2R4SL

Crystal structure of the human beta2 adrenoceptor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Beta-2 adrenergic receptor
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4sL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4sL01
3MO1B 3MRKA 3PWNA 1UYWH 2WZPD 5T3XE 4TNWK 4LGSB 3BW9A 4MA8H 5GRXG 1EJ6A 4PJ9B 1QPPA 1Z2KA 1G0DA 2XZCH 3CFDA 1EVTC 5DJ2A 4Y4KD 3QIBC 2AXGB 4JY4B 3DROB 5KZCB 2VQTA 4O5LL 7FABL 4NN7B 3SDDC 3ULUE 4F7PB 2W9LA 2DQJL 4PP1D 2FLBT 1CFNB 4WFHD 2GSIB 1R3HA 5JUEL 3CXHK 4XVUD 1BAFH 1YEGL 3TBSB 2P45B 2ITDB 3MLPA 1XF3A 4F33A 3LMJH 5C8JA 5HGHA 4JFDD 3GMLB 4I48A 1P6FA 4L4TD 4HXAL 2BNUB 3Q48A 1A02N 2VXTL 4HS6B 1NMBH 1RQ5A 1TZHB 5TPWH 1Z5LA 3NPSB 3OAZH 1RZGB 4ZPTB 5IF0A 4PJEA 3VE0A 5DDHA 1ITBB 1E0OB 2Q76B 4LRNH 4IJ3C 5GRVK 4PV9A 2JJSA 2MHAB 4V2CB 5JNYA 3MLRL 2A6KB 3S3JA 3TFKD 1OTTD 1M1SA 4JZJA 4E5XB 5E2UL 4PRIB 1ZKAA 4NN5C 3QIWA 2IBGA 4WUKL 4Z7UA 4AK1A 1KCRH 3HPJA 2QEJA 5K33A 2WINB 3WBDA 4IRZL 3HLAA 4M7JH 3BP6A 1G7QA 3KXFB 3C2AL 3WFBL 1FL6A 2HT3D 4XHJC 1E4XH 3ZLQC 3MV7B 1CD0A 1Q94A 4WHTA 1T20B 2I9LB 1W0WA 2A74A 2FJFA 4O51A 4ERSH 3MCLH 2N4IA 1BQLH 2B1HL 5DJYA 1A7RH 2XN9D 3MRHA 3RWEA 4JANA 5KVMC 3KXFE 4GBXC 3BWAA 5BW7C 4ZO8A 1TENA 1IZJA 1M7IA 2FH6A 5DUBB 2ADFL 5HHOE 3PWLA 3UTTA 3G5YB 2MNUA 4LNVA 4F7EB 2NQCA 1HEZB 4P23D 3CX2A 3ARGB 3NA9H 1JWMB 2A77L 5DRWB 1I8KB 2FEDD 1WK0A 1QBML 5BRZB 3JV6A 4X4XA 5IB1B 3W9DA 1F4AA 1AQDA 3DPBA 5JXED 2AQ3A 2BC4A 4U49A 5C0RH 4UU9A 4Y2DB 5JPNB 2FIKA 3O3UN 3RPKA 4KK9C 1A6PA 1KCLA 1WC7B 1P7QA 2IALA 1GL4B 2DQGL 1UWEH 4QNPE 5D6DA 3FT4B 1LP9A 1NLBH 1CE1L 5SV3A 4LL9A 1U3HD 1HOCA 5EUOE 1NANH 3QNZA 5HHPA 1QLFA 4MDIB 3SCMD 1PVHA 2R1WB 5EO0B 5CEYB 1CI5A 5ITBH 3L9RA 1K8DA 1RD6A 1CGTA 3V8OA 3BHBB 1I9EA 5MENE 3QDGE 4MMZC 5MEOB 3GSNL 3X3GL 3U46B 4P2QD 4XP1H 2C1OA 2ID5A 2Z8VC 1U92B 1FG9C 4QRRE 2AJYL 3K2UL 43CAA 4K3HA 3WDIA 1QEWB 1GZPB 3KPOB 1UZ8A 2N56A 4YHLL 3PWVA 4LMQI 5I19L 5IQ7H 4YR6B 2DS4A 2AJZA 1T0MA 3EKCA 5I1LA 1FNFA 1MPAH 1V05A 1YEKL 2IWGA 2NY6B 4YGVB 1JGLL 3UPAA 1AD9B 1UACL 3TZVD 1JNHB 1LO0H 1U8LA 4E41D 4LSUL 3I3EA 2UUDK 5GGUB 3MV9B 1K6QL 5DGRA 1OD9A 1EXUB 2XKUA 2VLJD 3TIEB 3RPIB 1QSEB 1BLNB 3PUCA 1TFHA 3UPCA 4J3UA 1BWMA 4QHLB 3IJSA 5HYSG 5D2NB 4WW1B 3CUPB 4OCSL 1SBSH 2IEPA 1RIHH 1XF4A 4MWFA 1QFWI 1I4FB 4Y5XA 3GSRB 3MOAL 1FVDB 3MRNA 4WNQA 4FABH 3ARBD 4R7DB 5I1HL 3ULUC 2P5ED 4XNYH 1N3NB 1AJ7L 4K55A 4U0QB 2X2YA 3IGAA 3MRCA 2C3VA 2QLVB 5F89A 3N85L 4MDJA 2ICWA 4HKJB 1EHLL 4LLYB 1A21A 2VZVA 2NX5B 4KAQL 2SEBA 1OCWH 4F15C 2VDQL 4JRXD 5I1JL 5F9JA 4HPOH 5HSFA 5D7KE 3KPNA 3EGSA 5DR5H 2FR4B 3JWOC 4D9RD 4MDJB 1YPZA 4X6FB 3VG9C 4L1DA 1IGCH 4G42A 2JJWA 3OKDA 4TVPH 5EUOF 1B9ZA 2VAAB 3RTQB 2BVUA 4W6YB 3T3PF 1JWUA 4LLQA 4MJ5B 3RWJB 1IARB 4HG4K 4Z7WE 1LMKA 4KZEL 2HVJB 3K46A 3LQMA 4ZFOA 1AHWA 3BPOB 3W9EA 1NFDA 4YFLF 5GSVB 3AU1B 1F00I 4QRPE 1MFCH 4N9GB 5IM7B 5DFWH 2BDNH 5INDB 3MBEA 2ENSA 4GSDL 4Z7UF 5KZCD 3JV4B 4WVRA 2NLJB 2NX5D 1J1OH 3BDYL 1Z9LA 3TV3L 3WFDH 3O6MH 2RBLA 4F7CB 3C5ZC 5ISZD 1GC1H 2W9EL 4ELMF 3MODH 3NFNB 2VSCA 3PIQA 1FYHB 4O2EB 1F6AA 4WTZG 1WZ1H 5JNYB 1AJ7H 1MCIA 2FEDC 2VXQH 2R2CA 4FS0A 4PJCE 1WAAA 4F2MA 4YDIH 4KKLC 1UM4L 3T0EB 1MOEA 4YHLH 4AT6B 5JHLL 5IBUG 1AQKH 1K5NA 1N5AB 1L0YA 5CMAB 4PGZA 1EBPA 1TVBA 4YBQC 1ZAGA 1T6WA 3HC4L 5DHVH 1FL6B 3D2UD 3R06B 1CL7L 3SCMC 4AEEA 2EDFA 2F54B 3QUZB 2ARJQ 2AP2A 3B4NA 5DRXB 4P9MH 1KIRB 2BSRA 2EXYC 1KXTB 5HYJB 3GM0A 5IG7A 3DYPA 4GG6A 1J87A 1FNAA 4CNIA 1OSPL 4JPKH 1N0LA 3HE6D 2C4XA 5EU3A 3QDGA 2CDGB 3RFZC 2X1QA 1G7IB 1IM9B 3DX6B 4HCRA 5DSCA 5GXBB 3RBSA 1RK1A 3LRSB 3MR9A 5HPMA 4PJFA 3BGFC 3EO1B 4FFVD 4QXGH 4XBGA 3MUHL 3BRGC 4PYHA 2H32H 3BO8A 5DSCB 3DBXA 2WUCH 2GJ6B 5GGSB 2HLAA 2LAAA 2FWOA 4I77H 2XZZA 4L1HA 3ETBF 2VLRD 5EBMA 4HWEH 4UU9B 1S9WA 3S37H 2F54D 5CSBA 2Q6WB 4R4ND 2FO1A 5H94A 1TVDA 5IROA 3V6OC 1B4RA 2AI0H 4ZS6C 4WW2A 1LWRA 5CKAA 4P57B 2XN9E 5L7XH 5FECA 3U0PA 1SY6L 2XPGB 1MLCA 1ROWA 4LSTL 1JPFB 4FQ1L 3BPCB 3L3GB 3SPVB 1A6TA 2PW2A 5I76B 2P5WA 4R90L 4WUUB 4ZSOE 2C3VB 2FHFA 3P0VH 4OT1H 4LPXA 2Q8AH 4U1LB 2FGWL 2YK1L 5JXAL 1I1FA 1FFQA 1I9RL 4NM4L 3C60C 1QVOA 5BO1L 3N1PC 3QEHA 1NC4B 2W9EH 4HMCA 1FRGH 2QQLL 2UWEB 1WWCA 4HUKB 3U7WL 4PGDB 5DQ9A 2N1KA 3EFDL 1YJDH 2D7MA 3JTTB 2QQNL 4D8PA 3KPLA 4Q6IA 4JZNA 3P4MB 3SKMB 4JO3L 5JOFB 2HVJA 4ODSH 4NO0D 4XCYB 1ETZA 5EH1A 5FF6A 3QUMA 4GUPB 4I77L 2VIRA 1KNOB 4L4TE 1U8OB 1TZHA 5C0CE 1FV1B 1KLGB 1JNJA 5FHAH 4S2SA 1GGBH 3WFEL 4QTHB 1JZ3A 1ZHLA 3U0WL 4M61B 2IQ9H 5SX4H 1CR9L 5E4EC 4JREB 2GTZB 1FLTX 4WU5B 5AUMB 4ZAKA 3MRFB 3MLVL 2BDNL 4NDMB 3DYOA 3BEWB 4G7YH 4YDJA 5C0BD 4PG2A 1OSPH 5F6IC 3UJTL 4E41B 3VXRE 5BJTB 4OLEA 1J11A 3BKJL 3WIHA 3MV9D 1WUNT 4POZC 3N1GC 5HD8D 4GW4A 4N8VB 3VFNB 4J3VA 2Q8AL 3IAPA 3S6CA 3B6SA 2DYPD 5GRJL 2ICWI 1ZVYA 1HYRC 4UV4H 1FIEA 1JTTA 3PABB 4MNQD 1JGEB 4U05A 4G8FB 2BVOB 2B0SH 2O61A 1Z9SA 3SEPA 1E4KA 3CU7A 1KCSL 3VGAB 1MIML 1MHHB 4Q9QL 4LOUD 1MI5E 1CQYA 2A6JB 4NQEB 5CHNA 3TIDA 3KYOB 3LD8B 3S97C 8FABA 4ZSOA 3IFLL 1ZVHA 2AI0L 1RHHB 3DTXB 2R4RL 1U8LB 3X12B 1OWRM 1QP1A 1T1WA 4JY6B 1ES0A 3W9DB 3HC4H 5J13B 1I1AD 1MCDA 1XCQA 3TGXA 2AS5M 3FQWB 5EN2A 4KI5F 4PJGF 3ZDZF 3P2TA 5KANI 1NAMA 5H8DA 5FXCH 3CVIH 3MOAH 3T0ED 3LCYA 4JJHA 3FB7B 1R5IB 2CDFB 1X5AA 1KIQB 1UFUA 1KJVB 2DMCA 3SKNA 2XKSA 3MRRA 3NCFB 2O5ZL 2KPNA 2WP3O 1QSFA 4LCIH 4KUCF 1I7ZB 1VPOH 3ARSA 4HUUA 4APQC 3QFDB 4P46C 3Q0HA 5DA0B 3V5DA 2Q1EA 2YC1B 4NHCL 4ZO7A 4PJGE 2A6IA 4NQCD 1H15B 1MCNA 3WKMH 1D3CA 4JG0L 4CADB 1BWWA 3TCLA 4J6RH 1B88A 3L3JB 4ETQB 5JPMB 1MWAH 5C6TL 3CAFA 3WIHH 4PY7B 4H88L 3UXFA 4RBPK 4CDGC 5T1KB 5KSAB 1T83A 3ARTA 4RISH 5D7LB 3HZYB 3TCLB 4HBCL 5C9JA 4ZFGH 1FYTD 5JHDB 4N68A 3V7AE 5I8CB 4FNLL 5AG9A 4RX4A 4DQOH 3EO0A 1YNTA 3C09B 1BZ7A 4OV5A 1KFAH 1P7QB 4YHNA 5CZVH 2ZP0T 4HUXA 4GAYA 5GRZA 4P9HC 5D1QB 4UILL 5SWZE 3VWJA 1F4WH 1C5CH 1A6TB 2PW2B 2X42A 3E6HB 1VFBB 1F45A 2JJSC 4ENED 3FRPA 4X5XA 4G80A 4Y19A 1JZ7A 4KI1A 1KTRL 2CXKA 3EDEA 1G7PA 2PNDA 2CR6A 4Z78A 1K8DB 3QFJA 2ILLA 4JFOB 3VRIB 2HN7B 1I7TB 2DQDL 1F42A 2YA2A 4JJ5A 3UX9B 4XNXH 3QO1A 1ZA6B 3IETA 3V6ZB 1MJ8L 2F58H 1HE7A 2YWYA 3DUSB 3HZMA 2EDYA 2NW3B 3S4SA 4B7IA 1BM3H 4WFFE 2VL5B 1J7VR 4MS8D 1GHFH 3WJLC 2ZCLL 2DQUH 1FL5B 2HLFC 2QSTA 1YEDB 1JHKL 4EN3B 4YHML 4EBQL 1T1ZA 2X1XR 4J1UB 3W9EB 3Q2CA 5EOCJ 4NJAH 4L4VB 4OLYL 3DYMA 4HC1L 5E1HB 5F9DC 2B1HH 3CDFA 4L8DA 5C0EA 4LCUA 3S7GA 1DR9A 1Y0LB 2OLDA 4NDMA 3F58L 5HVHB 4XNMB 3ULVD 1J0KA 4G6AC 1I3GL 3TP4A 3VXUA 4K94H 1MELA 1EK3A 3QXDA 3QIWC 4UTAL 1HKLL 1EGJL 1T7XA 2OSLA 1U8NA 3MRHB 4KHXH 5DUPL 5BS0D 1C08A 3LKPA 4FQXA 5IB4A 4XP6H 3ZYIA 5LWYL 1EA9C 5D70H 3VD5A 2W0PA 3KJ4C 2V6HA 1IKNA 1YEEL 3QXDB 4J6RL 2W0KA 4NUGH 3B9VA 2HP4A 4M7LH 2F5BH 3LKPB 4N0CC 3MFGB 3OXRB 2W07A 4K7FB 5CD3A 4JFEB 1DSFL 2BJML 1S9YB 5IHLB 2XZQH 4H20H 4NFBA 4L29A 3HAEB 1EAPB 1OWWA 3VG9B 2AV1A 5DMJB 4F8TA 4FTVE 1NGQH 1E4KC 1Q9WB 4QRSB 4YDLC 4NZUH 1AGEA 5F96L 1U8PB 2L0DA 3S3SA 4WENB 2YUXA 3QQ9D 2DLTA 1OTSD 2DLHA 1ZVSA 5TDNB 1H8NA 1GGCL 4YDIL 3DIFB 2DD8H 2JTDA 3VFNA 1X5IA 2EZ0D 3OMZA 5JIPA 4YHOH 3VW3L 1MHCB 1JP5A 5E2WL 2AXJA 5DMYA 5IB5B 3HFML 4J3OC 2GKIA 4Z7WA 1CK0H 5D96C 1T22B 1BIIA 1CFQB 3FAWA 1JN6A 4NOBA 2CLVB 1UWGL 8FABB 4CL7A 1G6RL 3C8KA 2ZUSA 4NKMA 1BVLB 1X5HA 3H3BC 4YHNB 3HHRB 5CGTA 3AXLA 2IF7A 2IPKA 2R0KL 3HG1B 3IFPA 4FNLH 5GJTH 3B2UD 3VD9A 3EO1A 2BZDA 4XZUA 4WNQB 1NBZA 5GGUA 4DGIH 5MEPB 4FQ2H 4BYHA 2E9IA 3F58H 4XWOD 4QHNB 4EDXB 5ADPL 5DLML 5FO8B 1QFOA 2J88H 4AENA 4YHYC 4MZ3A 3KPTA 3CCHB 1EMTL 1I1AB 1RUKH 1I8KA 2BSRB 4LDLB 3ZHDA 4WI2A 3H2WA 1ND0B 1FBIH 5I71C 1OGAD 4N1CA 2FR4A 1R3IL 4PJXE 5FYKU 4U1LA 5IT2H 1BX2A 1CCZA 3SE8L 3WUWA 3QDME 3LZFL 4XMLL 2MSPA 1UM6H 3LSOB 1GIGH 3GSOA 2E7MA 1X6NA 1TITA 1TNMA 4FTVA 3AUVA 3THMH 1E4XI 3A6CL 2J8UF 2P1YA 3K8LA 4BSWA 1I7RB 4DUVA 3FT3A 5GS1A 5C09D 5FM5M 4DGYL 3QUMB 3OKMB 1ORSB 1U8HA 4F3FB 3VDCA 4DKFL 4QHKI 3MRQA 3W0WD 3QA3A 1NGPH 3EJYC 2A74B 4OZIF 4S2SB 1S8DA 5GS0H 3JV5A 3NFNA 4GW1B 1CYGA 3PV6A 1ULVA 2Q6WA 3L7FB 3I2CL 4KRLB 1J1PL 5AYUH 4GRMB 2NW2A 2VLKE 3FO0L 3DX9A 1HINL 3UPRB 3RAJH 2Z91B 4MCYB 2H9GB 1YUHB 2CUHA 3QDAA 4HBQA 1EHAA 3O11B 5B3JF 1DQLH 4PTUB 3TH4T 3QIWD 2YRZA 4X9HA 5ALCL 3EBAA 1ZANL 1BD2B 3VRLE 4PJXB 4OZIE 4KKAC 5DRWA 3SE9L 1P7QD 4IMLB 2LVCA 5C0FB 5CD3B 2CK0L 2VXUL 4JFFD 2HVKB 3FMGL 1HSAB 5J11B 2Q7NA 2VAAA 1N4XH 2X1PA 4TVPD 1UVQB 4WFEE 4M7LL 3SDXB 3UEZA 4Z95L 2J6EH 3QEGL 3SCMA 3WFEH 2PYEB 1CFTB 1E6OL 3JVGA 5C0JB 4CVZB 4DZBA 4HWNA 3RVWD 5FYJE 3ZSTA 4LSQH 1AFVL 2HTKD 3MUGB 3P4OB 4JQVA 4LF3B 2COQA 1TCRA 5GGRA 3IDIA 2DN7A 4K71B 2DLIA 3NCJL 1EO8H 4X80H 1DE4A 2VIRB 3SE3A 4M62L 4N0FB 1XF2A 3DMMB 4RZCB 3GGWA 3VXSA 4JRYB 3H42L 4WEUD 4I18B 4UQ3A 4M7LT 4ZQKA 5E24E 3GSWA 3RU8L 5ALBL 4O5LH 4P23C 5IIEA 2J8OA 1HHKB 3RVTC 3ARFA 2X4OB 4PJ8D 2APBA 5FAAA 1I7TA 1IM9A 5DEZA 2VSDA 3LV3B 1HQ4A 5J9PB 3H9SD 2BFVL 2A9MH 4P3DB 4ETYA 2EDHA 2QR0B 3T3MF 4HUWB 1CTOA 1W72A 1LQSR 4I2XA 4WUUA 2Z8RA 5TDPA 4FQIL 3AFLA 1VFOA 4AY0A 3BISA 1S5HB 3TPUA 2C7UA 2CIIA 3VXTA 1QFWH 3OKYA 4R2GD 5SWSE 2ZG3A 1GGTA 12E8L 4KJWD 3M8OL 3VXUD 3MCG1 3OAYH 5ILTH 2J7LA 4Z7UE 2HFFB 5JR1L 1IKNC 4CRPA 5F7EL 3CFEA 5DD1L 3OKLA 1IAIH 4HIIB 4L9LA 3KPPA 4K8RL 3RVVC 4KTEH 3GSNH 5HGHB 1S3KL 3ULSA 4FQJL 3DI3B 4V1DD 2IPUG 1B3JA 2HKHL 4EVNB 3OR7B 2WW8A 1KENL 1LEKB 5ICZA 4YHIA 4PGDA 5DQ9B 3MRGA 4QXGL 2WWMC 4U1GB 1I9RH 1QSFE 5D2LA 5LGJA 3PL6C 2X9XA 2FH8A 2NY1B 3CGTA 1X7QB 4XCFL 3CSYA 2EEBA 3WLWD 2R0LH 4GRWE 4G9DA 2C5DC 5KTEL 3G6JA 4HS3B 1K4DB 3BKYL 3DGGB 3RWHA 5DC9B 4IJ3B 1EUTA 2UZIH 5IB3A 1JHTA 5BRZE 3G6JB 2VXVL 2G2RB 4P3CH 4DKFH 3OBAA 5GZND 1RV6X 4UIMB 3BQUB 4Y1AE 5KS9F 5IW1A 1C16B 4XNUH 4IS6A 4PJAB 2HT4C 1YPZE 2DYPB 3VWKC 1MY7A 3DJ9A 3PHQA 5IEHB 1Y6KR 5K93A 3W0WA 25C8H 3FO0H 2FGWH 3UTOA 4NFCA 1VFAB 1KACB 3BGMA 4Q74A 2JB6A 3EJZD 3WIIH 5C0EB 3TJEH 3QDMA 4ZUSB 1R24B 2IADB 5C0FA 5F9JB 1BREA 1TMCB 3NN8B 4ZO6A 1J0YA 2P8MA 5IQ7L 3FO1B 2VDML 4E0RB 3S35X 2YD9A 3DGCR 4DZ8B 4NQXB 2VDOL 3MXVL 4XP9H 1M6OA 5KW9L 3UYRH 1RZKH 4LRIA 4HJJL 5TQ0H 4UQ2B 3QIWB 5KTEH 4PJDB 2FO4A 5D1XD 4RA0C 2F8XC 1ZA6A 1T4KA 3QUZA 4OV6F 3PP3K 4JN1H 5JW3L 3QFDA 1AIFA 2R15A 2BNRD 4UOW0 4Y1AD 4YFEA 3ARWA 3UYOD 2VDNL 5EU7E 4UT9H 5LXGL 4MJID 4I0PC 4UQ3B 4O2CB 1HXYA 4WCYH 3LD8C 15C8L 5T3XL 1GCFA 3KGRA 3WFCL 5HBBA 1AGDA 5I1GL 4KAQH 5T1KD 5EG6C 2LU4A 3L5XL 4TUKH 2B39A 2DQJH 1Z0MA 3PIQB 2QR0A 1ETZB 1IZKA 3PNWB 3EYVB 4M3JA 1CFNA 5DVLA 1R6VA 1S9WB 3TIDB 4K9EH 1LNUB 5D1XC 4MLIA 3NACH 2VKWA 3BVNB 3RNQA 4YBQD 3ARDA 1PQZB 4PJEE 2XWBA 2A9NH 3H7BA 3BT2L 5CUSH 1S7UA 2O93L 3R1GL 2AKRB 3SQOH 3ARPA 4OFYA 3BVNA 2IPKB 3WJJC 3L3GA 4W4OA 5DZNA 3WEXA 4A6YB 1EXUA 4PJIA 3EIFA 2VR5A 2VISA 1I9JL 1JL8A 2AK4A 1S5IL 5TE7H 5SWSD 4ERSL 1ZLVK 3GMNA 5ID0B 1R0AL 1GOHA 1IQDB 1S7WB 3O6ML 3QCTH 1HZHL 1FZJB 1DDHB 3REVA 2BHZA 1CFQA 5FM4A 5HVWA 1GC1L 2R4SL 4JN2B 2Z91A 3L1OH 2XTLA 1BFOA 3VFSB 1IL1A 5ICYA 5ICXA 1FFPB 4HHAB 2AABH 2J8UA 5D4QA 2FWOB 5T3XH 1EEZA 3VFUB 4OZFH 4PJ8C 2DI8A 4JG0H 4JN2A 5F89B 3MV11 5FGCB 4C55A 4K3EH 1WGOA 4PRPD 4KZEH 4PD4K 5KSUB 4XCYA 3MV7A 3NFPB 1F90L 1E6OH 1KTLB 3TC9A 1PKQE 4HJJH 5TQ0L 2BP3A 43C9A 2NNAB 3F7YB 1CVSC 3EO0B 2FX8H 2R0ZH 4FQQA 5F7HA 1IC7L 2GSIA 3O8XD 4BQ6A 2GK0A 3HMWH 5D71L 3BPLB 3MJ7B 5JZ7D 3SKOB 2ZCHH 2VJXA 3PQYE 2W65B 4NZRH 1B2WH 4M6NH 1A4JB 1CZ8H 3VWKD 1YN7B 2ZUXA 3KHOA 2RHEA 3CZFA 4ZD3L 4HUUB 4WI9A 1I1YA 4HJ0C 3ARFD 4PJ8A 3VG0H 4CMMA 4OIBA 4NPYB 4QRRB 5HHVH 3N0PB 5T1DH 2KUTA 3CVHL 3K80A 4X4XB 5IB1A 5J1SC 4NO0A 4BH7B 5K9JL 1PKQB 2C3WA 1EZVY 3V6OA 3PWPA 5DHVA 4F3FA 3E0GA 2X7LB 4OLUH 4NQDA 5E2VL 5A3ID 5E6IA 1TETH 1D5BB 4G6KL 5H35B 2BY1A 3RKDD 2I26N 4OTXH 4Y19E 4K9EC 4BK4A 1WBYB 5BZWB 4K9EL 3KPSE 2X9WA 1T7YA 1XGQA 4I3GA 4FQIH 2JIXA 3NACL 3PWJA 1XGPA 4MJ6B 1JYNA 1XGTA 1INQB 1JGLH 4OF0A 1AIFB 3L9RB 1KT2B 3W5NA 5EN2B 2A9NL 1AE6L 5GZNC 4JVUA 4L8SB 3QP3A 2D7PA 1BBDL 4LVOB 1UVQA 1JZ5A 1FHGA 3KPQA 5FOBA 4XMPH 5F1NA 1I9JH 5DYOA 4EXKA 3HMWL 5B3JE 4KVCL 3BKJH 2DQFB 1LE9B 1UGNA 5EOQL 4XMKH 5I73B 2A6DA 5TJWK 4XVJL 4E41A 4Y4HA 4PJHB 5GRJH 4JJ5B 2NMSA 1C7TA 3P77B 3QDMD 1IKFL 1SJEA 2CLRB 3GRWH 3X14A 1J86A 5A2JH 3IYLW 3EOBB 4GAGH 3OB0K 4Z7OF 4QYOB 3D9AH 4DVBB 4TSBL 3QUKA 4QO1A 1G7HA 5AD0B 2HT3C 3T8XA 3TA3C 1F3JA 3T4AB 2PUQT 4QHMA 2LQRA 5CIPB 5E8PB 1MCOH 1HYSD 1QSFD 2RFXB 3QUXC 5TE6H 3R8BB 4ZG1A 5EO9A 5EBLB 4XAKE 3JUYA 4HCRL 3HPLA 1SEBA 1P4LA 5CP3H 1H8OA 1KULA 2ZUQC 1Y0LA 1JRHH 2BMKA 1EHLH 3S96B 1YQ2A 4MQXD 2O5XH 2OR9L 4JVPA 4PLNC 5HYIA 4POUB 4PB0H 2F74B 1G0XA 4HAGA 4KVCH 2BSTB 5IK3B 5AG8A 4MA1C 2UYLA 4I2XE 4YHIB 2HRLA 2CDEB 2FEEL 3OF6A 4MXQC 4YPGA 1PGRB 5LAXA 4NN6B 4LLQB 3OXRA 4R0LA 1P2CB 3QRGL 4OUUB 5SWSB 3FQNA 1YPZF 3H9SE 4YK4C 3V2AR 5I8OH 4K3GA 3BPCA 5B38G 4M00A 3AXLB 2W0FA 3S5LA 3THML 1WWBX 1ZXQA 5F1IA 4AMKH 4LU5H 3HUJA 1BX2B 1OAZL 1QSED 3CU1A 3KWWA 4TSBH 1RJYB 1C8PA 1G9ML 1MVUB 2V7HB 4EUPB 1CL7H 4D3CL 1YMMB 2DWDB 4N5ED 3E6HA 3WD5L 3QBTB 2J3SA 5CCKH 4HJ0D 2ARWA 4OGXH 2G2RA 5DHVB 3D0LA 1ZGLP 2MMXA 4D2NA 3VG0L 1DBBH 4OZGF 4LEOA 4JEGB 4XVJH 4KRPD 2O5XL 4M03A 4YEFA 2XZAL 2EYRB 5ADOL 2OJZL 2IPTL 1T5WB 3GHBL 3D2UA 4QF1B 5A3IC 4YEEA 4LEOB 4LASH 4PGCA 5E08H 1BM3L 5FA4A 4ZUUA 3JVGC 1IAOB 2ARJB 3UO1H 4YQXL 3MLTB 3D69A 5DO2C 4XC1H 3EYVA 1CE1H 3HAEH 4WI5A 2Y4SA 1BOGA 1J0JA 4PRAA 3QRGH 1KIRA 5HI4C 1FPTH 3QA3B 1Q9OA 3ZE2F 2AXHA 3MV8D 3MUGA 3P4OA 4U6XA 2QTEA 4PRNB 1VACA 1K3ZA 3MOQA 4KGJA 3TT1H 4WWKD 1IAIM 1HHHA 2H1PH 4HXBL 4WJ5B 4FMKA 2XQBL 4DN4H 5F6HJ 1HINH 3RWEB 1KEGL 4JQIH 3TYFA 4M7ZC 1NLDH 1JI2A 2K1MA 4GQ9H 5ISZB 2WINA 3SKNB 3H9SB 3MGOA 3U36B 3NABH 1KCRL 3V5HA 1ZHBB 3H42H 2CO6B 1LP9F 5ICXB 4ZSOB 1CD9B 1U8KB 4X4ZA 1P5UA 1X4XA 3ME0A 2OK0L 4UT6H 1RY7B 3V4VH 5E8OB 3EFDH 1U9KA 2BJMH 1TNNA 4PJ9D 1L7IL 3GSWB 3O3DB 1XR9A 1I75A 5GGVL 2UWEE 4HUNB 5EORH 1JK8B 3ZDXE 4XX1E 3VFWA 4LF3A 2V2TB 1OGAE 4BFIB 5SWZD 3MGAA 2YK1H 5JXAH 2BHYA 3DOSA 4RMRA 1CLYL 1DTUA 3EO9H 1F4XH 5J8OA 1R3JA 5GZOC 3V0WL 4ZMAT 4KJQD 12E8H 4CVUA 2X70A 1QOKA 4CW1B 3C87A 3NCYS 4KQ4H 1MCEA 5I8KH 1NUDA 3NGBB 2EYTB 2H3NA 5D1ZA 3L1OL 1JYXA 1FVEA 3AREC 3FRPG 1OLLA 1IC4L 1SEQL 5FUCE 3V9FA 1A5FL 2JIXD 3CFDB 3FQUA 3O81A 4MDIA 1B0GA 4Z7VB 1OVZA 1NAKH 1MQKL 2FGZA 3MNWA 3TNMB 3MRBB 2XYCA 2GAZB 4Q97A 4K3DL 2VN7A 5IW6B 2X4TA 1H9VA 4MJ2A 4M3KB 1N64H 1PG7W 2VUOA 1H3PL 1JV5A 4Q9QH 3H9YA 3VH8G 2I9TB 5IMKB 1T0MB 2H8PB 3IF1A 5DDHB 3VD4A 4X4YA 4XHQA 4OCYH 1NFIA 5DUML 1X5KA 4KJPD 1SEBB 4XPBH 5JW5B 1G7PB 1I3GH 3CXDH 4APQD 3BJLA 3PWVB 1EGJH 2J88L 2P5WB 3BMVA 5I1LB 2WWKO 1IGTB 3F6IA 4NC1E 1E27A 3WL9B 1RUKL 4AEFA 5F3HB 5L0QC 3R4DA 4K94C 5K9OB 2D31B 1KENH 2QSVA 4XI5D 1ORQB 5F7UA 1PKQA 2V9RA 5GRUL 1MLBA 4Z0BH 3PDGA 2JLLA 3B8YA 1I1AA 1ZSDA 2X4NA 2XKNA 4MNQE 2IFFH 5MEQA 1HN1A 4P23B 4F9LA 4TVPL 5EBMB 1ZEAL 5JMOC 3BP6B 4YFDB 4YHYB 4GMSH 2FB4L 5HDBF 4OZ4A 1LE5B 5C0JA 4NWTL 2CRIA 3CZJA 4F9PA 5DD6A 4OM0L 1CGSH 4TUJB 1QSZA 1UC6A 1AY1H 1JRHI 4KUCD 4PLOB 3ES6A 5SV4A 5AZ2L 4XNYL 1OL0A 1HEZA 2GI7A 5FK9B 3PP4H 2EDTA 3WE6A 4P3WA 2ZOLA 1GGCH 3WIFB 3MZTA 1TJHH 3LQAL 1CLOL 3JV6B 4P46D 3JTSB 2R2EA 4X6BB 2BC4B 3C60D 4PB9L 3C08L 3I75A 3DHMA 3MRGB 3TPKA 2QBWA 2K7PA 3FQXB 1G7LA 1XF1A 3ARGA 2VRAA 4GW4B 4GS7C 4RGOL 2HFEB 4U33A 4FZEL 3UBXB 2JJTC 1OSZA 2D7TH 4P2QB 2O5YH 1EGJA 6FABL 1RUPH 4XPAH 3X12A 4ORGB 3UTQA 2ICCA 5F72S 3I3BA 3VGDA 3D5OF 5D7IF 1MJ8H 2A6JA 3D25A 3MOBL 2GQHA 3MRIB 4HJGB 3FQNB 4LSQL 2FB4H 1A7OL 1CXIA 4XWGH 3D3VA 3RVWC 1P7KA 3VXQB 3VXSD 1GGYA 4U3HA 5E2TL 1JF1A 1CN4A 5L9DL 4Z7NF 4HIJB 1LP9E 1J05B 2EDEA 2YOCA 3ULUF 4UT9L 3LEYL 5LXGH 1DDHA 4RSVA 1KCVL 4PJEB 1NL0H 4X9GA 3HI5H 1MAMH 5DRXA 4LLVB 5HHOB 4R4NC 1GPOH 2WAHA 3VXME 4OUOA 1CICB 1AGBA 1PAMA 2BMKB 5DC4B 4LSPL 2DQGH 2R0WL 4GRLD 5DMIL 3SDYH 4Z0XB 2R4SH 3IXTA 2YZ1A 4ZQKB 3NFSL 4RFOL 3GNMH 5T3ZH 3FONA 3O3AA 3BI9X 4N8CL 5KSBE 3WXWL 1BVKB 1AD0A 4HKXA 4PBVC 2P7TA 2EO9A 3SDAC 2YWZA 5SWZA 3B9AA 4LFHD 5I16B 5HGAA 4FZ8H 2QHLA 4D94A 1QLEL 1LDPH 4DAGL 4JDZA 4LSUH 3OV6A 4GXVH 4GBXB 5BZDB 4G6ML 4WEMB 1CGSL 3LN5B 5J11C 2G9HA 3B2VH 4AENB 2OQJB 3TWCH 1RK0A 2NXZC 5JQ6L 1NUNB 4PJGB 1HXYB 4WTZA 1CLCA 4MNQA 2X09A 1VA9A 1FFOA 5ERWB 4OJFL 4NM4H 1H3TA 3T0EE 1MAKA 3U9UB 4GXUM 5JW4M 1NEZG 3QZWB 3S98A 3VMNA 3OAYK 4IDJH 4DOHE 4HH9B 4N8VA 2VZ3A 3NTCL 3QFJB 4XCFH 5C0CA 3CSYB 4KHTH 1K4CB 5EU4A 5IMMA 1UCBL 1IQWH 4NN6C 1TJGL 4K3EL 1GZQB 3HRPA 2IH1A 1X5GA 3EW3B 1AFVH 1DQJA 4TQEH 3N1QC 3FT2A 4OZ4B 1LE5A 1XGYL 5DEFB 1J88A 2VDPH 3ZE0E 5EU5B 1IGIH 3QUMH 2NX5E 3EO9L 1AXIB 1FCCA 2MQ3A 1I7RA 5H35A 1ZTXL 3QULB 1FJ1A 4L8BB 3QXAB 4HIEB 3OKOA 4PRID 3QQ9C 1DN0B 4AQ1B 4PJCF 4MCZA 5C07B 2QQLH 1F6FB 3DV6B 5BOPA 3ARVA 3WNPA 4DKDC 3BEVA 4P4KC 1F6AB 3MJ8A 5A1AA 2LTQB 3DRQB 3BE1H 1N6VA 2L4OA 1IM3B 3D85A 4JE4B 1SJEB 5E8DL 1S7SB 4NT6A 4DCQB 5DJXA 1A7BA 4PV9B 3I6KB 1HDMA 1U36A 1EHNA 1G7JB 4APQB 2EC9T 3O3BA 4J23A 1FFNB 2EYRA 3HG1A 3IFPB 5HI3D 3C60B 3V95A 5CIPA 5E8PA 5TE4H 2APTA 2VLRB 3DUUA 1WTLA 2G60H 3OKNB 5BOZG 2X41A 1KJ2L 4ZTPL 1PFCA 2XWJA 4YJZL 4JPWH 3KPSA 5IVNA 3GBLA 2XXCB 5C0NC 5GGTH 4JFQB 5KSBA 3BSZH 3QH3B 3RDTB 3ZHKA 4K3JL 2B4CC 1VEPA 4JPIA 3GMNB 5ID0A 1MEXH 1A1NA 2NY7L 4OFYD 1OPGH 2HLAB 4I0PD 3FQWA 4DUWA 5DJ6B 3WFCH 1KB9J 4YBLC 2X4OA 4DGVH 4FHBD 3PV7A 4U6YB 3B83A 2OR9H 3E1F1 1T21A 1FNSH 5IB5A 5TDNA 1OLZA 4UINL 1A5FH 1I7UB 3T0BA 2B5IB 5CZXC 3NMEA 1CLZL 4R0LB 2R0WH 3GGWB 5DMIH 3VXSB 2CDGA 3GZKA 5E2UH 2NYYC 3MJ9A 1F13A 1JGUL 3BMWA 2MCG1 4PRBA 1F4YH 4OZFG 3HN3A 1U8JA 1C12B 3RX8A 5I1AA 5IEKA 3QWQB 2I07B 2YD2A 1N59A 1MWAA 2IQAB 4ZTOH 1ONQA 2DKUA 2VNCA 3QDGD 2IG2H 1NGWB 1RK0B 4RGMB 1H5BB 1WBZA 5A2KH 3MRJB 4U1KA 3M07A 1LO3L 2ZJSL 5C08B 2MPAL 3O41A 4FQLL 2XWTA 1WCBA 3DETC 2EIBA 5BZDA 2IAMD 3BDXA 4RMTA 4LIQE 3BPNB 1EEYA 2BHUA 3O2DH 5ALCH 3IS0X 1MVFA 1PZ5B 2W59A 4ZXBC 2ZCKH 5IJVA 5CIPH 3SDAA 4Q2ZA 3LKOB 2XG5A 4NZTL 3ROLB 4YBLB 2P8PB 1P1ZA 5FUOL 5JOFA 1R3LA 2ZSWB 5CINL 1Q38A 5I1GH 4ZNEE 2CKBL 1XT5A 4MD5B 1H3VA 1U8QA 3ZT5A 4A2MA 4C83A 3VFRB 5JHDA 4OF8A 2EIZB 3QXTA 3ROLA 3V6BR 1U8NB 3HC3H 1HK6A 3GBNL 5D72L 2A0LD 2EDXA 2H8PA 2YKLH 4U6XB 5IROC 2Z31A 2KDGA 3DX7B 3QIBB 1JGDA 5HGBA 2ZUVA 3ILQD 2HAZA 2NTFA 5C3TA 3RNKA 1SY6A 2P8MB 1PYWB 4H20L 5HHOD 2VWEE 3WDHA 3UO1L 2ZPKH 1EUUA 5T1LD 1AHWB 5I8EA 1OAYL 4H0IA 3F7VB 3IDMA 3GDBA 4NRYB 1ERNA 3MRQB 3O9WA 1BMGA 4LVHC 4K7PX 4X0KB 3BXNA 4WO4C 4OZGB 3BZ4B 4O4YL 3R0NA 1YQVH 4ONFH 4Y4HD 2NY3C 2OP4H 1IGJA 1NDGB 4OD1L 1IM9D 4I3RH 1C16A 3O2DL 4M9OA 5EO1B 4ODWB 5M7QA 1UXSA 4WV1A 4Y4FA 5FDWA 2JK5A 2OJEB 2PTTA 3PHQB 5IEHA 2GJ6A 2WUBL 4PGEB 3GSVB 2IPTH 1ND0A 4XNZB 5KVFH 2E6JA 4OD2B 1QBAA 3NFSH 5D93C 3TO4B 1YZZA 4NQTA 3IDXL 1EBAA 3O0RH 4HZLA 3BGFB 4Y4FB 1AGDB 1K4CA 5JA8B 4X83A 5CHNB 4PG9B 5F3HA 5MI0B 1WBXA 2X1WL 4ZYKB 4FZ8L 2FJFB 4EI5D 1D5BA 2NY2B 3M45A 2A38A 4JGUA 2VC2L 1UT9A 1MCJA 5E9DA 3DUHA 2EKJA 1XGRA 5KSAD 2D9QB 3EYQC 1NFDE 1H0DB 1TJHL 4Y4HC 4YBHA 1T1YB 4M8QA 1FNHA 3SY0B 2YUZA 3BP5A 2ED8A 4U6TA 3D48R 3CSGA 2E7LA 4KFZC 3G5YA 2G9HB 5L2JB 2VYRE 3B9DA 1JTPA 4F9PC 3OR7A 1UYWL 4ZFZA 5FOJA 4O02H 1L9NA 2BY3A 2Y5TB 4IOFD 3RP1A 4LQ1A 1JFQH 2YC1A 2VDLH 5INCA 1A6WL 3ARQA 4JFEA 3S4SG 4AJ0A 1RUQL 4QCIB 1JMXA 2BXYA 4P5TD 1BPVA 2VLJE 3O6LL 1TPXC 4O2EA 5DJZB 1GIGL 2XOTA 2VQ1A 1ZLUH 3IJHB 5EFIA 4E41E 4TTGA 1KB5H 2GFBA 1U8PA 5EZOH 5I74B 5IHUL 2IH1B 5EORL 3LH2H 4Y2DD 3FTGA 4KV5F 5TDOA 3MQIA 3KWWB 5TE6L 4PRDA 1D6VL 1YMHA 4Z76A 3EYFA 5C7XH 3LDBB 4QOKB 1QNZH 1WAAF 1Q9KB 1QHOA 4IRJD 3L6FA 3EYUL 4KY1L 5JO5B 3RWCB 3EJZC 4LHQB 3QHZL 3TEUA 3KPSD 5I75B 1MIEH 4HF5H 1OCWL 3NN8A 4S1RL 3RWCA 3IDGB 4NKIL 1S9XA 1VHPA 3GI8H 3QDGB 3HFMH 3VD3A 3QZWA 5GIRB 2M26A 1RZ7L 5GSRB 3NTCH 3VXNA 1U8QB 1FFOB 3AROA 5CSZB 4MAYB 3A6BH 3RGVD 4L8CA 1TJGH 5ESQA 4DQOL 2GW5A 2YEZA 4JQXA 4Y2OA 4Z78B 2FIRT 1JTOA 2BERA 4J1UA 4NJ9H 1CXEA 4WW2C 2FX7L 2RR3A 1VKXB 4HX1A 1T1XA 1LEGB 1U3ZA 2CGRL 3U4EB 1MJ7H 1D6VH 5IV2B 4U31A 5LJYH 3QAZC 2FJHA 3RVVD 1UB5A 5IOPB 2X6MA 5D7JC 1II4E 1QSEE 3QPQD 2VLMD 1FAIH 2UY6A 1RZ8B 4W4OC 5F8QC 4I5BA 1ZANH 2AJ3A 1XGUB 3KYNA 4KRPC 1KIPB 4Q9BA 4JM2B 4MSWA 5E56A 4Z9KB 4TNWF 3UTTD 3SKJH 3VFRA 1YA5A 4WU7B 4H1LG 5FCUL 3PHOB 4KMTH 2CK0H 2VXUH 4K23L 3W11C 3RY6A 1J8KA 3VXPA 4FFWC 3O0RL 4XC3H 1GSMA 4ZFOB 1KG0A 4WWID 4MX7B 4OI8A 3QWOB 1RPQA 5IFHH 2G60L 3MRLB 4LU5L 2WLZA 4Z6AT 5CJ8A 1YEFL 1HXMA 1Q94B 1AC6A 1PEWA 1QFPA 2DLEA 4GQPH 2HFGL 5I18L 2AVGA 4K94L 3FZUD 5IHZA 4LKXA 3G6JF 2E8YA 4YFLI 3WSQH 1CBVL 4YDVA 4RFEA 3MLZH 2OBGA 1MEXL 2NY7H 2FX7H 3NZHH 2AK1H 3VCLB 4UNVA 4GRLB 4OQTH 1IGJB 3KLHC 1Z9MA 3MV7E 3FQRA 4EI5B 4NC1C 4AYFA 4J2XA 3L5JA 3FO9B 5CAYB 4XX1G 3S36L 5H2BB 2QQKL 1ZS8B 3FOMB 1LO0L 3HE6B 1HNFA 4X5WA 5HHVL 1F3DJ 3BRFA 2QQNH 1XF2B 5C0GA 3P0GB 5DMGC 2V5YA 1CG9A 3QDJE 5T5NG 4MB5A 5BRZA 2GIYA 2XA3A 1YY9D 2HRPL 1JGVH 1JPTH 3GSUA 2VO5A 2UZIL 1XCTA 2AK4E 1YEJL 4HGWA 1T89C 2HJFA 1G1YA 1MHCA 4JFFB 5IG7B 3S88H 4WI7A 1C5BH 4EUPG 4R90H 1IGYB 3ALWA 1TTUA 5C09B 2FHBA 3TT1L 3DVIA 3PGCA 1IAKB 1UXWB 2V5MA 1JCKA 1Q1JL 3CFCL 4QHMB 5MERB 3W39A 3VFTA 1QA9A 1QFWM 3MRDA 3B3IB 1WICA 4I3RL 4KTEL 5DK0B 1IGTA 2DYPA 5FUOH 2Z31C 4KZDH 3HE7B 4NNYA 1YY8A 3KDMB 4Z0XA 4GJTB 1KB5B 1BFOB 5J6HA 1RI8A 4RIRA 2ATPA 1UWGH 4UBDC 2EICA 3EOTH 4D0DA 4Q58C 1S78C 4H26B 4PRPB 1H15A 5GJTL 1MFNA 5E6ID 5FKAA 3R8QA 3U79A 3UTSE 3M8OH 4TPRL 1T1XB 3IRPX 1JPST 4JN1L 5IJKC 1PQZA 2VDRL 5DMKB 3G04A 4IRZH 4M7JL 4Y5VC 1MCHA 1YEJH 5EBGA 4P46A 4I9WD 4CVXB 4HDIA 4L3ED 4M4PA 4RGND 3SGKC 1ZMYA 1KF9B 3T0AA 4NQDE 2WIIA 2GTWB 4UZGA 4LLUA 4OQTL 5DFVD 1AHWC 1KN2H 4XCCH 1IVLA 3VXUB 5L6YH 5E5MB 1OM3H 3DWTA 3REVB 1BQHA 4U6VL 4XXCA 3F7PC 2Y36L 3QXWA 1MJJB 5DWUH 1FE8L 2QQKH 3I3DA 4UB0H 2XRAH 3MLTA 1WFNA 3QJFB 1NC4D 3GKWH 1AD0B 2X1OA 4ZUVB 2VL5A 3G5VA 1ACYH 2C4FT 4JR9L 3MA7A 1NGPL 4YHKL 1A9BB 5IVXE 1IGFL 1T5WA 3ORJA 5T3ZD 3BXNB 2R1XA 2X4RA 1KLUB 5C0AB 3AREB 5FFLA 4RX4D 3P9WB 1LDSA 5EPMB 1HYSC 1A4KB 5ELIA 3ZSSA 4Z8FH 4JHWH 1RIUL 3RI5K 4TSAH 4KUZL 3ZL4H 1IE5A 5ITBL 2OM5A 1QNZL 1XR9B 1DQDH 4WUUE 4MD4B 3LVEA 3QEUB 1M6OB 1YEHL 5ISZA 4XBEL 4R96B 3QQ4B 4LSDA 2PO6C 5B39G 5F7FA 2YPVL 3QPQC 3BQUD 3K1DA 4W81A 5DJYB 3QUYA 4LHUA 3WJLA 3VU2A 2MKWA 4W4NA 2P8LA 4FZEH 4PIRF 5EUKB 5SX5K 4CGTA 4NHUA 3E8UL 3P30L 4XHJD 4P5MB 3ULUL 4AEIL 5DWUL 5F8RC 1CDGA 4TOYH 2FBJL 5E7FA 5GS2H 3CK0H 4M93C 3TCXA 2DL9A 5TDPB 1CXLA 3U0TB 4OZIB 3WHE1 2WBJB 2VABA 2VDKH 4I0KA 3GIVB 3MLXH 4PLJD 4U1KB 4XC1L 1MAJA 5HDBE 43C9B 1ZWIA 2WWKT 1WC7A 2IALB 4XCNA 2AKRA 5LVEA 1NCNA 2KH2B 3SGDI 5IM7A 4MNHB 4MD5A 1MSPA 3MO1A 5K59F 3AGVA 4ZOBA 5FYLD 4OZHA 5KVGH 5JO5A 2GEEA 2IH3B 3O6FB 3VCLA 4MNGA 3WXVL 2CUIA 1N2RB 2BRRL 5T1MB 3ZE1E 4EN3C 2FIKB 1KJMB 4FQXD 1HSBA 1OF2B 2PR4H 1Y6NR 4JB9L 3RI5F 2XQYK 5ID1B 1BD2D 2BNQB 2YPKB 2YD3A 3M17B 1HI6B 1DVFB 4HSQA 1TETL 2ATKA 1PSKL 5CINH 1KB5L 5DO2D 2P5EA 1A6AB 3G5ZA 5IHBA 1MH5A 3ECBB 1S9XB 4KMQA 1GH7A 5JIHA 4CVZA 5CJXC 2IQAA 1OOAA 2CIKA 4KK5D 1DSFH 2ERJB 4QCIA 1MCFA 2AEWA 2R8SH 2W9DL 4HLZH 4KK6C 4ZXBB 5E9DE 1BP3B 3VFPA 2V2WA 4HUXB 2R0KH 3VXOB 2CRMA 3HR5B 1WWWX 1NUFA 5E95B 4TSAL 2KZ1B 5D7LD 3QHTC 1LO4L 4OSUL 5B38A 3WSQL 2F8OA 4EXPX 4RMUA 2V2WB 2I9TA 3LHPH 3E6FB 1PYWA 5SWQB 3G5XB 1WFUA 4GKNB 3CZFB 3DSNA 4PBWD 3O11A 5GS3A 4LIQH 2NLJA 1K2DA 1MAML 2R2HA 4Z7UB 2D9CA 3D2UB 1WZ1L 1BZ9B 3UBXG 5KN5B 4LLMB 2GITB 4LLYA 3MMEA 4GFTB 5E2WH 4UBDD 4PG2C 1OD7A 4KMTL 4NO3A 1MFAL 4K7PY 4PG9A 3T4YA 1CFSB 2HYMA 5E4EB 1BZ9A 3CFKB 4ZUTB 1DQJB 1DLHA 1AKJD 4WI8A 4Y16C 4Y5XB 1WITA 2CD0A 4N5UA 3TBSA 3WDJA 1GZQA 4QYOA 4LVNC 3REWA 4WU7A 4H8WH 5C08A 2EDKA 2IANA 4EIZC 2R56H 3D39D 1J12A 3FT2B 2YEZB 4BZ1L 2CKBB 3QPXH 3JSSA 3KPMB 2ITCA 3QO0B 4F7MA 1ZT4A 4JFXA 4PJFF 2OMNA 3W82A 4PREB 1BBJB 4OCWH 4ISVA 2EYSB 3V4UL 5F3BB 3U4AA 2X4UB 4OSUH 4ZNCD 4IHOB 2E6QA 2YSSA 2J4WL 5A16A 1NMAH 3GO1H 3Q3GA 4CDHA 1FN4A 3HCVB 3B5TA 1TQBB 4MB3A 5JOPD 1E28B 3DV4A 1ZHKA 4X5LA 5DT1H 4K23H 1JWUB 2FHCA 4U3XA 3BWUC 5F1NB 4IHOA 3HMXH 1OTUD 4XC3L 3TA3A 1T89A 1UB6B 3QCVH 4DKEH 2D3VA 2HKFH 1FO0B 5E9DD 5FYJU 3KHQA 4PPTA 1Y6MR 2FSEA 4Z76B 1FGNL 3V52L 1NCAL 4DEPB 5JW3H 3CFJA 3CK0L 5EC2A 3RTQC 5CD5D 2PN5A 4OCYL 1MFEL 4D0CB 1EVUA 4JKLA 1A3LH 2GJZA 4PJAF 3L3HB 5E99H 4JFFA 5F7KC 1TZIA 1O5DT 2ESVE 4NRZB 2RIKA 2V5SA 4U1HB 2ADFH 2VISB 3GSUB 4GRWF 4FMFA 1I3RB 4M62H 1T7WA 2GT9A 3R1GH 2PO6D 1OP5K 3FB6A 4CNIB 5HJ3A 1QSEA 1UKSA 1NQBA 1QKZH 5FYJD 3GSQB 3MNZB 1S5IH 5TE7L 3L95A 4JFDA 5ICZB 2D0FA 2Z35A 1DBML 1NMCB 3MYZA 4GO6B 3GHBH 1P7HL 4RFEB 3GO1L 5D5MB 4NNYB 3ARFB 1N6QL 2UVEA 2D0GA 4TVPE 3T65A 1QR4A 4JG1L 1Z3GL 4YGVA 1ZHNB 3EZ8A 3TBVA 4BUHA 1KN4H 1A3RH 2ZUUA 1BFSA 2QHRH 2F74A 3FT4A 4KI5D 1M05A 2RCSH 1IEBB 1JWSB 3OGCA 4XVSL 3HS0A 2VZSA 5MERA 3AS3A 2MOVA 5D2LE 1T2JA 3O2WL 5HI5C 4KUZH 4MA1B 1F6LL 3PQYA 1I8MA 1KNOA 5T33L 1KJ2H 3OXSB 4QWWC 5DMKA 4XP5L 2NY1D 5F7EH 4I48B 3F62A 2CIIB 4X80L 3MRJA 5IJVB 3JZ7A 3W0WB 3GBML 1FORL 1UM5L 3QEUA 3QXVA 1KJVA 3UTZA 2IQ9L 4XP6L 1U41A 4PRPA 3EUUA 4WV1B 5SWSA 3IFOB 3AU1A 1RUPL 4PJFE 4XPAL 3QFJE 1KCUL 2IAMA 3SO3B 1FE8H 4UUJA 4NQEE 5I1IH 4ONHB 1GOGA 3KPRD 3F5WA 1QKZL 4U1SB 4ZS6D 5C0DB 1WFTA 1D9KB 4Z7VA 4OI7A 1BD2A 1O7SA 2OCFD 1YYMH 2XTJC 4JAMB 4OCLC 3DGGA 4ZUVA 3CJJA 4I18C 3CVHA 3K1KC 5E2VH 5KSAA 4KK5C 4YDVB 1KN4L 2EE6A 5GISH 1LO2H 5DYOB 5J57B 3H0TA 5FM5O 2XV6B 3BJ91 5IP4A 2WBJA 5FGBA 4RMVA 3ILPA 1BBJA 1BQHB 3SE3C 3N1MC 3AM8A 2PYEA 4X6FA 5F7YC 4TUOB 4NSKA 4Y16B 2XICA 4G43A 2OL3A 5D7IE 3IFLH 1AKJA 5BV7C 2NY4D 3T2PA 1YECH 1Z5LB 1H8SA 4JM2F 3BEWA 3IDGA 2EE3A 4U0RC 2OJZH 2X4PB 4ODHH 3S36X 2BNUA 2HLFD 4LOUC 1KJ3L 3EHBC 4LHUG 2AK1L 4GUPA 3BIKB 3OKKA 2J5LB 4Y89A 1ZHKB 4WY7L 4UV4L 4NRXA 1VENA 3I02B 2IGFH 5FYLH 2Y25A 1OB1B 2YKLL 3CX5K 1IM3A 3D85B 2APXA 5J89A 1P6AB 4MVBD 3UYRL 4KHTL 1B90A 3ZL4L 1BBDH 1SJHB 1P84K 1K85A 3B3IA 3H3KA 4MJ4A 3UAJD 4LMQE 3Q1SL 4N9GA 1ADQA 2QKIA 5I1DA 2H1PL 4KJYB 4MQTB 1CXFA 1VCAA 4OJFH 2YPVH 3FB6B 2NY0C 5HHNB 1L4IA 1NC2A 4HBCH 1V7MH 1QA9B 3MRDB 1BJ1J 4HXAH 2L7UA 3D39A 4F57L 1I3RA 1NJ9B 2FL5B 4KROB 5HVFB 4GKSA 3OZ9H 1YNKL 1RURH 3MCLL 5I6XB 1EEYB 2PR4L 5JORA 3QIUC 4S1QL 4XPGL 3WUWB 4R4FL 5GRUH 2LV4A 3SGKA 1U91A 4NHCH 3VFUA 4JLRB 2DJUA 3VI4E 3KAAA 5J56B 5HHME 5IWLA 3O6FC 1DVFA 2OTPA 5KVDH 1MWAB 3MV9E 4QGYA 5D5MF 2AGJL 1ZGLM 3TBWB 4DUXA 5C6PB 4JKWA 5GS0L 4MNHA 2FLRT 5C0BE 3EOTL 1AQDB 1RZIB 4S1DC 3T0DA 1CDUA 1F2XK 5GGRY 4HCRH 4ZAKC 2W9DH 1MHPL 1T66D 1QLRA 2APWA 3DBXB 1EEQA 5CSGA 3UZEA 3C8KB 3WFZA 5IHZB 4ONFL 3L3KA 2KBGA 5K59E 2DQEH 1TZIB 2ZNWA 25C8L 2BCKA 3HI6L 3NH7L 2N7AA 3U0TA 2VLLA 4OZIA 2CJUL 1CIUA 4HC1H 3WJJA 3FFDB 4ZTPH 2ITCB 1I1FB 5JPMA 1GAFH 4RWYH 4JRWA 5F1IB 2P43B 4LIQL 3EDFA 3GMMA 2JB5H 1H3WM 4A2LA 4HK3J 3O45B 1OPGL 3OKEB 2BNQE 4ZFOL 1QEWA 2X7LA 3QUYC 2EIDA 3U82B 1YEIL 3QDMB 4PJBB 2FX9H 4K71C 3C60A 4IMLA 4OCMC 5J12C 3SJVE 1F90H 2GYSA 1G7HB 3H9ZA 1EAJA 3T2OA 1R5VA 3TBYB 3GSOB 5JW5A 3QUZC 2X4SA 3IDNB 3MCKA 1JJUA 3L5IA 4LSRH 3LS4H 5LCVL 4WGVB 4OAWA 4QXWA 1IJ9A 5JLZB 1IT9H 3RWIA 5IR1B 1FO0L 4OD3H 2GK2A 4XPBL 4P99A 4OZHE 2WBWB 3SKOA 3FB5A 3SQOL 3BYTA 3QDHA 1ZLSL 1GGIH 3N1FC 5D93B 4CUCA 3BYYA 3ZKND 4BUGA 4FQQB 3F8UB 2FJHB 3PV6B 5BCAA 3TNNB 5DQDH 4I18A 2FECI 5ALBH 2HFTA 1NC4A 3ARGD 5C07A 4N0FA 2R1YB 5I15H 5IIEB 3L5XH 3VDBA 4U6VH 4ZFFB 4XPFH 3BD5A 3FO1A 1NGZB 5FGBC 1KJ3H 1JF6A 4Z18A 1D7FA 1RU9L 3IU4H 3DMMC 5DR5L 4LVHB 5CP7B 5AAWA 4ODVH 1QR1A 5T3ZL 5IB2B 1T7VA 3A6BL 3U2SA 2IG2L 5EC1A 5B21A 2UUDH 1NCUA 4JO4L 4HV8A 2JIXB 2NZIA 4L4VA 4CU6A 4TSCL 5F9OH 3BT2H 5CUSL 3IAGC 3GHEH 3A0OA 3UP1A 3MPCA 3O41B 2X9YA 5L0QB 2EEDA 3G04B 3H0TB 5M94B 2OYPA 2IAMC 3MFFA 1QG3A 3ULVC 5E99L 2C9AA 5CP3A 2LABA 1W0YT 2VLRA 5C70A 2DJ4A 5IQ9A 1AP2B 3QHZH 1R3KA 4IIQA 1NGQL 3NOIA 4NUJA 3K2MC 3ARDB 2DM3A 3ALPA 5C9JB 4XMKL 1JZ2A 2IMNA 1CDCA 5I1HH 1J1XL 2HJKB 4YXKL 5GGVY 5I74C 2NZ9D 3GK8L 5D2NC 5ECJE 3ELAT 2OP4L 1NC2D 1KC5H 3NIDF 5MP6H 3WO4B 1CD1B 2P5WD 4U6YA 1QBLH 3ZKMC 3BZFA 4NBZB 5GGTA 3SJVD 2BVQA 1CU4L 1IQWL 1A9EB 3QZWG 3RX7A 3I02A 3V0VA 1X5ZA 4YXLH 5FYKL 4MAYC 4KDVA 5JUEH 1JNNL 5I66B 1NANI 3WS3A 2QADD 4ZOCA 1YY9C 5E00A 3NIGF 1UM4H 2C26A 5IVOA 2YR3A 1UB6A 1CIDA 4OLZL 4PRNA 3DUUB 3PGDB 1X4ZA 1BVZA 2HT4D 2O5ZH 2R2HB 2RAMA 1UXWA 4HGWB 1KCVH 2D2OA 3MYJB 3TWCL 3G5XA 3D85D 4Y4FC 4LBEB 4YDLB 3MRMB 3T65B 3MJ9L 2WUBH 5IBTH 3BDYH 3TV3H 4CN4A 4OBRA 3WMSA 3VGEA 1MI5B 1JBJA 4GRWB 1IAMA 3RZCC 1I4FA 4FP8L 4OF3A 2Y06L 4NP4L 3KDMA 1FFRA 1RFDH 5C0CD 1Z9OA 3VE0B 5I2IB 1FBIL 1P69B 1NBZB 2YD5A 4LDEB 4CVWA 3MJ8B 5C0BA 4N8CH 4BELD 4G8FA 2JJVA 4JDVB 2F53B 1T3FA 5HHMD 5DRNA 2Q3AA 3ECBA 1XR8B 2FX9L 5TF1H 3U1SH 3QCUL 4XCEB 3TN0C 2E7HA 3A6CH 5E0QA 5F9OL 3TO2A 4S1DD 2H6PB 2DQTL 5J3HD 4YE4L 4JY5H 3UTZB 1OAZH 2OX5A 3P40A 4XGZB 1PG7X 4XNMA 1C5CL 4S11A 4OZGA 5EZOL 4R7NB 4KROC 4P4KA 3QRFM 1BZQK 1KTDB 4OM1H 1XMWA 2W0FB 1G7LB 1PJ9A 3FQXA 3PL6D 1DVFC 1Q1JH 3FT3B 3O6FA 4KKAD 5AZEH 1FZOA 4IOFC 3LEXA 3TA3B 1A7NL 4BZ1H 1GYAA 4LHUD 4BFGA 3B43A 5C7XL 3SDDD 5EU4B 5IMMB 2DIJA 1L0QA 1B0RA 5ESVB 1QBMH 4HWZB 1Y18B 3RA7H 3MJ9H 4YX2L 3HI1B 4AG4L 2V5RA 4HGKC 1WZMA 1ZEAH 3RGVC 2H26B 3FFCE 3LS5H 3K4AA 5DJ0A 1ITCA 4D8PB 1VADA 4KXZI 3TN0D 2XY1A 4WWKB 2WMPA 4X98B 3LRGA 4XXDB 1MJJA 4DVRL 3RNQB 4F58L 2V5TA 1UEYA 3BP4A 5HDOA 2AAVA 4UAOB 5C0ND 3J8F7 1MHPH 4BQ9A 4YWGL 1QRNE 4PJDE 2GCYB 2PXYD 3TYGH 1DFBL 5H37G 2ED7A 1DEDA 3QI9B 3ZKXB 4Z7QE 5EZLA 3D3VB 4HMDA 3HNVL 5HYSB 1DQDL 1HH6A 3LQAH 2PW1A 5ENWB 1PKOA 3BH9B 4FQ1H 35C8H 2EDWA 4GAYB 2W60A 4YK4B 4MQ7A 1EZVX 1EO8L 1RJCA 3I9GH 1HKLH 2BVYA 1CXHA 1HH6B 4IM8A 3KLDA 4KKCC 3BE1L 5HY9A 3RJDA 1JHLH 1RZJC 4LLVA 1CD1A 3FAXA 2R23B 5I19H 1NCCH 5EO1A 4G7VL 5D5MA 1NEUA 1V7NL 4ELMA 1QRND 5F1SA 1YEIH 4WDIA 2YN5A 4QRQB 1CGUA 1T7ZA 2XZCL 4P5TB 1OARL 2DM4A 4OB5L 2Y6SD 3O8XA 1QRKA 5GJSL 3AVEA 4FQHB 1N8ZA 4NO5B 3KYOA 5TQ2L 4JRYA 2UZXB 3VXMA 5BW7A 1YEDA 4YO0B 4LCCC 3VI3F 4YPGB 3QFJD 1Z3GH 3DROA 3KXFD 5KVEH 2Z92A 4ALAH 5E2TH 1U95A 4NZRL 3UTPE 3CUPA 5KBNC 3UCRA 5KSAC 1QFWL 3FTGB 2Q7YB 2ZSVA 4JFXB 3QR2A 2DQEL 3IXAA 4U1JB 3V0WH 1FDLL 3GSXA 4Q9CA 4P59L 2RGSA 4DW2L 1FAIL 1KN2L 4UUJB 1KV3A 1YMHB 3DECA 4BQ8A 1GJIA 1TQCC 5DEGB 1RZFH 4RWHA 4U6HA 3CPLB 4BQCA 1MFBH 4XPGH 4HK0A 5IBLC 4P46B 2DLFH 4OLUL 4Y19B 1F58H 1FIGL 1A0QL 2HMIC 5KOMC 5IUSA 1PEZA 2NXYD 2BCKB 4FTVB 3RIFF 1XH3B 3NIGE 5C86A 5H37H 2Y07H 5GS0D 1RAMA 3IU4L 3S34L 2Z8SA 2J12B 4PRHA 4NO0B 4BH7A 5DTFA 3E8UH 3PWPB 2AEPL 4OGZA 2NCMA 4DVRH 3BN9C 2Y72A 4U7MA 1RUMH 1NCTA 3WNMA 3TVMA 1JGDB 5HGBB 4JRXE 2NR6C 2VL4A 3WLBB 4PLKD 3P4MA 4BZYA 2MJWA 3C09C 3O9WD 4LKXB 3NZHL 2AV7B 1YEHH 5TDOB 2HJLB 3QNZB 5HHPB 1G7MA 2P5EE 4GW1A 1KFAL 3HG1E 5D1QC 1JYWA 3FOLB 4HK3N 3OPZH 5GSVA 3ZTNL 4Z7NE 4PJDF 5MEPA 4RQQA 1WAAE 1QBBA 2H32A 3DV6A 4LARL 4IDJL 1M7DB 2A73A 3MBXH 1ORSA 1U8HB 4M48L 1A6UH 4L8SC 2ESVA 1DL7L 2FD6L 5J1TC 3CFBB 5D6CA 1VPOL 5IFAL 3V6FA 1RUQH 3PL6A 4EQ3A 2VDNH 3IDIB 4X8JB 1SJXA 4MHHG 4TUKL 1R24A 4EKXA 2ZKHH 3EDJA 1LVEA 5T3XD 5IB4B 3T04D 1E27B 3WL9A 2VWEC 1OARH 1BQUA 2DLGA 3VGHA 3PL6B 1IGMH 3EYSH 1ZGLB 3RL2B 5A43C 5ACZA 3OQ3B 1DUYB 4IIQC 2D03H 4H1LB 5FDWB 3TA3D 3U7YH 5FYKD 1INEL 1CL7I 4KWUA 4H0GA 5FA3A 3BZEB 1ED3A 2EDDA 3O4OC 4OLZH 5KVEL 1M71B 2AEIT 4RDQG 3HNSL 4NRXB 1PG7L 4TRPL 1DFBH 5D8JH 1VDGA 2X4RB 3MFFB 1BECA 4GW5B 1IFHL 4APQA 1DLFL 5TE4L 2VTFA 5A2IH 1ODAA 3IS1X 4L8SA 4DW2H 5DFVC 3ZYJA 5F3BA 1RULL 1FSKB 1J0HA 1A4JA 3ABZA 3D39E 3PWPE 1FZMB 2CKBA 3LEVL 3MA9H 3SE9H 5FB8A 1OAUH 1TJIL 1CGYA 4RRPA 3U2SB 1NBQA 2IAMB 5HTSA 3IDUA 4PJ7B 5CEZD 3PABA 1IEAB 3X3FL 3V5HB 3ZMRA 1HHIA 1UENA 4P5TA 3K4ZA 5D7IA 2X70B 4JRXB 2DMKA 1OSZB 4JANB 3QUXA 2VE6A 4X6CA 1CU4H 2H3NB 5D1ZB 1KJMA 1I7ZA 5GIRA 1MCLA 4QNPF 4KTDL 1WT5A 3GJFA 1RMFL 1CICC 3C5ZA 5GS1B 2ENYA 5DRNB 32C2B 4DOHB 3K2UH 2HFFA 3RZCB 4R26H 3RY5A 5CKGA 1O0VA 1KJ2A 4NNXB 2FX8L 4OCXH 4XCNB 3WN5C 1QFUH 4GG8B 1A7OH 5DD5H 4AL8H 3VGGA 3FCTB 2NW2B 2ICWJ 4GRMA 1JV5B 1BLNA 4QXTA 3H3PH 4OLVL 2DQHL 3V7AG 5FIEA 1MRCH 1YUHA 4AIXA 2H2SC 3U7WH 2ZZUT 4JZJC 2JELH 4N8VG 4N0UE 1O7VA 2HMID 1D5XB 4JFDB 2YUVA 3C08H 3IJHA 2K7QA 2Y06H 4NP4H 5EIIB 3L3JA 3OHXA 3PDDA 3PWNB 4YHOL 4NUJB 4WTXA 4LLDA 4DWHA 3FB8B 4RGOH 3X13B 1ZA3A 3MXWH 3GMQB 5HPOA 3MROA 2HKFL 1A7PH 4ONGH 2GSGA 2J8UB 5DTFB 1XIWD 2O5YL 5K9OA 2CKBH 2EH8H 1HHGA 2ITDA 3DNKA 1OGTB 5HI4D 3SCMB 3STLA 2D4FA 3VW3H 4FXGB 3VXPB 4NZDA 4PJAA 3C8HA 5FV1L 2WLYA 1JZ4A 4Z7WB 2YXFA 1VACB 5ANMB 4DAGH 3F12B 1A6AA 3G5ZB 2OL3H 1XGPB 3EJJX 4Z77A 1PX3A 4H8WC 4YGAB 3BQUA 4X9BA 2A2QT 2WP3T 5BVJA 5LCVH 1JMZA 2JCCA 3Q6FB 3O6KH 4P4RB 1S7TA 1MIEL 4UMGA 3OTTA 4M6NL 1FO0H 4QT5B 4R97C 4PY8I 2YPLA 2DWEB 5DS8A 5C9KA 3LKSA 1KPRB 2BY2A 3Q6FA 4PJXF 3H3PL 1P4IH 4PRHD 3U4BL 1BFVL 1HQRB 2NXYC 4L4JA 4PJBF 1ZHBA 4HX1B 1TCMA 2AJUL 4Y5YB 5IVXA 7CGTA 2R69H 2JELL 1IKFH 3H9SA 3MGOB 3G6AA 3MRMA 2H26A 4JFZH 1E4JA 3LDBC 1ZT7A 2R2BA 4PJHF 4QRQA 4HV8B 3L3DB 2E9WA 4RFOH 3T3PE 3GIVA 1D6EA 3ARYA 3GIZL 3BFOA 1CDYA 5DHXB 3VJ6A 5EA0L 2IANB 3FZUC 3HB3C 5JW4R 1DP0A 3VH8A 1YMME 4IOIB 5IFJB 1G6RH 1L7TL 3IKCA 4C54A 5JHLH 2JCCF 3ARBC 3PHOA 1MFDL 4S0TD 2MKLC 4YDKH 4W6XB 2QKIB 5I1DB 1UADC 3HNSH 1DLHB 5IW3A 1T0NA 5MHSE 2QSCH 3W2DH 2V2TA 5HHNA 3FN9A 2VC2H 4R4BA 4JKPL 4WUUD 5EZJA 3FFCA 3OGOE 1UH2A 3H7LA 1DQLL 1TVHA 2CR3A 2Q86A 2H45A 2YA1A 4NQSB 1JPSL 4X99B 1KCUH 4X8XA 5INDA 1WFOA 3ZKQD 5T3ZE 3TNMA 2DOCA 3BEVB 1KUMA 3QB7C 2VDLL 3IKKA 3ESVF 3MRIA 2AJSL 3HUJF 5CLTA 2LE9A 4PY8J 4RCAA 3MBEB 3DVFA 3WFHA 3RIAF 32C2A 3HNTL 1REIA 2VXSL 2VDPL 3VFVA 5GS1C 1DQML 3LIZH 3X14B 3H9HA 3D87B 4DZBB 2FECL 4EI6B 5LGHH 4Y4KC 3SKUD 1K2DB 1S7WA 1CF8H 4CMHC 4HAFA 4CVXA 1SM3H 2Z9TA 1T0PB 3SDCB 4KKBC 5FB8B 3EYUH 3O6LH 1DQTA 3CLFL 1CDBA 1OTUC 3E2HB 1N2RA 3KYKL 4NKQB 4P2YA 1UCBH 2LAGB 3T3ME 4FP8H 4Y2DA 2EO1A 1U8MA 3LKNB 5E7BA 4KK8C 4Y4KB 4R7DA 1T21B 5HYQB 3AMKA 4U1MB 1D9KC 2BFVH 3CSBA 3QO1B 4ZYKA 1EH9A 5L88L 4ONHA 4P2RA 4HS3A 4OQ1A 4MWFB 4G6FD 3HZMB 3KPRE 2W65A 2YPLE 3HE7C 4Y4KA 3VFOB 2J2ZA 4BJLA 2DMBA 1FGVH 1B4JL 2NY2D 1WQVT 5KS9B 5CS7A 2GK0B 1R5WB 2ZUWA 5CJQL 2AJXH 3CFCH 4P2OA 3RHWK 2D7NA 4FXKB 3C2SA 4MJIA 1LEGA 1NMAL 3NH7H 4PGBA 1XGQB 2W0LA 1KTLA 3DSFL 2H2SD 1FYTA 2AJYH 3C6LC 2B1AH 3OB0H 4L8BA 4H25A 4LLMA 4L8DB 3D6GA 3O45A 3I84A 2AK4D 3LN4A 4ZUSA 5HXMA 5EU6A 3IVKA 3EDDA 3Q6GL 5AWNL 1SBBA 1AGCA 2BSSB 4GKZB 3WHXA 4PV8A 1U3YA 2HJLA 4OFIA 4P49A 4LASL 5E08L 3RL1B 3DO7A 3EYSL 3D3VD 4M7KH 4XBPA 1F4YL 4PRHE 2NY2C 4YQXH 1HWGB 3KYMA 1ZLWK 1WJ3A 4DK3A 1LP9B 1S7RB 1VGKB 4QRTB 4PRHB 4U1HA 3MV7D 4QF1A 3FN0H 5EPMA 4ZXBA 3RBGA 4XBPB 1QLFB 3DI2B 5D7SH 3O3DA 5JXEA 3P4NA 2XI9A 2QV2A 2D4DA 3O2WH 5CBAB 2JCCB 5GGQH 5GGVH 4OKVB 1F11B 2W1NA 1YEFH 2ZOKA 3QJFA 4KH2A 3GB7A 1RUAH 4OD1H 4QT5A 4DN4L 4P3CL 4JFPA 4N9OB 3WNNA 2R23A 1OAUL 1TJIH 4D0BA 1GAFL 3KPSB 4RWYL 1AH1A 2CDFA 2NY5H 5LBSL 3HRZA 3ARGC 5L8KB 5JQHC 2F53E 1N5AA 5CMAA 2ZOKB 4Q6YA 2GTZA 1IL1B 4OF6A 4WO4B 4TTDC 5I75C 1JPSH 3TJHC 4QHKJ 4MQ7B 2AGJH 1U6AH 5EUKA 1MQKH 3T2QA 1AC0A 1TZGH 3O4LA 2DTMH 4JO4H 1K5NB 4LKCA 3UTTE 2O61B 4MYWB 1X5JA 2C3GA 1RK1B 1SEQH 3WV0A 4M5ZL 2GCYA 4ZPVB 3B6SB 2GJ6D 3Q5TA 1E6JH 3TESA 3BRDA 2WQRA 1FGVL 1I8IB 4HFUL 1T20A 2I9LA 2BVOA 2ZNXA 5FO7B 1NGYB 4OD3L 3KPQB 4R6UA 3IJSB 4POZD 1D5ZB 5K9KA 1UQSA 2DF3A 3ARED 1YC8A 4L4VD 4Y0GA 4H0HB 1MFCL 5BS0A 4OZHF 4P5MA 4KKBD 3RVUC 1FP5A 4QY8B 2WBJC 5J6GA 1DBAH 3C6SA 4JFYA 2VR9A 3ZTJH 5B4MC 5CZVL 2NPLX 2CRYA 3CLFH 4JB9H 5EBLA 1MFBL 4XAKD 4Q6IC 2DQDH 4HHAA 5LBSH 2BVEA 3D9AL 2XTJD 1C08B 5INCB 3UTTB 1AGBB 2E9JA 1T03H 15C8H 1WISA 3P9MA 2MQCA 3T09A 1QFUL 3TBVB 5C92A 5EULV 1OAYH 4RMSA 1ZLVH 2H6PA 4XP9L 3RTQD 2IGFL 5FYLL 3QJHB 3ET9F 3S5LB 1UZ6E 3UTSB 1BEYH 2OL3B 2HH0H 3GKZA 4LSSL 3ULVH 1I8LC 2OTUB 3RAJL 5KVGL 2FYYB 4NJAL 1CTNA 4KKLD 4JCMA 4PS4L 3VXQA 5CEZL 3RWGB 3GUTB 2WBJD 2JJUA 2CIKB 5CILH 4AQOA 1YNLH 4PTUA 4MAUH 3I50L 1JHKH 2DQFA 1LE9A 3IT8D 4Y7MA 3ES6B 3DSFH 2XTJB 3GI9H 3OG4B 5C08D 4MCZB 3SBWC 4PJXA 2P5EB 1NBVL 4P2OD 4O02L 3UPRA 3GUTA 1I8LA 5IK3A 3JBG7 1XH3A 3RRQA 5LGJB 4H1LA 1ZOXA 3CIQA 5C1MB 1P53A 1X5XA 5LWYH 1QUNA 4XCCL 1N5YH 1UZ8B 1AGCB 3B2UC 4GXUN 4ODWA 4Z77B 4HLJA 1D9KD 3X11A 5I17B 1MCWM 2IMMA 1K9TA 2NXZD 2ZUYA 3GEWB 3SDCD 1T3FB 3HR6A 4KJPC 5DVOA 1HILB 4UIMA 4JQXC 4HEPG 1OTSC 4RMWA 5E1AA 5CBAA 3NCEB 4QRTA 4WEBL 3HG1D 2OI9B 4P2OB 1RURL 3P4NB 3O4LE 1HHIB 1CDJA 5L9DH 4OLWH 1Q0YL 4XAWH 4NWUL 4LSSH 2Z0BA 2A73B 1BFVH 1U42A 2KQMA 1G7IA 3MBXL 4UINH 5DURB 1R0AH 4LVNB 3QHFH 5FUZH 4JZOB 3VFMB 3HE7A 4S1RH 2Z93B 2ZCHL 3P0YL 3KYKH 4OFKA 1RHFA 5HDLA 4JO3H 3T2NH 3O4LB 3O6FD 4PJEF 4YNYA 5I30L 5CWSA 4PGCB 3X3FH 2R9HD 2PXYA 1LK3L 1YJDC 3MGTB 4CU8A 3HI5L 4FQXB 1RZIA 2FATH 4QRPB 1TXKA 5C2BH 2ADJB 3HMXA 4HKBB 3PWUB 1XZ0B 5L8JB 3TPUB 1NCBL 5H94B 2VQUA 5EB9A 3D0VB 1B4JH 2R56L 1BIIB 5EZLB 1KT2A 5BQ7A 4HUWA 2OTWA 5TH2B 4HXBH 2HT2D 1PG7H 4HKZA 3Q5YA 2G5BB 3T1FA 3QNYB 1S5HA 4OCWL 3V4UH 1NGWA 1KEGH 1U8IB 3L3HA 4CN6A 1YMMA 2FSEB 4FA8A 1UEMA 2VDKL 4KXZH 4ZXBD 5LGHL 5LGKA 4GQ9L 2NY4C 4N0RA 1D5ZA 2XWJB 5ID1A 5K9KB 2VH5H 3UTPD 2OZ4L 1M4KA 4R0LC 1LDPL 1LEIA 4J3TA 4ZD3H 4ORZC 1UJ3C 3I6LD 5T1MA 3D39B 4M6OH 2BX5A 1OW0C 3ULUH 4PJGA 4O2FA 3ZE2E 3EHBD 4KI5C 4JRYD 4DGIL 4Z7OE 1T83C 4LNRA 4GG6E 2VR4A 4M43H 3P0YH 2WNGA 3SDYL 5GJSH 3WUWG 1IBGL 3TVMD 4PJCA 5DJDA 4K8RD 1MH5B 1YYLL 5D2NE 2Q86B 3CDCA 1QHPA 2L7JA 4YIQA 3K4DA 1KJ2B 4NNXA 3LQZB 5IESH 4MAYA 2AJZB 1UH3A 3MYJA 4X4MA 1E4XL 5IFHL 2D7QA 4G8GE 3HUJB 3ZKNC 4AL8L 2I5YH 3SGEH 4D9LL 3RWFB 3D1MC 4UDUA 3V8CA 3AY4A 3I2CH 5JDJA 5DK3A 3OXSA 2E8ZA 2EZ0C 1YECL 4WJ5A 4RGNE 3WFHB 1BQHG 1OT2A 4HK0B 4XP4L 1UM5H 3RWFA 2XN9A 3LKQB 2ESVB 3QQNA 4PJ5D 5A40E 4JHAH 1NKRA 4U1NA 1PZ5A 4B50A 4P2RB 3LPGA 3CMGA 1IEBA 1JWSA 2BNRE 1KB5A 4PRIA 4LLAA 3CD4A 3DRQA 2YD4A 4I3SL 2CPCA 3G9VA 2RCSL 4M1DH 4L3EB 4BSJA 5IW6A 4QHNA 4YWGH 3MV9A 1CFBA 3RDTD 2NNAA 4EIGB 5D7LA 1YYML 2AXGA 4NC2B 5D2LF 3STZA 3MLSL 5IBUB 4JAMA 1IRAY 4E0RA 3AREA 4XZUB 1ED3B 3AY4C 4WWKA 4JVWA 3OWEA 5HD8C 4ZAKD 4WHDA 5DJAA 1NLBL 2EYSA 4BSWB 5DHYA 4N1HB 3C2AH 3WFBH 5EA0H 5E8EB 1ZT1A 4Q0XH 4MJ5A 5B39A 4ORGA 4WW2B 5E2JA 3BESR 4X6EA 4HIXH 2Y5TA 4K7PH 1QACA 3QQ4A 1P9MC 4D9LH 4X5XB 2NXZB 1CVRA 3G08B 1UCTA 1W0VB 4X6BA 1DL7H 2RB8A 4C58B 3GB7B 5DD0H 4P2OC 3C5SA 3TT3H 2NY5C 2FL5A 3X3GH 4LK4A 1JZ6A 1M7DA 4UV7L 5DJZA 1HI6A 4MA7H 2FRGP 2ICEA 1WBYA 4C56B 4HT1L 1N0XH 4H5SB 4WY7H 4R2GC 4XTRC 1KGCD 1XZ0A 2ZOLB 4M6AA 1JGVL 1TDQA 2X4QB 3TIEA 2VITB 4H8WL 1A2YB 1YN6A 2LU3A 4FFYH 4WHCA 1U3JA 4XNQB 3RZWA 1FL5A 2X4TB 5FO9A 4M5ZH 3FHQA 3QCVL 4DKEL 4ENEC 4PRDB 1Q9WA 3VA6A 1S7SA 4R9HA 4FQHA 2AJSH 3CH1A 3WHXB 3SDCA 5DZOA 5J1AB 3W5MA 2DICA 4LBEA 1NSNL 2J4WH 1JF1B 4HF5L 1DQQB 3F7RA 4D9QE 4PRIE 4LGPB 2PTUA 3QIBD 4K8RH 3U46A 5BJTA 4HPYL 1EFXB 4KGLA 4FABL 3M1BB 5D1XA 1X3DA 3L7EB 4HJGA 4HS6A 3AS0A 2D31A 4GAJH 4OF5A 5ILTL 2YUWA 1L0XA 5DA4A 3OGCB 4WIQA 5DQJA 3P30H 4LCWA 2VDQH 2Y7QA 3M17A 5I1JH 2ADGB 2P5WE 4DVBA 1RUML 1CLZH 4F9LC 3WS3B 1QD0A 3BZFB 4DTGL 4XWOC 2EE2A 3C6SB 5KS9E 4E5XA 5CEXB 2XZQL 2HJFB 2EXWD 3U7AA 1HQ4B 4NFDA 3L95B 2ATPB 4G6AD 4OM1L 3RGVA 4U1GC 4M1GL 4HH9A 5JHDD 3KJ6L 1VKXA 5I1KH 2VLME 1FNGA 1AR2A 3LKNA 7FABH 1CLYH 3AS1A 4OFVA 2MPAH 4FQLH 3TO4D 4NWUH 1GXEA 2BNRB 2DQHH 3IDMB 1R3KB 1EEUA 2FD6H 3DXAB 3BIBX 5DS8B 5K9JH 2DDQH 3MC0A 3BUTA 3OKMA 5ERWA 4MA3A 4NO2A 4LSPH 4ZUWB 1DEEA 4GKOA 2EDLA 3BWAB 5FGCE 4X6DB 1FVEB 5KSVB 1OAKL 2BSSA 3LY6A 3GKWL 3QJHA 2QJDA 2KQNA 4JR9H 1PSKH 4HKJA 4ZOEA 1GVIA 4L9LB 5EIQA 1NCCL 2SEBB 1ZT7B 2R2BB 3U7YL 1BVKA 1HH9B 3G6DL 4PJ9A 1XIWC 4TSCH 1C7SA 3QI9A 4WFED 1UJ3A 4TRPH 1SYVB 2YRPA 1HCVA 1F11A 3ULVL 3QNXB 3HPJB 3KR3L 2GY7B 4GMTL 1Q9LB 3KLAA 1SVCP 3BOVA 3MRPB 4UNTA 5FF6B 3I50H 4NKDB 2FO4B 3L7FA 5D5ME 4ACPA 1G7JA 4DKAA 2JF1A 3ZZ1A 3KPMA 2MHAA 1P4BL 1UJTA 4PFEA 1YQVL 4GKNA 5JMRA 4M6OL 4DCQA 4GSDH 4N0CD 5DGQA 2VLKD 3IU3A 4M5YH 4ZAKB 5DLMH 3GRWL 4RRPG 2I25N 1NAMH 1VEMA 4G8EB 4TOYL 1IILE 1OQOA 5IKCB 3DURB 4N90D 1LK3H 3SDXF 1OAKH 1HWHB 1NCDL 1M05B 2FATL 3DLQR 5D7IB 1XGYH 4P5KB 2X4PA 5C09E 2GITA 2UZYB 4YXHH 1AGFA 3B5HA 1IC1A 2F5AL 1U3HA 4JFED 4WO4A 3L3DA 5D7JD 2PXYB 3HLAB 3V0AC 4NCC2 5CP7A 3VFVB 2XT1B 5DJXB 5L8LB 1CDIA 2C3XA 1A22B 3CH1B 1OW0A 3VRJA 2NZ9C 4GMSL 1S7XA 2GY5A 4JHBA 4OLXL 1UA6H 4HS8H 4CU7A 5CJBA 2V9TA 5DUMH 1U93A 2GT9B 3U4EA 3CXDL 1MUJB 2M1KA 3DMMA 4J3SA 4KQ3H 1DANT 1JE6A 2YHGA 5JPNA 1RFDL 5BO1H 4CN1A 2XA8H 3EJYD 3C5ZB 3S37L 4BH8B 4HEME 3EDKA 4XTRD 4S0SD 4MXWH 4YAQA 2J6EL 3QEGH 4ELMB 2XACC 5FKPA 5ICYB 3EFFA 2VABB 2WUCL 1M7IB 4TPRH 5ITFB 2CO7B 1CFTA 1ES0B 1XF5B 4MXVE 2VERN 1FO0A 1T80A 3MOBH 4OUUA 1F2QA 4YIQB 2V7NA 4OF7A 3MGTA 3GSXB 2Z92B 1EV2E 3KJ6H 4HD9A 3UYPA 3QXAA 1MF2L 4OZHB 5JIIA 4OT1L 4MJIB 1AXTH 3QULA 2DKMA 4XRCB 3BKCL 3VGFA 3V79C 4M6ML 5D1ZC 5DK2A 2I24N 4KU1A 1J1XH 3X17A 3U4BH 4N0UB 1WV7T 4QY8A 3RKDC 4KKCD 3W81A 2GJJA 1IC7H 4UNUA 4RNRA 4HS8L 4XVUC 4QRSA 5IJKA 5EO0A 1NGXB 4AG4H 4CADA 5A2LH 4YX2H 3QYCA 3O4OB 4NKIH 2NXYB 4FTVD 1IBGH 5I6XC 4F7CA 2X44D 3PE9A 2HTKC 4ODSL 3RL2A 4ZUUB 3SKJL