2R57A

Crystal structure of the two mbt repeats from sex-comb on midleg (scm)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycomb protein Scm
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 51
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r57A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r57A01
5KH6A 2LTOA 4IURA 4L59A 5CIUA 4A4EA 4HCZA 3UWNA 2RI2A 1WJRA 2BKDN 2EQUA 5KE2A 4OVAA 2G3RA 3PMIA 3L2RA 2K3YA 2R58A 2B8AA 3E9FA 3QIIA 1N27A 3FEOA 5KCHA 3C4SA 3OYGA 4IKFA 1RI0A 2JZ2A 4BD3A 1OI1A 3OYHA 1WJSA 2M0OA 2RHXA 3E9GA 3ME9A 3NTIA 4IUVA 2L89A 3LLRA 4NS5A 2VYTA 3OS2A 1OZ3A 4UC4A 5KCOA 4BE0A 1OZ2A 2GFUA 3QBYA 5FRNA 3OYBA 4E7HA 3S3OA 4PL6A 3OS0A 2HQEA 2YRVA 4EDUA 1H3ZA 2DIGA 3L42A 2MWPA 2L3RA 4IUQA 2F5KA 3OYLA 4QQGA 2JTFA 5D6XA 3KUFA 3LGLA 2RJDA 4GY5A 2GF7A 2RJCA 3O8VA 3MEAA 2DAQA 2O4XB 2P0KA 4E7IA 1KHCA 3S3MA 4C5HA 2R5MA 4C5GA 3CEYA 2GFAA 5FROA 3DB4A 4PLLA 2X4XA 3LX7A 3F70A 4QQ6A 3OYJA 2R57A 4E7JA 2LDMA 3L2VA 3OS1A 2LVMA 2K3XA 4C5EA 3M9QA 3L2QA 4BE1A 4Z02A 3MO8A 5IN1A 3H8ZA 3OYAA 4BE2A 4CRIA 3MP6A 3OYNA 3LYIA 2EQKA 2RJEA 3MEUA 3P8DA 3OYFA 4BACA 2QQSA 2O4XA 2RI3A 3DLMA 5C6SA 3L2UA 1MHNA 2MWOA 2FHDA 4ZTJA 2X35A 2X4WA 2RHZA 4E7KA 3FDRA 3MEVA 2DIQA 3MEWA 3NTHA 2EFIA 4A4FA 2R5AA 4FL6A 2M1HA 2RO0A 2NLUA 2D9TA 2RJFA 2XK0A 4PLIA 3S6WA 3OYKA 1SSFA 2BUDA 4IUUA 4C5IA 1XNIA 3EAEA 4BDZA 3OMGA 3OYDA 4E7LA 3NTKA 2PQWA 3OY9A 2E6NA 4RG2A 3GOXA 4BDYA 5KE3A 2X4YA 2E5QA 3BDLA 4FU6A 4B9WA 3DB3A 2QQRA 4QQDA 4N4IA 3LGFA 5J26A 3UT1A 4N4HA 2M16A 5FRMA 4Q5WA 3S3NA 3MP8A 5D6WA 1WGSA 3QJ6A 4LD6A 5D6YA 3QKJA 1WJQA 4II1A 2RHIA 4QVZA 3H6ZA 2LRQA 4A4HA 4IUTA 3OB9A 5IAYA 3OYIA 4ZTFA 2BIVA 2EKOA 3OYMA 1OYXA 2IG0A 2CKKA 3L2WA 2WACA 4B9XA 5M9OA 2EQJA 3OQ5A 3OA6A 3LH0A 4A4GA 3OYEA 4IUPA 3PFSA 3PNWC 2RI5A 2RHUA 2XDPA 2RHYA 3META 3MP1A 3ZEHA 4QW2A 3SD4A 2LCCA 4N4GA 3FLGA 4X34A 2EQMA 3FC3A 3ASKA 2HQXA 3OYCA 1G5VA 2L8DA 3P8HA 3OMCA 5C0MA 5J39A 3Q1JA 3PMTA
chains in the Genus database with same CATH superfamily
3X28B 1WHLA 1M1KU 5LJ5f 5GAN8 3LWIA 2PUKB 2CUDA 5IT9E 2QEXT 1YJNA 5KYWB 3L2RA 2B8AA 1W2BS 3C4SA 1SKUB 3EGDA 2RHXA 3E9GA 1I8FA 1RADB 3OSSC 2OTLA 1M1FA 2KYMA 1OZ2A 3QBYA 2JJ9A 3VS6A 4PL6A 2QAZA 2F69A 1VQ6T 4M75D 1M3BA 2QA4A 2A3LA 3O8VA 1YI2T 4FIBA 2VWFA 1YCYA 1LJOA 2JM9A 3JCMV 2MIOA 3PT9A 1PD1A 2ZPGB 1GCQC 4C5EA 3TEEA 2QYZA 1VQ4A 3LYIA 2EQKA 3EGXB 3G1JA 4HCBA 2EJGA 5KYWA 2QDLA 3L2ZA 4EMKC 1KD1C 3O5ZA 2EQIA 1UGPB 1SSFA 1JRIA 1ZUYA 4IUUA 3JB9F 2DYIA 2HQHA 3VKIA 2RF0A 1AWJA 1XOVA 3UA7A 2J6FA 1N8RC 3M0RA 2P0QA 4F16A 4PFZA 1HYOA 1X6OA 4ANJA 2W10A 2YLBA 3M0SA 1VIEA 3OW2S 1YIJT 2QDYB 4FW1A 3QUIA 4IUTA 2QTXA 3GIBA 4V2SA 2DNUA 4M7AE 4J9FA 2EQJA 1KFZA 3OA6A 1QQJA 3INZA 2VGMA 3ZFJA 4M7DC 1G2BA 2V1QA 3VRYA 1HJDA 2E5KA 4C8QE 2HSPA 3CCST 3CCLQ 2J6KA 2LCLA 2E41A 1Z9ZA 3A1PA 4J7IA 1JXOA 5D7UA 4M7AF 1AEYA 5FWCA 1WNLA 1UECA 4JJBA 2JUFA 1Q7YU 5CKHA 1VOMA 1K73R 4M75F 1RABB 2J05A 5LJ5g 3CCQQ 1QKXA 3QZ9B 3NTIA 2NUTB 3CCRA 3SFMA 1VQMQ 4C8QF 2K2VA 3X26B 2GFUA 3JB9H 3EG3A 4EPCA 1S72T 1B07A 1X75C 1JJ2P 1IREB 5CKBA 5A0DA 1SEMA 3JV3A 2JTMA 1OV3A 2M02A 4E7IA 1K9AA 4C5HA 3CBOA 2D8JA 1QVGP 4OB2B 3SB2A 3NMZC 3RERA 2BZXA 3OYFA 4JS5A 1OX8A 3JB9G 5GAN2 2K7AA 2X9HA 3ZL7C 2ESWA 2LP5A 2HSEB 1M1GA 3GF5A 1YWPA 4EMKB 2RO0A 2XK0A 1PSEA 3OS5A 4PLIA 2HCKA 2DMOA 4Z89A 3CXCP 3VS7A 3EG1A 3A98A 2OAWA 4DEXA 4QVDA 1VQPT 2KRNA 2QQRA 5J26A 2QXFA 3GBQA 5HKCA 1G83A 3EFRA 3BW1A 2DRKA 1PHTA 1H641 2BIVA 2K2MA 1OYXA 1KJWA 4C92A 4PJLA 4AG1C 1G8XA 1GCQA 3M0UA 4J6WA 2EGEA 2RHYA 1Z9QA 3E1SA 4M7DB 2HAXA 1D09B 2EQMA 1HSQA 2O9SA 4M4ZA 2DF6A 4RTVA 1CSKA 4M75G 2KAFA 1U1TA 3PMTA 5CIUA 2DXTA 2B86A 2EQUA 2YLCA 2YUQA 1VYUA 2K3YA 3LWHA 2C0OA 3CCLA 1M27C 3I56Q 3OSVA 2KMTA 3G4SA 2I2LA 1X01A 1ZA2B 3LW5E 4OMFB 1QP2A 1VQLQ 2HQEA 1AVZC 1C1AA 1K1ZA 4BY6C 3CBMA 1QVGA 2E10A 2JTFA 3CCQA 4M7DA 3SHWA 2DERA 1VQMA 5CR2A 4M78E 1IB8A 2R5MA 2DL4A 3N5BB 2JT4A 2X4XA 2KSSA 4E7JA 3M4YA 2JOYA 4MMKA 3MO8A 2EYZA 1BK2A 2NUPA 2K9GA 4JRKA 2YT6A 2KBTA 3LH5A 4DOVA 2F1LA 2BE9B 4Y91A 2RK2A 5FLXE 4RTXA 1S1NA 2D6FA 3HRUA 4M78F 1R77A 5KYYB 1QVFS 3A8OB 5I2MA 3S3NA 2BZ8A 1M1KC 1VA7A 1ARKA 1NLPC 1MV3A 3GLXA 2ZPFB 2CP0A 2EWNA 1YJNT 4IUPA 1I81A 4J9IA 2LX9A 3QYGB 3FLGA 3CC7Q 2XIDA 2HDAA 4RTUA 4ZGEB 2DLPA 2OTLT 1KC8U 2DYBA 2KXCA 1UB4A 2WSFE 5KYYA 4FCYA 5KH6A 2K3BA 3A8HB 1R8OB 4HCZA 5KE2A 1RLPC 3CMAT 2QA4T 3FEOA 2LNHB 2JZ2A 3OYHA 2DL7A 4OMOA 2LT1A 1ZQ1A 1UDLA 4PJOD 4F7UB 1G3WA 1T0HA 1WPYA 2DPPB 2L89A 2DILA 3WVDB 1WA7A 1GBQA 4ME7A 1VQ4T 2CUBA 4JJNK 4BI8B 2YRVA 1K76A 2LJ1A 2YRDA 4GY5A 1X2QA 3MEAA 3CD6A 1UGQB 1KHCA 2DXBA 2L3SA 3U23A 4MZPA 2J6OA 4PLLA 2R57A 4NL3A 1VQLA 2ROTA 4LD9K 5KYUA 2RD1A 3MEUA 1VQKA 4RG8A 1RACB 1VQ5Q 2RI3A 1Q86U 1E6GA 5GMKj 2RA2A 2KT8A 4ZNXA 2RK1A 4F7UA 1TSFA 3PGGA 4KGVB 4BDZA 1MUZA 5GANd 3HL8A 2E6NA 4RG2A 5KE3A 2V1RA 1IHVA 2CP7A 1N9SA 1WIEA 1D1BA 2NYSA 2PU9B 5D6WA 2FL7A 3JCMh 3HKSA 2PVGB 4IIOA 5IAYA 3JSCA 3EH1A 2DTIA 4PNOA 3QXEB 3M0QA 1YJ9Q 1TU0B 3EG9A 1RAHB 2Y4XA 3SD4A 2DEQA 1IGUA 2HD0A 3G7ZA 3CCRT 3ASKA 3WXMB 5ECAA 5C0MA 4HVVA 5J39A 1BIAA 1M8MA 2K5FA 4LXCA 5GANj 1C6VX 1MMAA 3CC7A 2WSCE 3FB9A 3G71Q 1YITT 1N27A 1ABOA 2DXCA 3H41A 5LJ3d 1M2VB 2LZ6B 3ME9A 5GANf 4QVCA 4JUVA 2HBWA 2PUOB 1WZOA 1XTDA 3OYBA 4J9CA 2ZGWA 1KQ1A 3SDZA 1Y0MA 2A28A 2GF7A 1KIKA 3JCMe 1Q81R 2FPFA 1OPLA 3QWXX 1CKBA 2KEAA 5CAIA 4FT4A 3RDVA 3QJYA 1ZLMA 3CMEQ 2Y90A 5CK9A 1I4K1 3RMSA 4F04B 1YJWQ 2QQSA 3DLMA 2QGGA 5GAOp 9ATCB 4ZTJA 2X35A 3H9NA 4DBFA 1QVPA 1KD1R 4XQ3A 4M77D 1DJ7B 2F2VA 1M2VA 2R5AA 2QTVA 2YUPA 2GTJA 1XNIA 1NJIU 1D3BB 4RTZA 5LJ3j 1N8RR 1VQ5A 1AHJB 1IO6A 1VQOQ 4QQDA 2O9VA 1A0NB 5FRMA 2VXEA 1W4SA 2DVEA 4LUEA 5LJ3f 3CPWP 5CKDA 3OB9A 2EKHA 3L2WA 1LNXA 4F14A 2OJ2A 3JAME 4PJOG 3VU3C 2DJQA 5KYXB 3CCLT 4RTTA 4J9EA 4OMMA 1PSFA 1JB0E 2LCCA 4X34A 2MI6A 2VUBA 4AFSC 3G4ST 2JW4A 2XICA 2DL5A 2QG9B 1TUGB 3EGUA 1YJ9A 4L5GA 4IURA 1T0JA 5LJ5h 3CCQT 1K0XA 3TVTA 4L6V5 1VQMT 1SHGA 1NYGA 2I0NA 2FG0A 1RI0A 3H0HA 1WDXA 1M90U 5IXFA 2KRSA 1M2OA 4X1VA 1IRXA 4UC4A 1J3TA 4DBQA 3VYGA 5GAMe 1BI3A 1V76A 2IVWA 5KYXA 4JZ4A 2MYSA 3KUFA 4DA4A 3LGLA 4Y28E 1XJWB 1QWFA 2XI9A 1UE9A 4M77F 2GFAA 5L23A 2LVMA 4BE1A 3M53A 4P5NA 4OMPA 1LCKA 4CRIA 2JVVA 4KBMB 3P8DA 4JRIA 3L2UA 1MHNA 2FHDA 2X4WA 1CKAA 2AZVA 4OB0B 3M0TA 5GAN5 4J6YA 2KVQG 3KBGA 1RLQC 3CMEA 1D0XA 2CZ7B 5IHKA 3T9NA 5GAOq 1Q81C 3CPWA 4C92C 8ATCB 1NPRA 1KC8C 1WQWA 3JCMQ 3QKJA 1UGVA 1WX6A 4NOYA 1TTHB 3OBYA 4HCKA 2CKKA 5LJ3g 4QKUA 2OI3A 2KROA 3RBBB 3VUZA 1VQOA 2MAMA 2G6FX 4RCBA 4R55A 5A0LA 4M7AA 2DA9A 3PVQA 1VIFA 4ZN1A 4OGEA 3UF4A 1ZUKA 1W2BP 2VB6A 1WXUA 4JPBW 2HQXA 1YP5A 1G3YA 1WYXA 5GAOr 3JCMP 5LL6S 5DLOA 4C8QA 2XHCA 3VS2A 2QQAA 2VKNA 2VXFA 4A4KA 1K0SA 4LN2A 3V8JA 3VS3A 2LTOA 4A4EA 4C0GA 3M57A 2G3RA 2H3JA 2FZKB 3EHRA 3CD6T 4M75E 5KCHA 1QCNA 1H8KA 4XTXA 1VQ7A 4NL2A 1Q86C 1MNDA 1ZA1B 3DLLA 2BTTA 3G6EA 1BCMA 3CCMQ 1K8AU 1VQKT 3M0PA 2RQVA 1VQ9T 4E7HA 2AZSA 2E64A 4M77G 1QWEA 2DBKA 4BB7A 2ATCB 3H0FA 2FPEA 3MPUB 5AYFA 4JDSA 1N9RA 1VYVA 2DFUA 1B34A 3OS1A 4Z02A 4ATOA 2V8IA 3MP6A 3BFMA 3OYNA 5IH2A 1OU8A 4LNPA 3OW2P 4KGZB 2LQKA 1MV0B 1Q95G 2EYXA 3JCMX 1AZGB 2XD0A 2KDSA 3M56A 3GOXA 4DBHA 3FJPA 4B9WA 2HL5C 3UT1A 3KFVA 4C92B 3CCJT 4J9GA 4C0ZA 1M1KR 2JM8A 1K9MU 3H6ZA 4DOWA 4FYWB 2ZCFB 1W2BA 3CC4Q 2MCNA 2DVJA 3LH0A 1MNEA 2JMCA 3TREA 3ZEHA 3I9QA 4J83A 4C92D 3JB9J 1X6BA 5CQXA 1GBRA 1BYMA 1G5VA 1M5Q1 3GNFB 2M0YA 2QK0A 1UEBA 4L59A 2CP5A 5I22A 2ZPIB 1VQ6Q 3OYGA 3E9FA 4BD3A 3BY7A 3JRZA 3A8MB 1PWTA 5I21A 2O31A 2HBPA 4BE0A 1YNZA 5FRNA 3CCVT 2COYA 1UFFA 1YCSB 1NJIC 2DJZA 4IUQA 2L2PA 5I2SA 1PD0A 3X24B 4XTYA 1FMKA 2O88A 2NUPB 1NG2A 2QQBA 5CKFA 3F70A 1VQ5T 4WCIA 1D1AA 3M9QA 4M7DD 1SG5A 5IN1A 3H8ZA 2WSEE 4M78A 1JJ2A 2EGAA 1PKTA 5C6SA 3NTHA 2L3PA 1YIJQ 3RKYA 3HFNA 2KY9A 2QGFB 3D7SB 1O9SA 2ZZDA 1ZUUA 1BKBA 5FWBA 3M54A 2H3EB 5GMKi 4E47A 2AK5A 3FIFA 2K4YA 3CC2Q 3AT1B 2ZPHB 4JLGA 4C0DC 1WHGA 3CCSQ 1I07A 2LRQA 5CVIA 3CXCA 4KH0B 2RH2A 2KK4A 5HCKA 1B7TA 2IIMA 2P0PA 1YHQT 2D1XA 2OX7A 2WACA 1YJ9T 2EYYA 3OQ5A 1B3QA 2YRCA 1M90C 2DKGA 2COWA 2RI5A 3P8BB 3MP1A 1SPKA 1SSHA 3CPFA 2P84A 3CC4A 4CC7A 3OMCA 1AWOA 1UGSB 1ZSZB 5CQYA 3DKMA 3H0IA 3HRTA 2HMAA 1XQHA 3HTRA 3PMIA 1Q82U 1HK9A 3V7SA 2JXBA 1KQSS 5DY9A 3TSZA 3WVEB 2KI7A 2DD5A 4LDWA 2YSQA 4FYVB 1M3CA 2FZCB 2YUNA 1E7OA 1GRIA 2CP6A 1PCXA 4MZTA 1BCOA 1PKSA 4QQGA 2FPDA 3E2UA 4LUDA 2FRYA 5KYUB 1EX4A 3EFOA 4HVUA 1E6HA 4ZGDB 3CMET 2DAQA 4HKEA 3S3MA 4OMQA 3CEYA 2RM4A 1ZSZA 4A53A 3JCMJ 4GLMA 3JCMb 4WF2A 1QVFP 3REAB 4B6MA 2EGCA 1QP3A 2RJEA 2JTEA 1TOVA 2O4XA 5DM7R 2EW3A 2EFIA 2GQIA 2D9TA 1TH7A 3ER0A 1Y71A 4C5IA 5J3BA 2E4HA 3I56A 1VQOT 4C92G 3NTKA 5GMKh 1OPKA 5FU7C 1N8RU 2DX1A 2RQUA 5GAN3 1TXQA 2J7IA 2FRWA 4JS4A 1AT1B 3JCMW 4DBRA 3EG9B 1VUBA 4C0DB 2A36A 4LDXA 2XDBA 4ELYC 4XU2A 2KXDA 1I1JA 4FSXA 2ED0A 3OBWA 3CC2A 1GFCA 1O75A 1C0MA 1TS9A 2EBPA 3JCMd 3CCSA 2LT4A 1VQ7T 2E6ZA 4CI0C 3OYCA 3URGA 4PJOE 2KQWA 3G6ET 4AFUC 4MDXA 4XK8E 5GJWB 1Q7YC 2ROLA 2FZGB 4CC3A 4OVAA 2CP3A 4M7DG 4ORZA 4PJMA 1EZZB 4IKFA 1FWZA 3UDCA 5A0GA 1I5OB 3ZBDA 1TWBA 1OZ3A 1WHJA 1WXBA 5GMKe 2HKQB 4PJOF 3RKWA 1I5LA 1ZX6A 4AG2C 2VV5A 2JMAA 3UPUA 2YXYA 1QVFA 2QQ9A 4LE9A 2C0IA 3CCUQ 3THKA 2OTJQ 3QDFA 2AKLA 1NEGA 2E65A 2MOXA 3OYJA 4O6JA 5I11A 2Z0WA 3L2QA 4FW2A 1N5ZA 4XU3A 1IHWA 1RI9A 3PE0A 1I0CA 3JCMf 1LOJA 4F7UF 3NGPA 1JXMA 1YWOA 2RQTA 2ZAEA 3M4GA 3V8LA 4FL6A 1OQKA 1ABQA 3J81E 4D8KA 3OYKA 1OOTA 5EG2A 4FYXB 4ELZC 1QW1A 4BDYA 2DZ9A 2E5QA 1MGQA 3RUXA 4J9BA 1KC8R 5FU7B 2L0AA 1G3TA 3QWYA 4M7AC 4EIKA 4II1A 5LJ3h 1X43A 4EMHA 1V1CA 1WHKA 4M75C 3OYMA 2IG0A 3BDUA 5GAMd 1T3SA 4C8QC 2SRCA 2DZCA 1RL2A 3CMAQ 1UUEA 2QA4Q 1NPPA 3EFSA 3I55Q 2EYWA 4KULA 1WQ7A 4KUDK 4HVWA 3EG0A 1KK7A 3Q1JA 2DETA 3EH2A 2JNGA 2KNBB 1FMWA 4RTYA 3J80E 2MMPA 1WJRA 2EAYA 2PVOB 2CDTA 4XTZA 1PNJA 1Q86R 1MMNA 4RKUE 3PTAA 3QHSA 3LLRA 3JCMc 2QASA 3C12A 1LVKA 4F17A 1BI1A 3OS0A 2RPNA 5GAMj 2SEMA 2L3RA 1OULA 3MCAB 5D6XA 2L5QA 1WFWA 2BE7D 2CGHA 4M77E 3RIRA 1FYNA 2CT3A 2A0FB 4F7UG 2ED1A 5GAMf 4QQ6A 3EG2A 2RQRA 2FYKA 3PIOA 1K73U 2KGTA 3C95A 1GXIE 2F2XA 3RESA 2LX7A 3FJ5A 4MZMA 5GANg 3PIPA 2DBMA 3HPWA 3CCUA 2OTJA 4A4FA 3G71A 3SWNA 2RJFA 5A2QE 1BI0A 4LDYA 3RKXA 2DK3A 3NHNA 2GBQA 4E7LA 4R0KA 3HRSA 4PJNA 3I5RA 4VUBA 3TSWA 4RTWA 4N4IA 1TG0A 2AHJB 2V8KA 2OAUA 1WGSA 5D6YA 1M9SA 1QLYA 1QCOA 3CC4T 4M7AB 2EKOA 3BE3A 1Q82C 1R0CB 4M75B 6AT1B 3R6OA 4BI3A 8AT1B 1F1BB 2P4TA 4D6WA 4C8QB 1YJWA 3EHQA 3QPHA 5GAN6 1JBMA 1YITQ 2HEQA 4AFQC 5LJ5e 1T3LA 4OB3B 5CCAA 3KXTA 3QZ5B 1KSWA 1BIBA 4M7AD 2LQ8A 1K4US 1RAAB 2K5LA 3CMAA 1R0BG 2CP2A 4X9CA 2RI2A 3UWNA 3GPLA 2BKDN 3I55A 4C8QD 1GCPA 1FMVA 4HT9A 2X4JA 3J7AF 2LCSA 2DXUA 4FSSA 2E70A 2VYTA 4M75A 3MKDA 4PK4A 3JB9I 5GJVB 4J9DA 4TVRA 2F2WA 2EPDA 1UTIA 4EDUA 3L42A 1RUWA 1NJIR 4M78C 1B34B 3HSBA 2EVRA 3QYHB 1ZSGA 1N6AA 3I56T 5FROA 1TUCA 4BE2A 1UHCA 1VQLT 5GAMg 1P92A 2DTHA 2MWOA 2RHZA 1JJ2S 4E7KA 1NLOC 3I5SA 2C0TA 1RAGB 2JS0A 3MHXA 3QSUA 1FX7A 1NZ9A 5IXBA 1JQQA 3EGXA 1OU9A 1QVGS 1VYTA 3C94A 3CC2T 1U5SA 3BDLA 2DL8A 4RCCA 2DO3A 3IQLA 4AT1B 2W0ZA 4LDUA 3MP8A 2CSIA 2E1HA 3VYHB 1HD3A 1VQ8Q 1EFNA 2LMJA 1WI7A 4A4HA 4BI4A 4ZTFA 1W6XA 3G4SQ 2HL3A 1RAFB 3HP9A 4J9HA 4ZGJB 3CXCS 4GLKA 2J06A 3CCEQ 1M90R 4A4GA 1VQNQ 3OYEA 4J8OA 2ECZA 3PFSA 4JJDA 2EJ9A 3META 2PVDB 4QW2A 1RAEB 2PTKA 2ZPEB 2EJFA 4PFOA 4DQ2A 3GP8A 1KG1A 5HK0A 3E19A 2CREA 4XU1A 3VS0A 2DD4A 4MMLA 2VVKA 1YITA 2QI2A 2VGNA 1ZHIA 3CC7T 2A08A 1AOJA 2QEXQ 1WJSA 4KUIA 4FM4B 7AT1B 4C0FA 4AMCA 5GMKm 1ZSZC 4PFPA 2X3WD 2MWPA 2F5KA 2NUTA 4Y92A 1BU1A 2CH4W 4M78B 1OX9A 5GMKl 2RJCA 4K11A 4Z8AA 1BB9A 1NM7A 1G3SA 1YI2Q 3L2VA 4JLIA 2K3XA 4BUGA 5GAOm 4CC2A 1QCFA 1QMCA 3MEVA 4XTUA 4R56A 2JN0A 4HA8A 5GAOl 4XTWA 2M1HA 3V7RA 4M78D 2BUDA 1EIFA 2K6DA 3ULRB 3RMQA 3EAEA 4KT0E 4XU0A 1ZBXA 1NBEB 3OYDA 2A7YA 4PJOC 3CCMA 4PJJA 4EMKA 1PG5B 3VS1A 3OW2A 2DL3A 2A37A 1TUDA 4M7AG 4N4HA 5L8RE 3TU4K 3QJ6A 4C92E 1NE8A 1KQ2A 2CZ0B 3CQTA 2RHIA 4QVZA 3OYIA 3REBB 2GQVA 4LDVA 4B9XA 4C8QG 1Y07A 2CS7A 1SF9A 2RB6A 1M8VA 2X3XD 4QT7A 1VQ8A 2XKOC 2F5TX 1U3OA 2CT4A 1K8AR 3CD6Q 2GNCA 4IIMA 1PC0A 2K5IA 4C92F 3CCEA 3GNGA 1VQKQ 1VQNA 2YDLA 1GL5A 1VQ9Q 1M3AA 1BI2A 1X2KA 1Q7YR 1AWWA 2CSQA 2R58A 1K73C 4RUGA 3C0CA 3L1AA 5GAN7 3A5ZB 3A8LB 3EFOB 2EIFA 2RNAA 4M7DE 3S3OA 2DIGA 4RMOA 4JRQA 3OYLA 3CCUT 2OTJT 2HZYA 3G71T 2QEXA 1S72Q 3V8KA 2RQWA 5FU6C 1SHFA 2O4XB 3M5AA 4C5GA 2DE0X 1YBYA 2CYZB 2GGRA 3DB4A 4XAXB 2LDMA 1PRLC 2KR3A 4JZ3A 1BBZA 4OF1A 1K9MR 2O2OA 3CCJQ 1U8RA 4HXJA 1X27A 2XMFA 4M7DF 1PM3A 2HKNA 1VQ6A 1PRMC 3S6WA 1YFNA 2VC8A 1IXDA 1YI2A 3CBPA 3OMGA 2YWWA 2E12A 2PNIA 2V26A 3OY9A 2CZ6B 1YJWT 4FU6A 2MF2A 2LNVA 2LC4A 1Q81U 4OMLA 4PJOB 2DEUA 2MK5A 4Q5WA 2LQWA 2ABLA 2XDDA 1VQPQ 4N0AC 2KRMA 2DTOA 4E6RA 4EMGA 2Y4YA 3UATA 3VV0A 3SEMA 3NFCA 2YHTA 1KD1U 1UJYA 3R6NA 2LJ3A 2COZA 3I55T 1JEGA 3PNWC 4ESRA 1KQSP 4AFZC 2KYBA 4E7ZA 1WLPB 2M9UA 1WXTA 1YIJA 1W1FA 3M58A 2L8DA 4XTVA 4M77C 1MMGA 2GCXA 3CCVQ 2BZYA 4A54A 4BY6B 4MDWA 4PJOA 2KE9A 5IHNA 5CKEA 3RNJA 1U06A 4X9DA 4KH1B 1RAIB 1ZBJA 1OI1A 2JS2A 1K8AC 3M55A 4NS5A 1VQ9A 1YN8A 5KCOA 3QG1A 4M78G 4E2FB 1UHFA 4E7SA 2RJDA 4J7FA 2FEIA 2P0KA 5FU6B 2CZ1B 4JRPA 3A8GB 3SWNC 2FO0A 1V29B 4OMNA 2E3IA 5GANh 3OYAA 4HCCA 1LPLA 2C06A 4F7UE 3X25B 1S72A 2O01E 3FDRA 2K79A 1HXDA 2AIRB 2DIQA 3MEWA 4OB1B 4J5YA 3QDRB 2L3QA 2AKKA 2EYQA 4FYYB 3RR6A 1YHQQ 1U1SA 2X51A 1WHMA 1H92A 3TQ7P 2PQWA 5IHIA 3CCJA 3DB3A 2D0QB 3LGFA 2M16A 3VJPA 1K9MC 1IZ6A 3HFOA 2VASA 2AT1B 4OGCA 2D0NA 1Q82R 1KQSA 1X69A 1X6GA 5HY6A 4Z88A 1SRMA 2XG8D 2XDPA 1VQPA 1Y96B 2HNIA 2NWMA 3VS5A 1MMDA 2YUOA 1YJNQ 1M30A 4GBQA 2LJ0A 3FC3A 3FRNA 2PZ1A 3CPWS 1D0YA 3NPFA 2DM1A 1NYFA 2V8JA 2OTLQ 4M77B 5GANe 2H8HA 2K57A 3MJXA 3OYYA 4WTOB 2E3HA 1AZEA 2DRMA 1SRLA 4YTLA 3VS4A 2FB7A 3QIIA 1WHHA 3HHTB 5EC7A 4N0AA 3X20B 4IUVA 2M0OA 1UG1A 1NEBA 1UGRB 4OP0A 3OS2A 2ENMA 3CCVA 5FW9A 2M51A 1W70A 3AHUA 2KT1A 1H3ZA 3I35A 5HK3A 4JJCA 1VQ4Q 1Y96A 4A63B 2P4RA 5AT1B 1JO8A 1D1CA 5CO7A 4J6XA 5GAOn 1IGQA 2XU8A 3LX7A 5GAMh 5KYNA 1Y57A 3CCMT 4M77A 1GFDA 3SWNB 4CC4B 4BACA 4KGXB 1ACMB 2GTOA 2NUZA 5LJ5d 1H3HA 1FXXA 1UJ0A 1D0ZA 1AWXA 4KRTA 3M59A 4O5VA 2NLUA 2RMOA 4D8DA 3VRZA 5LJ3e 3UA6A 1JU5C 1QKWA 2X4YA 3PVLA 4ZN3A 4FT2A 3VUBA 1VQ8T 2MPXC 5DLQE 1Y7XA 4LD6A 1D3BA 1WJQA 2CH4A 1VQ7Q 4DEYA 3TCJA 3JB9D 3V7CA 3EGDB 1YHQA 3G6EQ 3CCET 2D8HA 1VQNT 3QO3A 3JCMg 5M9OA 4HT8A 1AD5A 2FVUA 2RHUA 1OEBA 2RN8A 4PKCC 4N4GA 5LJ5j 5GAN4 2IPOB 2LQNA 2ZPBB 1KHIA 3P8HA 1M4ZA 3CCRQ
chains in the Genus database with same CATH topology
1BIAA 3X28B 2K5FA 1M1KU 4XU1A 5LJ5f 5GANj 5GAN8 3HRTA 2DD4A 4MMLA 1YITA 1YI2T 3LWIA 2PUKB 2QI2A 2VGNA 2QEXT 5IT9E 1YJNA 1XQHA 3CC7A 2WSCE 3PMIA 3FB9A 1YITT 3L2RA 1Q82U 1HK9A 2B8AA 3V7SA 1N27A 1W2BS 3C4SA 1ZHIA 1KQSS 3CC7T 2DXCA 5DY9A 1WJSA 2RHXA 3E9GA 5LJ3d 3ME9A 5GANf 1I8FA 3WVEB 4KUIA 4FM4B 4QVCA 2DD5A 3OSSC 1M1FA 4LDWA 4JUVA 2OTLA 4C0FA 1OZ2A 3QBYA 2PUOB 5GMKm 1XTDA 3OYBA 4PL6A 2ZGWA 1KQ1A 3SDZA 2MWPA 4MZTA 2F5KA 2F69A 4QQGA 4PJOD 1VQ6T 4M75D 4M78B 2GF7A 5GMKl 2QA4A 2A3LA 2RJCA 3O8VA 4ZGDB 4FIBA 3CMET 1YCYA 2DAQA 4HKEA 3JCMe 3S3MA 1LJOA 3JCMV 3CEYA 2RM4A 5CAIA 4FT4A 3PT9A 4A53A 1G3SA 3QJYA 3L2VA 2ZPGB 4JLIA 2K3XA 2Y90A 4BUGA 3TEEA 4C5EA 3JCMb 3JCMJ 4WF2A 5CK9A 5GAOm 1I4K1 3RMSA 1VQ4A 1QP3A 2EQKA 2RJEA 3LYIA 2QQSA 2O4XA 3DLMA 2EJGA 4HCBA 5GAOp 5DM7R 4ZTJA 2X35A 3L2ZA 3MEVA 4XTUA 4EMKC 1QVPA 1KD1C 4XQ3A 2JN0A 4R56A 2EFIA 4HA8A 1DJ7B 2R5AA 4M77D 4XTWA 2M1HA 3V7RA 1UGPB 4M78D 5GAOl 2D9TA 1TH7A 1SSFA 1JRIA 1EIFA 1Y71A 2BUDA 3ER0A 1XNIA 3EAEA 4IUUA 3RMQA 4KT0E 4XU0A 1ZBXA 3VKIA 1D3BB 5J3BA 1NJIU 1XOVA 3I56A 1VQOT 5LJ3j 4C92G 3OYDA 3NTKA 1N8RC 2A7YA 1AHJB 5GMKh 3JB9D 1VQ5A 2P0QA 4PJOC 3CCMA 5FU7C 4EMKA 1N8RU 3OW2A 4QQDA 5GAN3 1X6OA 4N4HA 5L8RE 5FRMA 2VXEA 1W4SA 2DVEA 3TU4K 4JS4A 2YLBA 1VIEA 3QJ6A 4C92E 1NE8A 5LJ3f 3OW2S 1KQ2A 2CZ0B 3JCMW 1YIJT 2RHIA 4QVZA 2QDYB 5CKDA 3QUIA 4IUTA 2QTXA 3OB9A 3OYIA 3GIBA 1VUBA 4C0DB 4LDXA 2XDBA 4V2SA 4ELYC 4M7AE 2GQVA 3L2WA 4LDVA 4XU2A 4B9XA 4C8QG 1LNXA 2EQJA 3OA6A 1Y07A 3INZA 4FSXA 2CS7A 3JAME 2VGMA 2RB6A 3OBWA 3CC2A 4PJOG 1M8VA 3ZFJA 1O75A 4M7DC 3VU3C 2XKOC 1VQ8A 2F5TX 3JCMd 3CCLT 3CCSA 4C8QE 1PSFA 2LT4A 1JB0E 2LCCA 4X34A 1VQ7T 3CCST 2E6ZA 2K5IA 4CI0C 2MI6A 3URGA 2VUBA 3OYCA 4PJOE 2KQWA 3G4ST 3G6ET 2XICA 2LCLA 4C92F 2E41A 4MDXA 3CCEA 4XK8E 3GNGA 1VQNA 4J7IA 1YJ9A 1BI2A 4IURA 4L5GA 1Q7YC 5LJ5h 4M7AF 3CCQT 1WNLA 1Q7YU 2JUFA 4OVAA 2R58A 4L6V5 5CKHA 1VQMT 1K73C 4M7DG 4M75F 5LJ5g 3L1AA 4IKFA 1RI0A 3QZ9B 1FWZA 1M90U 5GAN7 3NTIA 3UDCA 5A0GA 3A5ZB 3SFMA 3CCRA 3ZBDA 4C8QF 3A8LB 1OZ3A 4UC4A 2K2VA 3X26B 2EIFA 2GFUA 3JB9H 5GMKe 3S3OA 4M7DE 4PJOF 3RKWA 4EPCA 1I5LA 3VYGA 5GAMe 1S72T 1BI3A 1X75C 2DIGA 2IVWA 1IREB 4RMOA 4JRQA 3OYLA 5CKBA 5A0DA 3CCUT 2OTJT 2VV5A 3KUFA 3LGLA 4DA4A 3G71T 2QEXA 2JTMA 3V8KA 4Y28E 3UPUA 1QVFA 5FU6C 2QQ9A 2XI9A 4E7IA 2O4XB 3M5AA 4M77F 4C5HA 4C5GA 3CBOA 1YBYA 2CYZB 2E65A 2GFAA 3DB4A 3OYJA 4O6JA 4OB2B 4XAXB 2LDMA 2LVMA 3SB2A 3M53A 3L2QA 4BE1A 4OF1A 4P5NA 4XU3A 4CRIA 2JVVA 4KBMB 3P8DA 3OYFA 4JS5A 3JB9G 3RERA 4JRIA 3JCMf 3L2UA 1MHNA 5GAN2 2FHDA 1LOJA 1U8RA 4F7UF 2X4WA 4M7DF 3M4GA 4OB0B 3V8LA 5GAN5 1VQ6A 1M1GA 3GF5A 4FL6A 4J6YA 2KVQG 3KBGA 4EMKB 2RO0A 3J81E 2XK0A 3S6WA 1PSEA 2VC8A 3OS5A 4PLIA 3CBPA 3OYKA 1YI2A 3CMEA 2CZ7B 3OMGA 5EG2A 2E12A 3T9NA 4ELZC 1QW1A 5GAOq 1Q81C 3OY9A 3CPWA 2CZ6B 4C92C 4BDYA 2DZ9A 4QVDA 2E5QA 4FU6A 2MF2A 2LNVA 1YJWT 2LC4A 1MGQA 1VQPT 1Q81U 4PJOB 2QQRA 3RUXA 1NPRA 5J26A 1KC8C 2QXFA 5FU7B 1G3TA 4Q5WA 4M7AC 1WQWA 3JCMQ 3QKJA 5HKCA 2XDDA 4N0AC 3EFRA 4II1A 5LJ3h 2DTOA 3BW1A 4NOYA 4EMHA 4EMGA 2Y4YA 1H641 2BIVA 4M75C 3VV0A 3OYMA 1OYXA 2IG0A 3OBYA 3BDUA 4C92A 2CKKA 3NFCA 5LJ3g 2YHTA 5GAMd 1KD1U 3VUZA 4C8QC 1VQOA 2DZCA 2MAMA 1RL2A 4RCBA 4R55A 3E19A 5A0LA 4M7AA 3I55T 3PNWC 4J6WA 1VIFA 4ZN1A 4OGEA 2RHYA 3E1SA 1NPPA 4M7DB 2HAXA 2M9UA 3EFSA 2EQMA 2HQXA 4KULA 1YIJA 1G3YA 1WQ7A 5GAOr 3M58A 3JCMP 2L8DA 5LL6S 4C8QA 4XTVA 5DLOA 4KUDK 2XHCA 2QQAA 2VXFA 4M77C 4A4KA 4M75G 2KAFA 3Q1JA 1U1TA 3PMTA 2GCXA 3V8JA 4A54A 2LTOA 4MDWA 5CIUA 2JNGA 4A4EA 4BY6B 3J80E 2DXTA 2MMPA 4PJOA 1WJRA 2EAYA 5CKEA 2EQUA 2YLCA 4C0GA 3M57A 4X9DA 2PVOB 2G3RA 2H3JA 2K3YA 3LWHA 4M75E 5KCHA 3CD6T 4XTZA 3CCLA 4XTXA 1OI1A 1VQ7A 4NL2A 1Q86C 3PTAA 4RKUE 1K8AC 3QHSA 3M55A 3LLRA 3OSVA 4NS5A 3JCMc 3DLLA 2KMTA 3C12A 1VQ9A 5KCOA 2I2LA 3G4SA 3G6EA 1BI1A 1X01A 1K8AU 1VQKT 1VQ9T 3LW5E 4OMFB 2E64A 4E7HA 3QG1A 4M77G 3OS0A 1QP2A 2HQEA 4M78G 4BB7A 5GAMj 4BY6C 3CBMA 2L3RA 3MCAB 1QVGA 2E10A 2JTFA 5D6XA 3CCQA 2L5QA 4M7DA 2RJDA 4J7FA 5AYFA 2CGHA 4JDSA 1VQMA 4M77E 3RIRA 2P0KA 5CR2A 1N9RA 4M78E 2R5MA 5FU6B 4F7UG 3N5BB 2CZ1B 5GAMf 4JRPA 3A8GB 2X4XA 2KSSA 3SWNC 4QQ6A 4E7JA 1B34A 3M4YA 2JOYA 3OS1A 4MMKA 2FYKA 3PIOA 4Z02A 3MO8A 1K73U 4ATOA 1V29B 2V8IA 5GANh 3OYAA 1GXIE 3C95A 3BFMA 3MP6A 3OYNA 4HCCA 3QSUA 3RESA 2C06A 4F7UE 3X25B 1S72A 2O01E 4JRKA 3FDRA 1HXDA 2DIQA 4MZMA 3MEWA 2LQKA 4OB1B 5GANg 4J5YA 3HPWA 4DOVA 3PIPA 3CCUA 4A4FA 2OTJA 3G71A 3JCMX 3QDRB 4Y91A 3SWNA 2RJFA 5A2QE 2XD0A 1BI0A 2EYQA 4LDYA 3RKXA 2DK3A 2RK2A 5FLXE 1U1SA 2D6FA 3HRUA 2KDSA 4E7LA 3HRSA 2PQWA 3M56A 3GOXA 4M78F 4VUBA 3CCJA 1QVFS 3FJPA 4B9WA 3DB3A 4C92B 2D0QB 4N4IA 3LGFA 3A8OB 3UT1A 3CCJT 2M16A 5I2MA 3VJPA 2AHJB 2V8KA 3S3NA 2OAUA 1K9MC 4C0ZA 1WGSA 5D6YA 1IZ6A 1M9SA 3HFOA 1M1KC 3CC4T 1K9MU 4M7AB 3H6ZA 4DOWA 3JB9F 3GLXA 2EKOA 4OGCA 2ZPFB 2ZCFB 1W2BA 1Q82C 1KQSA 4M75B 3R6OA 4BI3A 2EWNA 5HY6A 3LH0A 1YJNT 2P4TA 4D6WA 4IUPA 4C8QB 1YJWA 2XG8D 2XDPA 1VQPA 3QPHA 5GAN6 3TREA 1JBMA 3ZEHA 1I81A 1Y96B 2HNIA 4J83A 4C92D 3JB9J 2LX9A 3QYGB 5LJ5e 3FLGA 4OB3B 5CCAA 5CQXA 2XIDA 3FRNA 3FC3A 3CPWS 3KXTA 4ZGEB 3QZ5B 2OTLT 1BYMA 1BIBA 4M7AD 1G5VA 1M5Q1 2LQ8A 1KC8U 1UB4A 3GNFB 2WSFE 2V8JA 4M77B 5GANe 5KH6A 1UEBA 4L59A 2K57A 3A8HB 1R8OB 2K5LA 3OYYA 4HCZA 3CMAA 4X9CA 3UWNA 2RI2A 3GPLA 2BKDN 5KE2A 2ZPIB 4YTLA 3CMAT 3I55A 2QA4T 2FB7A 4C8QD 3QIIA 3HHTB 3E9FA 3OYGA 3FEOA 4HT9A 2X4JA 2JZ2A 4N0AA 4BD3A 3OYHA 3J7AF 3X20B 2M0OA 4IUVA 2LT1A 1ZQ1A 3BY7A 3JRZA 3A8MB 1UGRB 4F7UB 1G3WA 2DPPB 1WPYA 2DXUA 2E70A 2L89A 4OP0A 2VYTA 4M75A 5I21A 4M7AG 3OS2A 3CCVA 3WVDB 2HBPA 3JB9I 4BE0A 4ME7A 1VQ4T 4JJNK 5FRNA 4TVRA 4BI8B 3CCVT 3AHUA 2YRVA 4EDUA 1H3ZA 3L42A 1NJIC 5HK3A 2DJZA 4M78C 4IUQA 1B34B 1Y96A 5I2SA 4GY5A 3HSBA 3X24B 3QYHB 4XTYA 5CO7A 4J6XA 3MEAA 3CD6A 1UGQB 1KHCA 2DXBA 1N6AA 5GAOn 3I56T 2QQBA 4MZPA 5FROA 4PLLA 2XU8A 3LX7A 3F70A 5CKFA 5GAMh 2R57A 4NL3A 1VQ5T 3CCMT 1VQLA 3M9QA 4M77A 4M7DD 5IN1A 3SWNB 3H8ZA 2WSEE 4M78A 4BE2A 1JJ2A 2RD1A 4LD9K 3MEUA 4BACA 1VQKA 4RG8A 1VQLT 5C6SA 1P92A 2RI3A 2DTHA 5GAMg 1Q86U 2MWOA 5LJ5d 2RHZA 1JJ2S 1FXXA 4E7KA 5GMKj 2RA2A 3NTHA 4C5IA 3MHXA 3RKYA 1FX7A 1NZ9A 2RK1A 3HFNA 2NLUA 2KY9A 3M59A 4O5VA 3PGGA 4F7UA 4BDZA 1O9SA 5GANd 2ZZDA 5LJ3e 3HL8A 1QVGS 2E6NA 4RG2A 1BKBA 3C94A 3CC2T 3M54A 5KE3A 2X4YA 5GMKi 3BDLA 4ZN3A 1N9SA 4FT2A 4RCCA 2DO3A 3VUBA 4E47A 1VQ8T 5DLQE 3FIFA 2PU9B 2K4YA 4LDUA 1Y7XA 3MP8A 5D6WA 2E1HA 1D3BA 4LD6A 1WJQA 3VYHB 2ZPHB 4JLGA 3TCJA 4C0DC 2FL7A 3JCMh 2LRQA 3HKSA 5CVIA 3V7CA 4A4HA 2PVGB 4BI4A 5IAYA 3CXCA 3JSCA 2RH2A 4ZTFA 2KK4A 1YHQA 3CCET 2DTIA 3HP9A 1VQNT 2P0PA 3QO3A 1YHQT 1YJ9T 2WACA 4PNOA 4ZGJB 3QXEB 3JCMg 5M9OA 3CXCS 3OQ5A 4GLKA 4HT8A 1M90C 2DKGA 4A4GA 2FVUA 4J8OA 3OYEA 3PFSA 2RI5A 2EJ9A 2RHUA 3P8BB 3META 3MP1A 2Y4XA 2PVDB 4QW2A 3SD4A 2ZPEB 2DEQA 2EJFA 2HD0A 3G7ZA 4N4GA 4PKCC 5LJ5j 5GAN4 3CCRT 3ASKA 3CPFA 3WXMB 4DQ2A 3GP8A 2ZPBB 3CC4A 1KG1A 1KHIA 3P8HA 3OMCA 5C0MA 1M4ZA 1UGSB 5HK0A 5J39A 5CQYA 3DKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KH6 A;  2LTO A;  4IUR A;  4L59 A;  5CIU A;  4A4E A;  4HCZ A;  3UWN A;  2RI2 A;  1WJR A;  2BKD N;  2EQU A;  5KE2 A;  4OVA A;  2G3R A;  3PMI A;  3L2R A;  2K3Y A;  2R58 A;  2B8A A;  3E9F A;  3QII A;  1N27 A;  3FEO A;  5KCH A;  3C4S A;  3OYG A;  4IKF A;  1RI0 A;  2JZ2 A;  4BD3 A;  1OI1 A;  3OYH A;  1WJS A;  2M0O A;  2RHX A;  3E9G A;  3ME9 A;  3NTI A;  4IUV A;  2L89 A;  3LLR A;  4NS5 A;  2VYT A;  3OS2 A;  1OZ3 A;  4UC4 A;  5KCO A;  4BE0 A;  1OZ2 A;  2GFU A;  3QBY A;  5FRN A;  3OYB A;  4E7H A;  3S3O A;  4PL6 A;  3OS0 A;  2HQE A;  2YRV A;  4EDU A;  1H3Z A;  2DIG A;  3L42 A;  2MWP A;  2L3R A;  4IUQ A;  2F5K A;  3OYL A;  4QQG A;  2JTF A;  5D6X A;  3KUF A;  3LGL A;  2RJD A;  4GY5 A;  2GF7 A;  2RJC A;  3O8V A;  3MEA A;  2DAQ A;  2O4X B;  2P0K A;  4E7I A;  1KHC A;  3S3M A;  4C5H A;  2R5M A;  4C5G A;  3CEY A;  2GFA A;  5FRO A;  3DB4 A;  4PLL A;  2X4X A;  3LX7 A;  3F70 A;  4QQ6 A;  3OYJ A;  2R57 A;  4E7J A;  2LDM A;  3L2V A;  3OS1 A;  2LVM A;  2K3X A;  4C5E A;  3M9Q A;  3L2Q A;  4BE1 A;  4Z02 A;  3MO8 A;  5IN1 A;  3H8Z A;  3OYA A;  4BE2 A;  4CRI A;  3MP6 A;  3OYN A;  3LYI A;  2EQK A;  2RJE A;  3MEU A;  3P8D A;  3OYF A;  4BAC A;  2QQS A;  2O4X A;  2RI3 A;  3DLM A;  5C6S A;  3L2U A;  1MHN A;  2MWO A;  2FHD A;  4ZTJ A;  2X35 A;  2X4W A;  2RHZ A;  4E7K A;  3FDR A;  3MEV A;  2DIQ A;  3MEW A;  3NTH A;  2EFI A;  4A4F A;  2R5A A;  4FL6 A;  2M1H A;  2RO0 A;  2NLU A;  2D9T A;  2RJF A;  2XK0 A;  4PLI A;  3S6W A;  3OYK A;  1SSF A;  2BUD A;  4IUU A;  4C5I A;  1XNI A;  3EAE A;  4BDZ A;  3OMG A;  3OYD A;  4E7L A;  3NTK A;  2PQW A;  3OY9 A;  2E6N A;  4RG2 A;  3GOX A;  4BDY A;  5KE3 A;  2X4Y A;  2E5Q A;  3BDL A;  4FU6 A;  4B9W A;  3DB3 A;  2QQR A;  4QQD A;  4N4I A;  3LGF A;  5J26 A;  3UT1 A;  4N4H A;  2M16 A;  5FRM A;  4Q5W A;  3S3N A;  3MP8 A;  5D6W A;  1WGS A;  3QJ6 A;  4LD6 A;  5D6Y A;  3QKJ A;  1WJQ A;  4II1 A;  2RHI A;  4QVZ A;  3H6Z A;  2LRQ A;  4A4H A;  4IUT A;  3OB9 A;  5IAY A;  3OYI A;  4ZTF A;  2BIV A;  2EKO A;  3OYM A;  1OYX A;  2IG0 A;  2CKK A;  3L2W A;  2WAC A;  4B9X A;  5M9O A;  2EQJ A;  3OQ5 A;  3OA6 A;  3LH0 A;  4A4G A;  3OYE A;  4IUP A;  3PFS A;  3PNW C;  2RI5 A;  2RHU A;  2XDP A;  2RHY A;  3MET A;  3MP1 A;  3ZEH A;  4QW2 A;  3SD4 A;  2LCC A;  4N4G A;  3FLG A;  4X34 A;  2EQM A;  3FC3 A;  3ASK A;  2HQX A;  3OYC A;  1G5V A;  2L8D A;  3P8H A;  3OMC A;  5C0M A;  5J39 A;  3Q1J A;  3PMT A; 
#chains in the Genus database with same CATH topology
 3X28 B;  1WHL A;  1M1K U;  5LJ5 f;  5GAN 8;  3LWI A;  2PUK B;  2CUD A;  5IT9 E;  2QEX T;  1YJN A;  5KYW B;  3L2R A;  2B8A A;  1W2B S;  3C4S A;  1SKU B;  3EGD A;  2RHX A;  3E9G A;  1I8F A;  1RAD B;  3OSS C;  2OTL A;  1M1F A;  2KYM A;  1OZ2 A;  3QBY A;  2JJ9 A;  3VS6 A;  4PL6 A;  2QAZ A;  2F69 A;  1VQ6 T;  4M75 D;  1M3B A;  2QA4 A;  2A3L A;  3O8V A;  1YI2 T;  4FIB A;  2VWF A;  1YCY A;  1LJO A;  2JM9 A;  3JCM V;  2MIO A;  3PT9 A;  1PD1 A;  2ZPG B;  1GCQ C;  4C5E A;  3TEE A;  2QYZ A;  1VQ4 A;  3LYI A;  2EQK A;  3EGX B;  3G1J A;  4HCB A;  2EJG A;  5KYW A;  2QDL A;  3L2Z A;  4EMK C;  1KD1 C;  3O5Z A;  2EQI A;  1UGP B;  1SSF A;  1JRI A;  1ZUY A;  4IUU A;  3JB9 F;  2DYI A;  2HQH A;  3VKI A;  2RF0 A;  1AWJ A;  1XOV A;  3UA7 A;  2J6F A;  1N8R C;  3M0R A;  2P0Q A;  4F16 A;  4PFZ A;  1HYO A;  1X6O A;  4ANJ A;  2W10 A;  2YLB A;  3M0S A;  1VIE A;  3OW2 S;  1YIJ T;  2QDY B;  4FW1 A;  3QUI A;  4IUT A;  2QTX A;  3GIB A;  4V2S A;  2DNU A;  4M7A E;  4J9F A;  2EQJ A;  1KFZ A;  3OA6 A;  1QQJ A;  3INZ A;  2VGM A;  3ZFJ A;  4M7D C;  1G2B A;  2V1Q A;  3VRY A;  1HJD A;  2E5K A;  4C8Q E;  2HSP A;  3CCS T;  3CCL Q;  2J6K A;  2LCL A;  2E41 A;  1Z9Z A;  3A1P A;  4J7I A;  1JXO A;  5D7U A;  4M7A F;  1AEY A;  5FWC A;  1WNL A;  1UEC A;  4JJB A;  2JUF A;  1Q7Y U;  5CKH A;  1VOM A;  1K73 R;  4M75 F;  1RAB B;  2J05 A;  5LJ5 g;  3CCQ Q;  1QKX A;  3QZ9 B;  3NTI A;  2NUT B;  3CCR A;  3SFM A;  1VQM Q;  4C8Q F;  2K2V A;  3X26 B;  2GFU A;  3JB9 H;  3EG3 A;  4EPC A;  1S72 T;  1B07 A;  1X75 C;  1JJ2 P;  1IRE B;  5CKB A;  5A0D A;  1SEM A;  3JV3 A;  2JTM A;  1OV3 A;  2M02 A;  4E7I A;  1K9A A;  4C5H A;  3CBO A;  2D8J A;  1QVG P;  4OB2 B;  3SB2 A;  3NMZ C;  3RER A;  2BZX A;  3OYF A;  4JS5 A;  1OX8 A;  3JB9 G;  5GAN 2;  2K7A A;  2X9H A;  3ZL7 C;  2ESW A;  2LP5 A;  2HSE B;  1M1G A;  3GF5 A;  1YWP A;  4EMK B;  2RO0 A;  2XK0 A;  1PSE A;  3OS5 A;  4PLI A;  2HCK A;  2DMO A;  4Z89 A;  3CXC P;  3VS7 A;  3EG1 A;  3A98 A;  2OAW A;  4DEX A;  4QVD A;  1VQP T;  2KRN A;  2QQR A;  5J26 A;  2QXF A;  3GBQ A;  5HKC A;  1G83 A;  3EFR A;  3BW1 A;  2DRK A;  1PHT A;  1H64 1;  2BIV A;  2K2M A;  1OYX A;  1KJW A;  4C92 A;  4PJL A;  4AG1 C;  1G8X A;  1GCQ A;  3M0U A;  4J6W A;  2EGE A;  2RHY A;  1Z9Q A;  3E1S A;  4M7D B;  2HAX A;  1D09 B;  2EQM A;  1HSQ A;  2O9S A;  4M4Z A;  2DF6 A;  4RTV A;  1CSK A;  4M75 G;  2KAF A;  1U1T A;  3PMT A;  5CIU A;  2DXT A;  2B86 A;  2EQU A;  2YLC A;  2YUQ A;  1VYU A;  2K3Y A;  3LWH A;  2C0O A;  3CCL A;  1M27 C;  3I56 Q;  3OSV A;  2KMT A;  3G4S A;  2I2L A;  1X01 A;  1ZA2 B;  3LW5 E;  4OMF B;  1QP2 A;  1VQL Q;  2HQE A;  1AVZ C;  1C1A A;  1K1Z A;  4BY6 C;  3CBM A;  1QVG A;  2E10 A;  2JTF A;  3CCQ A;  4M7D A;  3SHW A;  2DER A;  1VQM A;  5CR2 A;  4M78 E;  1IB8 A;  2R5M A;  2DL4 A;  3N5B B;  2JT4 A;  2X4X A;  2KSS A;  4E7J A;  3M4Y A;  2JOY A;  4MMK A;  3MO8 A;  2EYZ A;  1BK2 A;  2NUP A;  2K9G A;  4JRK A;  2YT6 A;  2KBT A;  3LH5 A;  4DOV A;  2F1L A;  2BE9 B;  4Y91 A;  2RK2 A;  5FLX E;  4RTX A;  1S1N A;  2D6F A;  3HRU A;  4M78 F;  1R77 A;  5KYY B;  1QVF S;  3A8O B;  5I2M A;  3S3N A;  2BZ8 A;  1M1K C;  1VA7 A;  1ARK A;  1NLP C;  1MV3 A;  3GLX A;  2ZPF B;  2CP0 A;  2EWN A;  1YJN T;  4IUP A;  1I81 A;  4J9I A;  2LX9 A;  3QYG B;  3FLG A;  3CC7 Q;  2XID A;  2HDA A;  4RTU A;  4ZGE B;  2DLP A;  2OTL T;  1KC8 U;  2DYB A;  2KXC A;  1UB4 A;  2WSF E;  5KYY A;  4FCY A;  5KH6 A;  2K3B A;  3A8H B;  1R8O B;  4HCZ A;  5KE2 A;  1RLP C;  3CMA T;  2QA4 T;  3FEO A;  2LNH B;  2JZ2 A;  3OYH A;  2DL7 A;  4OMO A;  2LT1 A;  1ZQ1 A;  1UDL A;  4PJO D;  4F7U B;  1G3W A;  1T0H A;  1WPY A;  2DPP B;  2L89 A;  2DIL A;  3WVD B;  1WA7 A;  1GBQ A;  4ME7 A;  1VQ4 T;  2CUB A;  4JJN K;  4BI8 B;  2YRV A;  1K76 A;  2LJ1 A;  2YRD A;  4GY5 A;  1X2Q A;  3MEA A;  3CD6 A;  1UGQ B;  1KHC A;  2DXB A;  2L3S A;  3U23 A;  4MZP A;  2J6O A;  4PLL A;  2R57 A;  4NL3 A;  1VQL A;  2ROT A;  4LD9 K;  5KYU A;  2RD1 A;  3MEU A;  1VQK A;  4RG8 A;  1RAC B;  1VQ5 Q;  2RI3 A;  1Q86 U;  1E6G A;  5GMK j;  2RA2 A;  2KT8 A;  4ZNX A;  2RK1 A;  4F7U A;  1TSF A;  3PGG A;  4KGV B;  4BDZ A;  1MUZ A;  5GAN d;  3HL8 A;  2E6N A;  4RG2 A;  5KE3 A;  2V1R A;  1IHV A;  2CP7 A;  1N9S A;  1WIE A;  1D1B A;  2NYS A;  2PU9 B;  5D6W A;  2FL7 A;  3JCM h;  3HKS A;  2PVG B;  4IIO A;  5IAY A;  3JSC A;  3EH1 A;  2DTI A;  4PNO A;  3QXE B;  3M0Q A;  1YJ9 Q;  1TU0 B;  3EG9 A;  1RAH B;  2Y4X A;  3SD4 A;  2DEQ A;  1IGU A;  2HD0 A;  3G7Z A;  3CCR T;  3ASK A;  3WXM B;  5ECA A;  5C0M A;  4HVV A;  5J39 A;  1BIA A;  1M8M A;  2K5F A;  4LXC A;  5GAN j;  1C6V X;  1MMA A;  3CC7 A;  2WSC E;  3FB9 A;  3G71 Q;  1YIT T;  1N27 A;  1ABO A;  2DXC A;  3H41 A;  5LJ3 d;  1M2V B;  2LZ6 B;  3ME9 A;  5GAN f;  4QVC A;  4JUV A;  2HBW A;  2PUO B;  1WZO A;  1XTD A;  3OYB A;  4J9C A;  2ZGW A;  1KQ1 A;  3SDZ A;  1Y0M A;  2A28 A;  2GF7 A;  1KIK A;  3JCM e;  1Q81 R;  2FPF A;  1OPL A;  3QWX X;  1CKB A;  2KEA A;  5CAI A;  4FT4 A;  3RDV A;  3QJY A;  1ZLM A;  3CME Q;  2Y90 A;  5CK9 A;  1I4K 1;  3RMS A;  4F04 B;  1YJW Q;  2QQS A;  3DLM A;  2QGG A;  5GAO p;  9ATC B;  4ZTJ A;  2X35 A;  3H9N A;  4DBF A;  1QVP A;  1KD1 R;  4XQ3 A;  4M77 D;  1DJ7 B;  2F2V A;  1M2V A;  2R5A A;  2QTV A;  2YUP A;  2GTJ A;  1XNI A;  1NJI U;  1D3B B;  4RTZ A;  5LJ3 j;  1N8R R;  1VQ5 A;  1AHJ B;  1IO6 A;  1VQO Q;  4QQD A;  2O9V A;  1A0N B;  5FRM A;  2VXE A;  1W4S A;  2DVE A;  4LUE A;  5LJ3 f;  3CPW P;  5CKD A;  3OB9 A;  2EKH A;  3L2W A;  1LNX A;  4F14 A;  2OJ2 A;  3JAM E;  4PJO G;  3VU3 C;  2DJQ A;  5KYX B;  3CCL T;  4RTT A;  4J9E A;  4OMM A;  1PSF A;  1JB0 E;  2LCC A;  4X34 A;  2MI6 A;  2VUB A;  4AFS C;  3G4S T;  2JW4 A;  2XIC A;  2DL5 A;  2QG9 B;  1TUG B;  3EGU A;  1YJ9 A;  4L5G A;  4IUR A;  1T0J A;  5LJ5 h;  3CCQ T;  1K0X A;  3TVT A;  4L6V 5;  1VQM T;  1SHG A;  1NYG A;  2I0N A;  2FG0 A;  1RI0 A;  3H0H A;  1WDX A;  1M90 U;  5IXF A;  2KRS A;  1M2O A;  4X1V A;  1IRX A;  4UC4 A;  1J3T A;  4DBQ A;  3VYG A;  5GAM e;  1BI3 A;  1V76 A;  2IVW A;  5KYX A;  4JZ4 A;  2MYS A;  3KUF A;  4DA4 A;  3LGL A;  4Y28 E;  1XJW B;  1QWF A;  2XI9 A;  1UE9 A;  4M77 F;  2GFA A;  5L23 A;  2LVM A;  4BE1 A;  3M53 A;  4P5N A;  4OMP A;  1LCK A;  4CRI A;  2JVV A;  4KBM B;  3P8D A;  4JRI A;  3L2U A;  1MHN A;  2FHD A;  2X4W A;  1CKA A;  2AZV A;  4OB0 B;  3M0T A;  5GAN 5;  4J6Y A;  2KVQ G;  3KBG A;  1RLQ C;  3CME A;  1D0X A;  2CZ7 B;  5IHK A;  3T9N A;  5GAO q;  1Q81 C;  3CPW A;  4C92 C;  8ATC B;  1NPR A;  1KC8 C;  1WQW A;  3JCM Q;  3QKJ A;  1UGV A;  1WX6 A;  4NOY A;  1TTH B;  3OBY A;  4HCK A;  2CKK A;  5LJ3 g;  4QKU A;  2OI3 A;  2KRO A;  3RBB B;  3VUZ A;  1VQO A;  2MAM A;  2G6F X;  4RCB A;  4R55 A;  5A0L A;  4M7A A;  2DA9 A;  3PVQ A;  1VIF A;  4ZN1 A;  4OGE A;  3UF4 A;  1ZUK A;  1W2B P;  2VB6 A;  1WXU A;  4JPB W;  2HQX A;  1YP5 A;  1G3Y A;  1WYX A;  5GAO r;  3JCM P;  5LL6 S;  5DLO A;  4C8Q A;  2XHC A;  3VS2 A;  2QQA A;  2VKN A;  2VXF A;  4A4K A;  1K0S A;  4LN2 A;  3V8J A;  3VS3 A;  2LTO A;  4A4E A;  4C0G A;  3M57 A;  2G3R A;  2H3J A;  2FZK B;  3EHR A;  3CD6 T;  4M75 E;  5KCH A;  1QCN A;  1H8K A;  4XTX A;  1VQ7 A;  4NL2 A;  1Q86 C;  1MND A;  1ZA1 B;  3DLL A;  2BTT A;  3G6E A;  1BCM A;  3CCM Q;  1K8A U;  1VQK T;  3M0P A;  2RQV A;  1VQ9 T;  4E7H A;  2AZS A;  2E64 A;  4M77 G;  1QWE A;  2DBK A;  4BB7 A;  2ATC B;  3H0F A;  2FPE A;  3MPU B;  5AYF A;  4JDS A;  1N9R A;  1VYV A;  2DFU A;  1B34 A;  3OS1 A;  4Z02 A;  4ATO A;  2V8I A;  3MP6 A;  3BFM A;  3OYN A;  5IH2 A;  1OU8 A;  4LNP A;  3OW2 P;  4KGZ B;  2LQK A;  1MV0 B;  1Q95 G;  2EYX A;  3JCM X;  1AZG B;  2XD0 A;  2KDS A;  3M56 A;  3GOX A;  4DBH A;  3FJP A;  4B9W A;  2HL5 C;  3UT1 A;  3KFV A;  4C92 B;  3CCJ T;  4J9G A;  4C0Z A;  1M1K R;  2JM8 A;  1K9M U;  3H6Z A;  4DOW A;  4FYW B;  2ZCF B;  1W2B A;  3CC4 Q;  2MCN A;  2DVJ A;  3LH0 A;  1MNE A;  2JMC A;  3TRE A;  3ZEH A;  3I9Q A;  4J83 A;  4C92 D;  3JB9 J;  1X6B A;  5CQX A;  1GBR A;  1BYM A;  1G5V A;  1M5Q 1;  3GNF B;  2M0Y A;  2QK0 A;  1UEB A;  4L59 A;  2CP5 A;  5I22 A;  2ZPI B;  1VQ6 Q;  3OYG A;  3E9F A;  4BD3 A;  3BY7 A;  3JRZ A;  3A8M B;  1PWT A;  5I21 A;  2O31 A;  2HBP A;  4BE0 A;  1YNZ A;  5FRN A;  3CCV T;  2COY A;  1UFF A;  1YCS B;  1NJI C;  2DJZ A;  4IUQ A;  2L2P A;  5I2S A;  1PD0 A;  3X24 B;  4XTY A;  1FMK A;  2O88 A;  2NUP B;  1NG2 A;  2QQB A;  5CKF A;  3F70 A;  1VQ5 T;  4WCI A;  1D1A A;  3M9Q A;  4M7D D;  1SG5 A;  5IN1 A;  3H8Z A;  2WSE E;  4M78 A;  1JJ2 A;  2EGA A;  1PKT A;  5C6S A;  3NTH A;  2L3P A;  1YIJ Q;  3RKY A;  3HFN A;  2KY9 A;  2QGF B;  3D7S B;  1O9S A;  2ZZD A;  1ZUU A;  1BKB A;  5FWB A;  3M54 A;  2H3E B;  5GMK i;  4E47 A;  2AK5 A;  3FIF A;  2K4Y A;  3CC2 Q;  3AT1 B;  2ZPH B;  4JLG A;  4C0D C;  1WHG A;  3CCS Q;  1I07 A;  2LRQ A;  5CVI A;  3CXC A;  4KH0 B;  2RH2 A;  2KK4 A;  5HCK A;  1B7T A;  2IIM A;  2P0P A;  1YHQ T;  2D1X A;  2OX7 A;  2WAC A;  1YJ9 T;  2EYY A;  3OQ5 A;  1B3Q A;  2YRC A;  1M90 C;  2DKG A;  2COW A;  2RI5 A;  3P8B B;  3MP1 A;  1SPK A;  1SSH A;  3CPF A;  2P84 A;  3CC4 A;  4CC7 A;  3OMC A;  1AWO A;  1UGS B;  1ZSZ B;  5CQY A;  3DKM A;  3H0I A;  3HRT A;  2HMA A;  1XQH A;  3HTR A;  3PMI A;  1Q82 U;  1HK9 A;  3V7S A;  2JXB A;  1KQS S;  5DY9 A;  3TSZ A;  3WVE B;  2KI7 A;  2DD5 A;  4LDW A;  2YSQ A;  4FYV B;  1M3C A;  2FZC B;  2YUN A;  1E7O A;  1GRI A;  2CP6 A;  1PCX A;  4MZT A;  1BCO A;  1PKS A;  4QQG A;  2FPD A;  3E2U A;  4LUD A;  2FRY A;  5KYU B;  1EX4 A;  3EFO A;  4HVU A;  1E6H A;  4ZGD B;  3CME T;  2DAQ A;  4HKE A;  3S3M A;  4OMQ A;  3CEY A;  2RM4 A;  1ZSZ A;  4A53 A;  3JCM J;  4GLM A;  3JCM b;  4WF2 A;  1QVF P;  3REA B;  4B6M A;  2EGC A;  1QP3 A;  2RJE A;  2JTE A;  1TOV A;  2O4X A;  5DM7 R;  2EW3 A;  2EFI A;  2GQI A;  2D9T A;  1TH7 A;  3ER0 A;  1Y71 A;  4C5I A;  5J3B A;  2E4H A;  3I56 A;  1VQO T;  4C92 G;  3NTK A;  5GMK h;  1OPK A;  5FU7 C;  1N8R U;  2DX1 A;  2RQU A;  5GAN 3;  1TXQ A;  2J7I A;  2FRW A;  4JS4 A;  1AT1 B;  3JCM W;  4DBR A;  3EG9 B;  1VUB A;  4C0D B;  2A36 A;  4LDX A;  2XDB A;  4ELY C;  4XU2 A;  2KXD A;  1I1J A;  4FSX A;  2ED0 A;  3OBW A;  3CC2 A;  1GFC A;  1O75 A;  1C0M A;  1TS9 A;  2EBP A;  3JCM d;  3CCS A;  2LT4 A;  1VQ7 T;  2E6Z A;  4CI0 C;  3OYC A;  3URG A;  4PJO E;  2KQW A;  3G6E T;  4AFU C;  4MDX A;  4XK8 E;  5GJW B;  1Q7Y C;  2ROL A;  2FZG B;  4CC3 A;  4OVA A;  2CP3 A;  4M7D G;  4ORZ A;  4PJM A;  1EZZ B;  4IKF A;  1FWZ A;  3UDC A;  5A0G A;  1I5O B;  3ZBD A;  1TWB A;  1OZ3 A;  1WHJ A;  1WXB A;  5GMK e;  2HKQ B;  4PJO F;  3RKW A;  1I5L A;  1ZX6 A;  4AG2 C;  2VV5 A;  2JMA A;  3UPU A;  2YXY A;  1QVF A;  2QQ9 A;  4LE9 A;  2C0I A;  3CCU Q;  3THK A;  2OTJ Q;  3QDF A;  2AKL A;  1NEG A;  2E65 A;  2MOX A;  3OYJ A;  4O6J A;  5I11 A;  2Z0W A;  3L2Q A;  4FW2 A;  1N5Z A;  4XU3 A;  1IHW A;  1RI9 A;  3PE0 A;  1I0C A;  3JCM f;  1LOJ A;  4F7U F;  3NGP A;  1JXM A;  1YWO A;  2RQT A;  2ZAE A;  3M4G A;  3V8L A;  4FL6 A;  1OQK A;  1ABQ A;  3J81 E;  4D8K A;  3OYK A;  1OOT A;  5EG2 A;  4FYX B;  4ELZ C;  1QW1 A;  4BDY A;  2DZ9 A;  2E5Q A;  1MGQ A;  3RUX A;  4J9B A;  1KC8 R;  5FU7 B;  2L0A A;  1G3T A;  3QWY A;  4M7A C;  4EIK A;  4II1 A;  5LJ3 h;  1X43 A;  4EMH A;  1V1C A;  1WHK A;  4M75 C;  3OYM A;  2IG0 A;  3BDU A;  5GAM d;  1T3S A;  4C8Q C;  2SRC A;  2DZC A;  1RL2 A;  3CMA Q;  1UUE A;  2QA4 Q;  1NPP A;  3EFS A;  3I55 Q;  2EYW A;  4KUL A;  1WQ7 A;  4KUD K;  4HVW A;  3EG0 A;  1KK7 A;  3Q1J A;  2DET A;  3EH2 A;  2JNG A;  2KNB B;  1FMW A;  4RTY A;  3J80 E;  2MMP A;  1WJR A;  2EAY A;  2PVO B;  2CDT A;  4XTZ A;  1PNJ A;  1Q86 R;  1MMN A;  4RKU E;  3PTA A;  3QHS A;  3LLR A;  3JCM c;  2QAS A;  3C12 A;  1LVK A;  4F17 A;  1BI1 A;  3OS0 A;  2RPN A;  5GAM j;  2SEM A;  2L3R A;  1OUL A;  3MCA B;  5D6X A;  2L5Q A;  1WFW A;  2BE7 D;  2CGH A;  4M77 E;  3RIR A;  1FYN A;  2CT3 A;  2A0F B;  4F7U G;  2ED1 A;  5GAM f;  4QQ6 A;  3EG2 A;  2RQR A;  2FYK A;  3PIO A;  1K73 U;  2KGT A;  3C95 A;  1GXI E;  2F2X A;  3RES A;  2LX7 A;  3FJ5 A;  4MZM A;  5GAN g;  3PIP A;  2DBM A;  3HPW A;  3CCU A;  2OTJ A;  4A4F A;  3G71 A;  3SWN A;  2RJF A;  5A2Q E;  1BI0 A;  4LDY A;  3RKX A;  2DK3 A;  3NHN A;  2GBQ A;  4E7L A;  4R0K A;  3HRS A;  4PJN A;  3I5R A;  4VUB A;  3TSW A;  4RTW A;  4N4I A;  1TG0 A;  2AHJ B;  2V8K A;  2OAU A;  1WGS A;  5D6Y A;  1M9S A;  1QLY A;  1QCO A;  3CC4 T;  4M7A B;  2EKO A;  3BE3 A;  1Q82 C;  1R0C B;  4M75 B;  6AT1 B;  3R6O A;  4BI3 A;  8AT1 B;  1F1B B;  2P4T A;  4D6W A;  4C8Q B;  1YJW A;  3EHQ A;  3QPH A;  5GAN 6;  1JBM A;  1YIT Q;  2HEQ A;  4AFQ C;  5LJ5 e;  1T3L A;  4OB3 B;  5CCA A;  3KXT A;  3QZ5 B;  1KSW A;  1BIB A;  4M7A D;  2LQ8 A;  1K4U S;  1RAA B;  2K5L A;  3CMA A;  1R0B G;  2CP2 A;  4X9C A;  2RI2 A;  3UWN A;  3GPL A;  2BKD N;  3I55 A;  4C8Q D;  1GCP A;  1FMV A;  4HT9 A;  2X4J A;  3J7A F;  2LCS A;  2DXU A;  4FSS A;  2E70 A;  2VYT A;  4M75 A;  3MKD A;  4PK4 A;  3JB9 I;  5GJV B;  4J9D A;  4TVR A;  2F2W A;  2EPD A;  1UTI A;  4EDU A;  3L42 A;  1RUW A;  1NJI R;  4M78 C;  1B34 B;  3HSB A;  2EVR A;  3QYH B;  1ZSG A;  1N6A A;  3I56 T;  5FRO A;  1TUC A;  4BE2 A;  1UHC A;  1VQL T;  5GAM g;  1P92 A;  2DTH A;  2MWO A;  2RHZ A;  1JJ2 S;  4E7K A;  1NLO C;  3I5S A;  2C0T A;  1RAG B;  2JS0 A;  3MHX A;  3QSU A;  1FX7 A;  1NZ9 A;  5IXB A;  1JQQ A;  3EGX A;  1OU9 A;  1QVG S;  1VYT A;  3C94 A;  3CC2 T;  1U5S A;  3BDL A;  2DL8 A;  4RCC A;  2DO3 A;  3IQL A;  4AT1 B;  2W0Z A;  4LDU A;  3MP8 A;  2CSI A;  2E1H A;  3VYH B;  1HD3 A;  1VQ8 Q;  1EFN A;  2LMJ A;  1WI7 A;  4A4H A;  4BI4 A;  4ZTF A;  1W6X A;  3G4S Q;  2HL3 A;  1RAF B;  3HP9 A;  4J9H A;  4ZGJ B;  3CXC S;  4GLK A;  2J06 A;  3CCE Q;  1M90 R;  4A4G A;  1VQN Q;  3OYE A;  4J8O A;  2ECZ A;  3PFS A;  4JJD A;  2EJ9 A;  3MET A;  2PVD B;  4QW2 A;  1RAE B;  2PTK A;  2ZPE B;  2EJF A;  4PFO A;  4DQ2 A;  3GP8 A;  1KG1 A;  5HK0 A;  3E19 A;  2CRE A;  4XU1 A;  3VS0 A;  2DD4 A;  4MML A;  2VVK A;  1YIT A;  2QI2 A;  2VGN A;  1ZHI A;  3CC7 T;  2A08 A;  1AOJ A;  2QEX Q;  1WJS A;  4KUI A;  4FM4 B;  7AT1 B;  4C0F A;  4AMC A;  5GMK m;  1ZSZ C;  4PFP A;  2X3W D;  2MWP A;  2F5K A;  2NUT A;  4Y92 A;  1BU1 A;  2CH4 W;  4M78 B;  1OX9 A;  5GMK l;  2RJC A;  4K11 A;  4Z8A A;  1BB9 A;  1NM7 A;  1G3S A;  1YI2 Q;  3L2V A;  4JLI A;  2K3X A;  4BUG A;  5GAO m;  4CC2 A;  1QCF A;  1QMC A;  3MEV A;  4XTU A;  4R56 A;  2JN0 A;  4HA8 A;  5GAO l;  4XTW A;  2M1H A;  3V7R A;  4M78 D;  2BUD A;  1EIF A;  2K6D A;  3ULR B;  3RMQ A;  3EAE A;  4KT0 E;  4XU0 A;  1ZBX A;  1NBE B;  3OYD A;  2A7Y A;  4PJO C;  3CCM A;  4PJJ A;  4EMK A;  1PG5 B;  3VS1 A;  3OW2 A;  2DL3 A;  2A37 A;  1TUD A;  4M7A G;  4N4H A;  5L8R E;  3TU4 K;  3QJ6 A;  4C92 E;  1NE8 A;  1KQ2 A;  2CZ0 B;  3CQT A;  2RHI A;  4QVZ A;  3OYI A;  3REB B;  2GQV A;  4LDV A;  4B9X A;  4C8Q G;  1Y07 A;  2CS7 A;  1SF9 A;  2RB6 A;  1M8V A;  2X3X D;  4QT7 A;  1VQ8 A;  2XKO C;  2F5T X;  1U3O A;  2CT4 A;  1K8A R;  3CD6 Q;  2GNC A;  4IIM A;  1PC0 A;  2K5I A;  4C92 F;  3CCE A;  3GNG A;  1VQK Q;  1VQN A;  2YDL A;  1GL5 A;  1VQ9 Q;  1M3A A;  1BI2 A;  1X2K A;  1Q7Y R;  1AWW A;  2CSQ A;  2R58 A;  1K73 C;  4RUG A;  3C0C A;  3L1A A;  5GAN 7;  3A5Z B;  3A8L B;  3EFO B;  2EIF A;  2RNA A;  4M7D E;  3S3O A;  2DIG A;  4RMO A;  4JRQ A;  3OYL A;  3CCU T;  2OTJ T;  2HZY A;  3G71 T;  2QEX A;  1S72 Q;  3V8K A;  2RQW A;  5FU6 C;  1SHF A;  2O4X B;  3M5A A;  4C5G A;  2DE0 X;  1YBY A;  2CYZ B;  2GGR A;  3DB4 A;  4XAX B;  2LDM A;  1PRL C;  2KR3 A;  4JZ3 A;  1BBZ A;  4OF1 A;  1K9M R;  2O2O A;  3CCJ Q;  1U8R A;  4HXJ A;  1X27 A;  2XMF A;  4M7D F;  1PM3 A;  2HKN A;  1VQ6 A;  1PRM C;  3S6W A;  1YFN A;  2VC8 A;  1IXD A;  1YI2 A;  3CBP A;  3OMG A;  2YWW A;  2E12 A;  2PNI A;  2V26 A;  3OY9 A;  2CZ6 B;  1YJW T;  4FU6 A;  2MF2 A;  2LNV A;  2LC4 A;  1Q81 U;  4OML A;  4PJO B;  2DEU A;  2MK5 A;  4Q5W A;  2LQW A;  2ABL A;  2XDD A;  1VQP Q;  4N0A C;  2KRM A;  2DTO A;  4E6R A;  4EMG A;  2Y4Y A;  3UAT A;  3VV0 A;  3SEM A;  3NFC A;  2YHT A;  1KD1 U;  1UJY A;  3R6N A;  2LJ3 A;  2COZ A;  3I55 T;  1JEG A;  3PNW C;  4ESR A;  1KQS P;  4AFZ C;  2KYB A;  4E7Z A;  1WLP B;  2M9U A;  1WXT A;  1YIJ A;  1W1F A;  3M58 A;  2L8D A;  4XTV A;  4M77 C;  1MMG A;  2GCX A;  3CCV Q;  2BZY A;  4A54 A;  4BY6 B;  4MDW A;  4PJO A;  2KE9 A;  5IHN A;  5CKE A;  3RNJ A;  1U06 A;  4X9D A;  4KH1 B;  1RAI B;  1ZBJ A;  1OI1 A;  2JS2 A;  1K8A C;  3M55 A;  4NS5 A;  1VQ9 A;  1YN8 A;  5KCO A;  3QG1 A;  4M78 G;  4E2F B;  1UHF A;  4E7S A;  2RJD A;  4J7F A;  2FEI A;  2P0K A;  5FU6 B;  2CZ1 B;  4JRP A;  3A8G B;  3SWN C;  2FO0 A;  1V29 B;  4OMN A;  2E3I A;  5GAN h;  3OYA A;  4HCC A;  1LPL A;  2C06 A;  4F7U E;  3X25 B;  1S72 A;  2O01 E;  3FDR A;  2K79 A;  1HXD A;  2AIR B;  2DIQ A;  3MEW A;  4OB1 B;  4J5Y A;  3QDR B;  2L3Q A;  2AKK A;  2EYQ A;  4FYY B;  3RR6 A;  1YHQ Q;  1U1S A;  2X51 A;  1WHM A;  1H92 A;  3TQ7 P;  2PQW A;  5IHI A;  3CCJ A;  3DB3 A;  2D0Q B;  3LGF A;  2M16 A;  3VJP A;  1K9M C;  1IZ6 A;  3HFO A;  2VAS A;  2AT1 B;  4OGC A;  2D0N A;  1Q82 R;  1KQS A;  1X69 A;  1X6G A;  5HY6 A;  4Z88 A;  1SRM A;  2XG8 D;  2XDP A;  1VQP A;  1Y96 B;  2HNI A;  2NWM A;  3VS5 A;  1MMD A;  2YUO A;  1YJN Q;  1M30 A;  4GBQ A;  2LJ0 A;  3FC3 A;  3FRN A;  2PZ1 A;  3CPW S;  1D0Y A;  3NPF A;  2DM1 A;  1NYF A;  2V8J A;  2OTL Q;  4M77 B;  5GAN e;  2H8H A;  2K57 A;  3MJX A;  3OYY A;  4WTO B;  2E3H A;  1AZE A;  2DRM A;  1SRL A;  4YTL A;  3VS4 A;  2FB7 A;  3QII A;  1WHH A;  3HHT B;  5EC7 A;  4N0A A;  3X20 B;  4IUV A;  2M0O A;  1UG1 A;  1NEB A;  1UGR B;  4OP0 A;  3OS2 A;  2ENM A;  3CCV A;  5FW9 A;  2M51 A;  1W70 A;  3AHU A;  2KT1 A;  1H3Z A;  3I35 A;  5HK3 A;  4JJC A;  1VQ4 Q;  1Y96 A;  4A63 B;  2P4R A;  5AT1 B;  1JO8 A;  1D1C A;  5CO7 A;  4J6X A;  5GAO n;  1IGQ A;  2XU8 A;  3LX7 A;  5GAM h;  5KYN A;  1Y57 A;  3CCM T;  4M77 A;  1GFD A;  3SWN B;  4CC4 B;  4BAC A;  4KGX B;  1ACM B;  2GTO A;  2NUZ A;  5LJ5 d;  1H3H A;  1FXX A;  1UJ0 A;  1D0Z A;  1AWX A;  4KRT A;  3M59 A;  4O5V A;  2NLU A;  2RMO A;  4D8D A;  3VRZ A;  5LJ3 e;  3UA6 A;  1JU5 C;  1QKW A;  2X4Y A;  3PVL A;  4ZN3 A;  4FT2 A;  3VUB A;  1VQ8 T;  2MPX C;  5DLQ E;  1Y7X A;  4LD6 A;  1D3B A;  1WJQ A;  2CH4 A;  1VQ7 Q;  4DEY A;  3TCJ A;  3JB9 D;  3V7C A;  3EGD B;  1YHQ A;  3G6E Q;  3CCE T;  2D8H A;  1VQN T;  3QO3 A;  3JCM g;  5M9O A;  4HT8 A;  1AD5 A;  2FVU A;  2RHU A;  1OEB A;  2RN8 A;  4PKC C;  4N4G A;  5LJ5 j;  5GAN 4;  2IPO B;  2LQN A;  2ZPB B;  1KHI A;  3P8H A;  1M4Z A;  3CCR Q; 
#chains in the Genus database with same CATH homology
 1BIA A;  3X28 B;  2K5F A;  1M1K U;  4XU1 A;  5LJ5 f;  5GAN j;  5GAN 8;  3HRT A;  2DD4 A;  4MML A;  1YIT A;  1YI2 T;  3LWI A;  2PUK B;  2QI2 A;  2VGN A;  2QEX T;  5IT9 E;  1YJN A;  1XQH A;  3CC7 A;  2WSC E;  3PMI A;  3FB9 A;  1YIT T;  3L2R A;  1Q82 U;  1HK9 A;  2B8A A;  3V7S A;  1N27 A;  1W2B S;  3C4S A;  1ZHI A;  1KQS S;  3CC7 T;  2DXC A;  5DY9 A;  1WJS A;  2RHX A;  3E9G A;  5LJ3 d;  3ME9 A;  5GAN f;  1I8F A;  3WVE B;  4KUI A;  4FM4 B;  4QVC A;  2DD5 A;  3OSS C;  1M1F A;  4LDW A;  4JUV A;  2OTL A;  4C0F A;  1OZ2 A;  3QBY A;  2PUO B;  5GMK m;  1XTD A;  3OYB A;  4PL6 A;  2ZGW A;  1KQ1 A;  3SDZ A;  2MWP A;  4MZT A;  2F5K A;  2F69 A;  4QQG A;  4PJO D;  1VQ6 T;  4M75 D;  4M78 B;  2GF7 A;  5GMK l;  2QA4 A;  2A3L A;  2RJC A;  3O8V A;  4ZGD B;  4FIB A;  3CME T;  1YCY A;  2DAQ A;  4HKE A;  3JCM e;  3S3M A;  1LJO A;  3JCM V;  3CEY A;  2RM4 A;  5CAI A;  4FT4 A;  3PT9 A;  4A53 A;  1G3S A;  3QJY A;  3L2V A;  2ZPG B;  4JLI A;  2K3X A;  2Y90 A;  4BUG A;  3TEE A;  4C5E A;  3JCM b;  3JCM J;  4WF2 A;  5CK9 A;  5GAO m;  1I4K 1;  3RMS A;  1VQ4 A;  1QP3 A;  2EQK A;  2RJE A;  3LYI A;  2QQS A;  2O4X A;  3DLM A;  2EJG A;  4HCB A;  5GAO p;  5DM7 R;  4ZTJ A;  2X35 A;  3L2Z A;  3MEV A;  4XTU A;  4EMK C;  1QVP A;  1KD1 C;  4XQ3 A;  2JN0 A;  4R56 A;  2EFI A;  4HA8 A;  1DJ7 B;  2R5A A;  4M77 D;  4XTW A;  2M1H A;  3V7R A;  1UGP B;  4M78 D;  5GAO l;  2D9T A;  1TH7 A;  1SSF A;  1JRI A;  1EIF A;  1Y71 A;  2BUD A;  3ER0 A;  1XNI A;  3EAE A;  4IUU A;  3RMQ A;  4KT0 E;  4XU0 A;  1ZBX A;  3VKI A;  1D3B B;  5J3B A;  1NJI U;  1XOV A;  3I56 A;  1VQO T;  5LJ3 j;  4C92 G;  3OYD A;  3NTK A;  1N8R C;  2A7Y A;  1AHJ B;  5GMK h;  3JB9 D;  1VQ5 A;  2P0Q A;  4PJO C;  3CCM A;  5FU7 C;  4EMK A;  1N8R U;  3OW2 A;  4QQD A;  5GAN 3;  1X6O A;  4N4H A;  5L8R E;  5FRM A;  2VXE A;  1W4S A;  2DVE A;  3TU4 K;  4JS4 A;  2YLB A;  1VIE A;  3QJ6 A;  4C92 E;  1NE8 A;  5LJ3 f;  3OW2 S;  1KQ2 A;  2CZ0 B;  3JCM W;  1YIJ T;  2RHI A;  4QVZ A;  2QDY B;  5CKD A;  3QUI A;  4IUT A;  2QTX A;  3OB9 A;  3OYI A;  3GIB A;  1VUB A;  4C0D B;  4LDX A;  2XDB A;  4V2S A;  4ELY C;  4M7A E;  2GQV A;  3L2W A;  4LDV A;  4XU2 A;  4B9X A;  4C8Q G;  1LNX A;  2EQJ A;  3OA6 A;  1Y07 A;  3INZ A;  4FSX A;  2CS7 A;  3JAM E;  2VGM A;  2RB6 A;  3OBW A;  3CC2 A;  4PJO G;  1M8V A;  3ZFJ A;  1O75 A;  4M7D C;  3VU3 C;  2XKO C;  1VQ8 A;  2F5T X;  3JCM d;  3CCL T;  3CCS A;  4C8Q E;  1PSF A;  2LT4 A;  1JB0 E;  2LCC A;  4X34 A;  1VQ7 T;  3CCS T;  2E6Z A;  2K5I A;  4CI0 C;  2MI6 A;  3URG A;  2VUB A;  3OYC A;  4PJO E;  2KQW A;  3G4S T;  3G6E T;  2XIC A;  2LCL A;  4C92 F;  2E41 A;  4MDX A;  3CCE A;  4XK8 E;  3GNG A;  1VQN A;  4J7I A;  1YJ9 A;  1BI2 A;  4IUR A;  4L5G A;  1Q7Y C;  5LJ5 h;  4M7A F;  3CCQ T;  1WNL A;  1Q7Y U;  2JUF A;  4OVA A;  2R58 A;  4L6V 5;  5CKH A;  1VQM T;  1K73 C;  4M7D G;  4M75 F;  5LJ5 g;  3L1A A;  4IKF A;  1RI0 A;  3QZ9 B;  1FWZ A;  1M90 U;  5GAN 7;  3NTI A;  3UDC A;  5A0G A;  3A5Z B;  3SFM A;  3CCR A;  3ZBD A;  4C8Q F;  3A8L B;  1OZ3 A;  4UC4 A;  2K2V A;  3X26 B;  2EIF A;  2GFU A;  3JB9 H;  5GMK e;  3S3O A;  4M7D E;  4PJO F;  3RKW A;  4EPC A;  1I5L A;  3VYG A;  5GAM e;  1S72 T;  1BI3 A;  1X75 C;  2DIG A;  2IVW A;  1IRE B;  4RMO A;  4JRQ A;  3OYL A;  5CKB A;  5A0D A;  3CCU T;  2OTJ T;  2VV5 A;  3KUF A;  3LGL A;  4DA4 A;  3G71 T;  2QEX A;  2JTM A;  3V8K A;  4Y28 E;  3UPU A;  1QVF A;  5FU6 C;  2QQ9 A;  2XI9 A;  4E7I A;  2O4X B;  3M5A A;  4M77 F;  4C5H A;  4C5G A;  3CBO A;  1YBY A;  2CYZ B;  2E65 A;  2GFA A;  3DB4 A;  3OYJ A;  4O6J A;  4OB2 B;  4XAX B;  2LDM A;  2LVM A;  3SB2 A;  3M53 A;  3L2Q A;  4BE1 A;  4OF1 A;  4P5N A;  4XU3 A;  4CRI A;  2JVV A;  4KBM B;  3P8D A;  3OYF A;  4JS5 A;  3JB9 G;  3RER A;  4JRI A;  3JCM f;  3L2U A;  1MHN A;  5GAN 2;  2FHD A;  1LOJ A;  1U8R A;  4F7U F;  2X4W A;  4M7D F;  3M4G A;  4OB0 B;  3V8L A;  5GAN 5;  1VQ6 A;  1M1G A;  3GF5 A;  4FL6 A;  4J6Y A;  2KVQ G;  3KBG A;  4EMK B;  2RO0 A;  3J81 E;  2XK0 A;  3S6W A;  1PSE A;  2VC8 A;  3OS5 A;  4PLI A;  3CBP A;  3OYK A;  1YI2 A;  3CME A;  2CZ7 B;  3OMG A;  5EG2 A;  2E12 A;  3T9N A;  4ELZ C;  1QW1 A;  5GAO q;  1Q81 C;  3OY9 A;  3CPW A;  2CZ6 B;  4C92 C;  4BDY A;  2DZ9 A;  4QVD A;  2E5Q A;  4FU6 A;  2MF2 A;  2LNV A;  1YJW T;  2LC4 A;  1MGQ A;  1VQP T;  1Q81 U;  4PJO B;  2QQR A;  3RUX A;  1NPR A;  5J26 A;  1KC8 C;  2QXF A;  5FU7 B;  1G3T A;  4Q5W A;  4M7A C;  1WQW A;  3JCM Q;  3QKJ A;  5HKC A;  2XDD A;  4N0A C;  3EFR A;  4II1 A;  5LJ3 h;  2DTO A;  3BW1 A;  4NOY A;  4EMH A;  4EMG A;  2Y4Y A;  1H64 1;  2BIV A;  4M75 C;  3VV0 A;  3OYM A;  1OYX A;  2IG0 A;  3OBY A;  3BDU A;  4C92 A;  2CKK A;  3NFC A;  5LJ3 g;  2YHT A;  5GAM d;  1KD1 U;  3VUZ A;  4C8Q C;  1VQO A;  2DZC A;  2MAM A;  1RL2 A;  4RCB A;  4R55 A;  3E19 A;  5A0L A;  4M7A A;  3I55 T;  3PNW C;  4J6W A;  1VIF A;  4ZN1 A;  4OGE A;  2RHY A;  3E1S A;  1NPP A;  4M7D B;  2HAX A;  2M9U A;  3EFS A;  2EQM A;  2HQX A;  4KUL A;  1YIJ A;  1G3Y A;  1WQ7 A;  5GAO r;  3M58 A;  3JCM P;  2L8D A;  5LL6 S;  4C8Q A;  4XTV A;  5DLO A;  4KUD K;  2XHC A;  2QQA A;  2VXF A;  4M77 C;  4A4K A;  4M75 G;  2KAF A;  3Q1J A;  1U1T A;  3PMT A;  2GCX A;  3V8J A;  4A54 A;  2LTO A;  4MDW A;  5CIU A;  2JNG A;  4A4E A;  4BY6 B;  3J80 E;  2DXT A;  2MMP A;  4PJO A;  1WJR A;  2EAY A;  5CKE A;  2EQU A;  2YLC A;  4C0G A;  3M57 A;  4X9D A;  2PVO B;  2G3R A;  2H3J A;  2K3Y A;  3LWH A;  4M75 E;  5KCH A;  3CD6 T;  4XTZ A;  3CCL A;  4XTX A;  1OI1 A;  1VQ7 A;  4NL2 A;  1Q86 C;  3PTA A;  4RKU E;  1K8A C;  3QHS A;  3M55 A;  3LLR A;  3OSV A;  4NS5 A;  3JCM c;  3DLL A;  2KMT A;  3C12 A;  1VQ9 A;  5KCO A;  2I2L A;  3G4S A;  3G6E A;  1BI1 A;  1X01 A;  1K8A U;  1VQK T;  1VQ9 T;  3LW5 E;  4OMF B;  2E64 A;  4E7H A;  3QG1 A;  4M77 G;  3OS0 A;  1QP2 A;  2HQE A;  4M78 G;  4BB7 A;  5GAM j;  4BY6 C;  3CBM A;  2L3R A;  3MCA B;  1QVG A;  2E10 A;  2JTF A;  5D6X A;  3CCQ A;  2L5Q A;  4M7D A;  2RJD A;  4J7F A;  5AYF A;  2CGH A;  4JDS A;  1VQM A;  4M77 E;  3RIR A;  2P0K A;  5CR2 A;  1N9R A;  4M78 E;  2R5M A;  5FU6 B;  4F7U G;  3N5B B;  2CZ1 B;  5GAM f;  4JRP A;  3A8G B;  2X4X A;  2KSS A;  3SWN C;  4QQ6 A;  4E7J A;  1B34 A;  3M4Y A;  2JOY A;  3OS1 A;  4MMK A;  2FYK A;  3PIO A;  4Z02 A;  3MO8 A;  1K73 U;  4ATO A;  1V29 B;  2V8I A;  5GAN h;  3OYA A;  1GXI E;  3C95 A;  3BFM A;  3MP6 A;  3OYN A;  4HCC A;  3QSU A;  3RES A;  2C06 A;  4F7U E;  3X25 B;  1S72 A;  2O01 E;  4JRK A;  3FDR A;  1HXD A;  2DIQ A;  4MZM A;  3MEW A;  2LQK A;  4OB1 B;  5GAN g;  4J5Y A;  3HPW A;  4DOV A;  3PIP A;  3CCU A;  4A4F A;  2OTJ A;  3G71 A;  3JCM X;  3QDR B;  4Y91 A;  3SWN A;  2RJF A;  5A2Q E;  2XD0 A;  1BI0 A;  2EYQ A;  4LDY A;  3RKX A;  2DK3 A;  2RK2 A;  5FLX E;  1U1S A;  2D6F A;  3HRU A;  2KDS A;  4E7L A;  3HRS A;  2PQW A;  3M56 A;  3GOX A;  4M78 F;  4VUB A;  3CCJ A;  1QVF S;  3FJP A;  4B9W A;  3DB3 A;  4C92 B;  2D0Q B;  4N4I A;  3LGF A;  3A8O B;  3UT1 A;  3CCJ T;  2M16 A;  5I2M A;  3VJP A;  2AHJ B;  2V8K A;  3S3N A;  2OAU A;  1K9M C;  4C0Z A;  1WGS A;  5D6Y A;  1IZ6 A;  1M9S A;  3HFO A;  1M1K C;  3CC4 T;  1K9M U;  4M7A B;  3H6Z A;  4DOW A;  3JB9 F;  3GLX A;  2EKO A;  4OGC A;  2ZPF B;  2ZCF B;  1W2B A;  1Q82 C;  1KQS A;  4M75 B;  3R6O A;  4BI3 A;  2EWN A;  5HY6 A;  3LH0 A;  1YJN T;  2P4T A;  4D6W A;  4IUP A;  4C8Q B;  1YJW A;  2XG8 D;  2XDP A;  1VQP A;  3QPH A;  5GAN 6;  3TRE A;  1JBM A;  3ZEH A;  1I81 A;  1Y96 B;  2HNI A;  4J83 A;  4C92 D;  3JB9 J;  2LX9 A;  3QYG B;  5LJ5 e;  3FLG A;  4OB3 B;  5CCA A;  5CQX A;  2XID A;  3FRN A;  3FC3 A;  3CPW S;  3KXT A;  4ZGE B;  3QZ5 B;  2OTL T;  1BYM A;  1BIB A;  4M7A D;  1G5V A;  1M5Q 1;  2LQ8 A;  1KC8 U;  1UB4 A;  3GNF B;  2WSF E;  2V8J A;  4M77 B;  5GAN e;  5KH6 A;  1UEB A;  4L59 A;  2K57 A;  3A8H B;  1R8O B;  2K5L A;  3OYY A;  4HCZ A;  3CMA A;  4X9C A;  3UWN A;  2RI2 A;  3GPL A;  2BKD N;  5KE2 A;  2ZPI B;  4YTL A;  3CMA T;  3I55 A;  2QA4 T;  2FB7 A;  4C8Q D;  3QII A;  3HHT B;  3E9F A;  3OYG A;  3FEO A;  4HT9 A;  2X4J A;  2JZ2 A;  4N0A A;  4BD3 A;  3OYH A;  3J7A F;  3X20 B;  2M0O A;  4IUV A;  2LT1 A;  1ZQ1 A;  3BY7 A;  3JRZ A;  3A8M B;  1UGR B;  4F7U B;  1G3W A;  2DPP B;  1WPY A;  2DXU A;  2E70 A;  2L89 A;  4OP0 A;  2VYT A;  4M75 A;  5I21 A;  4M7A G;  3OS2 A;  3CCV A;  3WVD B;  2HBP A;  3JB9 I;  4BE0 A;  4ME7 A;  1VQ4 T;  4JJN K;  5FRN A;  4TVR A;  4BI8 B;  3CCV T;  3AHU A;  2YRV A;  4EDU A;  1H3Z A;  3L42 A;  1NJI C;  5HK3 A;  2DJZ A;  4M78 C;  4IUQ A;  1B34 B;  1Y96 A;  5I2S A;  4GY5 A;  3HSB A;  3X24 B;  3QYH B;  4XTY A;  5CO7 A;  4J6X A;  3MEA A;  3CD6 A;  1UGQ B;  1KHC A;  2DXB A;  1N6A A;  5GAO n;  3I56 T;  2QQB A;  4MZP A;  5FRO A;  4PLL A;  2XU8 A;  3LX7 A;  3F70 A;  5CKF A;  5GAM h;  2R57 A;  4NL3 A;  1VQ5 T;  3CCM T;  1VQL A;  3M9Q A;  4M77 A;  4M7D D;  5IN1 A;  3SWN B;  3H8Z A;  2WSE E;  4M78 A;  4BE2 A;  1JJ2 A;  2RD1 A;  4LD9 K;  3MEU A;  4BAC A;  1VQK A;  4RG8 A;  1VQL T;  5C6S A;  1P92 A;  2RI3 A;  2DTH A;  5GAM g;  1Q86 U;  2MWO A;  5LJ5 d;  2RHZ A;  1JJ2 S;  1FXX A;  4E7K A;  5GMK j;  2RA2 A;  3NTH A;  4C5I A;  3MHX A;  3RKY A;  1FX7 A;  1NZ9 A;  2RK1 A;  3HFN A;  2NLU A;  2KY9 A;  3M59 A;  4O5V A;  3PGG A;  4F7U A;  4BDZ A;  1O9S A;  5GAN d;  2ZZD A;  5LJ3 e;  3HL8 A;  1QVG S;  2E6N A;  4RG2 A;  1BKB A;  3C94 A;  3CC2 T;  3M54 A;  5KE3 A;  2X4Y A;  5GMK i;  3BDL A;  4ZN3 A;  1N9S A;  4FT2 A;  4RCC A;  2DO3 A;  3VUB A;  4E47 A;  1VQ8 T;  5DLQ E;  3FIF A;  2PU9 B;  2K4Y A;  4LDU A;  1Y7X A;  3MP8 A;  5D6W A;  2E1H A;  1D3B A;  4LD6 A;  1WJQ A;  3VYH B;  2ZPH B;  4JLG A;  3TCJ A;  4C0D C;  2FL7 A;  3JCM h;  2LRQ A;  3HKS A;  5CVI A;  3V7C A;  4A4H A;  2PVG B;  4BI4 A;  5IAY A;  3CXC A;  3JSC A;  2RH2 A;  4ZTF A;  2KK4 A;  1YHQ A;  3CCE T;  2DTI A;  3HP9 A;  1VQN T;  2P0P A;  3QO3 A;  1YHQ T;  1YJ9 T;  2WAC A;  4PNO A;  4ZGJ B;  3QXE B;  3JCM g;  5M9O A;  3CXC S;  3OQ5 A;  4GLK A;  4HT8 A;  1M90 C;  2DKG A;  4A4G A;  2FVU A;  4J8O A;  3OYE A;  3PFS A;  2RI5 A;  2EJ9 A;  2RHU A;  3P8B B;  3MET A;  3MP1 A;  2Y4X A;  2PVD B;  4QW2 A;  3SD4 A;  2ZPE B;  2DEQ A;  2EJF A;  2HD0 A;  3G7Z A;  4N4G A;  4PKC C;  5LJ5 j;  5GAN 4;  3CCR T;  3ASK A;  3CPF A;  3WXM B;  4DQ2 A;  3GP8 A;  2ZPB B;  3CC4 A;  1KG1 A;  1KHI A;  3P8H A;  3OMC A;  5C0M A;  1M4Z A;  1UGS B;  5HK0 A;  5J39 A;  5CQY A;  3DKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...