2R57A

Crystal structure of the two mbt repeats from sex-comb on midleg (scm)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
molecule keywords Polycomb protein Scm
molecule tags Transcription
source organism Drosophila melanogaster
total genus 51
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r57A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r57A01
2IG0A 3P8DA 5D6WA 3FDRA 5CIUA 5J39A 4PL6A 2G3RA 3E9GA 3H8ZA 3OYAA 2RJEA 2XK0A 4BACA 3EAEA 3PNWC 4IUVA 2BIVA 4C5IA 3OYHA 4L59A 2M16A 1WJSA 3SD4A 1KHCA 3QBYA 3MEAA 2CKKA 2EFIA 2RO0A 4NS5A 3PFSA 4ZTJA 2K3XA 3NTKA 4OVAA 3L2RA 4B9XA 3MEVA 3MP6A 3OMGA 3OY9A 5IN1A 5D6XA 2GFUA 4RG2A 2GFAA 3OYDA 4BE0A 2R57A 3S6WA 3NTHA 4A4HA 2R5MA 2RHZA 4X34A 3LGLA 2K3YA 5KE2A 2GF7A 1OZ3A 2X4WA 3OYCA 2LRQA 1OZ2A 2JZ2A 2R58A 4BE2A 4QQGA 2M1HA 4N4HA 1OI1A 3OYBA 3OYGA 4C5HA 2DIQA 4IUTA 4IUUA 3L2WA 1RI0A 3P8HA 2O4XB 4IUQA 4A4FA 2LCCA 4B9WA 5KCOA 3OYMA 3BDLA 2X4XA 4EDUA 2RI3A 4PLIA 5M9OA 3F70A 5FRNA 3PMIA 3M9QA 2L8DA 3OYFA 4Z02A 3QKJA 3MEUA 3L2VA 5KH6A 3OYEA 2O4XA 3OYIA 1N27A 3KUFA 3UWNA 3L2QA 2EQMA 4IUPA 4LD6A 5KCHA 1H3ZA 2D9TA 2L3RA 2R5AA 2RHIA 5FROA 3FC3A 3OS2A 3GOXA 5FRMA 3Q1JA 4BD3A 1WJRA 5KE3A 2LTOA 3L2UA 4UC4A 2QQRA 1G5VA 2FHDA 3OYKA 2RJCA 2MWPA 2RI5A 2VYTA 3LH0A 3MP8A 4FL6A 4QW2A 2MWOA 5D6YA 1XNIA 2F5KA 3DB4A 2E5QA 3L42A 3S3NA 2RI2A 2EKOA 3META 2LDMA 4C5EA 1MHNA 4BDZA 2EQUA 4CRIA 4BDYA 4GY5A 3QJ6A 4QQDA 2DAQA 4N4IA 2EQJA 4ZTFA 3DLMA 3LYIA 4IURA 2BUDA 5IAYA 4E7IA 2WACA 2EQKA 3S3MA 2E6NA 4A4GA 3OS0A 4QQ6A 2YRVA 3OA6A 2HQEA 2JTFA 2NLUA 3QIIA 3MP1A 3LGFA 3OB9A 3FEOA 3S3OA 3O8VA 2L89A 4A4EA 5C6SA 4II1A 3PMTA 4QVZA 4E7KA 2QQSA 5J26A 3NTIA 4BE1A 2X35A 3FLGA 2RHUA 3OMCA 2XDPA 2M0OA 3ME9A 1WGSA 4E7LA 3OYNA 3OQ5A 2LVMA 4Q5WA 3ASKA 3OS1A 3OYLA 1SSFA 2B8AA 1WJQA 2DIGA 2BKDN 2X4YA 3DB3A 4PLLA 4HCZA 2P0KA 3UT1A 4C5GA 3OYJA 3LX7A 4E7JA 2RJFA 3C4SA 2RHXA 3MEWA 5C0MA 2RHYA 2RJDA 4E7HA 4N4GA 3ZEHA 4FU6A 3E9FA 2HQXA 2PQWA 1OYXA 3H6ZA 3LLRA 3CEYA 3MO8A 4IKFA
chains in the Genus database with same CATH superfamily
3JB9D 3G6EA 5CKFA 2MPXC 3REBB 3OYAA 1QKWA 2K2MA 5I2MA 2QEXA 4ATOA 2DERA 1N8RC 4J6WA 2RO0A 3HTRA 4NS5A 1VQ5T 1RL2A 3TU4K 5LJ5g 2AKLA 4LN2A 3I56T 1NEBA 1TUGB 4M7DD 4RTXA 1AWWA 4FYVB 3RKYA 3CCRT 3JCMe 1W1FA 2LNVA 1VQ4Q 3OYCA 3NHNA 2RQWA 1UHFA 1WQ7A 4M77G 2FVUA 3MPUB 1RI0A 3P8HA 1LNXA 1UGQB 2YRDA 1YJ9T 1FXXA 3CPWA 3L2QA 1ACMB 1V1CA 1M3AA 1YJNQ 4L6V5 1T0HA 3GOXA 2DXTA 1X6OA 1YP5A 2CUDA 3HKSA 1K76A 4LDUA 1W6XA 1SG5A 1QWEA 1SRMA 3L2UA 1G5VA 2ABLA 3CCLQ 3CXCP 2DKGA 1VQ4T 1QVPA 4N4IA 5GMKj 3ZBDA 1QVFP 1Z9ZA 4A4GA 3AT1B 3ER0A 2KSSA 1JXOA 1V76A 2XU8A 2HQEA 5GAOp 3EG9B 2DTHA 3PTAA 1NZ9A 1ZBXA 1S72A 4BY6C 1YJNT 2JMAA 1BYMA 2Z0WA 3AHUA 2CSQA 4KGZB 1M27C 3MCAB 3CCLT 5AYFA 1K73R 3MEWA 4C8QB 4F7UA 3JCMc 3GNGA 2LQWA 2PTKA 4AT1B 2EIFA 2HL3A 4EMGA 3JV3A 4JRKA 4IKFA 5CIUA 4NOYA 5LJ5h 2DEUA 1KC8C 1QKXA 2P0QA 1G3WA 3JCMQ 1NLOC 4ZTJA 5GANj 4M7AG 2X3WD 3SWNC 2DILA 3QG1A 4LUEA 1K4US 2XD0A 3BE3A 2J6KA 2IVWA 3QUIA 3JCMf 2PVGB 1C0MA 3FRNA 5IH2A 4KUDK 1N8RR 1N9SA 3DKMA 4J83A 3JCMX 1G3TA 4AG1C 3TQ7P 1WYXA 5A0GA 3CCMA 1RAGB 4PJOF 3G71A 4BI3A 1T0JA 1I0CA 1ZSZC 2HAXA 3VKIA 2ECZA 3A1PA 4KT0E 2QQRA 3CC4Q 1IRXA 1MHNA 4FIBA 1VQ8Q 4DQ2A 3WVDB 1MMAA 2C0IA 1I4K1 3CBPA 3PVLA 4E7IA 3QXEB 4XU3A 1VQPA 2I2LA 3VS2A 2MIOA 3QDRB 5KYUA 1AWOA 1H92A 1RAEB 4ESRA 3CCQA 1O9SA 4HCCA 4BE1A 3HPWA 3C94A 1D0YA 3ME9A 2LJ3A 3EGXA 1VQOQ 1BIBA 2O2OA 2HCKA 4Q5WA 1Q95G 4M77E 5FW9A 1VQNQ 1UGPB 1PRLC 4NL3A 1Q82U 3CC4T 2COYA 2JT4A 4XU2A 1VQ8T 4PJNA 1DJ7B 4PNOA 2AKKA 4PL6A 4QVCA 4C0FA 2OTJA 2DTOA 1MUZA 3R6OA 4OB0B 2K3XA 4OVAA 4EMKB 4B9XA 2ZPHB 1HD3A 4AFUC 2AZSA 1JEGA 3QWXX 4RG2A 2C0TA 1VQOT 2FRWA 3D7SB 1PNJA 1K1ZA 1KC8R 2V1QA 1VQNT 2DL3A 1M1KU 2HMAA 5GAN4 2CS7A 5L8RE 3CC2Q 1NJIU 2X4XA 5GAMd 4C92C 2JTEA 5HY6A 4M77B 2VUBA 1QVGA 1YJWA 1I8FA 3UWNA 2HSEB 5HK3A 1VQ6A 3G4SQ 3TSWA 2DF6A 5D7UA 2ROTA 1FMKA 2D9TA 2MAMA 3VS3A 4F7UF 4R0KA 5CR2A 4JS4A 1EZZB 4FSXA 3RIRA 2DNUA 2FHDA 2MWPA 4JJBA 2DETA 4C5EA 2LT4A 1GCQA 4BDZA 1M5Q1 4GY5A 4M75D 5CKHA 4PJOD 4FW1A 3LYIA 3M57A 4KBMB 5KYNA 4M7AE 3CC2T 2F69A 2KNBB 1TSFA 4N0AC 2CREA 4KRTA 1UHCA 3G4ST 4PFPA 4JZ3A 3M5AA 4M78C 3NTIA 2X35A 3JB9H 3HRTA 4LDVA 1KJWA 2KXDA 3UF4A 1QP3A 2X4YA 4ME7A 3CPWS 2P0KA 2E64A 1A0NB 1WHHA 2KQWA 3U23A 3LH5A 4XAXB 3MO8A 1M90C 2IG0A 4E2FB 3E9GA 3M0QA 2Y4YA 3EAEA 3PGGA 3V8JA 1NPRA 1TUCA 2HBWA 2JW4A 4JLGA 1T3SA 1BI0A 3L2RA 3SEMA 4QT7A 2FL7A 2GFAA 4M7AB 4GBQA 2DXBA 1V29B 3KXTA 2K3YA 1K8AU 3NPFA 3OYGA 4IUUA 1VQ5A 4B9WA 2YUPA 2B86A 4XTYA 2HD0A 1HYOA 3I56A 4LDWA 2HZYA 4OMMA 3CCRA 5KCHA 2MMPA 5GAMe 1F1BB 1IHVA 1AWXA 1UUEA 2R5AA 3FC3A 1I5LA 2RM4A 2JMCA 3OYKA 2CGHA 1AT1B 2K79A 3S3NA 5A0LA 2E5QA 1YJ9A 1JXMA 5FU6C 3H0HA 2EAYA 1Q81C 3OYYA 4DBFA 3M0SA 2EQJA 1RAHB 3HFOA 1MNEA 2CT4A 3V7RA 4QQ6A 1BI1A 1ZA2B 4MDXA 2JTFA 4O6JA 3MP1A 2KROA 4GLKA 3X26B 5AT1B 1BBZA 1PD0A 3PMTA 2DZ9A 4II1A 4QVZA 1YI2Q 2EW3A 3EG9A 2G6FX 2JN0A 1VQ4A 2DPPB 4AG2C 1IHWA 2VGMA 3ASKA 5LJ3g 5FLXE 2L3PA 3UT1A 3RNJA 4E7JA 2J05A 1CSKA 1XOVA 1SEMA 3ZEHA 2DJQA 3UDCA 4FCYA 1YCSB 1OYXA 1HXDA 2E6ZA 4C8QA 1SPKA 1YJNA 3VYGA 5IHIA 1M3BA 1MV3A 4XTZA 4L59A 2SEMA 1Q86C 3QBYA 4AFSC 2GTJA 7AT1B 1YI2T 3CCLA 4C8QG 2KI7A 1IZ6A 1ZX6A 1M90R 1GRIA 4X34A 1M2VB 4RCCA 4RG8A 3OW2P 1KD1U 1Y7XA 1VOMA 3CPFA 2JJ9A 3I55Q 4O5VA 3HHTB 3EGUA 2O31A 2A28A 3JRZA 3URGA 5I11A 1ARKA 2X4JA 2JOYA 3I9QA 4EMHA 1OPLA 4M78F 2XI9A 1R0CB 4C0ZA 2DZCA 4F14A 1W2BP 5LJ5d 1BCMA 4QKUA 1JRIA 2RHIA 4DBQA 4KH1B 5GAMf 2NUTB 2D8JA 2H3JA 3GNFB 3DB4A 3E2UA 2RI2A 2P84A 1MV0B 2LP5A 5EG2A 3I55T 4ZGJB 3DLMA 2DXCA 2BZXA 2XDBA 2W10A 1SKUB 1RLPC 4FYYB 3CQTA 1X43A 3O8VA 1SF9A 1ZA1B 2CSIA 1VQ9Q 1W4SA 5LJ3h 1TS9A 2EJGA 4DBRA 1Q81R 2V1RA 2NUPB 2M51A 4AFZC 2E10A 1QVGS 3ZL7C 3EHRA 2MCNA 4DOWA 2QGFB 3SB2A 2DX1A 5HKCA 1G8XA 3HL8A 2JTMA 2AZVA 4M7DB 3A8GB 3VYHB 3PT9A 3VUZA 4LD9K 2RJEA 4M75C 4PJOC 2CT3A 3OYHA 2QG9B 1H641 2CKKA 2LX9A 2CH4A 2QDYB 3MP6A 5CAIA 1VQ9T 1RADB 5I21A 3A8LB 3CC4A 2L0AA 2K5FA 3RUXA 3EFSA 2R57A 4EMKA 1GBRA 1VQ8A 3WXMB 4YTLA 5GAOr 2J6FA 1OZ3A 2L3QA 5LL6S 3SDZA 2ROLA 4QVDA 3CBMA 2CZ7B 1X01A 2KRSA 3OS5A 1Q86R 4KGVB 2O4XB 3EHQA 4C0GA 2V8JA 3QKJA 5KH6A 3CCJQ 1VQOA 1PCXA 3V8LA 3M0TA 3M56A 3CCSA 4M77A 3CMAQ 3RERA 1U8RA 1M8VA 3OS2A 1VQNA 3OSSC 1JQQA 2KK4A 1BK2A 1PKTA 1E6GA 2K57A 4P5NA 5LJ5e 2VVKA 5GMKl 4M78D 2MYSA 3P8BB 4ZTFA 2KVQG 3VS4A 3TVTA 3OA6A 1FX7A 4C8QE 2DTIA 1NEGA 2IIMA 2X3XD 1PHTA 4MMLA 4HCKA 1Z9QA 2QYZA 3CCJT 3OW2A 1YHQQ 3FLGA 1WDXA 3CMAT 1OV3A 1WGSA 4Y28E 2MK5A 4CC3A 2VC8A 3OS1A 4PJJA 4BDYA 4LE9A 4C5GA 2FG0A 3CC2A 3M53A 1O75A 2ED1A 1G2BA 1ZLMA 3H9NA 4CC7A 1UJYA 2HL5C 2V8KA 1D09B 2PQWA 3LLRA 3G4SA 1QCOA 1D0ZA 1W2BA 5J39A 1IO6A 1K9MC 2GGRA 3G7ZA 1N8RU 1RI9A 4AMCA 2K4YA 2VASA 2YLCA 1WHGA 2EFIA 3PFSA 2BZYA 4A63B 4F16A 1X69A 1HK9A 5FU7C 1YHQT 4WCIA 4JZ4A 2YXYA 3THKA 3OYDA 4A4HA 1K0SA 1KSWA 2HQHA 2GQVA 1UGSB 5GMKi 4J9HA 4M7AA 3PIPA 2OAUA 1FMVA 1X6BA 3ZFJA 4IUTA 1WHLA 3OYMA 3X20B 4J9CA 4LNPA 3KUFA 5IHKA 1KK7A 1HSQA 4RCBA 1YWPA 3L1AA 1IGQA 1X27A 2EYYA 1X75C 2RK1A 3VJPA 3VS5A 2YWWA 2Y90A 1OX8A 1H3ZA 1KQSA 1XNIA 1BI2A 4FSSA 4MZPA 1U1TA 2HSPA 2MI6A 2ENMA 5LJ5f 3H41A 1BU1A 2L5QA 2DLPA 1QWFA 4M75F 2E6NA 4EPCA 1FWZA 4CC2A 2QA4Q 2E5KA 5CK9A 2M9UA 2QQAA 3QYHB 2QI2A 4LUDA 1MMGA 3V8KA 4FYWB 2OTLQ 2RH2A 2EWNA 2DM1A 2BKDN 2DRKA 1KHIA 3ULRB 3RDVA 3CD6Q 1E7OA 2E70A 2DJZA 3CCVQ 4Z8AA 4PFZA 4M77F 2XKOC 3MJXA 1NPPA 3FJ5A 5KYXB 4FYXB 4C5IA 2LNHB 5IXFA 3TEEA 1NJIC 4C0DB 2KT8A 1B3QA 3CCSQ 2QA4T 1TU0B 4PJMA 4KH0B 2FPFA 1LPLA 2HKQB 2V8IA 2DD5A 2OTLT 2RA2A 1K9MR 5GAN8 4BE2A 4QQGA 2M1HA 1M2VA 4KUIA 3CD6T 2KY9A 1UG1A 1SHGA 3NMZC 2DIQA 2ZPIB 4MZTA 2VV5A 1PKSA 1YI2A 1X6GA 3CCVT 2M02A 4E7ZA 3OYFA 3EG0A 2EGAA 2AHJB 3CXCA 3VUBA 2KAFA 3J80E 3N5BB 5L23A 1R77A 2EGEA 1QVFA 2WSFE 2E65A 3CCST 3M4GA 3Q1JA 4MDWA 2A36A 3BFMA 2FO0A 3J81E 1B34B 4UC4A 5GAMj 2ZPBB 2PVDB 5D6YA 5GAN7 2F5KA 3L42A 2NUTA 4HVUA 5GANg 2BZ8A 5GAOn 5FWBA 2DAQA 1BI3A 5IAYA 1H3HA 3I5RA 1YWOA 1TWBA 3JCMV 3LGFA 1C1AA 1NYGA 1JU5C 2JNGA 4M7AF 1GCQC 5GJWB 3I55A 2KMTA 1UEBA 3OYNA 5KYWB 2K7AA 2LZ6B 2LVMA 1RACB 1I1JA 2GBQA 1VQMQ 2CZ6B 1D3BB 3NFCA 1XQHA 4OMFB 3IQLA 4OMNA 1SHFA 4RUGA 2KEAA 5C0MA 1WHMA 4JUVA 3M0UA 3M0PA 4L5GA 3BDUA 4XTWA 5GMKh 1U1SA 1UECA 3MHXA 3CCEQ 3MEVA 1C6VX 4ELYC 3CC7Q 1YBYA 3S6WA 5LJ3d 3NTHA 3R6NA 2LQKA 1ZUYA 4M7DG 4M77D 4PK4A 4PFOA 1VQMT 1OI1A 3QJYA 1VYUA 1NJIR 1TUDA 4A4FA 4IIOA 4HT8A 5FWCA 2COZA 1VQ9A 4ORZA 4A54A 2O4XA 4OMOA 2BE7D 1I81A 2QK0A 2EQMA 4IIMA 4E6RA 3A8OB 5IXBA 3PE0A 5FROA 5GAN2 3CCET 5FRMA 1WA7A 4BY6B 3BY7A 1AD5A 4BD3A 1W2BS 5GANh 5GAN6 3CC7T 1WXUA 2LT1A 3VRZA 3GLXA 4WF2A 4QQDA 5J3BA 1U06A 1BB9A 1OU8A 2BUDA 4D8KA 1D1CA 2JM8A 1CKBA 3EG1A 1K9AA 2KBTA 2O9SA 4Y92A 3I35A 4X9CA 2XDPA 4J8OA 3M59A 3GPLA 4B6MA 4LDXA 3SWNB 2XIDA 2ZAEA 1Q7YU 2PUKB 2B8AA 5DLOA 3LX7A 4HVVA 2VXEA 4E7HA 4FU6A 1M90U 5GAOl 3CCJA 1PG5B 2LC4A 2ESWA 2RF0A 3CMAA 4RKUE 2DL8A 5GAOq 1WHKA 3RMQA 4XQ3A 3C0CA 1KQSS 4M7AD 2DRMA 3E1SA 4RTVA 1Y96B 1UFFA 1ZSZB 5KYYB 2CP5A 1YCYA 4J9EA 3SFMA 4ZN1A 4R56A 2MOXA 3HP9A 4BB7A 1YIJQ 4C8QC 2F5TX 4HKEA 3GP8A 2DL4A 2K9GA 2CP3A 2XICA 5LJ3e 9ATCB 1NYFA 3HSBA 3BDLA 2OAWA 4EDUA 3QSUA 2YUNA 3H0FA 2EYXA 1YHQA 3JCMW 4Z02A 1IGUA 2FZGB 1YFNA 2BTTA 1OU9A 1T3LA 2JVVA 2LQ8A 4JDSA 2MF2A 2FPEA 4J6XA 1R0BG 2XMFA 3A8MB 3EG3A 1XJWB 2COWA 4C92E 1YN8A 2DE0X 4XTVA 3UA6A 1Q81U 3CPWP 1YIJT 1JO8A 1Y07A 5A2QE 1LVKA 2J7IA 2DL7A 2E3IA 2WSCE 5CQYA 5LJ5j 2E41A 2LX7A 3VS0A 1LOJA 2NLUA 3RESA 2L2PA 1GCPA 3CMEQ 4RTYA 1UB4A 3I5SA 4E7KA 4CI0C 4PJLA 2OJ2A 3PVQA 3TSZA 3TREA 4DA4A 1WI7A 4M7DE 2C06A 4KGXB 4J9DA 1PWTA 3KBGA 1TTHB 3RMSA 3SHWA 4E7LA 2KDSA 4JPBW 3OSVA 4KULA 3DB3A 3CXCS 4HCZA 2EBPA 2H3EB 4JRIA 4TVRA 1D1AA 1QVFS 4M78E 1RAFB 3JSCA 1SRLA 2E3HA 2FRYA 5D6WA 1QCNA 3H8ZA 5DM7R 2XK0A 5CO7A 4C92B 2AK5A 2DEQA 2BIVA 3SD4A 2H8HA 5KYXA 4J5YA 3CMET 3H0IA 4C0DC 1OPKA 3JB9J 2PUOB 4BE0A 2YLBA 4FT4A 4ZGEB 3HRSA 1VQLQ 5KE2A 1XTDA 2GF7A 2QDLA 2LRQA 1Y71A 3OYBA 3VU3C 2O9VA 1AWJA 2CDTA 3V7CA 5CKDA 4OF1A 2QA4A 1PRMC 5LJ3f 2J6OA 3QZ9B 3PMIA 4XU1A 4JRPA 4NL2A 2OI3A 4EMKC 4LD6A 2OTLA 1VQ7Q 4DEYA 5CCAA 4M78B 2LCSA 3CD6A 2EGCA 3X28B 2QXFA 4CC4B 3O5ZA 3QPHA 1FMWA 4FL6A 3CCVA 3JCMb 1VQLT 1B34A 2EJ9A 4CRIA 2VXFA 1M1GA 4IURA 4M77C 2WACA 3S3MA 4J6YA 5CQXA 1VUBA 2ZPFB 1ZBJA 2A08A 3QIIA 3FJPA 5C6SA 3M0RA 2DMOA 1X2QA 2JM9A 2KYMA 2P0PA 2PNIA 2FPDA 5J26A 2P4RA 2FEIA 3JCMg 2F2WA 1VQ7T 1WNLA 3M55A 4C8QF 4XTXA 5CKEA 4J9FA 2KRNA 4HA8A 5KYWA 2RHYA 1TOVA 1WHJA 1D3BA 2P4TA 2RN8A 1K73U 1U3OA 1I07A 1YITQ 3CEYA 1OQKA 4ANJA 1ABQA 1JB0E 2DK3A 3DLLA 4F17A 3VS1A 2M16A 5GJVB 2L3SA 1B7TA 4OMQA 2CP2A 3OMGA 3OY9A 1M3CA 2GFUA 1M8MA 1M1FA 2JXBA 1G3SA 2R5MA 2JS0A 2RHZA 5HK0A 2O01E 5GAN3 2R58A 2XG8D 3EFOB 2VGNA 5FU6B 4ELZC 1CKAA 2ED0A 2LJ0A 4IUQA 5KCOA 1KG1A 1EX4A 1YITT 3F70A 4XTUA 3OYEA 1Y57A 2ATCB 1PC0A 4A53A 1UJ0A 4LDYA 4D6WA 1VQMA 4M4ZA 4M7AC 3QWYA 2DXUA 1IXDA 4Z89A 2KE9A 1M9SA 1RAIB 4DOVA 1UGRB 3PIOA 2DVJA 3QO3A 4X9DA 1MMNA 1WXBA 3LH0A 3MP8A 1QVGP 6AT1B 5CKBA 2KXCA 4RMOA 1UE9A 2EQUA 4E47A 4RTUA 8ATCB 1X2KA 3EGDB 2QTVA 2EQKA 3JB9I 3CCEA 1VQKQ 3JCMh 3V7SA 2DA9A 3FEOA 3S3OA 3CC7A 4A4EA 4HXJA 2E1HA 2PZ1A 3EFRA 2CZ0B 1NBEB 3OMCA 2HBPA 4F7UG 2EQIA 4MZMA 1JJ2P 3VV0A 3OQ5A 3E19A 1UDLA 3RR6A 1AOJA 4F04B 3VRYA 5GANd 3SWNA 1TG0A 1Q82C 2O88A 1K9MU 1OX9A 5IT9E 4HCBA 1VQKT 2CUBA 4C8QD 1KHCA 1G3YA 1SSHA 2X51A 3L2ZA 1GFCA 2DYIA 1WPYA 2CP0A 2FZCB 2YHTA 1ZUKA 3VS7A 4RTTA 2YUQA 5IN1A 1Y96A 1AHJB 4V2SA 3JAME 2JS2A 1VYVA 1ZSZA 3GBQA 2QQ9A 5KYYA 1MGQA 4RTZA 4M75E 4N4HA 4PJOE 4XK8E 2NWMA 1KC8U 1QQJA 4A4KA 1M1KC 3C95A 5ECAA 4PLIA 5FRNA 3MEUA 3G1JA 2J06A 3JCMJ 2Y4XA 3HFNA 3M58A 4Z88A 2K5LA 2YDLA 2VWFA 2CYZB 5GAN5 3G6EQ 1AVZC 4OMLA 2QEXQ 5GMKm 2CP6A 5GMKe 1N5ZA 2F2VA 1RUWA 2RB6A 4DEXA 1OOTA 1ZHIA 2K2VA 4E7SA 4J9BA 3REAB 3QYGB 2D0NA 4VUBA 1S1NA 2FZKB 2RQUA 1ABOA 1VYTA 2LCLA 4M75B 4PJOB 2RPNA 3G6ET 2ZCFB 1YIJA 1OULA 2K5IA 2QAZA 1N6AA 5DLQE 3EH2A 2QEXT 1BCOA 3RKWA 1PSEA 1RLQC 2IPOB 2RQVA 3C4SA 1KFZA 2X9HA 2DYBA 2XDDA 2DBKA 1KQ2A 1WQWA 4J9IA 2G3RA 3QDFA 5GANe 5HCKA 1N9RA 3EG2A 1B07A 2AIRB 1WJSA 1OEBA 5A0DA 1AEYA 2XHCA 3MEAA 2RQRA 4C92A 3GF5A 2DO3A 4OGEA 2NUPA 1Q82R 1U5SA 3KFVA 2SRCA 4J7FA 1S72Q 2EVRA 4K11A 3X25B 3LW5E 4C92G 1OZ2A 1D0XA 2K6DA 4D8DA 1K8AC 3L2WA 1FYNA 4M7DC 1G83A 2KR3A 3CMEA 4JJNK 2RI3A 3JB9G 4M7DA 2FYKA 3M9QA 2L8DA 1GFDA 2HEQA 4F7UE 5LJ3j 1JJ2A 1BIAA 2OX7A 4R55A 2YT6A 1NM7A 4RTWA 4HVWA 4Y91A 2I0NA 2E12A 1WLPB 4JJDA 4N0AA 5KE3A 4OB3B 1M1KR 3OW2S 2EJFA 4M78A 1S72T 2EKOA 2HKNA 5EC7A 2GCXA 1GXIE 3QJ6A 2YRCA 1WX6A 1Q7YC 2VB6A 1W70A 1IREB 2YUOA 3OBWA 4M78G 5I22A 4JRQA 4X1VA 3QHSA 1M30A 2RQTA 1VQLA 1M2OA 3CCMQ 1PD1A 4FM4B 3GIBA 1I5OB 1VIEA 4FW2A 3G71Q 5FU7B 3TCJA 3CCUA 3JCMP 4F7UB 2DIGA 1LJOA 2KRMA 4PLLA 3OYJA 2A7YA 2C0OA 3M4YA 2RHXA 2RJDA 1LCKA 2FB7A 2HQXA 3H6ZA 2ZPGB 2ZGWA 3FDRA 2D1XA 1VQ7A 5GAMg 4BACA 2LMJA 1RAAB 3PNWC 4J9GA 3UA7A 5GANf 2EPDA 1PM3A 3C12A 2EYZA 1WXTA 1VQPQ 2W0ZA 1D1BA 5IHNA 2DL5A 2ZZDA 3CCMT 2RD1A 3G71T 3CCQQ 2KYBA 4ZGDB 3LGLA 4AFQC 2RK2A 1KD1C 2E4HA 5DY9A 1R8OB 3M54A 2K3BA 2DVEA 2GTOA 1JBMA 2ZPEB 2LCCA 3EFOA 3CBOA 2RMOA 5M9OA 2VKNA 8AT1B 4DBHA 1BKBA 4BUGA 2PU9B 3LWIA 1E6HA 3WVEB 2OTJQ 1PSFA 2JUFA 2D8HA 1QP2A 3FB9A 4ZNXA 2L3RA 1KQ1A 1WFWA 1VQPT 1K8AR 1WJRA 2LTOA 2CZ1B 3OBYA 4OGCA 2RJCA 1YITA 2VYTA 2KGTA 1TXQA 4MMKA 3CCQT 1QCFA 4HT9A 3META 2LDMA 4GLMA 4BI8B 2QQBA 4WTOB 5CVIA 1UGVA 5KYUB 3OS0A 2YRVA 4C92F 4JS5A 1MNDA 1UTIA 3EGDA 3OB9A 3EGXB 2BE9B 2QQSA 3JB9F 2RNAA 1M4ZA 1YJWQ 2F2XA 2OTJT 1VQ6Q 1ZSGA 4PKCC 3UATA 3RKXA 1Q7YR 2A3LA 1QW1A 3OYLA 2EYWA 1SSFA 1P92A 4OMPA 4M7DF 2RJFA 1VA7A 2CP7A 4BI4A 2WSEE 5GAMh 3E9FA 2AT1B 1EFNA 3LWHA 3P8DA 3A5ZB 2EYQA 2CH4W 4IUVA 2NYSA 2QASA 1WIEA 1KIKA 1RABB 4FT2A 1TH7A 3JCMd 1AZGB 3NTKA 3HRUA 4LXCA 2GNCA 5D6XA 1GBQA 3J7AF 1Y0MA 2LQNA 3A98A 1YJWT 3MKDA 1VQ6T 3RBBB 3A8HB 2YSQA 2D0QB 2X4WA 2JZ2A 2EKHA 3EH1A 1VQKA 1IB8A 1VIFA 3QZ5B 4C5HA 1Q86U 1NE8A 3L2VA 3OYIA 3T9NA 3NGPA 1N27A 1YNZA 1EIFA 4IUPA 2D6FA 1KD1R 1K0XA 3INZA 4EIKA 1ZQ1A 4J7IA 2QGGA 3CCUQ 1NG2A 2RI5A 4QW2A 2MWOA 4ZN3A 1GL5A 1NLPC 2M0YA 1AZEA 2DBMA 1QLYA 4OB1B 1WZOA 1ZUUA 4OP0A 1HJDA 3UPUA 1K73C 1KQSP 2L89A 1VQ5Q 2NUZA 2PVOB 1J3TA 4XU0A 3VS6A 3I56Q 2A0FB 2GQIA 2DD4A 2RHUA 4M75A 2M0OA 4PJOA 2A37A 2HDAA 3CCRQ 2V26A 3BW1A 2KT1A 3X24B 5GAOm 1H8KA 1WJQA 2LJ1A 2F1LA 2DFUA 3FIFA 3CCUT 1JJ2S 4C92D 1QMCA 1MMDA 4JLIA 4OB2B 4N4GA 4JJCA 2HNIA 4M75G 5I2SA 4PJOG 2QTXA 1YJ9Q
chains in the Genus database with same CATH topology
1HXDA 2E6ZA 4C8QA 3JB9D 3G6EA 1YJNA 3VYGA 1K9MU 5GMKh 1U1SA 4XTZA 5CKFA 3OYAA 5IT9E 4HCBA 5I2MA 2QEXA 1VQKT 4C8QD 4L59A 4ATOA 1Q86C 1KHCA 3QBYA 1N8RC 4J6WA 1G3YA 3MHXA 2RO0A 4NS5A 3L2ZA 1VQ5T 1WPYA 1RL2A 3MEVA 1YI2T 2YHTA 3TU4K 5LJ5g 3CCLA 4C8QG 3I56T 4ELYC 4M7DD 5IN1A 1YBYA 1Y96A 1AHJB 4V2SA 3JAME 3S6WA 5LJ3d 1IZ6A 3NTHA 3RKYA 4X34A 4RCCA 4RG8A 3CCRT 2LQKA 1KD1U 1Y7XA 3JCMe 4M7DG 2QQ9A 4M77D 3CPFA 2LNVA 4O5VA 1MGQA 3HHTB 4M75E 3OYCA 1VQMT 4N4HA 4PJOE 1OI1A 1WQ7A 4XK8E 3QJYA 3JRZA 4M77G 2FVUA 1KC8U 1RI0A 3P8HA 4A4KA 4A4FA 4HT8A 3URGA 1M1KC 3C95A 1LNXA 1UGQB 2JOYA 2X4JA 4PLIA 1VQ9A 5FRNA 1YJ9T 4A54A 4EMHA 1FXXA 3MEUA 3JCMJ 2O4XA 4M78F 2Y4XA 2XI9A 3HFNA 3M58A 4C0ZA 3CPWA 1I81A 3L2QA 2K5LA 2DZCA 2EQMA 3A8OB 2CYZB 5GAN5 5LJ5d 1JRIA 2RHIA 4L6V5 5FROA 5GAN2 3GOXA 3CCET 5FRMA 4BY6B 2DXTA 3BY7A 4BD3A 1X6OA 1W2BS 3HKSA 5GAMf 5GMKm 4LDUA 5GAN6 5GANh 3L2UA 3CC7T 2H3JA 2LT1A 1G5VA 5GMKe 3GNFB 3DB4A 2RI2A 3GLXA 2DKGA 2RB6A 5EG2A 4WF2A 1QVPA 3I55T 4ZGJB 1ZHIA 4QQDA 5J3BA 2K2VA 4N4IA 1VQ4T 3DLMA 3ZBDA 5GMKj 2DXCA 2BUDA 3QYGB 4A4GA 3ER0A 4VUBA 2KSSA 2XDBA 2XU8A 2HQEA 5GAOp 2DTHA 3PTAA 1NZ9A 3O8VA 2LCLA 4M75B 1ZBXA 4PJOB 1S72A 1W4SA 5LJ3h 4BY6C 2EJGA 4X9CA 3G6ET 1YJNT 2ZCFB 1YIJA 2XDPA 4J8OA 1BYMA 2K5IA 1N6AA 3M59A 3GPLA 5DLQE 4LDXA 3SWNB 2QEXT 2XIDA 3RKWA 1Q7YU 2E10A 3AHUA 2PUKB 1QVGS 2B8AA 1PSEA 5DLOA 3LX7A 3MCAB 3CCLT 5AYFA 3C4SA 4DOWA 3MEWA 2VXEA 3SB2A 4C8QB 4F7UA 3JCMc 4E7HA 3GNGA 4FU6A 2EIFA 5HKCA 1M90U 5GAOl 3CCJA 4EMGA 3HL8A 2JTMA 2XDDA 4JRKA 4IKFA 2LC4A 1KQ2A 1WQWA 5CIUA 3CMAA 4M7DB 3A8GB 4NOYA 3VYHB 2G3RA 3PT9A 4RKUE 3VUZA 5GANe 4LD9K 2RJEA 4M75C 5LJ5h 5GAOq 1N9RA 3RMQA 4XQ3A 4M7AD 1KQSS 4PJOC 1KC8C 3OYHA 1WJSA 3E1SA 5A0DA 1H641 2P0QA 1G3WA 2XHCA 2CKKA 1Y96B 2LX9A 3MEAA 3JCMQ 4ZTJA 5GANj 2QDYB 4C92A 3GF5A 4M7AG 2DO3A 3MP6A 4OGEA 5CAIA 1VQ9T 5I21A 3SWNC 3A8LB 3SFMA 1YCYA 4ZN1A 3CC4A 2K5FA 3RUXA 3EFSA 2R57A 3QG1A 4J7FA 4EMKA 4R56A 1VQ8A 3WXMB 3HP9A 4YTLA 4BB7A 2XD0A 5GAOr 4C8QC 3X25B 1OZ3A 5LL6S 4XTWA 3LW5E 2F5TX 3SDZA 1OZ2A 4HKEA 3CBMA 2CZ7B 2IVWA 3QUIA 4C92G 1X01A 3JCMf 2PVGB 3FRNA 3GP8A 3OS5A 4KUDK 2XICA 1K8AC 1N9SA 3DKMA 4J83A 5LJ3e 3L2WA 4M7DC 3JCMX 1G3TA 2O4XB 3HSBA 3JB9F 3CMEA 3BDLA 4EDUA 4JJNK 2RI3A 3JB9G 3QSUA 4M7DA 2FYKA 1YHQA 4C0GA 3JCMW 3M9QA 2L8DA 4Z02A 4F7UE 2V8JA 3QKJA 5KH6A 5LJ3j 5A0GA 3CCMA 4PJOF 1JJ2A 3G71A 1VQOA 3V8LA 3M56A 4BI3A 4M77A 3CCSA 1BIAA 2JVVA 4R55A 3RERA 2LQ8A 1U8RA 1M8VA 4Y91A 2HAXA 4JDSA 2E12A 2MF2A 3OS2A 1VQNA 4J6XA 3OSSC 4N0AA 3VKIA 5KE3A 2KK4A 3A8MB 4OB3B 4KT0E 3OW2S 2QQRA 2EJFA 2K57A 4C92E 4M78A 1S72T 4P5NA 5LJ5e 4XTVA 1Q81U 2EKOA 1MHNA 5GMKl 1YIJT 4FIBA 1Y07A 5A2QE 2GCXA 1GXIE 4M78D 3QJ6A 3P8BB 4ZTFA 4DQ2A 3WVDB 1Q7YC 2KVQG 1I4K1 2WSCE 3CBPA 2E41A 5CQYA 5LJ5j 4E7IA 1IREB 3QXEB 1LOJA 3OBWA 3OA6A 4M78G 4XU3A 2NLUA 1VQPA 1FX7A 2I2LA 2DTIA 4C8QE 4JRQA 3QDRB 3RESA 3QHSA 4MMLA 1UB4A 3CCJT 4CI0C 4E7KA 3OW2A 3TREA 4DA4A 3CCQA 4M7DE 1O9SA 4HCCA 2C06A 1VQLA 4BE1A 3FLGA 3CMAT 3KBGA 3HPWA 3C94A 4FM4B 3RMSA 3GIBA 3ME9A 1VIEA 1WGSA 4E7LA 4HT9A 5FU7B 1BIBA 3TCJA 2KDSA 4Q5WA 3CCUA 4Y28E 3JCMP 4M77E 2VC8A 4F7UB 3OS1A 3OSVA 4KULA 4BDYA 2DIGA 3DB3A 1LJOA 4PLLA 4C5GA 3OYJA 3CXCS 4HCZA 3CC2A 3M53A 2A7YA 1O75A 1UGPB 3M4YA 4NL3A 2RHXA 1Q82U 2RJDA 4JRIA 2V8KA 3CC4T 4TVRA 2FB7A 2HQXA 1QVFS 2PQWA 3H6ZA 3LLRA 4XU2A 1VQ8T 4M78E 1DJ7B 2ZPGB 3JSCA 4PNOA 3G4SA 1W2BA 2ZGWA 5D6WA 3FDRA 5J39A 4PL6A 4QVCA 4C0FA 1VQ7A 5GAMg 2DTOA 3H8ZA 5DM7R 2XK0A 5CO7A 4C92B 4BACA 1K9MC 2DEQA 3PNWC 2BIVA 3G7ZA 1N8RU 3R6OA 5GANf 2K4YA 4OB0B 3SD4A 2YLCA 3C12A 2EFIA 3PFSA 2K3XA 4OVAA 4J5YA 4B9XA 4EMKB 3CMET 2ZPHB 1HK9A 5FU7C 4C0DC 1YHQT 2ZZDA 4RG2A 3JB9J 2PUOB 3OYDA 3CCMT 2RD1A 4BE0A 4A4HA 2YLBA 4FT4A 4ZGEB 3G71T 1VQOT 2GQVA 4ZGDB 3HRSA 1UGSB 3LGLA 5KE2A 1XTDA 2GF7A 5GMKi 2RK2A 1KD1C 4M7AA 3PIPA 2LRQA 2OAUA 1Y71A 5DY9A 1VQNT 1R8OB 3M54A 3VU3C 3OYBA 2DVEA 3ZFJA 4IUTA 1M1KU 5GAN4 1JBMA 2CS7A 2ZPEB 2LCCA 5L8RE 3V7CA 5CKDA 3OYMA 1NJIU 2X4XA 4OF1A 5GAMd 4C92C 3CBOA 2QA4A 5HY6A 5LJ3f 3X20B 3QZ9B 4M77B 5M9OA 3PMIA 4XU1A 2VUBA 4JRPA 4NL2A 1BKBA 1QVGA 1YJWA 1I8FA 3KUFA 3UWNA 4BUGA 5HK3A 1VQ6A 4EMKC 2PU9B 4LD6A 3LWIA 4RCBA 2OTLA 3L1AA 3WVEB 1PSFA 2JUFA 3FB9A 1QP2A 2D9TA 1X75C 2L3RA 1KQ1A 2MAMA 2RK1A 4M78B 3VJPA 5CCAA 1VQPT 3CD6A 3X28B 1WJRA 2QXFA 4F7UF 2LTOA 5CR2A 4JS4A 2CZ1B 3OBYA 3QPHA 4FSXA 3RIRA 4OGCA 2Y90A 2FHDA 2RJCA 2MWPA 1YITA 2VYTA 1H3ZA 4FL6A 3CCVA 1KQSA 1XNIA 4MMKA 3JCMb 3CCQT 4C5EA 3META 1BI2A 2LDMA 1VQLT 2LT4A 4MZPA 1B34A 1U1TA 2EJ9A 2MI6A 4BDZA 4CRIA 5LJ5f 1M5Q1 2VXFA 4GY5A 4M75D 5CKHA 4BI8B 2L5QA 4PJOD 2QQBA 3LYIA 3M57A 4KBMB 1M1GA 4IURA 4M75F 5CVIA 4M77C 2WACA 3S3MA 2E6NA 4J6YA 5CQXA 1VUBA 2YRVA 4EPCA 3OS0A 4M7AE 4C92F 2ZPFB 4JS5A 3CC2T 2F69A 3QIIA 4N0AC 3OB9A 3FJPA 1FWZA 5C6SA 2P0PA 2M9UA 2QQSA 5CK9A 2QQAA 3QYHB 3M5AA 4M78C 5J26A 3G4ST 1M4ZA 2QI2A 3NTIA 3JCMg 2X35A 4M7AF 1VQ7T 2OTJT 1WNLA 3M55A 4PKCC 3RKXA 3V8KA 4C8QF 4XTXA 5CKEA 3JB9H 3HRTA 2A3LA 1QW1A 4LDVA 2RH2A 3OYLA 2EWNA 1QP3A 1SSFA 2X4YA 2BKDN 4HA8A 4ME7A 1P92A 3CPWS 2P0KA 3S3NA 2E64A 1KHIA 4M7DF 2RJFA 4QVDA 4BI4A 2RHYA 2WSEE 5GAMh 1D3BA 2E70A 2P4TA 3E9FA 2DJZA 1K73U 2KQWA 3CEYA 4XAXB 1M90C 3MO8A 4M77F 3LWHA 2IG0A 3P8DA 2XKOC 3E9GA 1NPPA 2Y4YA 3A5ZB 1JB0E 2DK3A 2EYQA 3DLLA 3EAEA 4IUVA 3PGGA 4C5IA 3V8JA 2M16A 1NPRA 3TEEA 1NJIC 1TH7A 4FT2A 4JLGA 4C0DB 3JCMd 3NTKA 1BI0A 3HRUA 3L2RA 2QA4T 3OMGA 3OY9A 5D6XA 2GFUA 2FL7A 2GFAA 3J7AF 4M7AB 1YJWT 1M1FA 2OTJA 1G3SA 2V8IA 2R5MA 1VQ6T 2DXBA 5HK0A 2RHZA 1V29B 2DD5A 4M7AC 2O01E 3A8HB 3KXTA 2K3YA 2OTLT 2RA2A 5GAN3 2D0QB 2X4WA 5GAN8 2JZ2A 2R58A 4BE2A 4QQGA 2M1HA 2XG8D 1K8AU 3OYGA 4KUIA 2VGNA 1VQKA 2KY9A 3CD6T 1VIFA 3QZ5B 5FU6B 4C5HA 4ELZC 2DIQA 4IUUA 5KCOA 4IUQA 1Q86U 1NE8A 4B9WA 1VQ5A 1KG1A 2ZPIB 4MZTA 2VV5A 1YITT 1YI2A 4XTYA 2HD0A 3CCVT 3I56A 3F70A 3OYFA 4XTUA 4LDWA 3L2VA 3OYIA 3OYEA 3T9NA 2AHJB 1N27A 3CXCA 3VUBA 4A53A 1EIFA 2KAFA 4IUPA 3CCRA 2D6FA 4LDYA 4D6WA 3J80E 5KCHA 3N5BB 2MMPA 5GAMe 1VQMA 1QVFA 2R5AA 3FC3A 2WSFE 2DXUA 2E65A 3INZA 3M4GA 3Q1JA 3CCST 4MDWA 1I5LA 1M9SA 1ZQ1A 3BFMA 4J7IA 4DOVA 1UGRB 2RM4A 3PIOA 3J81E 1B34B 3QO3A 4X9DA 4UC4A 5GAMj 3OYKA 2CGHA 2RI5A 2ZPBB 2PVDB 3LH0A 3MP8A 4QW2A 2MWOA 5D6YA 2F5KA 5A0LA 5GAN7 2E5QA 3L42A 5CKBA 4ZN3A 4RMOA 1YJ9A 5FU6C 2EAYA 1Q81C 2EQUA 3OYYA 4E47A 5GANg 5GAOn 2DAQA 2EQJA 1BI3A 3HFOA 5IAYA 4OB1B 2EQKA 3V7RA 3JB9I 4QQ6A 1BI1A 4MDXA 3CCEA 4OP0A 2JTFA 3JCMh 3JCMV 4O6JA 3V7SA 3MP1A 3UPUA 3LGFA 1K73C 3FEOA 3S3OA 4GLKA 3CC7A 2L89A 3X26B 4A4EA 2E1HA 3PMTA 2DZ9A 4II1A 4QVZA 2PVOB 3EFRA 4XU0A 2CZ0B 2DD4A 2JNGA 2HBPA 2RHUA 3OMCA 2JN0A 4M75A 2M0OA 4F7UG 3I55A 1VQ4A 2KMTA 1UEBA 4MZMA 4PJOA 3OYNA 2DPPB 3VV0A 3OQ5A 2LVMA 2VGMA 3ASKA 3BW1A 5LJ3g 5FLXE 2CZ6B 1D3BB 3X24B 1WJQA 3NFCA 3UT1A 5GAOm 1XQHA 4OMFB 3FIFA 3CCUT 1JJ2S 3E19A 5GANd 4C92D 4E7JA 4JLIA 3SWNA 5C0MA 1XOVA 4OB2B 4N4GA 3ZEHA 2HNIA 4M75G 5I2SA 1Q82C 4JUVA 3UDCA 4PJOG 1OYXA 4L5GA 2QTXA 3BDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IG0 A;  3P8D A;  5D6W A;  3FDR A;  5CIU A;  5J39 A;  4PL6 A;  2G3R A;  3E9G A;  3H8Z A;  3OYA A;  2RJE A;  2XK0 A;  4BAC A;  3EAE A;  3PNW C;  4IUV A;  2BIV A;  4C5I A;  3OYH A;  4L59 A;  2M16 A;  1WJS A;  3SD4 A;  1KHC A;  3QBY A;  3MEA A;  2CKK A;  2EFI A;  2RO0 A;  4NS5 A;  3PFS A;  4ZTJ A;  2K3X A;  3NTK A;  4OVA A;  3L2R A;  4B9X A;  3MEV A;  3MP6 A;  3OMG A;  3OY9 A;  5IN1 A;  5D6X A;  2GFU A;  4RG2 A;  2GFA A;  3OYD A;  4BE0 A;  2R57 A;  3S6W A;  3NTH A;  4A4H A;  2R5M A;  2RHZ A;  4X34 A;  3LGL A;  2K3Y A;  5KE2 A;  2GF7 A;  1OZ3 A;  2X4W A;  3OYC A;  2LRQ A;  1OZ2 A;  2JZ2 A;  2R58 A;  4BE2 A;  4QQG A;  2M1H A;  4N4H A;  1OI1 A;  3OYB A;  3OYG A;  4C5H A;  2DIQ A;  4IUT A;  4IUU A;  3L2W A;  1RI0 A;  3P8H A;  2O4X B;  4IUQ A;  4A4F A;  2LCC A;  4B9W A;  5KCO A;  3OYM A;  3BDL A;  2X4X A;  4EDU A;  2RI3 A;  4PLI A;  5M9O A;  3F70 A;  5FRN A;  3PMI A;  3M9Q A;  2L8D A;  3OYF A;  4Z02 A;  3QKJ A;  3MEU A;  3L2V A;  5KH6 A;  3OYE A;  2O4X A;  3OYI A;  1N27 A;  3KUF A;  3UWN A;  3L2Q A;  2EQM A;  4IUP A;  4LD6 A;  5KCH A;  1H3Z A;  2D9T A;  2L3R A;  2R5A A;  2RHI A;  5FRO A;  3FC3 A;  3OS2 A;  3GOX A;  5FRM A;  3Q1J A;  4BD3 A;  1WJR A;  5KE3 A;  2LTO A;  3L2U A;  4UC4 A;  2QQR A;  1G5V A;  2FHD A;  3OYK A;  2RJC A;  2MWP A;  2RI5 A;  2VYT A;  3LH0 A;  3MP8 A;  4FL6 A;  4QW2 A;  2MWO A;  5D6Y A;  1XNI A;  2F5K A;  3DB4 A;  2E5Q A;  3L42 A;  3S3N A;  2RI2 A;  2EKO A;  3MET A;  2LDM A;  4C5E A;  1MHN A;  4BDZ A;  2EQU A;  4CRI A;  4BDY A;  4GY5 A;  3QJ6 A;  4QQD A;  2DAQ A;  4N4I A;  2EQJ A;  4ZTF A;  3DLM A;  3LYI A;  4IUR A;  2BUD A;  5IAY A;  4E7I A;  2WAC A;  2EQK A;  3S3M A;  2E6N A;  4A4G A;  3OS0 A;  4QQ6 A;  2YRV A;  3OA6 A;  2HQE A;  2JTF A;  2NLU A;  3QII A;  3MP1 A;  3LGF A;  3OB9 A;  3FEO A;  3S3O A;  3O8V A;  2L89 A;  4A4E A;  5C6S A;  4II1 A;  3PMT A;  4QVZ A;  4E7K A;  2QQS A;  5J26 A;  3NTI A;  4BE1 A;  2X35 A;  3FLG A;  2RHU A;  3OMC A;  2XDP A;  2M0O A;  3ME9 A;  1WGS A;  4E7L A;  3OYN A;  3OQ5 A;  2LVM A;  4Q5W A;  3ASK A;  3OS1 A;  3OYL A;  1SSF A;  2B8A A;  1WJQ A;  2DIG A;  2BKD N;  2X4Y A;  3DB3 A;  4PLL A;  4HCZ A;  2P0K A;  3UT1 A;  4C5G A;  3OYJ A;  3LX7 A;  4E7J A;  2RJF A;  3C4S A;  2RHX A;  3MEW A;  5C0M A;  2RHY A;  2RJD A;  4E7H A;  4N4G A;  3ZEH A;  4FU6 A;  3E9F A;  2HQX A;  2PQW A;  1OYX A;  3H6Z A;  3LLR A;  3CEY A;  3MO8 A;  4IKF A; 
#chains in the Genus database with same CATH topology
 3JB9 D;  3G6E A;  5CKF A;  2MPX C;  3REB B;  3OYA A;  1QKW A;  2K2M A;  5I2M A;  2QEX A;  4ATO A;  2DER A;  1N8R C;  4J6W A;  2RO0 A;  3HTR A;  4NS5 A;  1VQ5 T;  1RL2 A;  3TU4 K;  5LJ5 g;  2AKL A;  4LN2 A;  3I56 T;  1NEB A;  1TUG B;  4M7D D;  4RTX A;  1AWW A;  4FYV B;  3RKY A;  3CCR T;  3JCM e;  1W1F A;  2LNV A;  1VQ4 Q;  3OYC A;  3NHN A;  2RQW A;  1UHF A;  1WQ7 A;  4M77 G;  2FVU A;  3MPU B;  1RI0 A;  3P8H A;  1LNX A;  1UGQ B;  2YRD A;  1YJ9 T;  1FXX A;  3CPW A;  3L2Q A;  1ACM B;  1V1C A;  1M3A A;  1YJN Q;  4L6V 5;  1T0H A;  3GOX A;  2DXT A;  1X6O A;  1YP5 A;  2CUD A;  3HKS A;  1K76 A;  4LDU A;  1W6X A;  1SG5 A;  1QWE A;  1SRM A;  3L2U A;  1G5V A;  2ABL A;  3CCL Q;  3CXC P;  2DKG A;  1VQ4 T;  1QVP A;  4N4I A;  5GMK j;  3ZBD A;  1QVF P;  1Z9Z A;  4A4G A;  3AT1 B;  3ER0 A;  2KSS A;  1JXO A;  1V76 A;  2XU8 A;  2HQE A;  5GAO p;  3EG9 B;  2DTH A;  3PTA A;  1NZ9 A;  1ZBX A;  1S72 A;  4BY6 C;  1YJN T;  2JMA A;  1BYM A;  2Z0W A;  3AHU A;  2CSQ A;  4KGZ B;  1M27 C;  3MCA B;  3CCL T;  5AYF A;  1K73 R;  3MEW A;  4C8Q B;  4F7U A;  3JCM c;  3GNG A;  2LQW A;  2PTK A;  4AT1 B;  2EIF A;  2HL3 A;  4EMG A;  3JV3 A;  4JRK A;  4IKF A;  5CIU A;  4NOY A;  5LJ5 h;  2DEU A;  1KC8 C;  1QKX A;  2P0Q A;  1G3W A;  3JCM Q;  1NLO C;  4ZTJ A;  5GAN j;  4M7A G;  2X3W D;  3SWN C;  2DIL A;  3QG1 A;  4LUE A;  1K4U S;  2XD0 A;  3BE3 A;  2J6K A;  2IVW A;  3QUI A;  3JCM f;  2PVG B;  1C0M A;  3FRN A;  5IH2 A;  4KUD K;  1N8R R;  1N9S A;  3DKM A;  4J83 A;  3JCM X;  1G3T A;  4AG1 C;  3TQ7 P;  1WYX A;  5A0G A;  3CCM A;  1RAG B;  4PJO F;  3G71 A;  4BI3 A;  1T0J A;  1I0C A;  1ZSZ C;  2HAX A;  3VKI A;  2ECZ A;  3A1P A;  4KT0 E;  2QQR A;  3CC4 Q;  1IRX A;  1MHN A;  4FIB A;  1VQ8 Q;  4DQ2 A;  3WVD B;  1MMA A;  2C0I A;  1I4K 1;  3CBP A;  3PVL A;  4E7I A;  3QXE B;  4XU3 A;  1VQP A;  2I2L A;  3VS2 A;  2MIO A;  3QDR B;  5KYU A;  1AWO A;  1H92 A;  1RAE B;  4ESR A;  3CCQ A;  1O9S A;  4HCC A;  4BE1 A;  3HPW A;  3C94 A;  1D0Y A;  3ME9 A;  2LJ3 A;  3EGX A;  1VQO Q;  1BIB A;  2O2O A;  2HCK A;  4Q5W A;  1Q95 G;  4M77 E;  5FW9 A;  1VQN Q;  1UGP B;  1PRL C;  4NL3 A;  1Q82 U;  3CC4 T;  2COY A;  2JT4 A;  4XU2 A;  1VQ8 T;  4PJN A;  1DJ7 B;  4PNO A;  2AKK A;  4PL6 A;  4QVC A;  4C0F A;  2OTJ A;  2DTO A;  1MUZ A;  3R6O A;  4OB0 B;  2K3X A;  4OVA A;  4EMK B;  4B9X A;  2ZPH B;  1HD3 A;  4AFU C;  2AZS A;  1JEG A;  3QWX X;  4RG2 A;  2C0T A;  1VQO T;  2FRW A;  3D7S B;  1PNJ A;  1K1Z A;  1KC8 R;  2V1Q A;  1VQN T;  2DL3 A;  1M1K U;  2HMA A;  5GAN 4;  2CS7 A;  5L8R E;  3CC2 Q;  1NJI U;  2X4X A;  5GAM d;  4C92 C;  2JTE A;  5HY6 A;  4M77 B;  2VUB A;  1QVG A;  1YJW A;  1I8F A;  3UWN A;  2HSE B;  5HK3 A;  1VQ6 A;  3G4S Q;  3TSW A;  2DF6 A;  5D7U A;  2ROT A;  1FMK A;  2D9T A;  2MAM A;  3VS3 A;  4F7U F;  4R0K A;  5CR2 A;  4JS4 A;  1EZZ B;  4FSX A;  3RIR A;  2DNU A;  2FHD A;  2MWP A;  4JJB A;  2DET A;  4C5E A;  2LT4 A;  1GCQ A;  4BDZ A;  1M5Q 1;  4GY5 A;  4M75 D;  5CKH A;  4PJO D;  4FW1 A;  3LYI A;  3M57 A;  4KBM B;  5KYN A;  4M7A E;  3CC2 T;  2F69 A;  2KNB B;  1TSF A;  4N0A C;  2CRE A;  4KRT A;  1UHC A;  3G4S T;  4PFP A;  4JZ3 A;  3M5A A;  4M78 C;  3NTI A;  2X35 A;  3JB9 H;  3HRT A;  4LDV A;  1KJW A;  2KXD A;  3UF4 A;  1QP3 A;  2X4Y A;  4ME7 A;  3CPW S;  2P0K A;  2E64 A;  1A0N B;  1WHH A;  2KQW A;  3U23 A;  3LH5 A;  4XAX B;  3MO8 A;  1M90 C;  2IG0 A;  4E2F B;  3E9G A;  3M0Q A;  2Y4Y A;  3EAE A;  3PGG A;  3V8J A;  1NPR A;  1TUC A;  2HBW A;  2JW4 A;  4JLG A;  1T3S A;  1BI0 A;  3L2R A;  3SEM A;  4QT7 A;  2FL7 A;  2GFA A;  4M7A B;  4GBQ A;  2DXB A;  1V29 B;  3KXT A;  2K3Y A;  1K8A U;  3NPF A;  3OYG A;  4IUU A;  1VQ5 A;  4B9W A;  2YUP A;  2B86 A;  4XTY A;  2HD0 A;  1HYO A;  3I56 A;  4LDW A;  2HZY A;  4OMM A;  3CCR A;  5KCH A;  2MMP A;  5GAM e;  1F1B B;  1IHV A;  1AWX A;  1UUE A;  2R5A A;  3FC3 A;  1I5L A;  2RM4 A;  2JMC A;  3OYK A;  2CGH A;  1AT1 B;  2K79 A;  3S3N A;  5A0L A;  2E5Q A;  1YJ9 A;  1JXM A;  5FU6 C;  3H0H A;  2EAY A;  1Q81 C;  3OYY A;  4DBF A;  3M0S A;  2EQJ A;  1RAH B;  3HFO A;  1MNE A;  2CT4 A;  3V7R A;  4QQ6 A;  1BI1 A;  1ZA2 B;  4MDX A;  2JTF A;  4O6J A;  3MP1 A;  2KRO A;  4GLK A;  3X26 B;  5AT1 B;  1BBZ A;  1PD0 A;  3PMT A;  2DZ9 A;  4II1 A;  4QVZ A;  1YI2 Q;  2EW3 A;  3EG9 A;  2G6F X;  2JN0 A;  1VQ4 A;  2DPP B;  4AG2 C;  1IHW A;  2VGM A;  3ASK A;  5LJ3 g;  5FLX E;  2L3P A;  3UT1 A;  3RNJ A;  4E7J A;  2J05 A;  1CSK A;  1XOV A;  1SEM A;  3ZEH A;  2DJQ A;  3UDC A;  4FCY A;  1YCS B;  1OYX A;  1HXD A;  2E6Z A;  4C8Q A;  1SPK A;  1YJN A;  3VYG A;  5IHI A;  1M3B A;  1MV3 A;  4XTZ A;  4L59 A;  2SEM A;  1Q86 C;  3QBY A;  4AFS C;  2GTJ A;  7AT1 B;  1YI2 T;  3CCL A;  4C8Q G;  2KI7 A;  1IZ6 A;  1ZX6 A;  1M90 R;  1GRI A;  4X34 A;  1M2V B;  4RCC A;  4RG8 A;  3OW2 P;  1KD1 U;  1Y7X A;  1VOM A;  3CPF A;  2JJ9 A;  3I55 Q;  4O5V A;  3HHT B;  3EGU A;  2O31 A;  2A28 A;  3JRZ A;  3URG A;  5I11 A;  1ARK A;  2X4J A;  2JOY A;  3I9Q A;  4EMH A;  1OPL A;  4M78 F;  2XI9 A;  1R0C B;  4C0Z A;  2DZC A;  4F14 A;  1W2B P;  5LJ5 d;  1BCM A;  4QKU A;  1JRI A;  2RHI A;  4DBQ A;  4KH1 B;  5GAM f;  2NUT B;  2D8J A;  2H3J A;  3GNF B;  3DB4 A;  3E2U A;  2RI2 A;  2P84 A;  1MV0 B;  2LP5 A;  5EG2 A;  3I55 T;  4ZGJ B;  3DLM A;  2DXC A;  2BZX A;  2XDB A;  2W10 A;  1SKU B;  1RLP C;  4FYY B;  3CQT A;  1X43 A;  3O8V A;  1SF9 A;  1ZA1 B;  2CSI A;  1VQ9 Q;  1W4S A;  5LJ3 h;  1TS9 A;  2EJG A;  4DBR A;  1Q81 R;  2V1R A;  2NUP B;  2M51 A;  4AFZ C;  2E10 A;  1QVG S;  3ZL7 C;  3EHR A;  2MCN A;  4DOW A;  2QGF B;  3SB2 A;  2DX1 A;  5HKC A;  1G8X A;  3HL8 A;  2JTM A;  2AZV A;  4M7D B;  3A8G B;  3VYH B;  3PT9 A;  3VUZ A;  4LD9 K;  2RJE A;  4M75 C;  4PJO C;  2CT3 A;  3OYH A;  2QG9 B;  1H64 1;  2CKK A;  2LX9 A;  2CH4 A;  2QDY B;  3MP6 A;  5CAI A;  1VQ9 T;  1RAD B;  5I21 A;  3A8L B;  3CC4 A;  2L0A A;  2K5F A;  3RUX A;  3EFS A;  2R57 A;  4EMK A;  1GBR A;  1VQ8 A;  3WXM B;  4YTL A;  5GAO r;  2J6F A;  1OZ3 A;  2L3Q A;  5LL6 S;  3SDZ A;  2ROL A;  4QVD A;  3CBM A;  2CZ7 B;  1X01 A;  2KRS A;  3OS5 A;  1Q86 R;  4KGV B;  2O4X B;  3EHQ A;  4C0G A;  2V8J A;  3QKJ A;  5KH6 A;  3CCJ Q;  1VQO A;  1PCX A;  3V8L A;  3M0T A;  3M56 A;  3CCS A;  4M77 A;  3CMA Q;  3RER A;  1U8R A;  1M8V A;  3OS2 A;  1VQN A;  3OSS C;  1JQQ A;  2KK4 A;  1BK2 A;  1PKT A;  1E6G A;  2K57 A;  4P5N A;  5LJ5 e;  2VVK A;  5GMK l;  4M78 D;  2MYS A;  3P8B B;  4ZTF A;  2KVQ G;  3VS4 A;  3TVT A;  3OA6 A;  1FX7 A;  4C8Q E;  2DTI A;  1NEG A;  2IIM A;  2X3X D;  1PHT A;  4MML A;  4HCK A;  1Z9Q A;  2QYZ A;  3CCJ T;  3OW2 A;  1YHQ Q;  3FLG A;  1WDX A;  3CMA T;  1OV3 A;  1WGS A;  4Y28 E;  2MK5 A;  4CC3 A;  2VC8 A;  3OS1 A;  4PJJ A;  4BDY A;  4LE9 A;  4C5G A;  2FG0 A;  3CC2 A;  3M53 A;  1O75 A;  2ED1 A;  1G2B A;  1ZLM A;  3H9N A;  4CC7 A;  1UJY A;  2HL5 C;  2V8K A;  1D09 B;  2PQW A;  3LLR A;  3G4S A;  1QCO A;  1D0Z A;  1W2B A;  5J39 A;  1IO6 A;  1K9M C;  2GGR A;  3G7Z A;  1N8R U;  1RI9 A;  4AMC A;  2K4Y A;  2VAS A;  2YLC A;  1WHG A;  2EFI A;  3PFS A;  2BZY A;  4A63 B;  4F16 A;  1X69 A;  1HK9 A;  5FU7 C;  1YHQ T;  4WCI A;  4JZ4 A;  2YXY A;  3THK A;  3OYD A;  4A4H A;  1K0S A;  1KSW A;  2HQH A;  2GQV A;  1UGS B;  5GMK i;  4J9H A;  4M7A A;  3PIP A;  2OAU A;  1FMV A;  1X6B A;  3ZFJ A;  4IUT A;  1WHL A;  3OYM A;  3X20 B;  4J9C A;  4LNP A;  3KUF A;  5IHK A;  1KK7 A;  1HSQ A;  4RCB A;  1YWP A;  3L1A A;  1IGQ A;  1X27 A;  2EYY A;  1X75 C;  2RK1 A;  3VJP A;  3VS5 A;  2YWW A;  2Y90 A;  1OX8 A;  1H3Z A;  1KQS A;  1XNI A;  1BI2 A;  4FSS A;  4MZP A;  1U1T A;  2HSP A;  2MI6 A;  2ENM A;  5LJ5 f;  3H41 A;  1BU1 A;  2L5Q A;  2DLP A;  1QWF A;  4M75 F;  2E6N A;  4EPC A;  1FWZ A;  4CC2 A;  2QA4 Q;  2E5K A;  5CK9 A;  2M9U A;  2QQA A;  3QYH B;  2QI2 A;  4LUD A;  1MMG A;  3V8K A;  4FYW B;  2OTL Q;  2RH2 A;  2EWN A;  2DM1 A;  2BKD N;  2DRK A;  1KHI A;  3ULR B;  3RDV A;  3CD6 Q;  1E7O A;  2E70 A;  2DJZ A;  3CCV Q;  4Z8A A;  4PFZ A;  4M77 F;  2XKO C;  3MJX A;  1NPP A;  3FJ5 A;  5KYX B;  4FYX B;  4C5I A;  2LNH B;  5IXF A;  3TEE A;  1NJI C;  4C0D B;  2KT8 A;  1B3Q A;  3CCS Q;  2QA4 T;  1TU0 B;  4PJM A;  4KH0 B;  2FPF A;  1LPL A;  2HKQ B;  2V8I A;  2DD5 A;  2OTL T;  2RA2 A;  1K9M R;  5GAN 8;  4BE2 A;  4QQG A;  2M1H A;  1M2V A;  4KUI A;  3CD6 T;  2KY9 A;  1UG1 A;  1SHG A;  3NMZ C;  2DIQ A;  2ZPI B;  4MZT A;  2VV5 A;  1PKS A;  1YI2 A;  1X6G A;  3CCV T;  2M02 A;  4E7Z A;  3OYF A;  3EG0 A;  2EGA A;  2AHJ B;  3CXC A;  3VUB A;  2KAF A;  3J80 E;  3N5B B;  5L23 A;  1R77 A;  2EGE A;  1QVF A;  2WSF E;  2E65 A;  3CCS T;  3M4G A;  3Q1J A;  4MDW A;  2A36 A;  3BFM A;  2FO0 A;  3J81 E;  1B34 B;  4UC4 A;  5GAM j;  2ZPB B;  2PVD B;  5D6Y A;  5GAN 7;  2F5K A;  3L42 A;  2NUT A;  4HVU A;  5GAN g;  2BZ8 A;  5GAO n;  5FWB A;  2DAQ A;  1BI3 A;  5IAY A;  1H3H A;  3I5R A;  1YWO A;  1TWB A;  3JCM V;  3LGF A;  1C1A A;  1NYG A;  1JU5 C;  2JNG A;  4M7A F;  1GCQ C;  5GJW B;  3I55 A;  2KMT A;  1UEB A;  3OYN A;  5KYW B;  2K7A A;  2LZ6 B;  2LVM A;  1RAC B;  1I1J A;  2GBQ A;  1VQM Q;  2CZ6 B;  1D3B B;  3NFC A;  1XQH A;  4OMF B;  3IQL A;  4OMN A;  1SHF A;  4RUG A;  2KEA A;  5C0M A;  1WHM A;  4JUV A;  3M0U A;  3M0P A;  4L5G A;  3BDU A;  4XTW A;  5GMK h;  1U1S A;  1UEC A;  3MHX A;  3CCE Q;  3MEV A;  1C6V X;  4ELY C;  3CC7 Q;  1YBY A;  3S6W A;  5LJ3 d;  3NTH A;  3R6N A;  2LQK A;  1ZUY A;  4M7D G;  4M77 D;  4PK4 A;  4PFO A;  1VQM T;  1OI1 A;  3QJY A;  1VYU A;  1NJI R;  1TUD A;  4A4F A;  4IIO A;  4HT8 A;  5FWC A;  2COZ A;  1VQ9 A;  4ORZ A;  4A54 A;  2O4X A;  4OMO A;  2BE7 D;  1I81 A;  2QK0 A;  2EQM A;  4IIM A;  4E6R A;  3A8O B;  5IXB A;  3PE0 A;  5FRO A;  5GAN 2;  3CCE T;  5FRM A;  1WA7 A;  4BY6 B;  3BY7 A;  1AD5 A;  4BD3 A;  1W2B S;  5GAN h;  5GAN 6;  3CC7 T;  1WXU A;  2LT1 A;  3VRZ A;  3GLX A;  4WF2 A;  4QQD A;  5J3B A;  1U06 A;  1BB9 A;  1OU8 A;  2BUD A;  4D8K A;  1D1C A;  2JM8 A;  1CKB A;  3EG1 A;  1K9A A;  2KBT A;  2O9S A;  4Y92 A;  3I35 A;  4X9C A;  2XDP A;  4J8O A;  3M59 A;  3GPL A;  4B6M A;  4LDX A;  3SWN B;  2XID A;  2ZAE A;  1Q7Y U;  2PUK B;  2B8A A;  5DLO A;  3LX7 A;  4HVV A;  2VXE A;  4E7H A;  4FU6 A;  1M90 U;  5GAO l;  3CCJ A;  1PG5 B;  2LC4 A;  2ESW A;  2RF0 A;  3CMA A;  4RKU E;  2DL8 A;  5GAO q;  1WHK A;  3RMQ A;  4XQ3 A;  3C0C A;  1KQS S;  4M7A D;  2DRM A;  3E1S A;  4RTV A;  1Y96 B;  1UFF A;  1ZSZ B;  5KYY B;  2CP5 A;  1YCY A;  4J9E A;  3SFM A;  4ZN1 A;  4R56 A;  2MOX A;  3HP9 A;  4BB7 A;  1YIJ Q;  4C8Q C;  2F5T X;  4HKE A;  3GP8 A;  2DL4 A;  2K9G A;  2CP3 A;  2XIC A;  5LJ3 e;  9ATC B;  1NYF A;  3HSB A;  3BDL A;  2OAW A;  4EDU A;  3QSU A;  2YUN A;  3H0F A;  2EYX A;  1YHQ A;  3JCM W;  4Z02 A;  1IGU A;  2FZG B;  1YFN A;  2BTT A;  1OU9 A;  1T3L A;  2JVV A;  2LQ8 A;  4JDS A;  2MF2 A;  2FPE A;  4J6X A;  1R0B G;  2XMF A;  3A8M B;  3EG3 A;  1XJW B;  2COW A;  4C92 E;  1YN8 A;  2DE0 X;  4XTV A;  3UA6 A;  1Q81 U;  3CPW P;  1YIJ T;  1JO8 A;  1Y07 A;  5A2Q E;  1LVK A;  2J7I A;  2DL7 A;  2E3I A;  2WSC E;  5CQY A;  5LJ5 j;  2E41 A;  2LX7 A;  3VS0 A;  1LOJ A;  2NLU A;  3RES A;  2L2P A;  1GCP A;  3CME Q;  4RTY A;  1UB4 A;  3I5S A;  4E7K A;  4CI0 C;  4PJL A;  2OJ2 A;  3PVQ A;  3TSZ A;  3TRE A;  4DA4 A;  1WI7 A;  4M7D E;  2C06 A;  4KGX B;  4J9D A;  1PWT A;  3KBG A;  1TTH B;  3RMS A;  3SHW A;  4E7L A;  2KDS A;  4JPB W;  3OSV A;  4KUL A;  3DB3 A;  3CXC S;  4HCZ A;  2EBP A;  2H3E B;  4JRI A;  4TVR A;  1D1A A;  1QVF S;  4M78 E;  1RAF B;  3JSC A;  1SRL A;  2E3H A;  2FRY A;  5D6W A;  1QCN A;  3H8Z A;  5DM7 R;  2XK0 A;  5CO7 A;  4C92 B;  2AK5 A;  2DEQ A;  2BIV A;  3SD4 A;  2H8H A;  5KYX A;  4J5Y A;  3CME T;  3H0I A;  4C0D C;  1OPK A;  3JB9 J;  2PUO B;  4BE0 A;  2YLB A;  4FT4 A;  4ZGE B;  3HRS A;  1VQL Q;  5KE2 A;  1XTD A;  2GF7 A;  2QDL A;  2LRQ A;  1Y71 A;  3OYB A;  3VU3 C;  2O9V A;  1AWJ A;  2CDT A;  3V7C A;  5CKD A;  4OF1 A;  2QA4 A;  1PRM C;  5LJ3 f;  2J6O A;  3QZ9 B;  3PMI A;  4XU1 A;  4JRP A;  4NL2 A;  2OI3 A;  4EMK C;  4LD6 A;  2OTL A;  1VQ7 Q;  4DEY A;  5CCA A;  4M78 B;  2LCS A;  3CD6 A;  2EGC A;  3X28 B;  2QXF A;  4CC4 B;  3O5Z A;  3QPH A;  1FMW A;  4FL6 A;  3CCV A;  3JCM b;  1VQL T;  1B34 A;  2EJ9 A;  4CRI A;  2VXF A;  1M1G A;  4IUR A;  4M77 C;  2WAC A;  3S3M A;  4J6Y A;  5CQX A;  1VUB A;  2ZPF B;  1ZBJ A;  2A08 A;  3QII A;  3FJP A;  5C6S A;  3M0R A;  2DMO A;  1X2Q A;  2JM9 A;  2KYM A;  2P0P A;  2PNI A;  2FPD A;  5J26 A;  2P4R A;  2FEI A;  3JCM g;  2F2W A;  1VQ7 T;  1WNL A;  3M55 A;  4C8Q F;  4XTX A;  5CKE A;  4J9F A;  2KRN A;  4HA8 A;  5KYW A;  2RHY A;  1TOV A;  1WHJ A;  1D3B A;  2P4T A;  2RN8 A;  1K73 U;  1U3O A;  1I07 A;  1YIT Q;  3CEY A;  1OQK A;  4ANJ A;  1ABQ A;  1JB0 E;  2DK3 A;  3DLL A;  4F17 A;  3VS1 A;  2M16 A;  5GJV B;  2L3S A;  1B7T A;  4OMQ A;  2CP2 A;  3OMG A;  3OY9 A;  1M3C A;  2GFU A;  1M8M A;  1M1F A;  2JXB A;  1G3S A;  2R5M A;  2JS0 A;  2RHZ A;  5HK0 A;  2O01 E;  5GAN 3;  2R58 A;  2XG8 D;  3EFO B;  2VGN A;  5FU6 B;  4ELZ C;  1CKA A;  2ED0 A;  2LJ0 A;  4IUQ A;  5KCO A;  1KG1 A;  1EX4 A;  1YIT T;  3F70 A;  4XTU A;  3OYE A;  1Y57 A;  2ATC B;  1PC0 A;  4A53 A;  1UJ0 A;  4LDY A;  4D6W A;  1VQM A;  4M4Z A;  4M7A C;  3QWY A;  2DXU A;  1IXD A;  4Z89 A;  2KE9 A;  1M9S A;  1RAI B;  4DOV A;  1UGR B;  3PIO A;  2DVJ A;  3QO3 A;  4X9D A;  1MMN A;  1WXB A;  3LH0 A;  3MP8 A;  1QVG P;  6AT1 B;  5CKB A;  2KXC A;  4RMO A;  1UE9 A;  2EQU A;  4E47 A;  4RTU A;  8ATC B;  1X2K A;  3EGD B;  2QTV A;  2EQK A;  3JB9 I;  3CCE A;  1VQK Q;  3JCM h;  3V7S A;  2DA9 A;  3FEO A;  3S3O A;  3CC7 A;  4A4E A;  4HXJ A;  2E1H A;  2PZ1 A;  3EFR A;  2CZ0 B;  1NBE B;  3OMC A;  2HBP A;  4F7U G;  2EQI A;  4MZM A;  1JJ2 P;  3VV0 A;  3OQ5 A;  3E19 A;  1UDL A;  3RR6 A;  1AOJ A;  4F04 B;  3VRY A;  5GAN d;  3SWN A;  1TG0 A;  1Q82 C;  2O88 A;  1K9M U;  1OX9 A;  5IT9 E;  4HCB A;  1VQK T;  2CUB A;  4C8Q D;  1KHC A;  1G3Y A;  1SSH A;  2X51 A;  3L2Z A;  1GFC A;  2DYI A;  1WPY A;  2CP0 A;  2FZC B;  2YHT A;  1ZUK A;  3VS7 A;  4RTT A;  2YUQ A;  5IN1 A;  1Y96 A;  1AHJ B;  4V2S A;  3JAM E;  2JS2 A;  1VYV A;  1ZSZ A;  3GBQ A;  2QQ9 A;  5KYY A;  1MGQ A;  4RTZ A;  4M75 E;  4N4H A;  4PJO E;  4XK8 E;  2NWM A;  1KC8 U;  1QQJ A;  4A4K A;  1M1K C;  3C95 A;  5ECA A;  4PLI A;  5FRN A;  3MEU A;  3G1J A;  2J06 A;  3JCM J;  2Y4X A;  3HFN A;  3M58 A;  4Z88 A;  2K5L A;  2YDL A;  2VWF A;  2CYZ B;  5GAN 5;  3G6E Q;  1AVZ C;  4OML A;  2QEX Q;  5GMK m;  2CP6 A;  5GMK e;  1N5Z A;  2F2V A;  1RUW A;  2RB6 A;  4DEX A;  1OOT A;  1ZHI A;  2K2V A;  4E7S A;  4J9B A;  3REA B;  3QYG B;  2D0N A;  4VUB A;  1S1N A;  2FZK B;  2RQU A;  1ABO A;  1VYT A;  2LCL A;  4M75 B;  4PJO B;  2RPN A;  3G6E T;  2ZCF B;  1YIJ A;  1OUL A;  2K5I A;  2QAZ A;  1N6A A;  5DLQ E;  3EH2 A;  2QEX T;  1BCO A;  3RKW A;  1PSE A;  1RLQ C;  2IPO B;  2RQV A;  3C4S A;  1KFZ A;  2X9H A;  2DYB A;  2XDD A;  2DBK A;  1KQ2 A;  1WQW A;  4J9I A;  2G3R A;  3QDF A;  5GAN e;  5HCK A;  1N9R A;  3EG2 A;  1B07 A;  2AIR B;  1WJS A;  1OEB A;  5A0D A;  1AEY A;  2XHC A;  3MEA A;  2RQR A;  4C92 A;  3GF5 A;  2DO3 A;  4OGE A;  2NUP A;  1Q82 R;  1U5S A;  3KFV A;  2SRC A;  4J7F A;  1S72 Q;  2EVR A;  4K11 A;  3X25 B;  3LW5 E;  4C92 G;  1OZ2 A;  1D0X A;  2K6D A;  4D8D A;  1K8A C;  3L2W A;  1FYN A;  4M7D C;  1G83 A;  2KR3 A;  3CME A;  4JJN K;  2RI3 A;  3JB9 G;  4M7D A;  2FYK A;  3M9Q A;  2L8D A;  1GFD A;  2HEQ A;  4F7U E;  5LJ3 j;  1JJ2 A;  1BIA A;  2OX7 A;  4R55 A;  2YT6 A;  1NM7 A;  4RTW A;  4HVW A;  4Y91 A;  2I0N A;  2E12 A;  1WLP B;  4JJD A;  4N0A A;  5KE3 A;  4OB3 B;  1M1K R;  3OW2 S;  2EJF A;  4M78 A;  1S72 T;  2EKO A;  2HKN A;  5EC7 A;  2GCX A;  1GXI E;  3QJ6 A;  2YRC A;  1WX6 A;  1Q7Y C;  2VB6 A;  1W70 A;  1IRE B;  2YUO A;  3OBW A;  4M78 G;  5I22 A;  4JRQ A;  4X1V A;  3QHS A;  1M30 A;  2RQT A;  1VQL A;  1M2O A;  3CCM Q;  1PD1 A;  4FM4 B;  3GIB A;  1I5O B;  1VIE A;  4FW2 A;  3G71 Q;  5FU7 B;  3TCJ A;  3CCU A;  3JCM P;  4F7U B;  2DIG A;  1LJO A;  2KRM A;  4PLL A;  3OYJ A;  2A7Y A;  2C0O A;  3M4Y A;  2RHX A;  2RJD A;  1LCK A;  2FB7 A;  2HQX A;  3H6Z A;  2ZPG B;  2ZGW A;  3FDR A;  2D1X A;  1VQ7 A;  5GAM g;  4BAC A;  2LMJ A;  1RAA B;  3PNW C;  4J9G A;  3UA7 A;  5GAN f;  2EPD A;  1PM3 A;  3C12 A;  2EYZ A;  1WXT A;  1VQP Q;  2W0Z A;  1D1B A;  5IHN A;  2DL5 A;  2ZZD A;  3CCM T;  2RD1 A;  3G71 T;  3CCQ Q;  2KYB A;  4ZGD B;  3LGL A;  4AFQ C;  2RK2 A;  1KD1 C;  2E4H A;  5DY9 A;  1R8O B;  3M54 A;  2K3B A;  2DVE A;  2GTO A;  1JBM A;  2ZPE B;  2LCC A;  3EFO A;  3CBO A;  2RMO A;  5M9O A;  2VKN A;  8AT1 B;  4DBH A;  1BKB A;  4BUG A;  2PU9 B;  3LWI A;  1E6H A;  3WVE B;  2OTJ Q;  1PSF A;  2JUF A;  2D8H A;  1QP2 A;  3FB9 A;  4ZNX A;  2L3R A;  1KQ1 A;  1WFW A;  1VQP T;  1K8A R;  1WJR A;  2LTO A;  2CZ1 B;  3OBY A;  4OGC A;  2RJC A;  1YIT A;  2VYT A;  2KGT A;  1TXQ A;  4MMK A;  3CCQ T;  1QCF A;  4HT9 A;  3MET A;  2LDM A;  4GLM A;  4BI8 B;  2QQB A;  4WTO B;  5CVI A;  1UGV A;  5KYU B;  3OS0 A;  2YRV A;  4C92 F;  4JS5 A;  1MND A;  1UTI A;  3EGD A;  3OB9 A;  3EGX B;  2BE9 B;  2QQS A;  3JB9 F;  2RNA A;  1M4Z A;  1YJW Q;  2F2X A;  2OTJ T;  1VQ6 Q;  1ZSG A;  4PKC C;  3UAT A;  3RKX A;  1Q7Y R;  2A3L A;  1QW1 A;  3OYL A;  2EYW A;  1SSF A;  1P92 A;  4OMP A;  4M7D F;  2RJF A;  1VA7 A;  2CP7 A;  4BI4 A;  2WSE E;  5GAM h;  3E9F A;  2AT1 B;  1EFN A;  3LWH A;  3P8D A;  3A5Z B;  2EYQ A;  2CH4 W;  4IUV A;  2NYS A;  2QAS A;  1WIE A;  1KIK A;  1RAB B;  4FT2 A;  1TH7 A;  3JCM d;  1AZG B;  3NTK A;  3HRU A;  4LXC A;  2GNC A;  5D6X A;  1GBQ A;  3J7A F;  1Y0M A;  2LQN A;  3A98 A;  1YJW T;  3MKD A;  1VQ6 T;  3RBB B;  3A8H B;  2YSQ A;  2D0Q B;  2X4W A;  2JZ2 A;  2EKH A;  3EH1 A;  1VQK A;  1IB8 A;  1VIF A;  3QZ5 B;  4C5H A;  1Q86 U;  1NE8 A;  3L2V A;  3OYI A;  3T9N A;  3NGP A;  1N27 A;  1YNZ A;  1EIF A;  4IUP A;  2D6F A;  1KD1 R;  1K0X A;  3INZ A;  4EIK A;  1ZQ1 A;  4J7I A;  2QGG A;  3CCU Q;  1NG2 A;  2RI5 A;  4QW2 A;  2MWO A;  4ZN3 A;  1GL5 A;  1NLP C;  2M0Y A;  1AZE A;  2DBM A;  1QLY A;  4OB1 B;  1WZO A;  1ZUU A;  4OP0 A;  1HJD A;  3UPU A;  1K73 C;  1KQS P;  2L89 A;  1VQ5 Q;  2NUZ A;  2PVO B;  1J3T A;  4XU0 A;  3VS6 A;  3I56 Q;  2A0F B;  2GQI A;  2DD4 A;  2RHU A;  4M75 A;  2M0O A;  4PJO A;  2A37 A;  2HDA A;  3CCR Q;  2V26 A;  3BW1 A;  2KT1 A;  3X24 B;  5GAO m;  1H8K A;  1WJQ A;  2LJ1 A;  2F1L A;  2DFU A;  3FIF A;  3CCU T;  1JJ2 S;  4C92 D;  1QMC A;  1MMD A;  4JLI A;  4OB2 B;  4N4G A;  4JJC A;  2HNI A;  4M75 G;  5I2S A;  4PJO G;  2QTX A;  1YJ9 Q; 
#chains in the Genus database with same CATH homology
 1HXD A;  2E6Z A;  4C8Q A;  3JB9 D;  3G6E A;  1YJN A;  3VYG A;  1K9M U;  5GMK h;  1U1S A;  4XTZ A;  5CKF A;  3OYA A;  5IT9 E;  4HCB A;  5I2M A;  2QEX A;  1VQK T;  4C8Q D;  4L59 A;  4ATO A;  1Q86 C;  1KHC A;  3QBY A;  1N8R C;  4J6W A;  1G3Y A;  3MHX A;  2RO0 A;  4NS5 A;  3L2Z A;  1VQ5 T;  1WPY A;  1RL2 A;  3MEV A;  1YI2 T;  2YHT A;  3TU4 K;  5LJ5 g;  3CCL A;  4C8Q G;  3I56 T;  4ELY C;  4M7D D;  5IN1 A;  1YBY A;  1Y96 A;  1AHJ B;  4V2S A;  3JAM E;  3S6W A;  5LJ3 d;  1IZ6 A;  3NTH A;  3RKY A;  4X34 A;  4RCC A;  4RG8 A;  3CCR T;  2LQK A;  1KD1 U;  1Y7X A;  3JCM e;  4M7D G;  2QQ9 A;  4M77 D;  3CPF A;  2LNV A;  4O5V A;  1MGQ A;  3HHT B;  4M75 E;  3OYC A;  1VQM T;  4N4H A;  4PJO E;  1OI1 A;  1WQ7 A;  4XK8 E;  3QJY A;  3JRZ A;  4M77 G;  2FVU A;  1KC8 U;  1RI0 A;  3P8H A;  4A4K A;  4A4F A;  4HT8 A;  3URG A;  1M1K C;  3C95 A;  1LNX A;  1UGQ B;  2JOY A;  2X4J A;  4PLI A;  1VQ9 A;  5FRN A;  1YJ9 T;  4A54 A;  4EMH A;  1FXX A;  3MEU A;  3JCM J;  2O4X A;  4M78 F;  2Y4X A;  2XI9 A;  3HFN A;  3M58 A;  4C0Z A;  3CPW A;  1I81 A;  3L2Q A;  2K5L A;  2DZC A;  2EQM A;  3A8O B;  2CYZ B;  5GAN 5;  5LJ5 d;  1JRI A;  2RHI A;  4L6V 5;  5FRO A;  5GAN 2;  3GOX A;  3CCE T;  5FRM A;  4BY6 B;  2DXT A;  3BY7 A;  4BD3 A;  1X6O A;  1W2B S;  3HKS A;  5GAM f;  5GMK m;  4LDU A;  5GAN 6;  5GAN h;  3L2U A;  3CC7 T;  2H3J A;  2LT1 A;  1G5V A;  5GMK e;  3GNF B;  3DB4 A;  2RI2 A;  3GLX A;  2DKG A;  2RB6 A;  5EG2 A;  4WF2 A;  1QVP A;  3I55 T;  4ZGJ B;  1ZHI A;  4QQD A;  5J3B A;  2K2V A;  4N4I A;  1VQ4 T;  3DLM A;  3ZBD A;  5GMK j;  2DXC A;  2BUD A;  3QYG B;  4A4G A;  3ER0 A;  4VUB A;  2KSS A;  2XDB A;  2XU8 A;  2HQE A;  5GAO p;  2DTH A;  3PTA A;  1NZ9 A;  3O8V A;  2LCL A;  4M75 B;  1ZBX A;  4PJO B;  1S72 A;  1W4S A;  5LJ3 h;  4BY6 C;  2EJG A;  4X9C A;  3G6E T;  1YJN T;  2ZCF B;  1YIJ A;  2XDP A;  4J8O A;  1BYM A;  2K5I A;  1N6A A;  3M59 A;  3GPL A;  5DLQ E;  4LDX A;  3SWN B;  2QEX T;  2XID A;  3RKW A;  1Q7Y U;  2E10 A;  3AHU A;  2PUK B;  1QVG S;  2B8A A;  1PSE A;  5DLO A;  3LX7 A;  3MCA B;  3CCL T;  5AYF A;  3C4S A;  4DOW A;  3MEW A;  2VXE A;  3SB2 A;  4C8Q B;  4F7U A;  3JCM c;  4E7H A;  3GNG A;  4FU6 A;  2EIF A;  5HKC A;  1M90 U;  5GAO l;  3CCJ A;  4EMG A;  3HL8 A;  2JTM A;  2XDD A;  4JRK A;  4IKF A;  2LC4 A;  1KQ2 A;  1WQW A;  5CIU A;  3CMA A;  4M7D B;  3A8G B;  4NOY A;  3VYH B;  2G3R A;  3PT9 A;  4RKU E;  3VUZ A;  5GAN e;  4LD9 K;  2RJE A;  4M75 C;  5LJ5 h;  5GAO q;  1N9R A;  3RMQ A;  4XQ3 A;  4M7A D;  1KQS S;  4PJO C;  1KC8 C;  3OYH A;  1WJS A;  3E1S A;  5A0D A;  1H64 1;  2P0Q A;  1G3W A;  2XHC A;  2CKK A;  1Y96 B;  2LX9 A;  3MEA A;  3JCM Q;  4ZTJ A;  5GAN j;  2QDY B;  4C92 A;  3GF5 A;  4M7A G;  2DO3 A;  3MP6 A;  4OGE A;  5CAI A;  1VQ9 T;  5I21 A;  3SWN C;  3A8L B;  3SFM A;  1YCY A;  4ZN1 A;  3CC4 A;  2K5F A;  3RUX A;  3EFS A;  2R57 A;  3QG1 A;  4J7F A;  4EMK A;  4R56 A;  1VQ8 A;  3WXM B;  3HP9 A;  4YTL A;  4BB7 A;  2XD0 A;  5GAO r;  4C8Q C;  3X25 B;  1OZ3 A;  5LL6 S;  4XTW A;  3LW5 E;  2F5T X;  3SDZ A;  1OZ2 A;  4HKE A;  3CBM A;  2CZ7 B;  2IVW A;  3QUI A;  4C92 G;  1X01 A;  3JCM f;  2PVG B;  3FRN A;  3GP8 A;  3OS5 A;  4KUD K;  2XIC A;  1K8A C;  1N9S A;  3DKM A;  4J83 A;  5LJ3 e;  3L2W A;  4M7D C;  3JCM X;  1G3T A;  2O4X B;  3HSB A;  3JB9 F;  3CME A;  3BDL A;  4EDU A;  4JJN K;  2RI3 A;  3JB9 G;  3QSU A;  4M7D A;  2FYK A;  1YHQ A;  4C0G A;  3JCM W;  3M9Q A;  2L8D A;  4Z02 A;  4F7U E;  2V8J A;  3QKJ A;  5KH6 A;  5LJ3 j;  5A0G A;  3CCM A;  4PJO F;  1JJ2 A;  3G71 A;  1VQO A;  3V8L A;  3M56 A;  4BI3 A;  4M77 A;  3CCS A;  1BIA A;  2JVV A;  4R55 A;  3RER A;  2LQ8 A;  1U8R A;  1M8V A;  4Y91 A;  2HAX A;  4JDS A;  2E12 A;  2MF2 A;  3OS2 A;  1VQN A;  4J6X A;  3OSS C;  4N0A A;  3VKI A;  5KE3 A;  2KK4 A;  3A8M B;  4OB3 B;  4KT0 E;  3OW2 S;  2QQR A;  2EJF A;  2K57 A;  4C92 E;  4M78 A;  1S72 T;  4P5N A;  5LJ5 e;  4XTV A;  1Q81 U;  2EKO A;  1MHN A;  5GMK l;  1YIJ T;  4FIB A;  1Y07 A;  5A2Q E;  2GCX A;  1GXI E;  4M78 D;  3QJ6 A;  3P8B B;  4ZTF A;  4DQ2 A;  3WVD B;  1Q7Y C;  2KVQ G;  1I4K 1;  2WSC E;  3CBP A;  2E41 A;  5CQY A;  5LJ5 j;  4E7I A;  1IRE B;  3QXE B;  1LOJ A;  3OBW A;  3OA6 A;  4M78 G;  4XU3 A;  2NLU A;  1VQP A;  1FX7 A;  2I2L A;  2DTI A;  4C8Q E;  4JRQ A;  3QDR B;  3RES A;  3QHS A;  4MML A;  1UB4 A;  3CCJ T;  4CI0 C;  4E7K A;  3OW2 A;  3TRE A;  4DA4 A;  3CCQ A;  4M7D E;  1O9S A;  4HCC A;  2C06 A;  1VQL A;  4BE1 A;  3FLG A;  3CMA T;  3KBG A;  3HPW A;  3C94 A;  4FM4 B;  3RMS A;  3GIB A;  3ME9 A;  1VIE A;  1WGS A;  4E7L A;  4HT9 A;  5FU7 B;  1BIB A;  3TCJ A;  2KDS A;  4Q5W A;  3CCU A;  4Y28 E;  3JCM P;  4M77 E;  2VC8 A;  4F7U B;  3OS1 A;  3OSV A;  4KUL A;  4BDY A;  2DIG A;  3DB3 A;  1LJO A;  4PLL A;  4C5G A;  3OYJ A;  3CXC S;  4HCZ A;  3CC2 A;  3M53 A;  2A7Y A;  1O75 A;  1UGP B;  3M4Y A;  4NL3 A;  2RHX A;  1Q82 U;  2RJD A;  4JRI A;  2V8K A;  3CC4 T;  4TVR A;  2FB7 A;  2HQX A;  1QVF S;  2PQW A;  3H6Z A;  3LLR A;  4XU2 A;  1VQ8 T;  4M78 E;  1DJ7 B;  2ZPG B;  3JSC A;  4PNO A;  3G4S A;  1W2B A;  2ZGW A;  5D6W A;  3FDR A;  5J39 A;  4PL6 A;  4QVC A;  4C0F A;  1VQ7 A;  5GAM g;  2DTO A;  3H8Z A;  5DM7 R;  2XK0 A;  5CO7 A;  4C92 B;  4BAC A;  1K9M C;  2DEQ A;  3PNW C;  2BIV A;  3G7Z A;  1N8R U;  3R6O A;  5GAN f;  2K4Y A;  4OB0 B;  3SD4 A;  2YLC A;  3C12 A;  2EFI A;  3PFS A;  2K3X A;  4OVA A;  4J5Y A;  4B9X A;  4EMK B;  3CME T;  2ZPH B;  1HK9 A;  5FU7 C;  4C0D C;  1YHQ T;  2ZZD A;  4RG2 A;  3JB9 J;  2PUO B;  3OYD A;  3CCM T;  2RD1 A;  4BE0 A;  4A4H A;  2YLB A;  4FT4 A;  4ZGE B;  3G71 T;  1VQO T;  2GQV A;  4ZGD B;  3HRS A;  1UGS B;  3LGL A;  5KE2 A;  1XTD A;  2GF7 A;  5GMK i;  2RK2 A;  1KD1 C;  4M7A A;  3PIP A;  2LRQ A;  2OAU A;  1Y71 A;  5DY9 A;  1VQN T;  1R8O B;  3M54 A;  3VU3 C;  3OYB A;  2DVE A;  3ZFJ A;  4IUT A;  1M1K U;  5GAN 4;  1JBM A;  2CS7 A;  2ZPE B;  2LCC A;  5L8R E;  3V7C A;  5CKD A;  3OYM A;  1NJI U;  2X4X A;  4OF1 A;  5GAM d;  4C92 C;  3CBO A;  2QA4 A;  5HY6 A;  5LJ3 f;  3X20 B;  3QZ9 B;  4M77 B;  5M9O A;  3PMI A;  4XU1 A;  2VUB A;  4JRP A;  4NL2 A;  1BKB A;  1QVG A;  1YJW A;  1I8F A;  3KUF A;  3UWN A;  4BUG A;  5HK3 A;  1VQ6 A;  4EMK C;  2PU9 B;  4LD6 A;  3LWI A;  4RCB A;  2OTL A;  3L1A A;  3WVE B;  1PSF A;  2JUF A;  3FB9 A;  1QP2 A;  2D9T A;  1X75 C;  2L3R A;  1KQ1 A;  2MAM A;  2RK1 A;  4M78 B;  3VJP A;  5CCA A;  1VQP T;  3CD6 A;  3X28 B;  1WJR A;  2QXF A;  4F7U F;  2LTO A;  5CR2 A;  4JS4 A;  2CZ1 B;  3OBY A;  3QPH A;  4FSX A;  3RIR A;  4OGC A;  2Y90 A;  2FHD A;  2RJC A;  2MWP A;  1YIT A;  2VYT A;  1H3Z A;  4FL6 A;  3CCV A;  1KQS A;  1XNI A;  4MMK A;  3JCM b;  3CCQ T;  4C5E A;  3MET A;  1BI2 A;  2LDM A;  1VQL T;  2LT4 A;  4MZP A;  1B34 A;  1U1T A;  2EJ9 A;  2MI6 A;  4BDZ A;  4CRI A;  5LJ5 f;  1M5Q 1;  2VXF A;  4GY5 A;  4M75 D;  5CKH A;  4BI8 B;  2L5Q A;  4PJO D;  2QQB A;  3LYI A;  3M57 A;  4KBM B;  1M1G A;  4IUR A;  4M75 F;  5CVI A;  4M77 C;  2WAC A;  3S3M A;  2E6N A;  4J6Y A;  5CQX A;  1VUB A;  2YRV A;  4EPC A;  3OS0 A;  4M7A E;  4C92 F;  2ZPF B;  4JS5 A;  3CC2 T;  2F69 A;  3QII A;  4N0A C;  3OB9 A;  3FJP A;  1FWZ A;  5C6S A;  2P0P A;  2M9U A;  2QQS A;  5CK9 A;  2QQA A;  3QYH B;  3M5A A;  4M78 C;  5J26 A;  3G4S T;  1M4Z A;  2QI2 A;  3NTI A;  3JCM g;  2X35 A;  4M7A F;  1VQ7 T;  2OTJ T;  1WNL A;  3M55 A;  4PKC C;  3RKX A;  3V8K A;  4C8Q F;  4XTX A;  5CKE A;  3JB9 H;  3HRT A;  2A3L A;  1QW1 A;  4LDV A;  2RH2 A;  3OYL A;  2EWN A;  1QP3 A;  1SSF A;  2X4Y A;  2BKD N;  4HA8 A;  4ME7 A;  1P92 A;  3CPW S;  2P0K A;  3S3N A;  2E64 A;  1KHI A;  4M7D F;  2RJF A;  4QVD A;  4BI4 A;  2RHY A;  2WSE E;  5GAM h;  1D3B A;  2E70 A;  2P4T A;  3E9F A;  2DJZ A;  1K73 U;  2KQW A;  3CEY A;  4XAX B;  1M90 C;  3MO8 A;  4M77 F;  3LWH A;  2IG0 A;  3P8D A;  2XKO C;  3E9G A;  1NPP A;  2Y4Y A;  3A5Z B;  1JB0 E;  2DK3 A;  2EYQ A;  3DLL A;  3EAE A;  4IUV A;  3PGG A;  4C5I A;  3V8J A;  2M16 A;  1NPR A;  3TEE A;  1NJI C;  1TH7 A;  4FT2 A;  4JLG A;  4C0D B;  3JCM d;  3NTK A;  1BI0 A;  3HRU A;  3L2R A;  2QA4 T;  3OMG A;  3OY9 A;  5D6X A;  2GFU A;  2FL7 A;  2GFA A;  3J7A F;  4M7A B;  1YJW T;  1M1F A;  2OTJ A;  1G3S A;  2V8I A;  2R5M A;  1VQ6 T;  2DXB A;  5HK0 A;  2RHZ A;  1V29 B;  2DD5 A;  4M7A C;  2O01 E;  3A8H B;  3KXT A;  2K3Y A;  2OTL T;  2RA2 A;  5GAN 3;  2D0Q B;  2X4W A;  5GAN 8;  2JZ2 A;  2R58 A;  4BE2 A;  4QQG A;  2M1H A;  2XG8 D;  1K8A U;  3OYG A;  4KUI A;  2VGN A;  1VQK A;  2KY9 A;  3CD6 T;  1VIF A;  3QZ5 B;  5FU6 B;  4C5H A;  4ELZ C;  2DIQ A;  4IUU A;  5KCO A;  4IUQ A;  1Q86 U;  1NE8 A;  4B9W A;  1VQ5 A;  1KG1 A;  2ZPI B;  4MZT A;  2VV5 A;  1YIT T;  1YI2 A;  4XTY A;  2HD0 A;  3CCV T;  3I56 A;  3F70 A;  3OYF A;  4XTU A;  4LDW A;  3L2V A;  3OYI A;  3OYE A;  3T9N A;  2AHJ B;  1N27 A;  3CXC A;  3VUB A;  4A53 A;  1EIF A;  2KAF A;  4IUP A;  3CCR A;  2D6F A;  4LDY A;  4D6W A;  3J80 E;  5KCH A;  3N5B B;  2MMP A;  5GAM e;  1VQM A;  1QVF A;  2R5A A;  3FC3 A;  2WSF E;  2DXU A;  2E65 A;  3INZ A;  3M4G A;  3Q1J A;  3CCS T;  4MDW A;  1I5L A;  1M9S A;  1ZQ1 A;  3BFM A;  4J7I A;  4DOV A;  1UGR B;  2RM4 A;  3PIO A;  3J81 E;  1B34 B;  3QO3 A;  4X9D A;  4UC4 A;  5GAM j;  3OYK A;  2CGH A;  2RI5 A;  2ZPB B;  2PVD B;  3LH0 A;  3MP8 A;  4QW2 A;  2MWO A;  5D6Y A;  2F5K A;  5A0L A;  5GAN 7;  2E5Q A;  3L42 A;  5CKB A;  4ZN3 A;  4RMO A;  1YJ9 A;  5FU6 C;  2EAY A;  1Q81 C;  2EQU A;  3OYY A;  4E47 A;  5GAN g;  5GAO n;  2DAQ A;  2EQJ A;  1BI3 A;  3HFO A;  5IAY A;  4OB1 B;  2EQK A;  3V7R A;  3JB9 I;  4QQ6 A;  1BI1 A;  4MDX A;  3CCE A;  4OP0 A;  2JTF A;  3JCM h;  3JCM V;  4O6J A;  3V7S A;  3MP1 A;  3UPU A;  3LGF A;  1K73 C;  3FEO A;  3S3O A;  4GLK A;  3CC7 A;  2L89 A;  3X26 B;  4A4E A;  2E1H A;  3PMT A;  2DZ9 A;  4II1 A;  4QVZ A;  2PVO B;  3EFR A;  4XU0 A;  2CZ0 B;  2DD4 A;  2JNG A;  2HBP A;  2RHU A;  3OMC A;  2JN0 A;  4M75 A;  2M0O A;  4F7U G;  3I55 A;  1VQ4 A;  2KMT A;  1UEB A;  4MZM A;  4PJO A;  3OYN A;  2DPP B;  3VV0 A;  3OQ5 A;  2LVM A;  2VGM A;  3ASK A;  3BW1 A;  5LJ3 g;  5FLX E;  2CZ6 B;  1D3B B;  3X24 B;  1WJQ A;  3NFC A;  3UT1 A;  5GAO m;  1XQH A;  4OMF B;  3FIF A;  3CCU T;  1JJ2 S;  3E19 A;  5GAN d;  4C92 D;  4E7J A;  4JLI A;  3SWN A;  5C0M A;  1XOV A;  4OB2 B;  4N4G A;  3ZEH A;  2HNI A;  4M75 G;  5I2S A;  1Q82 C;  4JUV A;  3UDC A;  4PJO G;  1OYX A;  4L5G A;  2QTX A;  3BDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...