2R4SL

Crystal structure of the human beta2 adrenoceptor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
b'DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor
molecule tags Signaling protein
source organism Homo sapiens
publication title Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.
pubmed doi rcsb
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4sL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r4sL01
2R0WH 4LVNC 3VFMA 1EJOH 3BRFA 4LPVA 4JO3H 2DL9A 3GI8L 1RZ8B 3GRWA 4KMTL 3ZE0E 4Y4KC 5ITFB 4YDKH 1T3FA 4NO5A 5E99H 5T3XE 4LCWD 4XNQA 1KELL 3FQXB 4IDJH 2J6EH 5GGUA 1WCBB 1Y6MR 4ZOCA 5KSAD 4OCLC 4S11A 1QO3A 4X6CE 4MAYD 3T0EC 1J1PH 3MCLL 4HBCH 5GS1B 4XPAH 1AJ7L 1P1ZB 2IAMD 1ETZA 4PY8I 3ZYOA 1FNFA 1QR4A 5EO1A 1VACB 4MD0B 1BWMA 4NHUA 1KTLB 5GS2H 5KG9B 1A1NB 1YQVH 2VR5A 1J10A 4DAGH 2E9JA 5LGKA 1RZGB 4XC3H 5FO8B 1NBZB 1T5WB 3SE9H 2OSLA 3ZKND 4LAJH 1OWWA 5D6DC 5E6ZA 4MJ6A 2VN4A 3PWLB 1DLHA 1I1AB 4GRLC 4MAYA 5LGJA 4NQVB 2AXHA 1MJ8H 4LPYA 3TGXA 2X1WL 1NMBL 1TZHA 1RK1B 2WBJC 3M17B 4YAQB 3C60D 3SDXA 3IF1A 2IQAA 1LO3L 4J12A 5I1IH 5CEZE 5E2WL 1NL0H 5EC1B 4ZNEA 1F3JB 2P42B 3AU1A 1KTDA 4Q74A 4BFIB 3QDME 5IM7A 1F97A 3O6LH 2MWCA 4BH7B 5IB4B 1NC2D 1BD2B 3FQRA 4W6XB 1AE6H 1YQVL 1QSEA 4G6AC 1XEDA 3UP1A 1A6ZA 4EEEA 3MRNA 2DQJL 1EEZA 3GSNH 5SWSA 5BCAA 4K2UH 1D5ZB 3RWDA 1KB5A 2AK1L 3BZDA 3B3IB 5F7EH 1EEZB 3UO1L 3PQYD 4HZAA 4X0KA 2YR3A 5D5ME 3HKFA 2HJFA 4X5WA 1A3LL 5I18L 3FMGH 3EFFB 1JGEA 4WGWB 3S8WA 4AL8H 4PUBL 4RMVA 4KTDL 2W60B 4HCRH 4GG6A 4P3CL 3T0EB 5C86A 5E2TH 7CGTA 3DXAB 1BAFH 2DQTH 4Y2DD 1GOFA 4PJXE 3RKDD 2EDRA 2I25N 4HKJA 2FLRT 4QRRE 2EZ0D 3VFSA 3GO1L 1AHWB 1UACH 3I9GH 1EO5A 1QBMH 2M8XA 4L8BA 1EAPA 5EO0A 1BFVL 4LKXA 1A7RL 4Y4KB 1PKOA 1R24B 1FL3A 4N1EA 4JHAL 2C3GA 1UM6H 2F74B 4Y5VA 4UOW1 3K46A 4KRPD 5LGJB 4M6AA 2FNBA 1T2QH 5GJSH 1WSST 2FGWL 3ECBA 1V7NH 3DXAD 3V6OA 5D7JD 2YD3A 2QQNL 3MCG1 4NRZA 4MA7L 4KXZH 4MYWB 5EU6D 4JG0L 2KBGA 1JHTB 1CK0L 3D39A 1RUKH 5TQ2L 4PJ9A 1T5XA 1JGUL 3PWPD 1TVBB 5F1OB 1MCSA 3DIFA 1Q94A 3SDAA 1NLDH 3TVMC 1NAKL 1G7HA 2PYEE 2X44D 1ZA3B 3HMXH 3TYGL 3V6FA 4KY1H 5JNYB 2VZSA 4YX2L 5ESVA 1XR9A 1G7MA 4M1GH 1AO7E 1K8IA 2AKRB 4E9LA 3L5XH 2XY2A 5HDLA 3CFJA 1YMME 4G7VH 4HJJH 4WI9A 1K8DA 5EU6B 4DN3H 4LRIC 1G84A 1AGCB 2VC2H 3BP7B 2UYLA 1X6NA 1AHWC 1SJHA 1MLBA 2E5EA 3FTGB 2GJZB 3FZUD 1NBVL 5J13C 2DB8A 4I4WB 3KYOB 4HG4K 4JZNA 3L3IB 1D3CA 3GSRB 3QULB 1AJ7H 5FOJA 4CVXA 5C08B 4B50A 4YHOH 5B3NA 3UCRA 1D5MB 3MV8E 4NJAH 5E7BA 3T0EA 4KK8C 4J6RL 4N8CH 5KVGH 3MLTB 3JUYA 2HMID 1IRAY 3IFLL 4HIHB 4C56B 5C0CE 4YPGB 3L7EB 3O8XA 2BX5A 4CVZA 1U8KB 2HFGL 1ACYL 1C5CL 1CGWA 2DLFL 4MSWA 4YHMH 1SY6L 4Z0BH 3RNQB 3KJ6L 4JRYB 3RNKA 5KG9A 5DJYA 5T5FL 3F7YB 4OLXL 5IFAH 5IF0A 5CD5C 4XBPB 4OSUH 3WHXB 1NLBH 4Y1AD 1FO0A 1KPVB 1MFEH 1EHLH 4R4BB 3QUXA 3T2OA 3NABL 4P9ML 3K4AA 1CFTA 3SO3B 1YYLL 4Y19D 1FV1B 3IKCB 2VR4A 1ZHNA 3MV8B 4GG6E 4LCCA 1C7TA 2C1OB 3GHEL 2HT3D 4BKLA 3TJHC 4FQIH 1FNGB 1QRNE 5IHUL 5I1JL 5GRUL 3MA9L 3UXFA 4MXWH 3RVTD 1LO4H 2F74A 4M9OA 4Y5VB 1RURL 3T3PE 1MI5A 3B8SA 1E4WH 4JCMA 5CMAA 3QI9C 3FZUC 4OAWA 4JRYE 1CLZL 3DO3A 1GGBH 3LS5H 4OB5H 3FOLB 1KCRL 1IT9L 1J0HA 1E6JL 1UXWB 5D4QA 5E8NB 2AQ1A 1BZQK 2GTWB 4G9DA 2QKIB 4M1DH 5CIPH 1OTTD 4FA8A 3H3BC 5BVJA 2BNRD 3HPLA 5JW5A 5DD1H 3G5YB 4P46C 4TPRL 3CVIL 2ZP0T 4OZHB 3VI4E 3JV5A 4LSRL 3SE8L 1WWAX 4TULL 4I0PB 5ECJE 5HYJA 1YNTA 3OR7A 5C08E 4CMHB 3GMNB 1QEWA 4PJFF 3MFFA 4UBDC 5FO9A 4A6YA 4HIXH 4D2NA 4G8GB 4CU8A 4GT7A 2O5YL 4N8VA 3X3FH 3NFSH 4Y5VC 1E4WL 5B22A 3DTXB 5F7KC 4MA7H 3GJFA 1ZV5A 1FFOB 2QL1A 1NCWH 3G6JA 1JGLH 1WWWX 2GFBB 2FRGP 4BQ9A 2XQYG 5E5MB 3DUHA 3OHXB 4HUMB 1KBGL 3LKRB 3GFUA 2VL5B 3CFKB 5JMOC 4R4FH 4G8FA 5GRWA 1FVCA 2R0LH 3AXLB 4G8EB 5KVEL 4XVSH 4YPJA 1U9KA 1I7ZB 1EHLL 2WWKO 3VXSA 1CI5A 4F58H 3SKJL 1P7QB 4WFFD 1NGPH 4C4KO 2OR9L 2Q86B 2HFFB 3ARDA 3PF2A 3MXVH 1ONQA 2WBWB 4I77H 5FHBH 3P9LA 2Z91A 4TUOA 2DI9A 4JQVC 3MRBA 3WXVL 3I3EA 3H6JA 1GZQA 4X4ME 3UYRH 5ELIA 4N5EC 3EO1B 1OTTC 1AKJD 4M7KL 4PV8A 5DRZA 2G75B 4L29B 2UUDH 1JNNL 2M26A 5EWIH 4JY4B 3HG1E 4ZDHA 3SE4C 3VXUD 1F4WH 2EIEA 4LLDA 3DMMA 4EJ1C 1VGKB 3N1PC 4FFZL 5DJAA 3MLSL 2RCSH 2RIKA 3V5DA 3MV7D 1A4JB 5FB8B 1NKRA 4MQTB 2GCYA 5EN2A 1JK8A 4YZFF 2YD2A 2IALA 3HE6A 4ALAH 3I6GB 3BEVA 5ALCH 5DR5L 3K3QA 4IDLA 4HIXL 5ERWA 2R4SL 3X13A 3ZMRA 4K3DL 3ARTA 5ACZA 1HXMB 1OTUC 1H5BB 3QWQB 3BIAX 3MRPB 1QSEE 3BKCL 2R1WB 2F58L 1J0YA 3DVFA 1H15A 2CD0A 1BZ9B 3TBSB 2F19L 5FCSH 3IDMA 1FLRH 2B1AH 1XFPA 1SBSH 5JZ7D 3ISWA 3KPSB 3ULUD 3IAPA 1P6FA 1TITA 4ZFZB 4WO4D 5BS0E 5I8KL 5B4MC 3ULVH 3L5WA 1H3TA 1MHPL 1PAMA 3SEPA 4KZDL 4N90D 5T1KD 3HPJB 1QFWH 1HCVA 3OB8A 4XPTL 5CEYA 3ARSA 3OJMB 5HD8D 5JDSB 2D7TH 1DSFH 4JZJB 1P7QA 1XCTB 2GJZA 3T65B 2GIYA 4X4ZA 3VA6A 3SE3A 4WFHD 3LEVL 1KC5L 1IM9B 2X4RA 4JKKA 1D5BA 4Z7WA 5CJOL 3TPKA 3W39B 3WS3A 1UKSA 1E4XH 1E28B 1ZE3C 4BYHA 5IR1A 3TCXA 3FT2A 4EN3A 1WZKA 2LABA 4O2EB 4YBLC 1NGZB 3LRSB 1Y0LB 4YO0A 5HVGB 4YDJA 2P5WE 5IVOA 1OSPL 1FFOA 2QADB 4R3SA 3F7VB 1OAZL 2H8PA 2HVKA 1F4WL 3HS0B 3KJ6H 2VMFA 4FFWD 4K07A 4GS7B 5IV2B 3R0MA 3RUGE 1J86A 3HC0B 4MDIA 1A02N 4PJ9B 5ANME 4X6CA 1PKQE 4OCMC 4PP1D 3FB7B 5L8LB 2I9TA 2X4QB 2ZPKL 3BDBA 3OB0H 2J8UA 3NZ8A 2NW3A 4J6RH 4N8CL 1CBVH 1K2DA 4JO3L 2VDPH 3PJSB 4RAUA 5F1SA 4GAFB 2WIIA 3RKPA 5LBSH 5ANMA 4IOIB 4XRCA 2QADD 2R0WL 2K9UA 4LEXL 1JPST 4JKPL 2EICA 1R24A 1C1EH 3A67L 4PTUA 4IRJC 1CXKA 4J4PD 4LGPB 1L4IA 2ARWA 1ITBB 1CD1B 4YE4L 4B0MM 1JWMB 2V7HB 5MP6H 5INCB 1UYWL 4XMPH 1QKZH 2BVOA 1YEEH 4CBPA 1BLNA 2NY3D 5KVFH 2DQHH 5F96H 3TVMB 4HEME 1UVQB 1WISA 4HIEB 1A6AB 5ISZD 4U3CA 5KOMC 5CEYB 4L8SA 2MNUA 4YDIL 4LVHB 4PP2A 3QHFL 4LGRB 5LAXA 5IVXA 2BY2A 4Z18A 5ITBH 1NSNH 1LO3H 3VMOA 1NFIA 1X7QB 4GXUN 4MA8L 3E6HA 5D93C 4NWTH 4LVOB 4UQ2B 2YBRA 4EI6B 4RSVA 2JIXA 3FO9A 1I1CA 4UT9L 5CILH 2GY5A 3SDYL 4KJWD 2E7LC 3RNKB 3QHFH 1YY9C 2PYEA 2W65A 2DMKA 3FT3B 4XPBH 5F8QC 4CVZB 3F7RA 3D0VB 2ENSA 4YFEA 2OXHA 5FDWA 4GBXA 5A3ID 4MQ7B 2ZSWA 3X12A 5GJSL 1V05A 1ZANL 2VLRE 3VH8B 4UNUA 5A16A 1LP9A 3GSQA 5I1DA 3JBG7 4PTTA 4XWOC 5HGDB 5IESL 1CLZH 3LS5L 1DBAH 4TUJB 2WBJD 4NFCA 4PJIF 2AJ3B 1JE6A 3QYCA 5F93C 2IPTH 4QTIL 4NC1C 4C58B 1P53A 4Q97A 2IQAB 5IVZA 4XNMB 2UWEB 5J3HC 5IOPA 3LSOB 3QIWD 4FQHA 2NY2B 5D2LB 4P49A 3DMMC 3ZT6A 3F7QA 3GKWH 2Z4QA 4EVNB 5TF0A 3HE7B 1OAYH 4UZGA 4J1UA 3RA7H 1VGEL 5DK0B 25C8H 4PJHA 1DR9A 4D9LL 1N64H 5GRJH 5HDOA 5AYQA 4PGEA 1N7MH 1QSVA 2P4AB 2NLJB 5BS0B 5M95B 1G6RL 3FRPG 5AAMA 4B5EA 2QHRL 3RVVD 1QNZL 5CEZD 2DI7A 2X4TB 5HY9A 3WIHL 4X98A 3PNWA 3TO4D 5BZWA 2Q3AA 4P23B 1AY1H 1MOEA 4PG9A 4D94A 3T0VA 4C83B 4FNLL 5IEHA 3L3OB 4RDQF 2EDXA 2L7JA 3U48A 3U1SH 1ZLWH 3QPXH 4X7TA 5JW3L 4G8GA 4XCEA 4ZUSB 2I9TB 1WZLA 3TZVC 2DIJA 4ENEC 4DW2H 2BVQA 2EXYC 2VQ1A 5EFIA 4APQA 4LEOA 1AE6L 3VI3F 3MV9A 4O02H 1CZ8L 1IQDA 4TQEH 2APBA 5IK3A 3H9YA 1S9VB 5E6IA 2WLYA 3IXAA 1NDGB 3ZTJG 1ZLUH 5JOPD 1ODAA 2C3XA 4EIGB 4Z77A 4JFED 3TN0C 3CMGA 3N50A 4QRPE 1QLRA 3LN4B 3PP4H 3QRGH 4X6CF 1ZANH 4K9EC 5E2JA 4UDUA 3O2DA 2AJSL 3SDCA 1CLYH 1H5BC 3MO1A 1MJ8L 4HPOL 4NQCD 2HN7A 4HJJL 5DVLA 3MRQA 2BOBB 2Q8BL 4OM0H 3CSBA 3HNSH 1WFTA 2WNGA 4GG6B 1PG7W 2GJ6E 1W72L 3EYUL 1VEPA 2DM2A 2X1PA 5BV7L 1FNGA 5I2IA 5I1AB 1LNUB 2Q20A 4JEGB 4KTEL 1X5LA 4FQ1H 1CXIA 2BSSB 4I0CC 4ZO9A 1IGYB 1OP3K 1NAKH 1ZHNB 4HFWB 5FV1L 1QKZL 3OKLB 3PWJA 3BIKA 4FQXD 4I18C 4GMTH 1MHCB 5FYKH 4G8IA 4BSWA 3W2DL 5D9SB 3QJHB 1RZIA 4KI5F 1MI5D 4PJEA 4TQEL 4FFYH 1A6PA 1XGPB 3P77B 1JI2A 3C60C 1AP2B 4QOKD 5DXWA 1WCQA 1NCCL 3Q1SH 4R2GB 5HBBA 5EZLA 1BAFL 2DQTL 2FYYA 2Z8VC 5DVOA 3WFCL 4ZUUB 1T03L 1VGKA 4K3JL 2Z0BA 4K55A 3V79C 4P2QD 2VRAA 2P44B 1SBBA 2V17H 3QO0A 3FQWB 4NSKA 4PS4H 1F6AA 4HG4J 5HGHB 5B3JF 1HYSD 2XZAL 3WFDL 1GH7A 3X3GL 3PV7A 3PHQA 4OFYA 3PWUB 5AD0B 3F62A 4FZ8H 4PJCE 3AU1B 1MCLA 1UKQA 3EKCA 4F33B 1Q9WA 5CEXB 4EIZC 5JXEA 4NO3A 4IIQB 2EDYA 4EI5C 3NN8A 4NKQB 1FG9C 4L3EB 1QZ1A 1MHHA 1EXUA 4Z7OF 2N7BA 4MXVF 2VO5A 4HK3J 5HGBB 3LKQB 4NFBA 3WFCH 3S96B 4CN1A 5CJ5A 1N59A 3ULVE 2V9TA 1CFSB 1CICA 2CLRA 5J89A 3GSRA 4O9HH 4J2XA 2ITDA 4U3HA 4MWFA 1FFPA 2PW1B 4PRPB 4AQOA 4JPVH 1NFDB 1SYSA 4OFYD 1EFXA 3QFJE 1JYXA 4O5LL 4ZTPL 3O4LA 3QIUB 3TN0B 3WJJA 3G5XB 5DHYB 5DHVA 4MQXD 4DZ8B 4WUUB 1NAMB 2YXMA 4AEHL 3VFOB 4H20H 5BJTB 4TULH 2LU3A 3LKNB 3UTSD 1JPFA 3B2VL 1JPSL 2JJVA 3KNBA 4L4VE 1GHFL 4HWEH 2FCBA 3OJVC 4J3WA 3KG5A 1A0QH 1Q9LA 1S5HA 3ARYA 3DRTB 4NUGL 3QO1A 2DQFA 3MRKA 1BIIB 5IMOA 2HT2D 3FKUS 2WQRA 4UNVA 1BFTA 4BZ2L 4EUPH 4WHYH 2BJMH 2CUMA 3TIEA 5FA4A 2XQBL 4IOSD 3TP4A 5DC9B 1BM3H 1OSZA 2EZ0C 1YNTB 4WUUD 2H32B 1OW0A 2DBLH 2J88L 4XB8A 4Q9CA 4R97B 4Z8FL 1PY4A 4IMLA 3N1QC 4OM1L 2X4PA 4M9PA 2OR7A 3BUYB 1S7SA 4G6KH 1BF2A 3P0VH 3T0BA 5I1JH 2XG5A 2JCCB 3E8UL 4PJAE 4XCYA 3BFOA 3UTOA 1Q9KB 4NO3B 4JFZL 3P0GB 4TTDC 3RGVD 5DLML 1KCVL 4FG6C 4JY6B 5TFSH 1KELH 4HJGA 5C9JA 1OSZB 1UM4H 4UI2A 3U4AA 4E41B 5I16A 3OKYA 1IILE 1OT1A 4U0QB 2DQGH 1QBLL 3H42H 4KUCF 4XNXL 3V8CA 4G6JL 1JPTL 2DMCA 4QF1A 5CIPA 1TQBB 3EHBD 4Y2OA 1JMZA 1UZ8B 1G9NL 1A4KA 1EJ6A 2J5LB 3OZ9H 1KEGH 2EDEA 3RGHA 1FC2D 3MX0A 1S3KL 4G9FB 4P4KD 2MCPH 3CK0H 1FFNB 3W82A 4XNYH 4P4RA 1IFHH 1MCDA 2PYEB 4ELKB 3QFJB 1AI1H 3FB8A 3T0WA 1BD2A 2MSPA 2DLEA 3FQRB 1EEYA 1FZOB 5EG6C 5GZNC 4XHJC 1EHAA 1B9ZA 1HOCB 1DEDA 3GJEA 1QD0A 1L7IL 1I3GL 4JPIA 3QH3A 3MUGA 2EC9T 1UT9A 3P4LA 1A8JH 4QT5B 4YPGA 3V5HB 4F8QA 1ORSA 4HHAB 4PP1C 1KV3A 3P0YL 2ICWB 1RUAL 4HIHA 2UZYB 1LNUA 4GG8B 1E4JA 2BJML 3MJ7B 1A2YA 2DQDL 4PJCF 3O3DB 4PJFE 1X6LA 3DBXA 3EO1A 2DQIH 3KS0J 4U6YA 2VZ3A 1A2YB 3RZCC 5CAYB 4MMZC 3NACL 3Q2CA 5GPRA 2CUIA 2KQMA 4OQTH 3WMSA 4LP5A 5JIIA 1DBJH 3W11D 3L3GB 4UT9H 3MLPA 1HIMH 2X1QA 5MENE 5K9KB 4NHCL 5C09E 1FQ9C 3FOMA 1PQZA 1I1AA 1DLHB 1G6RA 2O26U 1R5VA 2DQUL 2XTJC 4FXKA 3DRTA 5DQ9A 1ADQL 5GGRY 1ZLSH 3VFTA 3WNMA 1CFQB 3O6ML 2VXTH 3CXHK 4AENB 2AJYH 5IT2L 4XBEH 3IDJA 3WIHA 4D9RD 2YPVH 4LHUD 3QJFA 4X6CB 3MPCA 1CE1L 4GAGH 4RGNE 1WUNT 3ULSA 2XZCL 3O3EA 4M7JL 5SWQB 1W8NA 3T1FB 4U6HB 3KDMA 1R5VB 2GAZA 2IBZX 5IHZA 4MGXA 2WWMC 3N1MC 2FX9H 4QRQB 5C0EA 1S7XB 4U1SA 4D9RE 2ITDB 2Y7QA 3S97C 2ICES 1NCDL 5C9KA 3P30H 1QOKA 4ERSL 3PV6A 2IPUG 3PQYA 2YSSB 4Z5RB 4QHKJ 4TVPL 1JVKA 2XTJD 4X7EC 1D9KD 2VL4A 2Z92B 4EUPA 3WUZA 2IANA 1XCTA 3ZLQC 3GSXB 1Q9WB 1K6QL 5CEXA 1EUTA 1S8DB 4UDUB 5FYJU 2LU7A 3T8XB 5HI5D 2EC9U 3LCYA 1HHGB 1I1FA 2HJLA 5E8PB 5D93B 1G0YR 1FSKB 3WJJC 3LIZL 3KHQA 1EDQA 5CJQH 3GSQB 2EYRB 5I1DB 1UH2A 4GUPB 2HJKA 3HR5A 5EU7C 4LLWB 1KXVC 4K9EH 5IW3A 5IESH 3T0EE 5L7XL 3N0PB 4WI4A 5C7XL 1LE5A 4LCWB 4PD4K 3SE3C 2E7MA 4Y4HA 5GISH 4LLWA 3PABB 1FO0B 1KPVA 4D8PB 2MKWA 4CN4A 4HS8L 2J3SA 3D39D 1P4LA 4ZNEE 1FGNL 3TBTB 4LBEA 4WJ5A 3D48R 4LSQH 2OM5A 4ODVH 3UPAA 1P9MA 5T1DL 4RIRA 5DJAB 2A0LC 4RX4A 3WL9B 1LEIA 4D9QE 2PTVA 2FR4A 2RJMA 1B6UA 3X14B 5IWLC 2A6DA 4IJ3C 3CX5J 5JW4R 4PJ9C 3QT2A 1MIEH 1MFAL 2Q6WA 1DL7H 3SOBH 1NFKA 3CXDH 2YSSA 1FDLH 1NBQA 4YHZH 3DWTA 2P1YA 4IIQA 1FHGA 2PYFB 4BJLA 4D9QD 1AGBA 3S98A 2DQDH 3D3VE 1JFQH 1IARB 1ZVSB 2FH8A 4NBXB 4GSDL 3D85B 3B9KD 2JELH 4JB9L 1N26A 3TBVA 3T1FA 5DGRA 4HXAL 3RIFF 1JZ4A 2NYYC 1KIRA 1NGWB 3C9NB 1FRGH 3MV9B 4JN1H 1HYSC 2CKNA 1R5IB 2YD5A 3KR3L 3WNKA 5E4IA 1ZA6A 2WANA 4YGVA 4I2XB 1OCWL 4QRSB 2D31B 2GHWB 2W9EL 3RP1A 3D3VD 5JPNB 1KJ2H 3R8QA 4P2RA 3UJIL 3G5XA 3IAQA 3KXFB 5DHYA 1BOGB 1RU9L 2QSCH 4IIQC 3O2DH 5E95B 1OT2A 2CPCA 3AS3A 4MAUH 1NFDF 2XFXA 5JOEA 1T3FB 3M8OH 4G8IB 2DJ4A 2Z31C 1J9CT 1KJMB 4PJDF 4XP1H 1BBJA 1NC2A 5F7EL 1ES0A 4EN3B 2DQEH 4ENED 3MOQA 5D96B 2NLJA 1QBLH 3H42L 2YRPA 4L3AA 3M07A 5JUEL 4D3CL 1NCDH 2NCMA 4XNZB 4MHHG 4UOJA 3KPSE 1B2WH 3NCMA 3GSXA 5HD8C 4YBQC 5E6YA 5D96C 2C3VB 5C0BE 2C4FT 4B7LA 1OCWH 3EAKA 1BVZA 3S36H 4OZFA 1G7IB 4N0UE 3LD8B 1KC5H 4LSVL 2Y6SC 3T0ED 1KGCD 4F7MB 1DL7L 3SOBL 3IFNH 3TBYA 3UPRA 2E7CA 3I75B 4HCRA 4F7TA 4NNPL 1N6QH 1IEHA 1OB1A 4AM0B 3REWA 1EH9A 3VXOB 5IGXH 3DX9A 3L9RB 1WIPA 5IJKA 2XWBB 5E8EB 4NZTH 4RAVA 5IK3B 4Y1AE 5J11C 3K80A 1BFOB 4OLYL 3RI5K 2FBOJ 3MLYH 2IBBA 1RI8A 2NY7L 1IAIH 3O6FD 2VQ1B 4X0KB 2OP4H 1RV6X 5KVDL 3JTTB 4FQCL 4PJIB 1BJ1H 1W0WA 3RWDB 2ZUUA 3F12A 3WFHB 5SWSB 1IGIL 1WBXB 3PWPB 5I1EH 4DAGL 3HMXL 3QRGL 4PRAB 3WV0A 2OZ4L 4NWUL 5KSVB 4RFEA 4PP2B 3IXTB 4Z0XA 1S7WB 4OCWL 4QGYA 4R2GC 4YDIH 4UAOC 4NCC2 4C57C 3WS3B 5CJQL 4QRRA 3SE9L 5IIEB 1CFVH 2OXGA 5C3LD 4HDIA 5IQ7H 1MHHB 2HN7B 3E1F1 2NZ9D 2Y72A 1PKQA 3NFNA 2C3HA 4RQQB 3C6SB 1LDSA 4FMKA 1N0LA 1NMAL 4Q7DA 2Q86A 1C16B 2JLLA 4KKNA 1X5XA 2OI9C 5GJTH 2BRQA 4ETQA 5GGSY 3L5WB 1WF5A 2WLZA 5F9OH 3BP4A 4NQCE 3DUUA 1FPTH 5I76A 1Q9LB 4YHNA 1O7SA 1QNZH 4HD9A 3U7YH 4WV1B 5CKGA 4NP4H 1PEWA 5HGAB 1FCGA 3K2MC 1KJ3L 2FEDC 4JVWA 3UJTL 3DVIA 3A0OA 5F71A 1MLCB 4FQ2L 3SJVB 4RCAA 3F7VA 3PP3H 2EIBA 2CIIB 1J11A 5I19H 1CFVL 3A6BH 4LQFH 5I1HH 3KPTA 4DVBB 3FONB 1HH9B 5E9DA 4RZCB 2VLKA 1CFSA 3N1FC 3WLWD 4GSDH 4PGEB 1KGCE 5HYJB 5MHSE 4QRTB 3BDYL 1I9RH 4LLDB 4LSPH 4IRSD 1TJGH 3RPKA 5ID0A 5HYJE 3HE7A 3N9GL 5EOTA 3KYKL 5IEKA 2GUOB 5HYQB 3BH8A 1JTTA 2BNRA 3GMQA 3VFUB 1HHHB 3QUXC 2IG2L 5L2KB 4GKZA 5FKPB 4HQQH 1W72B 2CR6A 3LEXA 3LZFL 4CL7A 1I7UA 1JWMA 4GRLA 5C0AB 2VAJA 1DBML 2VXVL 1QR1A 3C08H 2BFVL 3CD4A 1FFRA 3DSNA 2RR3A 1ZLSL 4OZHE 5L2KA 5FYLD 4U49A 5LXGL 3ILQD 5HYJD 5D8JH 3U36A 1ORQA 2YKLH 2QR0A 2XFXB 4YQXH 4JANB 1FAIL 5ITBL 1YN6B 1VA9A 1HNFA 1U8QA 4PJEE 5DUBA 4HKBB 2PUQT 3PL6A 1RUAH 5D7SL 4ODWA 4KHXL 4NNPH 4P5MB 3MRGA 1SVZA 1A14H 1II4E 2PXYB 3O3UN 4KROB 3V6OE 2Y36L 3BKCH 3TFKC 2W0KA 4H5SB 3T3PF 4KRMB 5DHXB 4QXTA 5GISL 3PDOB 2OR8A 4ISVA 1JN6B 4V1DE 2YHGA 1D5ZA 1C5BH 2YPLA 4NOFA 4GRLD 1KLFA 1XGRB 4PJBA 3E2HB 5C2BL 2J4WH 3VJ6A 4DCQA 5JXED 1CXFA 3T4YB 1GAFH 1UZ6F 5ICZA 2DLIA 1AO7A 4RGNB 3FN0L 1IGYA 1U8PB 3MRJB 2EE2A 2QBWA 3MBED 2B4CL 5J1TC 1WFUA 4MJID 1K5NB 3NPSB 2LAAA 1DQDH 1IL1A 4HPYL 3X3GH 2D0HA 4NKMB 2APWA 5E8OB 2VDLH 3HLAB 4LNRB 4GS7C 4Z7WF 4KGJA 2ZJSL 3MODH 4TUOB 5I1CH 2FIRT 1KTDB 4BFIA 3UJIH 3BISA 4ZFOB 2C1PB 1INDL 2D2OA 3S36X 3MLVH 3OJDB 4Y5XA 3AC0A 5CEZL 5T1LD 5DEZA 5A3IC 4ERSH 1O5DT 1SM3H 4YHIA 4H25B 4MJIB 1BX2A 3SGKA 3QO0B 1Q1JH 1BQLL 2LQRA 3MRFA 2NY0D 2J8UB 2XPGA 3QNXB 4OGZA 2MJWA 1WIUA 4KK5C 5T33H 2CLZA 4PR5B 4PRDB 1HSAB 4PBWD 1T22A 3HCVB 4X7TB 4WFGD 3ILPB 3VXUB 3TJEH 2F53E 2ADIA 4S0TD 3CVHA 3DTXA 2XKNB 3DJ9A 3IDGA 5D7SH 3DURA 4XGZB 5J4MA 2X89D 4R6UA 1M6OA 5IFHL 3UTQA 3LKOA 5IMLB 4XI5D 5HY9B 2BMKA 3PL6C 3MLRH 5I1LB 4X99B 4XCNB 5HHOA 2PXYA 4OZ4B 5C0AA 4QXGL 3MR9B 2EDBA 2CMRH 1YNKH 4ODSL 2QTEA 4OCSL 5FIEA 5I2IB 3NIGE 4PG2C 1RUKL 3CVIH 4XTRD 5K9QG 3EYQD 5GGTH 3FQTA 3S35H 5JMRA 2VXQH 1LK3L 4NQEE 3QUKA 2Z92A 5FGBC 5HHOE 3RIAK 2P49B 5KAQG 5E6IC 1S5IH 3INUL 4MB5A 3C60A 2E7HA 1FG2B 2PTUA 4X8XA 2DQHL 1OAUH 1L7TH 3BESR 3GGWA 3RFZC 2XXCB 2ZUYA 5IB1A 3RY6C 5T3ZD 5DEGB 1KJMA 3RWFA 4Z77B 2CK0L 3BPLC 1LO0L 3OXRB 5DWUH 2GQHA 1BIIA 3UC0H 3GSNA 1EPFA 4WDIA 3MFGB 4U6HA 5A16B 1S5HB 3PJSA 1YEKL 4GFTB 2ZUQB 2M1KA 2AV7B 3BGFB 2P5WB 4ZFGL 3P11H 3O6KH 4WTXA 4LCCB 5F9WC 4PB0H 4Q6YA 4AMKH 2X5PA 4JFFE 3LQAH 5MEPA 3D69A 2R39A 3BGAA 3U4BH 5F7UA 4JFDD 2ZSVB 3QUMA 1A7QH 3B3IA 4XXCC 25C8L 4WRLA 5T3XD 5IF0B 4O51A 5JNYA 3D87B 4UV7H 1MAKA 4YBQD 5EOQL 2OX5A 4HKXA 4JVUA 5DJZB 5EO9A 4D0DB 4K3JH 1HH6B 3EOAA 3S5LG 1OAZH 2IH3A 1TVBA 2R23B 3DSFL 5ENWA 3U9UB 5DJDB 5ABDE 1DQQA 1CD8A 4MNQA 5GZOD 1U3HA 3BD5A 1CIUA 3QFDB 3X11A 1CGUA 4OF8A 3H7LA 1OHQA 5DMKA 1NGXB 3IS0X 3F6LA 5DRNB 4JJHA 2L4OA 4ZOBA 3V0WL 4PD4J 1G9MC 1BVKB 5D2NB 4QRRB 1N6UA 4FOMA 4G43B 4DGIH 2Y36H 3O4OC 1NANI 4Y8DC 1S5IL 1PYWA 2BVYA 3KPLA 5F7LB 2VTFA 2AAVA 3IDNA 4HC1H 3LRHA 1QFWL 1BZ7A 5DRNA 4N5ED 1EZVY 1H3UA 4KQ3L 4R26L 4FTVA 4ZO8A 3WIFB 2ARJA 1MWAL 1OL0A 3DGCR 4L3EE 1KLUA 2JCCF 3SO5A 4MA3A 4HW6A 4KJYB 4RBPH 1U3JA 3U9PL 1ZWIB 3W9DA 4JR9H 5EBMA 3SDAD 4PFEA 3NZHH 4F15C 2R0ZL 3VFGL 3GSWB 3RL2A 2ENYA 5ALBL 1AQKH 4O02L 3PWNA 4WI7A 3C5ZC 4YXHH 4TOYL 3CSYB 1PBYA 1BPVA 4U4BA 3V0WH 4EI5B 5AUMB 4MSWB 4M61A 3L95B 5MP6L 5E08L 3T3MF 1KCLA 1QPPA 2EYTA 2QQNH 2QQKH 4MXQD 4FTVD 4RA3A 1CDCA 1YC7A 3N85H 5HVHC 3MC0A 5HHVH 1UCBH 3JWOC 1IC4H 5FOBA 1MRFL 2H26B 2C3VA 2WIMA 3RL1A 4JREC 3NA9L 1A6TA 1P4IH 1FL3B 4M3KB 4L4VB 1D5XB 1OP9A 3VFVB 1K4CB 2V5RA 1JWUB 4ODTL 3PQYB 3CXHJ 3VWJD 2J12B 4Y16D 5EC1A 4M4RA 1BP3B 3GJFK 4LOUD 3OL2A 1YYMH 1I3RB 2CRYA 1RZ7L 2D9CA 1IQDB 2RBLA 4QOKE 3D3VA 4K2UL 3TBSA 3MMEA 4GKOA 5EU6A 4Y2DB 2B7DT 4XNUL 1D7FA 1RU9H 2QSCL 1G7PA 4X6EA 3BRGC 3TV3L 3WLBB 1T1ZA 3RDTD 2XYCA 4QHUB 2RFXA 5BXFA 1MQ8A 3MRCB 4U1NB 2FB4H 4OD2B 3MRRB 4XP6L 4YHOL 1JGLL 3VD7A 1JTOA 4KRPB 1FIGH 4F9LA 3EYFA 2RFXB 4HXAH 4E42A 4JPWL 4P23D 4UTBL 2AEQL 5EUKB 3BP6B 5FUOH 4UT7L 3D2UB 2F5BL 1DP0A 4X6EB 3O6FA 4I2XA 4DUWA 1C08A 1QUNA 4Q6IB 4G80B 4XBGB 4YHPA 2BVPB 3MSPA 1IAKB 4XXCA 3LMJL 5B38A 5I8KH 3RPIA 4NPYB 4QKXB 4M6OL 3UTTB 4PLOB 4BQBA 4FQHB 4RA0C 1MIML 2K7QA 3IDNB 1PLGL 1YMMD 4BA8A 2FR4B 5DA0B 2FX8H 3TJEL 4HBQA 1XR8B 1WJ3A 3DETD 4JO1H 1MCHA 3QUYA 4HKJB 3GKZA 4MJ5B 4KY1L 2J2ZA 2OZ4A 3IDIB 3EDKA 1HEZA 4WJ5B 1UYWH 4R4NC 4DEPB 3QCVH 1IKFL 3MV11 1K5NA 4UT7H 4YWGL 1C5DB 3QBTB 4X9BA 3LKRA 1U3HB 1ZHBA 4HC1A 2VLJB 4JDVA 4UU9A 4L8CB 5HI4D 4CJ1A 3G5VA 3CC5B 2WUBH 3CLFL 1N2RA 3H9SD 5FGBA 4ZG1A 4M93B 2ZG1A 4JM2A 3TC9A 4HKXB 3P77A 2OS7A 1XR9B 1OAKH 4BK5A 4RGMB 4MCZB 2XKSA 1RZIB 1G9NC 1Q94B 3O9WA 2E7BA 3ARBD 4Z76B 2HMIC 4IRJD 2A6JB 5KJRL 2VH5H 2Q8AH 1N3NA 3JTSB 1KYOJ 3AS2A 3CMOL 2LU4A 1KB5L 4AEFA 1RUML 1J7VR 4I0PA 4HUWA 1WQVT 3BJ91 2MQCA 4M5YH 4YXLL 3WCYA 1KN2L 1MAJA 4IDJL 1H3PL 5D7JA 5IW6B 3MODL 2ATPB 4NBZB 4MMXC 4NKDA 3O8XC 2PXYC 4KROC 1UJTA 4KKLD 3STLB 2VAAB 3ARED 4M8VA 2NXYD 5I16B 1XMWA 2FJFA 3ARDD 5E9DD 4RMWA 3VFMB 5CCKL 3PV6B 3SCMA 4P4KC 1I7UB 1ACZA 2EIZB 5CJOH 3KPPB 1PY9A 4OFKA 3WLWC 1FG2A 3RU8H 5TE4H 5DSCA 1RZFH 4G6ML 5T3ZH 5I6XC 4ORGB 4UTAL 2OK0H 5E1HB 1AGDB 4Z8FH 4HUXB 2DQCH 5GXBB 5E7FA 3HB3C 3QEUB 1AO7D 2GY7B 4PJDB 4WEUD 4QCIA 2HTKD 3RQ3A 1T20B 4LDEB 5DUPL 3VWKB 3OGOE 5E9DB 4HSQA 4PRIA 3TPUA 2H3NA 4EI5A 2Y5TB 3DARA 1YEGH 3CPLA 3IDJB 2CGRH 1CS6A 1DBMH 3WHXA 4YBLB 2EDHA 1MCPL 3ILQC 3O0RH 1I8KA 3W5MA 4LSTH 2XQYK 1VFAB 3EDFA 3MLYL 5SV4A 2XICA 1SYVB 5IP4A 3EJYC 3CU1A 2ZNXA 2R2CA 5EBMB 5MEPB 3RI5F 3K1DA 2FSEA 1IT9H 1E6JH 1IGML 2A6IA 2ZNWA 5CGYD 1I1AC 3VWKA 4EXKA 4P46A 4WUUA 1TLKA 2VDRL 1IAMA 3I2CL 1NGQL 3NIGF 4DGYL 3NAAH 4LSQL 3ZDXE 1I85C 2GW5A 4JPWH 2IQ9H 3RZWA 2VQUA 3HMWH 5EU7E 9CGTA 2A73A 2NXYC 3AREC 3OKEB 2VWEC 1JI1A 2OQJB 2AJUL 1KSRA 1TJGL 3QULA 2Q1EA 4J7RA 3Q5YA 35C8L 2AP2A 3UTSA 1BVKA 3I9GL 2N4IA 3ZDYE 2PO6A 5BO1H 1NGXA 4WTZA 2HTLC 4NKDB 5T3ZL 4HT1H 1RJZA 2AK4B 2XZQL 3CVHH 3QEGL 3NCCB 2OL3L 4M8QA 4K94H 3FB8B 3QFJA 4DQOH 2VDML 5BMFH 3ROOA 3CSGA 2ADJB 4O2FB 4V1DA 2HFEA 2V7NB 4PUBH 3V4PL 5I1CL 4E42B 3U2SA 4WVRA 5FYLE 3QH3B 3VRIA 1TTFA 1AD9B 3W5NA 2R2HB 1ZLWK 3O9WB 1HOCA 2R9HD 1W0VA 4ISVB 5HYSG 5BMFL 4LF3A 1MNUH 1P1ZA 4Z7WE 3U0TB 4X7SL 4XNZC 5F1NB 2B4CH 2ZCKL 2AK1H 4OI9A 2XXMB 3DX6B 2XRAL 3N85L 5AG8A 3MRGB 4LHJB 4Z95H 4ZXBD 1XIWD 3ARXA 2HH0L 3HZKA 1RMFL 4F57L 1OOAA 3VMPA 1EX0A 4M48L 2VDQL 1Q9OA 1QTYT 3HI5H 1IGJA 2BVUA 4BH8A 3OSKA 3RWFB 2DN7A 3TA3D 1ZT1B 5JW4M 3EFDL 3QZWA 2IJ0C 1BJ1J 5GS2D 2AEWA 1JYWA 1WK0A 1B88A 4HEPG 2IAND 4IHOA 4PJFB 2GSGA 5ESQB 3VFWA 4PJ5B 1NC4B 3ZT5A 4X6BB 1K4CA 1CF8H 1U6AL 2V5SA 2FHBA 1XIWB 1C12B 1BJMA 1CGYA 1I3UA 5L88L 5FOBB 4LSSL 2X4OB 1BOYA 5ESAB 1GIGH 3Q5OA 3QXWA 4JGJA 1YEJH 4JFHD 3BHBB 4GW1A 3X11B 1U3ZA 4NZTL 4UDTA 4WO4B 3DROA 1YUHB 2IF7A 1G7QA 2EXYD 4MVBD 1J0JA 4X99A 1HH9A 2Y7QB 4K71C 1TZGL 4AH2A 4XWGH 1CDYA 3MJ6A 3HC0A 1ZXQA 2K3TA 1ZGLB 4JN2B 5MENA 3VXMB 3TNNA 1Q72H 3MNZA 4HJ0C 4NYLA 1FNHA 3CZJA 4RRPG 3L3OA 1RVFL 4GRWF 4O51B 4FS0A 3TA3C 4ELMF 4EN3C 5GGSB 5E00A 4F37K 3KXFA 2I9LB 4GG6F 3G5VB 4HS3A 3SE4A 1RUPH 3MOBL 1G7PB 5C1MB 1J1OH 1A1MA 4UTAH 1XIWC 1E28A 1G9EA 2Q7YB 4QY8B 5D71H 3CU7A 1NGYB 1MHEA 3U7AA 4XXDA 4Y4HD 4OKDA 5CS7A 1CICC 1EXUB 4X7SH 3OKNA 5BVJB 4JANA 4NOBA 3C6LB 3K4DA 4M6ML 2JJWA 5AYUL 1ZVSA 1F90H 1XF2A 2CLRB 1IEBA 4NGHL 4LCYB 5JLZB 2UZIL 3ZO0A 2GYSA 4LCUB 1MREH 1S78D 2WUCH 1I8LA 1EIBA 3T3ME 3STLA 3ZZ1A 2XWTA 1OVZA 3FQTB 2PR4L 4QHLA 4LLMA 4QTIH 4CDHA 2Q87A 3O41B 3BKYH 4GBXB 1N4XH 3CFEA 1XCQA 2FX9L 4U6XB 2R0LL 3LS4H 5DLMH 1M7DB 1MCIA 2CXKA 5AUMA 1GGCL 2AJXL 3O3AB 4YXHL 2WUBL 1XGRA 3CFBB 3U82B 2HRLA 4KJWC 3CXDL 1A5FL 3VH8A 4D0CB 1YPZF 1IGFL 2CJUL 3GRWL 5A2LH 3WHE1 5I9QC 1TVHA 4XZUB 4ZSOB 3CC5A 2D7OA 2B1HL 2AJYL 5H37H 3OKOB 4GBXD 4L8SB 1IGMH 4X4YA 2FGZA 3WNLA 4NBYB 2DICA 4BH7A 1B4JH 3Q6GH 5DT1H 1S7RB 2ZCHL 3HZMA 2EE3A 5DMYA 1FLRL 2B1HH 3BPCA 1ZTXH 4HXBH 3DV4A 4GRMA 1GPOL 1JV5B 4GAJL 4JM4L 4HPOH 4LFHG 3IVKB 2YD7A 1V7NL 3GHBH 2CQVA 3VXPA 2ZCLH 4RGNC 3LV3B 1P2CA 2NXZC 3GMQB 3WXWL 3M17A 4KJQD 3ZHLA 3IXAB 5IEKB 4LPXA 3EYVB 5JIKA 2EC8A 4PJ8C 1RSFA 5CUSL 5FM8A 1T7WA 1JGDB 3FAXA 1LO4L 5CJXC 2VL5A 3CFKA 1RFDL 4W70A 4MX7A 5JXAL 1I3GH 4YDLB 3P4OB 1BBJB 1RD6A 1IZKA 1HQRA 4GAYA 2CUHA 3M45A 1JHLH 5E6IB 5EIIB 5ISZA 2CO6B 3LS4L 4J4PA 3GBNL 2FATL 2NX5E 4JDTL 3STZB 3BYTA 1DTUA 5C71A 3WN5B 5D1ZB 1F4AA 2WINB 3BKYL 2O5XL 3CUPA 5IQ9B 1F45A 4R9HA 3RHWK 3D85D 3MJ9L 4P2RB 5ILTH 2YWYA 3NPZB 1RZ7H 3QXUA 4N0RA 4M5YL 5EU6E 4G9FD 1ND0A 2OTUA 3VFPA 2P8PB 1RUQH 3HAEA 4HT1L 5F88A 3SKJH 1RHHA 5D7LD 1GAFL 3TO4B 1FBIH 4LKCB 1LO0H 2J7LA 3MOBH 4X98B 4CW1A 5IJVB 3VGEA 1DEEA 1FZMB 1UA6L 4WWKA 4JQIH 5IVZB 1OP3H 1TJHH 2EDLA 2CXGA 3WD5H 4PJHB 4OAWB 5HYFA 1GRWA 2P47B 3FAWA 4FQJL 4XHQA 2QQKL 1A6TB 2DWEA 4HGWB 4PJHE 1FE8L 1S7RA 3EGSA 5LWYL 4LU5H 4GW5A 1YPZE 4KWUA 3FO2A 5L2JA 1F2QA 1V8HA 3VXPB 7FABL 4HV8B 4CNIA 2A74B 4TOYH 1DVFB 3P73A 5ENWB 4NQTA 2OJZL 3PWUA 3THML 4NJ9H 3SPVA 1X5ZA 2BNQA 2VLRD 4PJXB 1DN0B 5ERWB 5HHMB 2V2TB 4Q9RL 1JHKH 2BSRB 4HH8A 3TT3L 4E41E 1AD9A 2F5AL 3QNYB 3BE1L 3MRNB 5AZEL 3KPMA 4X6DA 4JREB 4JO4H 4PRDA 2YA0A 3HUJE 3N1GC 5HHPB 4P5MA 1WZMA 3PGDA 1RZJH 4U1IB 3WFZA 2DBJA 2Y4SA 4YGVB 3PHOA 4JM2D 3O11A 3K81A 1T4KB 4HC1L 5JO5B 2J8OA 2YBRB 4Y88A 1IC7L 1U95B 1UJ3B 2P5EB 2YS4A 1A6UL 3F58L 4ZS6C 2NY5C 1KCSL 1ZSDA 1YJDL 2VIRB 3GUTA 4K23H 4AEIH 4R2GD 3L5HA 1SJVA 1S7VA 3BI9X 4RMQA 2EXWD 5C0ND 2XT1B 4OIAA 3KPQB 3C6LA 4Y4FA 3U7YL 3MRQB 2BDNL 1A3RL 4LGSB 2IPUK 2HRPL 5B21A 4OV5B 4YXLH 3UZVB 5IFAL 2UY7A 4MJ6B 2EH7H 4WV1C 1GZQB 2DTSA 3ZDXF 5KSAC 1PEZA 3S34H 4RDQG 2DIBA 2A9NH 2J6EL 4BQ8A 1NGPL 4HWNA 1LEIB 2A6IB 2QQLL 1IAII 2MCPL 1EFXD 4EXPX 2EH8L 2AKRA 5IMOB 3SDXF 3CUPB 3U4BL 1HHJB 4F9PA 5KVGL 1G7JA 1RAMA 2D4FA 1I8KB 4OCNC 2DLHA 3MRMA 3P11L 2E6JA 2AJUH 1T7YA 2Z35B 5JPMB 3UDWC 2R1XA 2ZSVA 4JHBA 1A6UH 3FB7A 5D7IA 1EBPA 3BRDA 1ZEAL 1KPRA 4KHXH 5DWUL 3ZKXC 2R1XB 5EC2B 3AFLA 4KJPD 4AENA 2FECL 1BM3L 1RZJL 2FJGB 2GJJA 1FGVL 3ZTNL 3G04A 4XI5C 3S9DB 4H25A 4MJIA 4N0CD 3RWJA 3SCMD 1KYOK 3KXFE 3FB5A 3VXOA 2YEZA 1YEDB 1H0DA 2YPLD 5GGQH 3TN0D 4K7FB 4F9PC 5L0QB 4P9HC 2D7TL 3L3DA 5IHBA 1T21A 1XGTB 3LDBB 2JTDA 2X70B 5F7DB 3ZE2F 4I5BA 5DJ0A 3C60B 3B5HA 3BPCB 1PGRB 4MNQE 4NUJA 1CLYL 4D0BB 2K1MA 4J3VA 4OV6F 2ATPA 3E3QC 4KK9D 1KCRH 4HUVA 1I9RL 4LSPL 2UWEE 4K71B 1PG7X 3QISA 4WWID 2AV1A 5D2LE 2VUYA 4YEFA 5I1LA 2X4UB 1BD2D 3IJHA 1ZT1A 3KPRE 2BMKB 4YNYA 4NQDE 2YK1H 4QLRA 1W0VB 1QLEH 3LD8C 5TDOB 1FZOA 5DC0A 1BQSA 4UIMA 3GMOA 5DFVD 2PNDA 1MFCH 1MWAB 2MHAB 1D6VH 1A1OA 2HH0H 1LE5B 2R1YA 2I24N 3I3BA 1OD9A 5J6HB 3O41A 1LO5A 3Q48A 2C5DC 4R4ND 3BMWA 3T2QA 3VRLF 2XWBA 4YHKL 3O4OB 2VDOH 4JFOB 4IJ3B 1INDH 1MHCA 4MB3A 4F7TB 3O2WH 2BP3A 1J88A 5A2IH 5C0JB 2P43B 2JE8A 1VKXB 1TPXC 2Z91B 1F3JA 1WLHA 4FP8H 2EDTA 1P6AB 4YDKL 4ODTH 1H3PH 2FECI 4UT6H 5T3ZE 3H9HB 8FABB 3IF1B 5F6HJ 3MRLA 2VDOL 4YEEA 5CZVH 1I4FB 3NA9H 1R3KA 5C6TL 3MROB 3QFJD 4HMCA 1H3GA 5TDNB 3RIAF 5DMKB 3QWRD 4P23C 2L7UA 4CU7A 3WO3B 1CXLA 3VG9B 3P4NB 1QLRB 4YC2C 4BSVA 3O6FC 1EGJL 4AIOA 1JGVL 3KLAB 3L3IA 3OAUH 4U0RB 1P4BL 2OZ4H 1SJEA 1OW0C 4ZYKA 5I71C 3C5JA 5E94B 1RVFH 4TRPL 3E8UH 1S9VA 5I1GL 3G5ZA 4RMUA 4WWKC 3WFHA 2FJGA 4PRNB 5AAWA 4QY8A 5DRXA 5GHWL 1EEYB 4A6YB 1A7PH 1KPRB 4GOSA 4KZEH 5FXCH 3PABA 1HZHL 2R2BB 2H3NB 2YPLE 1NCBH 2D31A 2X42A 3VW3H 4KAQH 1CQKA 4WUUE 4IRSC 4TNVF 5C0AE 1DLFL 3CDYA 1XGQB 5MEND 1S7TB 3B9KC 5C0FB 1NEUA 5C09D 2WINA 4H88L 5JQHC 3HR5B 3HG1A 3JV4A 3AS1A 4MXVE 4PV9A 1GPOH 2LV4A 1WC7A 3LZFH 5IGXL 2I07A 5JA8B 3D6GA 1KF9B 1K4DB 2O5ZH 4N0FA 3WE6A 5FO9B 5DJ2B 3PL6D 1PW3A 4NJ9L 4O2EA 3I6LE 5FM4A 4Y4FC 5FYJH 3BW9A 1T2XA 3NIDE 1EUUA 4DGIL 3ARGD 3GMPB 4PJFA 3VFWB 2EEBA 1ZGLM 1YEEL 1BVLB 2ADGA 2BCKB 1GOHA 3OAUL 4U6YB 4NQDD 4HUXA 1RJCA 4JGMA 5C09B 5GRXG 2YA2A 5D2LA 4ZNCD 4R90H 1MY5A 3QDMA 3VXSE 3LEYL 3ZSSA 2Z31D 4HX1B 1CD0A 2F54B 3KPRB 3LN5A 4QNPF 5CGMA 4HBCL 3MYJA 4PJ5A 5I19L 2DKMA 5K9JH 4UINH 3KHOA 3VI3E 1FV1A 3IKCA 3L95A 2ICWI 4P3CH 2I26N 2W0PA 4WIQA 1FIEA 4HGKC 1I1RA 3RWGA 1IBGH 3G08A 1HNGA 2ORBH 1UB6A 1ROWA 2XTJB 2EDJA 2XNAA 1UENA 3TM6A 4HULB 2ADIB 4WU7A 1FORL 3LN9A 1MPAL 3GI8H 2XA3A 4Z7OE 2EDOA 4PJGB 3WDIA 5CWSB 4J3XA 1IGTA 2JK5A 1ZHLB 5JORA 3QNYA 3CMOH 2P24B 4ORZC 1S7QB 3P30L 1V3JA 2R8SH 4X4MA 4NGHH 5IB4A 3BXNB 3F6IA 2BSRA 4PRBA 1NGWA 3C9NA 5GZND 1UM4L 5D6CB 3Q5TA 2EYSB 5DMGC 3RVWD 3SJVD 1LEGB 3DHJA 4NDMA 2PO6B 4JFDB 4NCC1 3D85A 1C5BL 3WJLA 5E8DL 3GKWL 3BAEH 6CGTA 1P4IL 2A77L 2HFEB 2DL2A 2V7NA 2DTMH 3CNKA 1KULA 5HI4C 4JRXD 1NCCH 1N8ZA 5FHAL 2GEEA 4P3WA 5L2JB 3WKML 4LLUB 1LO2H 4RQQA 5HPMB 2X41A 4PGDB 3K7UA 4JG1L 4QHKI 2HTLD 2QADC 2Y25A 3QUYB 4H1LA 1I8MB 2XA8H 4N68A 1AGFA 1TNMA 4JRXE 3TIEB 1MFDL 3G9AB 1ORSB 2EE6A 4HHAA 4LDLB 4MD4A 1PVHA 3V4VL 1FZMA 4PG2A 3MUGB 3CX2A 3RRQA 2OP4L 4F7CA 3W81A 3ULUH 3NFPA 4WNQA 1H3VA 1RHHB 2CGRL 5GGQL 5HDQH 2ED9A 1VCAA 4JFQB 5EZOH 4DGVH 2P8PA 4P5TB 2R69H 1X3DA 3FO0L 2VYRE 4UQ3A 5MI0C 5J6HA 2RQ8A 2D7MA 4PRIB 3UTTE 1JHTA 5KS9E 1I9JL 3G9VA 2B0SH 4NKOA 1RZKC 1LE9A 5EIQA 1J8HE 1Z3GL 1PZUB 5GS0C 2COQA 3WIIH 4O4YL 4ZUVA 1EEUA 3QDGA 3C5SA 5GRUH 4CVUA 2NY1C 3TZVD 4I3RL 5J1AB 1P7HL 4U2YA 3CFCH 4PLKD 3HI6L 3KLAA 5J6GA 1RZ8A 5HJ3B 1WBZB 2FH6A 5C0BA 2R2EB 4NRXB 1FP5A 4EBQL 1T0MA 4HFUL 4PGJA 5M94B 1KPUA 3D3VB 5FK9B 3BT2L 4PJDE 5DURD 4Y16A 5SWSE 4GRWB 3KLSA 4GXVH 4MZ3A 5FF6B 5KN5A 3MXVL 4ELMA 3KJ4C 5DGQA 2WBJA 3ZT7A 4KQ4H 2EO9A 3EFFA 1YECH 2H9GB 1P9MC 2X70A 3WFDH 1AKJB 3RAJL 5CINH 1LP9E 3PIQB 3L3DB 4CUCA 2QJDA 5L6YL 1N3NB 3JTSA 3RTQC 3BOVA 1YEDA 2XY1A 5DS8B 2NMSA 4N9GB 3RDTA 4EDXA 2EECA 4CDGC 3FRUB 6FABH 3BSZH 4U1JB 2ATKB 3O11B 1IC4L 4HUWB 2FWOA 1S9YB 4P5TC 2PW2B 2JCCE 4PJAB 4RRPA 4KK6D 2NY0B 5EU5A 2RAMA 2BNUA 2HJFB 4X5WB 3S3PA 5KSUA 1AD0A 2DYPB 3IAGC 5D1XA 3B9VA 4TSAL 3ZL4L 1CLOH 4YHLH 2OI9B 1QLFB 5EZJA 4ODBD 3PWNB 3QEQE 2Z8SA 3MNVB 5C0DB 1G6RB 1HEZB 5B4MD 3QR2A 4TTDD 3RGVC 2R56L 2IQ9L 4ETQB 2DD8L 3EYUH 5ETUB 4KVNH 2A74A 3RX7A 4N8PA 1ZHBB 1MCPH 3LN5B 4HUVB 2ZCHH 4XMKL 2DYPD 3S4SB 2PKDA 3HLAA 2JCCA 4DOHE 4PV8B 5DRZB 1F5WA 1J1XL 3QAZC 4PYGA 4YUEH 4YFLI 1WFNA 5C0GA 1F58H 1NLDL 3Q3GA 4CMMA 2X4PB 3VW3L 5D1XD 1BIHA 4KK6C 1R3KB 4WHDA 3S4SA 2DS4A 3BQUA 2Z93A 1CF8L 3P9LB 1Q1JL 4KK5D 1DQQB 4MNQB 3UTTD 3BIBX 4FXLA 5I75B 3MTRA 1TZIA 1UWXH 1HI6B 4MXWL 3PHQB 2IBGA 4DUXA 5DI8B 3B5TA 2BVEA 4YC2B 2BHZA 3TH3T 2NY4D 4POZC 3UJJL 3O4LE 4XP9L 4AEEA 5DRWB 5EC2A 3BXNA 6FABL 3ARWA 4PJIA 5C6WH 3BGMB 1UEMA 4IRJA 5F97E 3OAYK 4QXUH 1N5AA 1FH5H 2CIKA 5GZOC 5IBLC 1WIOA 1MFBL 5EUKA 1CFNB 5J1SC 3R1GH 1QO3B 2B39A 1WAAA 3GMLB 5DMIL 2XNAB 4M62H 1MH5A 2OMNA 1FO0H 2ADFH 5E94A 4DKAA 4LCIL 4MAUL 4PRPA 4KI1A 1FVDB 4L4TE 1IKNC 2VLKD 1VGEH 3DLQR 1YPZB 5INDB 2FX7L 3DVGB 3OGCB 1BECA 4JFZH 3PDDA 3W0WE 1I8MA 5KZCD 4XNQB 4K8RD 1MCEA 3MV8D 4EDWL 5K9OA 4ZXBA 4CMHC 1T6WA 5KJRH 1ZHKA 4P2CG 2DQJH 3VCLA 2X4NB 1AGEB 5E0QA 2J4WL 5FDYA 1NBVH 5T1LA 1ZSDB 2VIRA 1KCSH 5MEQA 4JY5L 2HKFL 3H3KA 4DVBA 3ARFD 2YK1L 4UILH 3EO0B 4JRWA 4IRSB 3GJEB 4PTTB 2BY3A 3B8YA 2AEPL 1A0QL 3FJTA 4POZD 3GI9H 1K2DB 5GS3A 4LRIA 2AK4E 4JR9L 4XPTH 1EBAA 2IAMB 3HTLX 3QCVL 3NTCH 2R1WA 3MV8A 4CRPA 1ZWIA 3SKNB 4H88H 4NQEB 3K74B 4PRIE 3ORJA 3QCTL 3TYFA 4MS8D 4YK4C 3VI4F 5CP7A 4L9LC 4MJIE 4I0PD 3WHE0 1TENA 3KPNA 3PWPE 1M6OB 3VRJA 4YLQT 3FFDB 3VWKD 4YHLL 3BDXA 4U1GC 3WUWG 4RWYH 1PQZB 3RKDC 5FUOL 4PREA 4R7NA 3C5JB 3V5DB 2ZOLB 4H20L 4H26A 2H6PA 3IFNL 4PRPE 3QG6B 5DFWH 4WENB 3SGJC 4TUKL 3R4DA 3DX7B 4UILL 3SDDB 5BS0A 3TA3A 3QNXA 3TJHD 4ZFOA 4G3YH 2F53B 3W0WA 3LKQA 2LTQC 1RPQA 4CMMB 5E2UL 2EKSA 4LMQE 4ODXB 4YHIB 3QB7C 4POYA 4IMLB 5J06A 3SGEI 1R3JB 1F3DJ 1P2CB 3LPGA 3RTQB 3QFDA 3AUVA 3LKPA 2DI8A 2X7LA 1JP5A 3HE7D 1A7NH 4K7FA 15C8H 1S7WA 5B8CC 3KYOA 5CCKH 5ICZB 1K4DA 3OKMB 4Z7UF 4ETYA 2F53D 4E5XB 4XH2A 4N1CA 1MRDH 3PWVB 1RULL 3QWRA 2V17L 5JO5A 5J12C 2N1KA 4JDTH 1QLFA 5EZJB 2OTUB 4K7PX 5IW1B 3LKNA 4P57B 4XBGA 3OKDA 4HZLB 4U1IA 4YHML 1RZGA 3RTQD 2VZUA 4WTZG 1U8HB 4UUJA 3T4YA 4I1NB 2LAGB 1TNNA 3J8F7 5F3HB 3VXNB 3AY4C 1J1OL 3OV6A 4U1JA 3WN5A 5TDOA 4R3SB 3MRRA 1ZT4B 3BX7C 1HQRB 5EPMA 1T03H 2E27H 4P0DA 4JFPA 5EUOB 4I3RH 4DVRL 4JFFB 4F2MB 1QYGH 2R69L 2WZPD 4WO4A 1NCWL 3ZKMD 1OGAE 3ARUA 1H8NA 3MCKB 4BFBD 1QSZA 4MHHI 3BPOB 5FYJE 5C0NC 3VA2C 1NDMB 1XF4A 1BREA 3MGTA 4K3EL 4GO6B 3JSSA 2LVEA 1FNAA 3BD4A 1NL0L 4Y4KA 1JRHI 3P4MA 1RZKL 4F7EB 4XC1H 3LV3A 3MRBB 3GBML 3WYRA 3HI1B 4R0LA 1CD1A 1VKXA 2BXYA 4PB9H 4OD1H 1SBSL 2X89A 4JFFD 2DM7A 4OTXH 4U1SB 1G0DA 4L4VA 4U1HA 4YHYB 5KANI 5GHWH 5HGHA 4XTRC 4ODUB 3GRWH 5KSBE 1E27B 4IOIA 1LO2L 3NCEB 5HHOD 3JV4B 4PV9B 3NCJL 4PLJD 4XXDB 3TNMB 4YHYC 4M02A 5ID0B 4GRWH 3GMRB 2Q7YA 4H0GA 1QSED 3RZCD 1I3VA 2HKFH 3UBXB 5IVNA 1HSAA 1YY9D 3ABZA 3ESVF 5DYOA 1WBYB 1U3HD 5GSVA 2Z8RA 4PGCA 2EXWC 4QRSA 3WNNA 3QQ3B 2VE6B 2UY6A 4Y7MA 1V7ML 3H0TA 3T2PA 1FIGL 5CJXA 2JIXB 3FO9B 4J3UA 4X8JB 5SWZB 3U6RA 1CR9L 5C6TH 3VXMD 5E2TL 1UCTA 2D7NA 3CAFA 1EAJA 5AWNH 5L9DH 3P4OA 3RX5A 1L0QA 1QSEB 1ADQA 4AL8L 1TVDA 1CTNA 5I8OL 5J57B 2AABL 1KLUB 3NH7L 5DO2C 5DJ8B 4O2CB 3QDMD 4XB7A 3VD9A 5K9QI 1BHGA 4C54A 4Q0XL 1F4HA 4NKMA 3QXTA 3MUJA 4K3GA 5BW7C 1RJLA 3ROLA 5SWZD 1IKNA 1NFDE 1EV2E 3H9HA 5TPWL 1Z5LB 8FABA 2IH1A 1H9VA 1N64L 4WWKB 3OXSB 4MNGE 5TFSL 4IMKA 3VG9C 2KDGA 5D6CA 5GSRA 2W1NA 3FN3A 1ND0B 3HNVL 2NY3B 4U6VL 1U8PA 3O6LL 2ZG2A 1LEKA 1KB9K 3V52L 1DQML 2KL6A 3R06B 5EZLB 2ZOLA 4U31A 1U3HC 1HH6A 3EOAB 1J05B 4TSCH 5IBTH 2VXTL 1B6DA 1AIFB 3G08B 1EEQA 3CFBA 5FCUL 1Q72L 2JJTC 2IALB 5IBUB 5JOFB 1NCAH 2BFVH 3BD3A 1MIEL 4TYUA 3HC3L 4J8RB 3JUZA 5IFHH 1KFAL 1YY8A 5DYOB 5F70A 1MIMH 4O2FA 4V1DB 5D7KD 4WY7H 4CNIB 3KS0H 4Y0GA 1T66C 3I02B 4OGAC 4YDVA 1E4KC 5CILL 1MFDH 1RZJC 4RAVB 4HWBA 4AT6A 3BH8B 4OCRH 4ODUA 3MLRL 1NSNL 3SDCD 5CBAB 4RFNB 2QKIA 2VKWA 1IAOA 3DO7B 2E8ZA 4OT1L 4I5BB 5DJ0B 3HB3D 5BRZA 3V52H 1EMTL 2DQCL 4LQ1A 1N6QL 4J23A 3B43A 3DVGA 3LEXB 5DUMH 4LQFL 5I1HL 5D1QD 5DJCA 4PJGE 5EULV 1U8JB 2XRAH 1EERB 2VAAA 4FABL 1S7XA 5J11B 1R6VA 4FQQB 1ZHKB 4PJGF 5GGVL 4HWBH 1T4KA 4JDZB 3S5LA 1FYTD 3HG1B 3IDMB 2A9MH 4ELME 4HUNB 3VFPB 2W0LA 5F7NC 4UUJB 3HRZA 3C09B 1NLBL 1T89A 2BSTA 4OUOA 2PCPB 5B8CB 5JPNA 1U58A 4NM4H 5BJTA 4PJIE 3LRGA 3U79A 4QOKA 5FAAA 1FO0L 4WV1A 3ZYJA 5FHBL 1I8IA 2Y06H 4MCZA 1RUMH 1ZGLP 4OGYL 3FRPA 5LJYH 1MCQA 3MA7B 3EO9L 4WHTA 3C8KB 2RB8A 3O9WD 2Q8AL 3FN0H 1JK8B 4NM4L 4Z9KB 4R8WL 1HDMB 4U1KB 3QIBD 2Y5TA 4HFUH 1T5XB 4XPHH 1CQYA 2AEIT 1TCMA 5L9DL 2DIAA 3ELAT 4P2RD 4UINL 3VGDA 1OLLA 4AIXA 1F13A 3EGSB 1J8HD 1YEKH 3OG4B 1IGCL 3QDHA 4EVNA 2DJSA 5ID1A 3O3DA 3LOWA 2JELL 3OX8A 3DV6B 4N0YL 1OQXA 3TA3B 3FCTA 1XF3A 1R3HB 2C1PA 5LCVH 1JV5A 4PTUB 2DDQL 4IRZL 2H6PB 4OCRL 4PLNC 2FEDD 1G9MH 4NO0D 4M7LT 2GITA 5IB2B 1LEGA 4NDMB 1J8KA 1AXIB 2GJ6D 5FKAA 2Q8BH 4NQCB 4H8WL 5ISZE 5FYLL 4R0LC 3V4VH 2CMRL 4M1GL 1YEGL 3SKMA 1ZHLA 4BUHA 3ALPA 1O7VA 4L5FH 4NWTL 3FT3A 4FTVE 3UTZB 1T0NA 3JWDH 2NTFA 4PJBB 3RJDA 5CZKA 5I8CB 2GKIA 5HGGS 4N0YH 2ERJC 3MLXL 5DMGD 5AZ2L 5EIIA 3GNMH 4NIKB 4X9GA 2F58H 2DYPA 1U8KA 5E9DE 1R0AH 5F96L 3WD5L 5F1KC 3V7MA 1U58B 4W6WB 4S1QH 2VLJD 3QUZA 3C2SA 1WCBA 3ES6B 4M48H 3QCUL 3BO8B 3QDJE 4LLMB 1U8QB 4AG4H 2EYRA 1PJ9A 4XMLH 3E3QE 4QXWA 3CDCA 4X6BA 2Y6SD 2MQ3A 3GEWB 3C6LD 4L8BB 3DECA 1BEYH 5KSBB 5HVFB 3LVEA 3GGWB 1Y6NR 5I66A 3CGTA 5BVPH 4XNXH 3BUTA 4UV7L 1YNLH 5EOQH 1JNNH 4YAQA 1KJ3H 5D2NE 4F58L 1NDMA 5ANMB 1I7ZA 4YFDB 3VDBA 3RUGB 4LSUL 5BVPL 1E4XI 1ZVYA 2X4QA 5C0BB 3OKOA 5INDA 5HHVL 5JXAH 1HXMA 1O0VA 1A6VH 3FFCE 4WW2C 1NUDA 4NRYB 4ZTOL 1L0XA 4OGAD 5GGSA 1UJ3C 1DQTA 3REVB 4YWGH 4OKVA 3IGAB 2H2PD 3CVHB 4WHYG 3UBXG 2ICCA 5DHVH 1HHJA 1BBDL 3B4NA 5EA0L 2GCYB 5EN2B 4OZHF 4EZMA 4QRPB 3QXDA 4U1LA 2FD6L 3FN9A 3CX5K 1FFPB 1VFOA 2PW1A 4UB0H 1T1YB 3BZEB 3D39B 5I30L 4RGMC 4BSVB 3LHPH 2A0LD 1FVEA 3MMEB 2R29H 4H1LB 2EKJA 3OPZH 4TSBH 5DK2B 3IDYB 3G6JF 3E2HC 1CU4L 3K2UL 2V2WB 4XH2B 4OCYH 5T5NG 1AR1C 4KDWA 3UTSB 1X4ZA 1I7RA 2G2RA 1KUMA 4X7DC 3AM8A 2XKUA 3SHSA 4AY0A 3LB6C 4QRPD 1J0ZA 1IEBB 3UZEA 2X7LB 2ESVD 1YZZA 3DYOA 3SCMB 4U7KA 5C0IB 2AJZA 3NTCL 1A9EA 1RY7B 2WSKA 1VFUA 4NZRL 3W0WD 3RGVA 4RFOH 1FGNH 3GI9L 1QQDB 4BH8B 1ZS8A 1I9EA 1FYHB 2D4DA 3RPIB 3HNVH 1G9ML 3C09C 2CSPA 2VR9A 1RK0A 3T77B 1RJYB 2BVPA 1J5OH 2DTML 3HI5L 4P2OA 3SGDH 1UEYA 4FZEH 4KI5C 4Y19E 3MXWL 3D0VA 1KTRL 2DRUA 3LY6A 3P40A 1A6WL 2FO1A 5CHNA 1UWGH 4HF5H 4XNUH 1RURH 4HWZB 5TGBA 1OF2B 5I15L 4GUPA 5C0RL 3ARQA 3K8LA 1I9IL 4X4XA 2X9YA 4S1RL 3VRJB 2G60H 1UH3A 3CPLB 4DN4H 1IEAA 3QUMB 1YEIL 4RNRA 3DIFB 3VRLE 3WFBL 1HWGB 2AK4D 1QHOA 2B8OT 8CGTA 3O8XB 3L6FB 1F02I 5IMMB 3QUMH 2DWDA 2W07A 5IG7A 1WAAF 2ORBL 3L3JA 2LE9A 1UM5L 1A3LH 4LAQL 2WBJB 4OSUL 5ESAA 3LH2L 4LASH 3ZTJH 4M6MH 4WDIB 3VXQA 1G9NH 2ICWJ 3S34L 1JBJA 3DX9B 1SY6H 4Z0BL 4F80A 4YIQB 5A1AA 2GTWA 3MJGX 1KPUB 2W0FB 2HLFC 5BOPA 4NRXA 2WQ8A 4HJGB 4GH7B 5BOZG 4ZPTB 1RUPL 5C07A 1QSFE 3FL7A 4PJBE 3VFUA 3MXWH 3ULUF 2CO7B 5IB3A 5GGVH 1E6OH 1KXTB 3VG0L 4G5ZH 3EOTL 2IADB 2WIIB 1GVIA 5HHME 1GC1C 1UCBL 1R0AL 2DKSA 3G6AB 4ONOA 1SY6A 1NJ9A 1MVFA 3U7WL 2RHEA 4G80A 3OGCA 1KTKE 3BEWA 2MQ0A 2VITB 3CFDB 1H8OA 1HN1A 4OT1H 5LQBL 1QSFD 3WJLC 2XQBH 2IWGA 4DKFL 4PJ5D 1D5IL 2P46B 3OAZK 5DRXB 5IQ9A 4BZ2H 4NC2B 2QSTA 1U8NB 5EU4B 5B39B 5AZEH 2VLRB 1U8LB 4OD2A 4F7CB 3G5ZB 3ULUC 4OF6A 4WY7L 3TO2B 5K93A 3C6LC 4YO0B 1MCKA 4QOKB 5DD1L 2EEDA 1QVOA 3ARRA 2VUOA 4MA3B 1T20A 2HT3C 43CAA 5DHVB 2YUZA 4AEHH 3LHPL 2AV7A 5I17B 1OARH 1P7KB 3EUUA 1WTGT 2FD6H 3DMMD 3DBXB 3B2UD 1M71B 5IMKB 4PJXF 5DTFA 2NZ9C 1NFDA 4UV4L 4NN5B 4OLWH 1TJIH 5E2VL 1XIWA 4JG1H 1CL7L 1B4RA 1GGIH 3QEQB 2HG5A 1AGBB 1HK6A 1XGYL 1Z5LA 4ZTOH 4OI8A 3MLWH 4WI3A 4HS8H 4GBXC 4OD3H 5C0JA 1TTUA 4DFHA 4EDWH 2OYPA 3KVQA 2NY6B 2YD6A 4NQVA 2FDBP 4OLUH 5BZDA 1MCNA 5E8DH 1FZKB 4Y5XC 4HKZA 2FHFA 4M7KH 3TIDB 5F7WC 4KK9C 3SGDI 5IWLA 2EYTB 5DVNA 3WL9A 5ACMA 3QG6A 1DQDL 1NUGA 4OLXH 4XZUA 2CDFA 4ZSOA 1K8IB 4R4BA 1LHZA 5C8JA 5J12B 5HHNA 3F12B 3MJ8B 4NQDA 1K6QH 4U1NA 5GRJL 1PSKH 3O2DL 3UC0L 4OLVL 5BRZD 1INQB 3RNQA 1NMAH 3ILPA 3KYNA 5HI3C 3SPVB 1OAYL 5ICXB 3V6OC 1DBAL 2EDDA 1HHKA 3I6KB 1ZLVH 5IJKC 5F6IC 4Y2DA 1MJJA 2DMBA 4Z7UB 2CKBB 1MRFH 3VMNA 4DTGL 4TUKH 3MLUH 1RJYA 3VD3A 3FT4A 3CZFA 2BOBA 3FRUA 1D5MA 4OQ1A 5BRZE 1QQDA 4U05A 1DQLH 4PRHA 1CIDA 4Z7QF 3KPOA 3VE0B 1AXSB 2AV1B 3KPLB 5EH1A 1QFWI 5SV3A 3IDYC 5I1AA 4FMFA 4PJ5E 1FL5B 3BPNB 3INUH 3EOBA 2WP3T 3AS0A 4S10A 4P9HL 5C09A 5C70A 3NZHL 4LSRH 4JKWA 4R7DA 1FFQA 2DQFB 3NACH 1KJ2B 4L8DA 3NMEA 4KC3B 5I71B 4I18B 4L3CA 5DQJA 4YK4B 1YDPA 1T5WA 3VH8G 5K59F 3VFRB 4OZIF 4DZ8A 1X5AA 4LK4A 2VDQH 4O5LH 4L1HA 2CIIA 12E8L 3WFEH 4NYLB 4C83A 4UTBH 3SJVA 1LK2B 1JN6A 2WM0A 1ZVHA 3DX8B 3ZKSD 2X40A 3F8UB 1T2QL 1NGZA 3BZ4A 4XVTL 3P4NA 2CRMA 1G7QB 1TPXB 4UQ3B 3MV9D 4JZOA 3VG0H 1GC1L 4NQCA 2Z35A 5JPMA 1NEZB 4F7PA 2PYED 3PXHA 4OLVH 5E6ID 4OBRA 5IB2A 3JV6B 1BJ8A 1BX2B 3DRQA 5I73B 1ORQB 1K85A 4X80L 3OKMA 2NW2A 4G9DB 3SGEH 3MQIA 5ICYA 5ITFA 4LEXH 5C07B 2V2XA 3D0LB 2Y1VA 3I50H 4RISH 5DMJB 1CDGA 1JZ6A 3D18B 2VOTA 2VDPL 1TETL 1W72A 2ZOKB 3S96A 1G6RH 2BDNH 1EVUA 4IS6B 2WP3O 4L9LB 4HUUB 1DCLA 4ODXA 1J0IA 4KRNA 3BZFA 5IFJA 5H94B 1NUNB 3HZYA 5HI3D 3MRHB 4MJ2A 3SDCC 4E41D 3UJJH 5F72S 3MYZA 1S7VB 1EO8L 2C26A 5DURB 2WAHA 3CLFH 1JNLL 3I6KA 4WFED 5D71L 2DJUA 4XCNA 5C3TA 4W4NA 1FH5L 1CD9B 1YN7B 1UWGL 5HGDA 2D3VA 3MNVA 2W92A 4LF3B 4P2OC 2VXUL 4ONFH 4YBHA 1TJIL 5E2VH 4P4KB 32C2B 4NZUL 1U36A 3BPNC 4P59H 3O45B 1PFCA 4PIRF 4PJ8A 1RIVH 1T1ZB 1OF2A 5CP7B 3FO1A 5DQDL 3IJHB 3ET9F 1CE1H 4GAGL 5CHNB 3GK8H 4CKVX 1A47A 4U2ZA 2BSTB 2I60L 4C56A 1TIUA 4P57A 4JY4A 3HNSL 1OM3L 4PJEB 1UB5A 3ZDYF 4HKZB 1CL7I 5A2FA 2JF1A 4IRSA 3H3PH 4NQSA 5A2KH 3Q6FB 2DLTA 4HH9A 5FYKU 2H2SC 3S7GA 5JHDB 1GOGA 3I75A 1CWVA 3SY0A 5F89B 1D5IH 4LLQB 2JB5L 4LPWA 5K59E 1Q9KA 1S9XA 3V7AG 4F9LC 3ARGB 2YPKA 5ID1B 3A6BL 5E8OA 4X9IA 4TRPH 2Q76A 1OPGH 3C8HA 4OZGF 3TZVA 5KS9B 4ZTPH 1JGVH 5KOVC 5C6PB 5HHQA 1H8SA 3UJTH 1RIHL 4TSAH 3ZL4H 4RBPK 5CJBA 5D7LA 3BZ4B 4J8RA 1R3IH 5EFIB 4ALAL 4APQB 5E5MA 2Y07L 4YZFE 4WCYH 4G9FE 3MV9E 4WW1A 5KSAB 3DUSA 2MKLC 5JUEH 4KK8D 3IDGB 1AQDB 3BKMH 5ESVB 5EZIH 2B2XH 4LCCC 4MLSA 1J18A 3STZA 4J3TA 3NCBB 1SEBB 2I27N 3BSZL 4QHUA 4BM7A 1FSKC 2XACC 4BZ1H 5CD3A 3Q0HA 2VERN 4XVUD 2X4TA 3QNZB 1T1XA 4ONGL 3BEWB 1KENH 4D9LH 5MEOB 4X5XA 4EUPG 1TCRB 4PJ7B 3QEHA 1MCWM 1MFNA 3H9SA 1JGDA 2ARJB 4ZOEA 3V4PH 3W39A 1HQ4A 2VISB 3O4LB 5EB9A 1GC1H 3TO4C 3NFPB 4WNQB 3TT1L 1LVEA 5E5RB 4TVPH 3CFCL 5HVWA 5JZ7C 4ZFGH 2OTWA 2IC2A 2OR9H 3OXRA 1CGSL 4LKXB 3MLWL 1NC4A 4HMEA 5CGYC 2AGJL 5ESQA 4LOUC 2AQ2A 3OAYH 4CN6A 5FECA 1KCVH 1CGXA 4Q2ZB 2X4NA 4OV5A 4NQSB 1Y18B 1J5OL 3O4LD 3Q1SL 4C55A 2VDNH 4KHTH 1Z9MA 3D1MC 4P48A 4Y2DC 5DJ8A 4B53A 4GLRH 2X09A 4G7VL 2NPLX 1W72H 4X6DF 4OLEA 4ZQKB 2D03L 5HHXH 1DQJA 2IH3B 2ZZUT 1NC2B 3ZKMC 2AJ3A 1XT5A 2F54E 4WI8A 2ITCA 1A3QA 3PWPA 1SJXA 4PJ8B 4X6FB 3ULVL 2G9HA 3BN9D 3DURB 4XGZA 3HR6A 2V2TA 1JIBA 3GSWA 1X4YA 3GMLA 3OF6D 4D8PA 2VXVH 4PGZA 3UROR 4MQ7A 2B1AL 4Q9RH 3R8BB 1KIQA 4G42A 4P5TD 2R29L 3CDGA 2F19H 4U1GB 3ZDZF 1GCFA 3MRPA 1S7UB 2H1PH 1VADB 3DI2B 4HKBA 1SQ2N 2MCG1 2R9HC 1FC1A 2PXYD 4KROD 4HWUA 3U0PA 2G9HB 4NQED 1DN0A 3BAEL 3NCYP 3HE6B 4XPFH 3RY6A 3REWB 4E5XA 1BZ7B 5DI8A 4K8RL 4UIKH 5IM7B 1NUFA 3G6DH 4LCYA 5JLZA 4GRLB 1DVFA 5C07E 4JY6A 4JO2H 2VSCA 5CGTA 2NR6C 1IAOB 3DO7A 3U30C 3HZYB 1ACYH 1C5CH 2DLFH 5DD3H 4MD5A 3WN5C 4GQ9H 4DW2L 1YEFL 4HJ0D 1F4XH 2NY5H 3F5WA 4GQPH 4OFPA 4XP4L 3MO1B 3HE6D 4BZYA 5I17A 4OUUA 4J3SA 3GMPA 5D7IF 5AYUH 4HPYH 3V6ZA 3TESA 1VFMA 3O6KL 1YYML 5DJ2A 4P5KA 4U1KA 3UTPE 2I07B 2CK2A 4DCQB 3MRKB 1F6LL 1AC6A 2XZAH 1FRGL 5C0DA 4I3SH 5C92A 5B39A 4G8EA 1CICD 1MLCA 2EDNA 5BXFB 3KNBB 3DYMA 1JPGB 4XVSL 1R3IL 3G6JE 4M43L 1U8HA 1OTSD 5KW9H 5GS1A 2O61A 3EDJA 4L1DA 1MEXH 4S2SB 4UV4H 5KSUB 3GB7A 4I9WE 4NRZB 3MBXH 3MRFB 3QEUA 5TQ0H 5FYJL 4ONHB 4S1SH 2Q76B 4DN3L 4QHNB 3HC4L 4EN3D 2KH2B 1P84J 1G7JB 1GGYA 1MUJB 1SEQH 4RFOL 5L2KE 2JJSC 2QV2A 3OXSA 2OCFD 1BQHG 1S9XB 3SDYH 4NT6B 1Q0YH 4NQXA 2PYFA 3WNPA 3L5JA 4WI6A 5GIRB 3RTQA 3U83A 2AW2A 1G7IA 4OZHA 3QZWB 4F7EA 4ELMB 2KPNA 4YIQA 4ODVL 3DVNB 4XPBL 4MJ4A 3ZYIA 4F3FB 5D7JB 3QPQD 1I4FA 3EJZD 5DF0A 5F3BA 1UXWA 3BH9A 2IFFL 2ZUQC 1CCZA 2DQIL 3S4SG 1OGAB 2BHUA 1MWAH 3EZ8A 4MAYC 4K3DH 4MA8H 1T04B 5EU3A 4H26B 1YY8B 4G5ZL 4PRHB 3FQNA 3VXTA 4U7SA 5L7XH 3VJ6B 1SHMA 1U95A 1UJ3A 2P5EA 3LKOB 2YD1A 4QHMB 2E6QA 3GSUB 4NQDB 1LP9B 2HVJB 4FQJH 3LB6D 4NN7B 1YN7A 2RCSL 1MJUL 3QQ3A 1QYGL 3VXUE 5SX4H 3OR6A 4ZXBC 2BNUB 3L7EA 5D7KE 4G8GE 1OGAD 2P8MB 3ARBB 4HZLA 5E4EB 4QEGA 2R4RL 5J3HD 1AP2A 5JHDE 5DUBB 1IFHL 2G5BA 1T7VA 1WGOA 1Q38A 2Y23A 2G75A 1WEJH 4L29A 1ITCA 2E9BA 1OWRM 1KACB 1I1YB 2V5MA 1WZ1H 2JIXD 1A9EB 1NMCB 1F00I 1XR8A 3QHZL 3L3HB 4AIZB 3P9WB 1N7ML 5H2BB 1RULH 3MLTA 3OX8B 5F9JB 3D25B 3MGTB 3RA7L 1AFVH 4Y4HC 35C8H 4MAYB 4BZ1L 1B90A 1U41A 3PP3K 3O9WC 4L4JA 2BCKA 3B2UC 4LCUA 2G60L 2H32A 3JZ7A 2OJEA 1ONQB 4RZCA 1WWCA 3F58H 1XH3B 4MCYB 3DX7A 4HK3N 2HG5B 5EBWB 1IM3B 2V9RA 2FSEB 4Q9QH 1INEH 3CCHB 5C0AD 1AO7B 4M4PA 4ZFFB 4U1LB 3MZTA 1JF1B 4OZGA 4DKEL 3QDGB 4R7NB 4KDVA 5EO9B 3ARFB 2YC1A 5I75C 2P5EE 1TXKA 4QHNA 3QDGE 4M7ZC 4WU5A 5JXEC 3JWDL 1LE9B 1NKOA 4MLIA 1U93B 1K8DB 1WTLA 4NRYA 2VXSL 4DOHB 2YWZA 1N5AB 1FNLA 1I1AD 4RMTA 1B0GB 3IETA 3AGVA 1U93A 2KKQA 5CZXC 3S35L 4LSTL 3TFKD 4OJFH 5E00B 5J13B 4I48B 4XCCH 3LKSA 5IT2H 1U8LA 1CFQA 3HNTL 2NX5D 4IBLT 1AQDA 3JWDC 2E7LA 3SDAB 4ORGA 3TYGH 4LSSH 1FGVH 4P59L 2VITA 3CFDA 2BVTA 3FT2B 1JGUH 3KPPA 3ULVC 1CLOL 4W6YB 1N59B 3N06B 3I85A 3T8XA 1S9KC 1AXSA 4OFVA 4W4OA 3MBEB 4M7LH 4Q9QL 2YXFA 3BYYA 3HUJA 1AGDA 5FHAH 2EKSB 3T0AA 1XGUB 3RU8L 3DHMA 4DTGH 5F6HI 3ARZA 4LLVA 1GGCH 2AJXH 4AT6B 1GXEA 2A77H 4KGLA 2NYYD 1U8MA 3HZKB 4AYFA 5E24E 5EWIL 1AI1L 2EIZA 1AHWA 3L3HA 3IXTA 4F2MA 2NQCA 4G8GD 3GO1H 5J6GB 4HH9B 4Z7VB 1QA9A 1ZK9A 2HLAA 2NXZD 4OIIL 4PBVC 3DNKA 5FUZH 1VERA 4KQ4L 5DMIH 3RVUD 5IVXF 3L3JB 3ALXA 4ELKA 1XF5A 3BKJH 2QHRH 4X9FA 5TE6H 1EZVX 2AXGA 3E6FA 5SX4I 2A1WL 4M6NH 1S9WA 2VSDA 5HYIA 4X83A 2NNAA 3HAEG 1S3KH 5IKCA 3S88H 2FATH 1UZ8A 4JFDE 4RNRB 1XGPA 4AMKL 3B9EA 4BQCA 3QQNA 3NOIA 3HFMH 3C5ZD 3BVNB 4N9GA 2ITCB 2DQGL 3RDTB 4BFGA 4FG6D 1N2RB 1QRNB 3WIIL 2VABB 1SJEB 2GTZB 4OM1H 4L8CA 4HF5L 5CUSH 2EIDA 4MCYA 3X3FL 3BWUC 3BH9B 3DPBA 1X5FA 4JZNB 4HIEA 1UC6A 3AB0B 3RDTC 3RWEA 4LPCA 4OZIE 2GT9A 4A2LA 1OAUL 1SJHB 2BNRE 4HUUA 1FYTE 4KTEH