QIBD 1T1XA 5CLTA 2HVKB 2NQCA 5L2JB 4RQQB 1QSFE 1ZTXL 3G6JB 5GGQH 3VXQA 5JW4Q 1IGFL 3QHZH 4LSVL 3BH8A 3KXFB 2N7BA 2CLZA 3OKOA 3BEWA 3EOAA 2Q1EA 3CFKB 2AGJH 2GUOB 3QDJD 1S7RA 3A67L 2D0HA 3SDYL 5FYKL 1S7WB 2BOCB 1M1SA 2NR6C 4KZDL 3MUHL 2JJUA 5JHDA 2FECI 4QWWC 4Z7VB 3ULUE 5HVWA 3AAZA 5LGJA 1CBVL 1EO5A 4D0CA 4YDIL 1KPVA 2ZSWB 2XZQH 4LLYA 3F5WB 4WNQB 4WDIB 5T5FH 1ZLUK 3TA3B 1BLNB 1MJJA 1ACYH 3G9AB 4PLOB 4YIQB 4NUGH 5HHMD 3RWJA 4NQSB 1FNEB 3NOIA 5DVNA 4Z7UE 5C09E 1MCEA 4UT7L 5TFSH 3U2SA 3FQTA 4PJFE 5IV2A 4ZFOB 4IS6B 4PTUB 1AHWC 4HS3B 1XGTA 2X4NA 3LAFA 4I3RH 3C8DA 3GBNH 3IFNL 5BS0B 2QR0A 3RL2B 2PF6A 1QSEA 1ZVSA 4YHYC 1I3UA 3CC5A 5D4QA 3O4LD 1WGOA 5E2WL 4ZFZB 3MOQA 2IAMA 2XKUA 1MAJA 4NYLA 2OP4L 1GAFL 1CDHA 5F9DC 5HHOD 3W11C 5EBWA 3T04D 3CK0L 3HG1B 4ZD3H 1AI1L 2JJWA 1UH4A 3MJ9H 1CICC 2PW1B 1HINH 4DVRL 3VGEA 3PIQB 1FZOA 4G9FE 1I3RA 1OAXH 4OCYH 4HC1L 4PB0L 1VHPA 5IT2H 1G7QA 1HHHB 2P5ED 2NX5A 3DETC 1P7KB 3RHWF 1FSKC 1JE6A 1IAII 5DJDA 5E4EC 3O41A 1MH5B 4LSRH 4OF5A 1KJ2B 4HJ0D 3UZVB 3JV0A 4DFIA 4P3DA 1MJ7L 5ID1B 4JKLA 3VXRD 4P9MH 3QFDB 3BXNA 1HHKA 1D5XB 5IMMB 3IAPA 2ATKB 1DQDL 1EX0A 1JGEB 1N5YL 4KI5D 1AO7E 5KOMC 1GOHA 3QIUC 3DVGA 3T0ED 2HT4C 2P24B 3X17A 1BIHA 2QQLH 4LAJH 5ID0B 1WK0A 2MKWA 4P4RB 4XGZB 5CJQL 5KAQG 3ZE1F 3C8KA 1G9ML 1SVZA 1VKXB 1P84J 4M8VA 1N5AA 4YFDB 4R96B 4KY1L 4A6YB 5E9DA 5AZ2L 3HC3L 5CEYA 3I6LD 3IF1A 2JB5H 1IGJB 5DC0A 4N8CL 2EDHA 1E4XI 2IQAB 4G6MH 1ZHBA 4OJFL 3U9UB 5C1MB 3L3IA 1N6VA 1OAKH 4FFZL 2AQ2A 5DSCB 3W5MA 1OW0A 1QQDB 3DTXB 1H8NA 2PO6C 5DQ9A 5ILTH 4F7MB 2FSEA 3UYRH 3IU4H 5FUZH 2R29H 4PG9A 2BVYA 1QKZL 2W9DH 2KPNA 3CVIH 5GGSY 5DZOA 4PRPA 4GKSA 1T2QH 1VFBA 4X99A 1U8NB 3BHBA 4F7PA 5I17B 3L3KB 4N0YH 1EVTC 4J3OC 3VE0A 3WDHA 1R5WA 5IBUB 3HE6D 1P7QA 1YY8A 5D7KE 1C5CH 1J18A 3T2NL 3SQBA 2C4FU 3S5LG 5TDPA 4IRSD 3HB3D 5D7JD 3ZKSD 2E27L 4WFGE 4U1MB 2AABH 3JZ7A 2YD7A 1NCUA 1X9QA 4MAYC 5IIEA 1BEYH 2DQFB 4NSKA 5FGBA 4JO2L 4LHUB 2OZ4L 2XN9A 3MMEA 3QQ3B 5KVDL 3RJDA 4JN2A 4Q7DA 1T83C 5C86A 4NKIH 2DDQL 1EBPA 5DR5L 5GGVL 2Q6WA 2RCSH 3BZ4A 2NY0B 3LH2L 5J3HC 4JRYD 5I66B 2AV1B 1U8QB 3QDME 2W9EL 2YXMA 3DV4B 4JM2A 4G42B 4PJ9D 2VTFA 2W60B 4MA1C 2GJ6D 2BNRE 2G60L 2MCPL 3ELAT 5LAXB 1Q38A 3H9ZA 4X5LA 4MLIA 2QEJA 1EEZA 4GAYA 4TUOA 5CEZD 1K3ZA 1FPTL 2WQ8A 3NFNB 1G84A 1I75A 4P2OB 3EHBC 1C1EL 4HC1A 3LS5L 3I3DA 2A74B 4OCRH 1G7LA 3O9WA 4TSCH 4XZUB 4Z76B 3B5HA 4OGZA 4G9DB 4X7TA 2V17H 3H3BC 2ZJSH 1IQWH 1QOKA 2P8LB 1A9EA 1KGCE 3DXAE 3CZJA 3NFSL 1RUPH 4X6FB 1OP5K 4Y5VA 3WEXA 1JJUA 4M1GH 2P4AB 32C2B 1IGCH 1KELH 2V7HB 4J8RA 2HG5A 4HXBL 4S1SH 4HUKB 3OPZL 1ITCA 4AT6B 1N6UA 2R15A 1C5DB 2R2HA 3QEQE 5KS9E 5FGCB 3MJ7A 1RY7B 1BFVL 3ARBA 4OFDA 2VQTA 4ODWA 1BJ8A 4YGAB 2PXYD 3SN6N 3R0MA 3K8LA 1L6ZA 1TCMA 3TCLA 1K9TA 2UWEE 1SYVB 4OT1H 1A6WL 3IAGC 5T5NF 1GSMA 4M93C 2EH7H 3RIFK 4PV9B 5JZ7D 3ARGC 4OAWB 4PY7A 2C4FT 1YEDB 1EH9A 4DKEH 3RWIB 1AJ7H 5DUBA 4XH2A 5SWZB 5CZVH 5C0AD 3ZZ1A 1HDMB 43CAA 4BQ8A 3EW3B 2WNGA 3GO1H 4N1CA 2NY2C 2EDXA 4L3CA 3ULUF 1VGEL 2XXMB 3ARDC 5D2LE 3L3HA 3KPOB 5C2BH 1NCBH 1YMMA 2VERN 1UWXK 1FJ1B 1HYRC 1DFBH 4M48L 5ITBL 3QDGD 4LSUH 2DIJA 2OJEA 1S9WB 2FWOB 5IROA 3QIWD 1MHPL 2XKNA 1IGTB 1PVHA 2E9JA 3ULVD 4HJJL 2NLJB 4CMHC 3TVMA 4Z7UF 2HTLD 4IM8A 4BM7A 2DOCA 3SE3A 3HUJB 2VXQL 4NO0A 1FZMB 4PJFF 5HPMB 2F53A 4V2CB 1QRNB 5J89A 2ILLA 3KYAA 5CP3H 4LCWD 3VFTB 3BDXA 1T5WB 4JB9L 5IR1B 5HDOA 4MSWB 5E8PB 3FRPG 3VRIB 1RUAH 1Z0NA 4F8TA 3G08B 2YZ1A 3C6LB 2BSTA 4CJ0A 1KBGL 4U1IA 2XTJE 1QFUL 1N2RB 4GQPH 5D7SL 4HX1A 4JQVA 3FO9B 3RVUD 1ZLSL 4LCIH 3K4DA 4FNLH 2YA2A 5DEFA 3TV3L 1CIUA 4P2QE 4YHKH 5EBGA 1DVFD 1HH9B 3RPKA 3ARGD 5MENA 4OM0L 5KJRL 5DC4B 3FT4A 3VGGA 4YDKH 1NBZA 4L3EB 1QEWA 4O4YH 4XPAL 4FFVC 5TE7H 1MF2L 1UC6A 2VDPH 1NGYB 1I7RB 5EU6E 3WXVH 4LLWA 3DUSA 1Q72H 4TQEL 4UILH 4F2MA 3OKKA 3IDIB 3NA9H 1R3IH 3CFDA 3EO9H 2EIBA 1NGWA 1MCOH 4L5FH 5E4IA 4RX4D 1CF8L 2E6QA 4L1DA 3U7YL 1JBJA 1J05A 4GRLB 4ERSL 5IFJB 2ADFL 1EEYB 4YPJA 4G43B 5HHPB 2YHGA 1F3JA 3DMMC 3OXSB 2XY2A 3SY0A 3UAJC 1EFXB 4WTZA 4GW5A 2DQJL 5FXCH 3V4VH 3QUXA 3D69A 5EU7E 3RWCA 4Y4KA 1CXKA 5DJYB 1B3JA 2GSIA 2D4FA 3TWCH 1KTRL 3QQ9C 1MCHA 3RGHA 4G8FB 1KTKE 4RFEB 1W72L 3MRMA 2FO4A 1MI5D 5KW9L 4JRXD 1NGQL 2GFBA 1QFWI 2JIXD 4Y2DD 1OF2A 3GIZL 4WFHD 1OGTB 2BFVL 3KPRB 5A40E 3H6JA 4HPOL 1RZKH 4CAGA 4PJHA 3B9KD 1XIWD 1RK0B 1NL0L 1MCPH 2F8VA 4XHJD 3WE6A 1IZJA 1YMHA 3P4OB 1KT2A 3W0WB 4ZUVB 1FVEB 4OLZL 5IJKC 1P9MA 5BVJA 1YEKL 1DDHB 2GW5A 1X4YA 2DQHL 3ESUF 4V1DA 5EFIB 2KH2B 4BFIA 4WWKA 5I75C 1NC2A 5I0ZA 2I07A 3AY4A 3ILPB 4MCZA 4NKDA 4XPFH 1UWGH 2DICA 3GBLA 3NIDE 3S34L 2HJFA 2OTWA 3AREC 5GGTH 5JIKA 4EOWL 5EU4B 4YLQT 5I74C 5D93C 4NRZA 4QXUH 4D9RD 2X2YA 5ALBL 1U8JA 4LU5H 5CCKL 4YXHH 2DM2A 5F6IC 1ZS8A 3D6GA 1URLA 8CGTA 3ULSA 4P59H 5C0JA 2C1OB 2IH3B 2CLRB 1ZT7A 3I02B 1S7UB 5EU3B 4O51B 4OLEA 2EDRA 4P4KC 2AJUH 4J2XA 1OTUC 4N5EC 4X98B 2VXVH 2NPLX 3D5OF 3QIBA 4XNYL 4UBDC 5A2LH 3SCMB 3VXPA 3WN5A 1CFTA 2APTA 4OIIH 5GJSL 2F8OA 3P2TA 2NY4B 4LDLB 5AYQA 4R4BA 4JQIH 2EXWD 1A1OB 3T3PF 4KKAD 4LAQL 5ITFB 4YUEH 3QDJA 5IB1B 3IXAA 1RUML 1I1CA 5F1NA 4PG2C 4BSVA 4KJQC 4X0KB 4XP6H 3HMXL 3OJVC 4M8QA 4OD2B 3WFCL 3K1DA 3VDAA 1WTLA 4LKXA 3BMWA 1LDPH 3MUGB 5LXGL 1NFDA 4KTDH 4P46A 3H0TB 1FFQA 5AZEL 3JWDH 5KS9F 3QRFM 1S8DA 1OB1A 5KANI 4GG8A 3SJVD 1YECL 2VQ1A 3IDGA 5HHMB 1QRKA 1IFHH 3L1OL 2UWEF 2VDLH 2VLMD 4JFEB 3MRPB 5CUSH 1FNGB 4XP4H 4HCRA 1KCUL 3QR2A 3U36A 3IFPA 5DJXA 4H0GA 5FA4A 3CFBA 3UMTA 2ZG2A 4O00A 3O4LA 5DFWH 5FGRA 1X6NA 1T1WB 2J5LB 4PYHA 4AH2A 3RIAF 1RZ7L 4PRHB 3O6FB 1IEBA 4GAJL 3MV8B 2G5RA 3EDDA 1HEZB 4LNRB 4TYUA 3OJ2C 1MRFL 4ZO9A 1R3JB 1ED3A 4ZSOA 2DL2A 1N3NB 3R4DA 5MP6L 1WWAX 4RMWA 1HQRB 3O6LL 1K4CB 4PB9L 4ZUSA 1FFNA 4PGEA 4XPTH 4AENA 2VL4A 4JKPL 1B6UA 2P5EA 3HS0A 2BVQA 2VAAA 5HGBA 3QUYC 2NCMA 3MSPA 4X83A 3QG6A 3UO1L 4IOIB 1UKQA 1J1XL 3VXRA 2PYFA 2Z35B 5GGSA 4J3XA 2IGFH 2AW2A 4I2XE 3IFOA 3HI6H 4XNZC 1OAQH 5T3ZH 2YA1A 5KSVA 2AJ3A 1LE5A 1XGPB 1GC1C 2DMKA 2EEDA 3PABB 1QFHA 4ELKB 1UVQB 4R97C 3CXHK 3G04A 4ODBD 1AGBB 3RUGA 1JHLL 4YO0A 4J3UA 1P1ZB 5HYJB 1D5MA 3LN4A 4DN4H 2QTEA 5K9OA 4RISH 4ZPTB 5CSZA 3SE9H 5DK0A 1UENA 1KEGL 1S9XB 2MSPA 2AJSH 2XACC 1U8HA 4CN6A 3MV7D 4R7DB 3QYCA 1AHWB 4NQXB 3KPSE 4RAUA 2A83A 4EI5C 2FJGA 5C7XL 2L4OA 2FX7H 2NY6D 2VN7A 4WHYH 3DRQA 4YHYB 1OSPH 1PBYA 1X5GA 2VLRE 4K7PH 5ISZD 3MRGB 4U2ZA 2AEPL 5E1AA 1Q9KA 1M05A 4ENEC 3SO3C 3HAEA 5EOTB 1JNNL 2LAGB 1IJ9A 3ARVA 4N0FA 1OGAE 3HE6A 1DE4B 4JVUA 1GOGA 1JV5A 1V7NH 1XCTB 1CICB 3OSKA 3WJJC 2D7QA 3ROLA 4WI5A 3H7LA 3L5JA 5IMKA 1L9MA 4ZYKB 2P8MA 1KIPA 3GSNA 1FSKB 3PWPB 3CH1B 4IRSB 5D7JB 1SEQH 4BZYA 2XZCL 2VDMH 4RIRA 1FAIL 5E4EB 5H2BB 2AXFB 4EDXB 1H0DA 3H42H 4KUZH 5FYLH 5GSVA 4F37F 4R90L 1JPST 1T4KB 3PQYD 4FXGB 4HH9B 4XP9L 1ULVA 5DJ2B 5T33H 3MRDA 5ACZA 4JKWA 3PL6D 3TM6A 2KBGA 4Y1AD 2A77L 5BMFH 2ITDB 2R0KH 3QXAA 1WUNT 5DJAB 4QRPE 1VPOH 3WFBL 2O26U 3LZFL 3WNLA 1TJHH 1YEGH 4PJ9A 1IM3B 2X4QB 2GJ6A 3U4BH 4JRYB 3QXTA 4PGCB 1O5DT 2IPKB 1T5XB 5KVEL 4UAOC 1R5IB 3GI9L 3MBEC 3B83A 2E5EA 3L7EA 4EI5D 4M03A 4G6AC 1MELA 1QVOA 1A3LH 2IADA 2R1WA 4KAQL 4TVPD 3RVWD 4XBGA 2H9GB 4RRPA 1PG7L 4Z77B 3UX9B 4F33A 1UM4L 3NIDF 5C0RH 2PO6B 1TJGL 3MGAA 5JW3H 1UG9A 4GBXA 4PGBA 3FTGA 1ZLWH 3VFNA 1BF8A 3CMOH 3EKCA 1I1RA 3BD4A 5HGDB 1RZJC 4D0DB 1EMTL 1CWVA 2CO6B 5BS0E 1M71A 3JWOC 4ODUA 3P9LB 3QRGL 3VFOA 4WHYG 3OHXA 3BPCA 4YHIA 3OAYH 2PXYA 1ZTXH 1TXKA 1UACL 1QSEE 3N50A 3WFHA 4XAWL 1IGFH 4FG6C 1ERNA 2V7NA 4LSVH 3ZDZF 5DUPL 1IC4L 1DANU 1G7MB 3HKFA 4MAYB 3EJYC 5E8EA 3A67H 3SDYH 5FYKH 3FB6B 3WS3B 3DGGA 4LQFL 2CDEA 1WICA 5EZJB 1X3DA 5C0AA 1YA5A 1LP9A 4L4TD 4OQTA 1CBVH 5K9KA 1N59B 3OBAA 4YDIH 5FUCE 3HHRB 2BC4B 1BECA 5DJ0B 3MLTB 3D39D 4IDLA 3O3BA 2FX9L 1TNMA 1BBDL 1MY5A 4QRSA 4UT7H 4MA1B 4U49A 3QDGA 5MEOA 5FKPB 2EYSB 1LVEA 5E1HB 3QIWA 5DD0L 1IEHA 5DI8A 4P23D 5B4MD 2HFTA 3IFNH 3JUZA 3QULB 4QXGL 1J8HD 4U6VL 2ICWB 5E2WH 1TDQA 3MA7A 5F89A 1HSBB 1K6QL 2OP4H 4MJ5B 2YPLD 1GAFH 4EQ3A 2FL5B 3SOBL 3CK0H 4X6DB 4LCWB 4WI2A 3TT3L 5C0CD 3WO3B 4JM4L 1AI1H 4MJID 4LOUC 4DUXA 3L3OA 4JO1L 3VD3A 1RU9L 4MX7B 4HDIB 4DVRH 2P45B 5AWNL 5BW7A 5F3BB 5CBEB 4HC1H 4PB0H 2CMRL 3PV6A 2B4CL 1CVSC 1E6OL 1LK3L 1ZSDA 4YHNB 5J56B 1D6VL 5CMAB 5DRNB 4M93B 5BXFB 3RU8L 5B38A 3RWHB 3ARGB 3TZVA 1MUJA 5HYQB 1DQDH 1N5YH 1BX2B 5DFTA 4YAQA 3L3GB 3HPJB 5I1AA 4FTVA 1DN2A 3BT2L 5JPMB 3MRCB 5DJ8A 5IBTL 4RFOL 1DANT 1A47A 1D7FA 2OCFD 3D18B 1EXUB 2J2ZA 5CJQH 3ROOB 3ARDB 4HS8L 1G9MH 2R2EA 3O0RL 4WGVB 4O2FA 2QBWA 3C60D 4KY1H 4M4PA 4WO4A 5AZ2H 3HC3H 4KHXL 1OAZL 1TZHB 3SDCC 4RMSA 3PWVA 2CQVA 4OJFH 4A2MA 2XN9E 2Q3AA 3Q3GB 3OR6B 2BMKB 3LHPL 4FFZH 3V4UL 4CMHB 5C07D 1A5FL 5IHLB 4DCQB 2OK0L 5J9PA 1BOGA 5CIPA 1CGWA 2R9HC 4RZCA 4CKVX 2OI9B 1XR8A 1DQML 1QKZH 1A14H 3TFKD 1L6XA 2JIXA 4M4RA 4NKMB 5HD8D 4LHQB 1PG7W 4WTXA 4XPHL 1NDMA 3WHE0 3QWQB 4JRXB 3HFML 3JV6A 4WEUD 1QSVA 5JO5A 3C5SA 1XIWA 3HE7D 3T2NH 3MGOB 1A6ZB 3N1FC 5L2KB 4Y5YA 3UYOD 3JTSA 2J8OA 1IAKB 4F57L 4Q0XL 2XI9A 3RZCA 2DQGL 2E27H 4XNQA 2W59A 5D9SB 1U2HA 1Q0XL 1H9VA 4LP5A 2NTFA 2AKRA 4KJWC 4CW1B 5FUOL 4UU9A 4DZ8B 5F7FA 1I7UB 1BAFL 5DJ6B 4JO2H 3F7VB 2OZ4H 1MRDL 3OAZK 4ZS7L 5KVDH 3ARZA 5DR5H 5GGVH 5ERWB 4BH8A 1S7VB 3R0NA 3AS3A 3HNSL 4NGHL 4FRWA 2W0PA 3LH2H 3GSVA 3SE4A 2W9EH 4LLMB 5B39A 2Y72A 4M7LL 2JE8A 4CN1A 2G60H 2MCPH 2X9YA 3FQRA 1PJ9A 5AEAA 3DMMB 4DGVL 4HHAB 4PJAA 2GIYA 5GS0D 1FPTH 1KUMA 3H9SD 4G7VL 3NA4A 3ES6B 1EFQA 2VYRE 4PV8A 2MTPA 4L29B 4Z7VF 1C1EH 3IJYA 3LS5H 2ZOLB 2WW8A 2I9TA 4JANB 1QD0A 1K4DB 2FATL 3RL1B 4OFYA 4TRPL 3TO4C 4ZO6A 5EIIA 2FECL 3B9AA 3NFSH 5J12C 5D71L 4KVCL 1YMME 3AU1A 1PY9A 5KSBA 5GQBA 1P4BL 3KYOA 4YPGA 4R6UA 1EERB 1KJ2L 4HXBH 4MDIA 3OPZH 2AQ3A 4WUKH 3IDJB 3VD5A 3EBAA 4ZUWA 2CDGB 4FFWD 5ELIA 1BFVH 1I8IA 2FHBA 1M7DA 4CNIA 3DX6A 4PJIB 4JFDA 4C57C 1SJHB 3MUJA 4KJWD 2P5WD 1J0IA 2F53E 3KS0H 3F7YB 1A6WH 4Y2OA 1FORL 2NXYC 3GHEL 4TTGA 4Z8FL 5TDOA 5HHQA 4AY0A 5I75B 3REWA 3QH3B 4ZOEA 3SJVB 3V0VA 3RFZC 2CLVA 4HSQA 3AB0C 3AREB 1T66D 1GZQB 1WIPA 4TNVF 2CD0A 1VGEH 5I74B 1IC1A 5D93B 4OZGA 5B21A 4WIQA 1U8LB 4L3EE 4P0DA 2BRRL 5L2JA 4KJPD 4RQQA 2B1AL 5MENE 3MFFB 4U1HB 3G6JA 3IXTB 5F6IB 5TPWL 1CD1A 4M48H 4RAVB 2KKQA 1FL5B 4FQQA 5LWYL 3GMOB 4CMMA 3VJ6A 3QI9D 3BZEB 1MHPH 3CFKA 3U4EB 2NZ9D 4HJJH 1IAIL 4GKNA 1KC5L 2X9WA 4ZOAA 4P4KB 3AS0A 43C9B 1FHGA 3GJFK 2ENSA 2VXQH 3TO4D 5D7IB 4EJ1C 3RNKB 1KB9K 3GEWB 4XB7A 3GSWB 1BGXL 1RZIA 4JB9H 4WDIA 3TA3A 3V0AC 3OKMA 2AEIT 5ETUA 4LSQL 5CGYD 1KBGH 2RFXB 5DMGD 3QFJD 1UYWL 3LKQA 3LKNB 1ZWIA 3M1BB 1QFUH 4LLDA 4K8RC 4HUXA 3AS2A 1V05A 3DGCR 4L3AA 4XCEB 5D7SH 4PGJA 4N90D 1ZLSH 1F8TL 2ESVB 5C6WH 1I4FB 1OLZA 4Y8DC 3T0AA 4BELD 3E3QE 3I3EA 3TV3H 2FJHB 3H2WA 2C3VB 2NXYD 4XX1E 3UTTE 5C0EB 4OM0H 2VLKD 5KJRH 1E4XL 2YUVA 4ELMB 4WTZG 3KPRE 3MNWA 1IKFH 1EIBA 2BK8A 4H5SA 4NCC1 5EC1B 3W9EA 4XPAH 4UDUA 1MF2H 4LCCA 1G0XA 3MV7A 4TQEH 1EBAA 4ETQB 4JFZL 5FHBL 4NQDB 2MFNA 5JOEA 3OJDB 4HKBB 3EYFB 5EU5A 5IW3A 1ZT1A 2VDQL 3U7YH 3BIBX 1AD9A 2DF3A 4ZO8A 1A7NL 5ISZA 3V6BR 3EZJB 2ED9A 3V8OA 4ERSH 4D0BA 1W0VA 2NW3A 2ADFH 4HK0A 4V1DE 1F45A 1ZKAA 3QWOB 4GKZA 1AQKL 1OAUL 4XXDA 4Z7WA 1MH5A 3UPRB 5F7EL 2X1XR 2DQJH 1ONQA 3EFFA 4BQ9A 4LASL 5ID1A 5FYJL 1UQSB 1JI2A 4FQLL 3LSOA 2ATKA 1M7IB 2FJFA 5FOBA 1F4HA 3MRIB 3CFEB 3P73A 1W72H 3HC4L 1MCKA 5KW9H 1NGQH 1WFUA 4OCNC 1IE5A 4PJXB 3QUYB 4XRCB 1K8IA 2YUZA 3I75B 3GIZH 4QLRA 1YQVL 2X4SA 2HVJB 3CMGA 5A3IC 3DVIA 3RPIA 3WS6C 4HPOH 3FB5B 1WWWX 1NL0H 2EE3A 2JCCA 3BD5A 3FJTA 5EZOL 3VU2A 3PL6A 4XNZB 2FCBA 1PGRB 1WLHA 5CZXD 2IQAA 4OLZH 4FQIL 4I13B 1BD2B 4R97B 3VH8B 1YEKH 1DL7L 4R2GC 3T8XA 4Y1AB 2CIIB 2XWTA 4OUUB 2XT1B 1CR9L 2DQHH 3QPQD 3UXFA 1I7ZA 2GTZA 2BX5A 5IVXB 5KG9B 1NAMB 3PP3K 3V95A 1T22B 4LDOB 4NBZB 4NPYB 2WWKT 4YBQD 2BVOB 3RWFB 3QDJE 3QISA 2EC8A 4HMCA 3LV3B 4JZOA 2HAZA 1U8NA 3S34H 5BJTA 5A16B 1H5BA 3FONB 5IBLC 1BBJB 4TUJB 5ANMA 1A21A 5GS3A 5C70A 4NCDA 4EOWH 2ZUXA 2MQ0A 4EI5B 1N26A 4X6CB 4QEGA 3FT3B 3L3DA 5ICXB 4PJBA 5ALBH 4Q9RL 4NBYB 3K46A 5CCKH 4QTHB 3O3UN 1G6RB 4E0RB 4XVSL 4KK8D 3W81A 1X5YA 3OKEB 2PETA 3SO3B 2Z8WC 4G8EB 2JJSC 4Q9BA 4E42B 2PR4L 1GGYA 5IMOB 3N85L 2KZWA 5GJTL 1KENL 1YNTA 4XNYH 3UTSD 1JWMB 4OZHE 4Q6YA 1I8MA 4MMXC 4U6YB 3QQ3A 5GJSH 3X12B 3MRNB 2CO7B 3PF2A 1WT5A 3IT8D 3O4LE 3OX8A 3CFJA 3MACL 5A3ID 3D85B 2ID5A 5E2VL 3KLDA 4LAQH 1VB9A 2D4DA 1MVUB 2BHZA 1U8QA 4HIJA 2UVFA 1RUMH 5HHOE 3RNQA 4QOKA 4C56D 3LVEA 1K2DB 3VFMB 1U8IA 5C71A 1DQQB 3HMXH 3P11L 3V6FB 4H1LB 1KG0B 3WFCH 1CLOL 3ARRA 1ACZA 5LXGH 5CILL 2NNAB 4RBPK 2G75B 5DLML 2P5EE 4P2OA 1MCLA 5AZEH 3DHJA 3T1FA 4AG4L 3T4YB 3RZWA 1UZ6F 2A74A 1XGRB 4XZUA 4IHOB 3SDDC 2HLFC 1YECH 1YUHB 4C55A 2FD6H 5DMJB 3L1OH 3RWEA 3VXRE 3ARFC 2W0FB 1QLRB 1KCUH 1OT2A 3MBEB 4P23A 3M8OL 3TJHC 5JNYB 3WNKA 4Y19B 2V7HA 3S4SA 4KRLB 4KI5E 3U48A 1J8HA 3T0EE 4HD9A 3WUWA 1A7RL 4L9DA 2R2CA 1CE6A 4YXKL 3KLHC 3GUTB 4QRTB 3MLZH 4NNYB 3BOVA 4JY6B 4U33A 3RVXD 4JFYA 25C8L 2LFGA 3RUGE 4GAJH 5F9JB 5DXWA 3T2QA 1MRFH 4MB3A 2YPLB 5C0CA 3I6LE 4Y8AA 1EGJL 5MP6H 5CBAB 4ESKA 1T1ZA 4PJEB 3O6LH 4PB9H 1F6AA 5ICZA 3NVQA 3KVQA 5IOPB 4JKPH 8FABB 2HYMA 2FH8A 5D6DA 2XPGB 4OLUL 1R24A 3UO1H 5J57B 1A7BA 1J1XH 4WWID 2HT3C 2ITCB 3O3EA 4W6XB 2NTSP 5HYSA 3PP4L 2VLLB 1FJ1A 3GI8L 1GHFL 2DQTL 5FAAA 4U1NB 1I1AA 2DQDL 1FG2B 3M45A 4IIQC 1S9WA 2FWOA 3I6KA 5JORA 3VCLB 2OM5A 3HMWL 12E8L 4MNQB 1GGUA 5ICYA 4M5ZL 2IALA 1Q9LB 3VG0L 5AAWA 1MY7A 2HLFD 3R1GL 3HAEG 2V2XB 2VN4A 4FQJL 4LSDA 4LEOB 5IQ7L 5HPMA 3C60A 1KEGH 1BFSA 3RJQB 1DN0A 2GT9B 5GRWA 4PGDB 1KLUB 4POUB 1IAOA 3RDTD 3MNZB 2ZSVB 1FNFA 1IGYA 1TVHA 5DK2B 4ZUTB 2YBRA 2DJ4A 4P5KB 5C7XH 3CFCL 3ZT5A 3S35X 2AAVA 2WP3O 2DI9A 4K71C 2ADJB 1U8MA 5EPMA 3O2DL 1I1YB 3VG9C 2IEPA 2ZOKB 4JRYE 5DTFA 2AEPH 2C7UB 3GSUA 4P3CL 3K3QA 1HH6A 3S3PA 1JFQL 2GJ6E 1JNNH 3V79C 1ES0A 2HFFA 4M3JA 4WW2A 4ZXBC 3HE7A 1UJ3C 4ODHL 2YD2A 1C12B 3RTQC 5CEZE 3TNMB 3EYUL 1MCWM 3BKYL 4G8GA 2B5IC 1MOEA 1NGYA 1I7RA 4O5LL 4URTB 2VDKL 2A6DB 4P3WA 3MLYL 2J6EL 2EYTA 4PRIA 5D5MA 1RUKL 4NN5C 1PZUB 1TMCB 2XZCH 1FAIH 1U95A 2XRAL 2ZPKL 2FO1A 3GBML 3EUUA 4LGSB 4I0KA 3KR3L 4GRLA 2B7DT 4R90H 4XMPL 4XP9H 3ULUC 1EEYA 1RHHA 3OXRA 4NM4L 4RRPG 4XCFL 5HHPA 4F3FB 5GZOD 2ATPA 1HXYB 2AJVL 2A77H 5DD5L 5DJCA 3WD5L 1BZ7B 5C0NC 4FA8A 2DAVA 5JR1L 4PLKC 2RHEA 3KDMB 5GIRB 2XFXB 3WFBH 1DR9A 3LZFH 4PJDE 3DO7B 2C3GA 4RFEA 5T3XD 2X7LB 4C54A 1JTOA 5IW6B 5KVEH 4HIEB 4JY4A 1A1NB 1A2YB 3GI9H 1EGJA 3SDCB 3G5XA 1QTYT 5C0AE 1LP9E 2DWDA 1LE9B 4KAQH 4OLVL 1KPRB 2VNCA 2R23B 5IF0B 3BW9B 1F58H 1PG7H 3H9SB 3LS4L 4POZC 1OQOA 1UM4H 5CINL 2QKIB 4P2YA 2MWCA 1P6AB 4ZUVA 4Y4HC 1FVEA 2GSGA 2NYYC 1GZPB 2OSLA 2A73A 3NCCB 4NZJA 5E2UL 3HRZB 4MQ7B 5F1SA 2VE6B 1JNLL 3L5WA 1FVCB 4K7FA 1EMTH 3QDGE 2DI7A 3CNKA 3MGTA 5DQJB 1A6TA 2VLJA 1KLGB 3QRGH 3ULVE 1PQZA 5E8OB 2J8HA 1LO3L 1J0JA 1K8DB 1S7QB 4XAWH 2P5WA 2V9TA 3MNVA 2ADGA 5DUPH 4IJ3C 4YBHA 1ZVHA 4HBQA 4OZHF 5GS2D 1Q8MA 4NDMB 4LCWE 1X5XA 3MO1A 5E00A 5DGQA 3V5KB 2Q7NA 5TDNB 4WJ5A 4LQFH 3NMEA 1FAKT 4QY8B 1YN7A 4B7LA 3BZFB 1LQSR 3I02A 4AEHL 1S7UA 5EUOA 4IOFD 4EIGB 4JRWA 3VA6A 2ZKHL 1IQDA 5E6ID 3LEYL 3VWJA 2FX9H 4PYGA 5DVKA 1BBDH 2EDYA 4IRJC 2BSSA 2I27N 2E6JA 4FOMA 4JLRA 5I1HL 1FDLL 3O2WL 4RMRA 5F1IA 4GW4B 1HCFX 4PRNB 2D7MA 3S37L 2JJTC 2F58H 5IG7A 4NQCD 5L8LB 3QI9A 5DD0H 1N64L 3G9VA 5H37H 5BOPA 1B9ZA 2Y7QB 4CADA 1H3XA 1HKFA 4POZD 3WYRA 4QXGH 3V9FA 4MZ2A 5L9DL 2JB6B 4U6VH 3VRLE 2J6EA 2EYRA 3V5DB 2VKXA 3SGJC 3OL2A 1K6QH 4KK5D 4OD2A 4K94C 2VXTL 2A6JB 4GG6A 1CLZL 4KI5F 4N0CC 3TO4B 2BSRA 3AFLA 3MUGA 3VWKC 3OGCB 4WU7B 5TQ2H 3FCTA 3SOBH 5J12B 5HJ3B 2V2WA 4L8CB 3UJIL 4BH7A 5DRWB 4FFYL 5J11C 3TT3H 4JM4H 4XXCA 3PDOB 1U8OB 1G0YR 3TBVB 4JO1H 3RUGF 5IHZA 4R0LC 1RU9H 1LO0L 5F1OB 5AWNH 4LRIC 2APWA 2CMRH 4PFEA 3CVHL 2B4CH 1E6OH 3CUPB 4WCYL 5AD0A 1HQ4B 1MI5E 2ARJB 3BP7A 2ZCLL 3MREB 4KJYB 1D6VH 3MC0A 4JRXE 5C0BA 2NXYB 4WU5B 2F8XC 1T1WA 3RU8H 1Y6MR 5C08D 3SDAC 4WFHE 3O6FA 2VLKB 5FA3B 5I15L 4YDLC 1TITA 4HIHB 3DNKA 1RAMA 4MHHG 3RKDD 5J0BA 1D5ZA 3VFRB 3VFUA 4F7TA 1RI8A 3MOBL 4DVBA 1FNSL 1WFTA 1N3NA 4DJMA 4I0PD 4X8JB 3AB0B 5DFVD 3V5HB 3BT2H 3MLPA 3BGAA 1NCDL 5IBTH 4RFOH 3G6AB 1D6EB 1PEWA 1FVDB 4HS8H 4ISVB 1F00I 3O0RH 5HI5C 1G7PA 2CR6A 2YN5A 2YUWA 3IGAA 1UA6L 1B88A 3CCHA 4KHXH 2Z31D 4P48A 3QUMB 1MWAL 3D25A 3P77B 4MNHB 1JI1A 4PJGA 1ZT4A 2AV7B 4DGYL 3BN9D 3LHPH 3BSZH 4WUUB 3V4UH 3C9NB 4MS8C 1A5FH 1FGNL 2O61B 2H26B 2OK0H 3EGSB 4CBPA 1P2CA 4IMKA 5DHVA 4OI8A 1DQMH 4D9RE 3GSQA 3L95A 4ELKA 3B8SA 2CRZA 1NGPL 3MJ6A 4XPHH 4YNYA 3MXWL 5EOQL 1AKJD 5D7KD 3HFMH 5H37G 4LVHC 2XY1A 4GRWE 2D2OA 2MHAA 1BQHB 2V2TB 3UDWC 4PJAE 4O2EA 4L9LC 1X5LA 2Y6SC 2AXJA 4F57H 4Q0XH 4K3EL 4A2LA 2DQGH 5B39G 4QXTB 1CTNA 3U9PL 4KRPD 3LPWA 5FUOH 1II4E 5EC2A 3PWJB 4YH6A 1BAFH 2HN7B 2AP2A 1AQDB 5D1XD 1MRDH 5KSBE 4FMFA 2FRGP 4L4VD 2GYSA 4ZS7H 1F3DJ 3GB7B 4XBPB 3AXLA 4JFOB 4ZTPH 1T03L 4GMSL 3HNSH 4NGHH 5MI0C 1CICA 5HI5D 4JGUA 5EOCL 1H3GA 5I0DA 2X89D 2F54A 2MPAL 4M7LH 5GZNC 4BKLB 1ZGLB 5B3NA 3BE1L 2ED8A 3FRUB 2J8UA 3CXHJ 4YR6B 2RBLA 3SJVE 4DGVH 1UZ8B 5H2BA 1ZE3C 1NLDL 4Z78B 5F7HA 4PJDF 3D3VD 3LKRA 1J0YA 2D03L 4HG4K 4Y16C 4G7VH 2CUIA 3G5YB 3BP5A 1YEHL 2CIKA 3UTSA 3TPUA 4LRNL 3KYNB 4MDJB 1HILB 2FATH 1G9NC 2PTTA 3CVHA 4TRPH 2A0LD 4X7EC 3QIUA 4F8QA 4XT1C 1LP9F 5D2NA 1AIFB 5D71H 2AEQL 4KVCH 4QHLA 4Z5RB 3VFGL 5JQHC 1PX4A 3GIVB 3A6BL 4Q2ZB 1P4BH 2J4WL 1JYVA 3K2UL 4C56A 1KJ2H 2XTJC 3TBSB 3IVKB 5KSAD 3LKPB 3DX9B 3FFCD 4EI6B 4JDZA 1WBYA 4R2GB 2L0DA 3BKML 5KTEL 3D87B 1FORH 3ULVF 5J6GA 4Z77A 4MQXC 5B8CA 3GHEH 5HHVL 3NN8B 4Z8FH 2YSSB 1HWGB 2PUQT 1MWAA 2M26A 1EA9C 1JUFB 4BK4A 1Q94B 4F15C 5ENWA 3BGMA 4H0HB 5I18H 2DL9A 1ZAGA 1D9KD 3F12B 2NXZD 4EUPA 3KPTA 5IWLC 2EIZA 5C8JA 5A2FA 2BRRH 3FOLA 2B1AH 3MLXL 4XCNB 5TPWH 3ZDXE 5D7LA 2EO1A 5LWYH 3H9YA 3AM8A 3VXSB 1ITBB 3LRSB 4F7EB 3EO0B 5EU7C 2FYYB 4U2YA 4PLNC 1IAIH 1QA9A 1XZ0B 1KC5H 1W2KT 3FB6A 3MV7E 1AD0B 2BHYA 5DQDH 2B39A 5EZJA 1X4ZA 4DK6A 5I1DA 3IJHB 3L7FA 2DLEA 2V5RA 5E95B 1P7HL 2ZCKL 3MUY1 4ZDHB 3VDBA 3TIEA 5ISZE 3MUZ1 1GRWA 4HS6B 3VRLF 1CQKA 3PJSA 4LSQH 4L1HA 1I8KA 2VOTA 3TEUA 3L6FB 5DRXA 2EECA 3NAAL 3FKUS 3QEHA 1A0QL 3GGWB 5CWSB 5FKPA 1F8TH 1YYLL 2EYSA 5F7DB 4M61A 1OSZA 1XGUB 5D1ZC 1LDSA 1R3KB 4JCLA 2JJVA 5BZDB 4HMEA 3B3IA 3RQ3A 5HHXL 1ORSB 1JGLL 1P5VA 1SVCP 1E4XH 2Y23A 3X14A 5FDWA 2E7LA 1MLBB 3SDDB 4WW1A 1X44A 1W0WB 5D96C 3S3JA 2EDTA 3WBDA 4MJ5A 5C9JB 4Y89A 1GGCL 3ARFB 3PQYE 4F7CA 4JFZH 5FHBH 2JCCE 2Y5TA 1HXMA 4X9IA 3JV5A 4Y1AE 3FHQA 1X5KA 5M7QA 4CVZB 4L8SB 1FYHB 2DLGA 2VDQH 4UDTB 4JFXA 1A7NH 2W92A 4G3YL 1R5VA 1XCQA 5E08L 4S1RL 3C08L 4MVBC 4POYA 3T08A 3T65B 3KPMA 5EORL 3NCFB 3GM0A 3GNML 1AQKH 1OAUH 4YHNA 5DWUL 5F7EH 3BP4B 3O45B 4LCUB 3THML 5CJ5A 1SBBA 4LASH 2GITB 4PS4L 5FYJH 4KTEL 3LMJL 3PWNB 3SKOB 4FQLH 4EN3D 4RNRB 4TVPE 3PNWB 2XZAL 1O7VA 4KQ4L 4X7CC 1YC8A 2HMID 3HC4H 3HPJA 4DZBB 4LSPL 3W9DA 4PJBE 5IUSA 4PJ7B 3ZKMD 3P9MB 3TH2T 3CU7A 1PYWB 1YQVH 4WHDA 5CJXC 3UTZB 1EXUA 3GMQA 1F42A 5BVPL 3MV9D 2I26N 3DYOA 2ADIB 5CJOL 5IBUG 5JMRA 2XV6B 1FYTB 5EZOH 1AXSA 2G9HB 5HI4D 4HK3N 5F88B 4OCSL 4D9LL 4EVNA 4IIQB 5FO8B 3P40A 4FQIH 2VRAA 3OF6D 4GRWF 4UV7L 3W2DL 4CN4A 1DL7H 3QDAA 2XNAB 3C6SB 1CR9H 2HTKD 2VISB 3QO0B 5IK3B 4TSBL 3VFSA 5ADOL 3EYQC 2Z93B 3NFPB 2UZXB 3VD9A 3G5VB 4KTYA 2H6PB 3RGVC 1XF4A 1CGSL 3UJTL 3F7QA 1S7XB 3ZHLA 4L4TE 5KSBF 1JZ3A 3RIFF 4N0UB 4NUGL 4Q9RH 2HJLB 1KTLA 2VDOH 4K71B 1CXFA 2NZIA 1MFCL 2Y5EA 3VG9B 3D39E 1XF5A 4XVSH 4ZAKC 3VI3F 3CPLB 1K3IA 3FQUA 1T21B 3TGXA 2ZUQC 5E94B 5F21B 3LPGA 3KYMA 4QRRB 5DO2D 1HHJA 4ZXBB 3DUUB 3DBXA 2PR4H 1UJ3B 4NWTL 3R06A 3RTQB 3N85H 4HUNB 5GJTH 1KPUB 1KENH 1TZGL 3AUVA 5FYJE 1AE6L 2C1PA 1QLEL 1J8HE 3L9RA 1DLHB 1QSFB 1RURL 5DDHB 3Q6FB 4P5TC 3MACH 5L0QC 5CFHA 4NN5B 3K81A 2D3VA 5E2VH 2I25N 4KK6C 2YPLE 3RY6A 1T89C 4PJEE 4KRNA 4PRAB 5C0CE 1T0NA 3WUWG 4HFWB 4MJIE 4OCYL 5CGTA 3P11H 1ETZB 4XVJL 2YC1B 2RJMA 5DJZA 5CILH 1X5FA 4NUJA 4PTTA 4O58L 5E6IA 4AG4H 3WLBA 3BYTA 4XNMA 1EAPA 3JWDC 3BUTA 3VFWA 1K4DA 4Z7UB 5C09B 4RFNC 4AIOA 1JRHI 4JFFD 4NQCA 4PJFB 3H3PL 4BUGA 3M8OH 2C5DC 3FO0L 1WC7A 1A7RH 4K3HA 4YXKH 4NQVB 4OLWL 1I1FB 2P1YA 1SJEA 2I5YL 2CDGA 1W8OA 2Q7YB 25C8H 5HYSG 4Y4HB 2Z91B 5IJKA 3HI1B 4XAKD 5KZCB 3HCVA 5FK9B 1EGJH 1UB6B 4NQED 3GMMB 2UUDH 2DD8L 3EO1A 2Z92A 3ZDXF 5D8JL 5ILTL 2IF7A 4G9FB 5EO1A 2AXGA 3FQNA 5C07E 3WIHL 4P5TD 1ZLWK 2YD9A 4ZPVA 4MJ4A 1NDGB 3W39B 3FMGL 1GC1L 5EUKB 4OFKA 4OLUH 4IJ3B 1DBJL 5C08A 4AIZB 3PP4H 4HIIB 3BPOC 3GI8H 1GHFH 2YR3A 2DQTH 3MFFA 3NABH 3OAYK 4TVSa 4HKJA 1BJ1H 2DQDH 3JXAA 4PBVC 2E8ZA 1AO7B 4X9BA 4I0PA 2VZSA 3STZA 3HMWH 1FN4A 2EO9A 2WWMC 3AMLA 4XNXL 3BZEA 4WI6A 4JCMA 1IILE 4M5ZH 1EO7A 1CGXA 1M6OB 3R1GH 2QHLA 4U1KB 4X6EA 4FQJH 5TH2B 4PRIE 5IQ7H 5D5ME 5D7IA 4RGOL 4GMTL 1IM9D 4U6HB 4IRJB 1FRGL 4PJXF 4GT7A 2WANA 4OQ1A 2DYPD 1UB5A 1NC4B 2PW2B 1UXWB 3MODL 4UQ3B 2QJDA 1O0VA 2Z31B 2RFXA 3TIDB 4GSDL 3TN0A 3WIFB 3CFCH 3UTOA 1AGFA 1XR9B 4NM8L 5HDLA 3O2DH 5AG9A 3KPLB 2VR4A 2ZNXA 3PXHA 3SKMB 4JFHD 5EBMB 5H94A 1AKJA 1OY3B 4P3CH 2FR4B 3VWKB 1JFQH 3BKCL 1DQJA 3HA0A 3K1KC 3VXMD 5C0EA 3BN3B 5E5UB 2FHFA 3FHAA 4J7RA 4ODHH 5IVXF 4PP1C 4PY8I 3EYUH 2EDJA 3ARUA 4JJ5A 4BA8A 4R0LB 3H9SE 1TQBC 1SMOA 4O5LH 5IM7B 2VDKH 4MB4A 3CZFB 1N0LA 3MLYH 4E41D 3IJSB 1RUKH 1RUPL 4X6CF 4HUUA 2XRAH 2ZPKH 1TVBA 3GBMH 4Q9QL 4DKAA 1MEXL 1A1MB 3KR3H 4M3KB 1PSKL 2Q8AL 3SDAB 1VACB 4XMPH 3QUZD 4L4VA 3VW3L 4PJBF 1KB9J 5T3ZD 5HGAB 4NM4H 4XCFH 5FV2A 4HUWB 4TULL 1S3KL 3GMPB 2AJVH 2WIIA 3UPRA 4FMKA 4D8PA 7CGTA 5FUCC 3WD5H 1ZHKA 3LY6A 5JR1H 1G7JB 1X7QB 4EEEA 1J88A 2CDFB 2P5WE 3GMLB 2X89A 3QDMB 4ZFFB 5EN2A 1N8ZA 4GRMB 2BNRB 4X5XA 5C9KA 5JHDD 1RK1B 3B5GA 4M1DL 1JZ4A 3D3VA 4NZRH 1ZHLA 3INUL 1TCRA 4G80A 1WBXA 4HLZH 2GTWB 5K9QI 1EUTA 4OLVH 4KROD 1MHEB 4HWBL 3LS4H 2DM7A 4X7SL 2LABA 3JWOL 3WIHA 5CINH 3BYYA 5EUOE 5C2BL 5J4MA 1P4LB 5I8CB 3DXAB 4KKLD 3BWUC 4FXKA 3VH8A 1INDL 5E2UH 1JNLH 2X9XA 1AP2B 5F9AC 3O8XD 4XMLH 1MQKL 2DRUA 5BZWA 5CD5C 3NCJL 3IKKA 3PHOB 1OCWL 4CVXA 2DWEA 4LVHB 5A2JH 5KG9A 1NLBL 2BVOA 4KKCC 3FFCA 3QEQB 1UM5L 2LTQC 5KS9B 4L9LB 3LV3A 1LO3H 1OW0C 5A16A 2LAAA 1WWCA 2IAMD 2X09A 2YWZA 2BERA 2M2DA 1YY9C 1IEAB 4J4PD 1UM6L 1S9KC 2FZ3B 3MRHA 2UWEB 4GAGL 4WI7A 2Q8BL 3CDFA 4YGVA 4GG6E 2BNUA 2EXYC 1YN6B 5FYLD 5C0FB 5SV3A 1CFQB 3E6HA 3BO8B 2FB4L 1WZ1L 3QFJE 4X8XA 4FNLL 5JIHA 3IS0X 4LK4A 2X70A 2BXZA 3IFLL 4AEHH 1CD8A 2NX5D 1D9KA 4PJEF 1CGUA 1SQ2N 1AGDB 5MI0B 2ZKHH 5D2LB 3LEYH 4YDKL 1KB5B 1XGQA 4U6YA 2VLKE 3MRNA 3HR5B 5I1HH 1FDLH 3LB6C 3LKSB 3O2WH 4HPYL 3FRPA 3S37H 3DVNA 4JPIB 4OFPA 1VADA 3OKDA 4Y16B 4N5UA 5T1KB 1NMAL 4JG1L 1K2DA 1MFDL 3WL9A 5L9DH 2K7QA 1DP0A 4AM0B 4P99A 5JXAL 1SEBB 3MXVL 4HAFA 5I30L 4G8IA 2RGSA 4NRYB 3FO1B 4YEFA 3V6FA 2H32B 1MCIA 1VSCA 1UWEL 2VXTH 1CLZH 5E9DD 1E4JA 4JM2C 5FF6B 3I6GA 2G75A 4R8WL 3UJIH 1JGVL 1OPGL 4QHKJ 1QZ1A 2DBJA 3QUKB 4FFYH 3ISWA 1XGRA 3QCVL 3FO2A 1OAYL 4KKCD 2XTJB 1PKQB 3KWWA 3L3JB 4LVNC 1LO0H 4WGWB 2A6KA 4PJGE 3PWUA 4Z0XA 4NO3B 1YEFL 2W0FA 3MBEA 3RY5A 3VFVB 1DUZB 2V6HA 1JNHA 4P2QB 3O9WC 2VITA 4PRPD 5HYEA 1MHHA 1BOYA 2ZCLH 3BKJL 4QRTA 1G7IB 4NNYA 5DGRA 3LEVL 5FYKD 3FB8B 3IRZA 4Y5VC 1J0KA 1P7QD 3KJ6L 3RY4A 5I15H 4GH7B 4EXKA 5EU6B 5EIQA 3B2UC 4QTIL 3JTTA 4GW1B 1FZKA 2AJZA 3MOBH 3MROA 1FNSH 5KANG 3GSOB 5I1KL 1T7YA 4F15B 4V2BA 5CHNB 2CGRL 3NZHL 1NCDH 3TESA 4L8BB 3ARBC 1HHIA 4MWFA 1A7PL 4WW2F 1UT9A 3Q5YA 4Z7QE 3SBWA 4JO3L 3LQZB 4HV8B 5C2UB 3D2UB 4NP4L 5BCAA 4J23A 1P5UA 1YDPB 2VL5B 1KF9B 4LVOC 1B0GB 3FZUD 3K80A 2Q3ZA 5D5MF 1XMWA 1C16A 1A6UL 4DGYH 3MRFB 5IEKB 4E5XB 3UYPA 1FGNH 4OKVB 1A6AB 4EN3A 1FO0B 5CSBA 4CDHA 3LDBC 1QR1B 3QNZB 1JN6A 1RUQL 4EUPH 2A1WL 4ONOA 5T1LD 5GRZA 1KNOB 5CP3A 4JM2D 3GFUA 1MLCB 2CJUL 5INCA 3V8CA 1LEIA 1WVZA 1NGPH 2B0SL 2MQ3A 3BIKB 3GHBH 4ONHA 5IB5A 4QRUB 3MXWH 5EOQH 5EWIL 3MV9A 5HI3C 1J8KA 2J8UE 2V2XA 5IROC 1Q1JL 2KQNA 4TN9A 4ZNCD 2GT9A 1Y18A 3BWAB 4K3EH 1DCLA 3IDYB 3OF6A 5D1ZB 3UTSE 3MNZA 2VZ3A 4JQIL 2R2BB 4ZUTA 1G7HA 3U9PH 5KN5A 4FQXD 4UIMB 2Q87A 4NBXB 5D2NE 3C5ZD 4N9OB 5I8EA 4MGXA 2UZYB 2ZOKA 5I2IA 3BEVA 1OQXA 4YQXL 5D96B