2R57A

Crystal structure of the two mbt repeats from sex-comb on midleg (scm)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycomb protein Scm
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 51
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r57A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r57A01
3LLRA 2M1HA 4Q5WA 4HCZA 2NLUA 3OYAA 3S3OA 3FLGA 3OMGA 4II1A 4A4GA 2X4WA 3L2QA 2EKOA 2BKDN 4QQDA 2O4XB 2RHIA 3OYIA 4BE2A 2DIGA 4UC4A 3QIIA 3MEUA 3LX7A 1H3ZA 4X34A 4C5HA 3LH0A 3NTHA 2RO0A 3OYEA 2R58A 2LTOA 2RHZA 3C4SA 2RHUA 2EQUA 3ASKA 1RI0A 3E9GA 5C0MA 4QQ6A 1KHCA 3OMCA 3OYNA 5C6SA 3OYFA 4IKFA 4CRIA 2BIVA 2M0OA 4IUVA 3OYKA 3OB9A 1G5VA 3MEAA 3P8HA 4IUTA 2LCCA 3L42A 2LRQA 1N27A 3OYMA 3S3MA 3MP1A 2E6NA 3S3NA 4GY5A 4C5IA 3QKJA 3OYDA 3O8VA 3OYCA 3OA6A 2XK0A 2L89A 4A4FA 3OYLA 3LGFA 3OYHA 3ZEHA 4IUPA 2O4XA 1OZ3A 2D9TA 2LDMA 2EFIA 4N4IA 3OS2A 2BUDA 5FRMA 4Z02A 3PMIA 2FHDA 2LVMA 3H6ZA 5FRNA 1WJSA 3SD4A 3PFSA 3DB4A 3QBYA 3OQ5A 3FDRA 2E5QA 3OYBA 2HQEA 2B8AA 3L2RA 4BDYA 3F70A 4QQGA 4QVZA 4A4EA 2MWOA 2QQRA 2L8DA 2MWPA 4E7JA 4N4HA 2JZ2A 4ZTFA 3E9FA 2R5AA 3Q1JA 2RI5A 4NS5A 4B9XA 2WACA 3S6WA 3MEWA 3OY9A 3FC3A 4E7KA 1OYXA 5FROA 2CKKA 2EQMA 3OYGA 4RG2A 3ME9A 2DIQA 2GFUA 3LGLA 2HQXA 2RJCA 2F5KA 1XNIA 3M9QA 5KCOA 4E7LA 2VYTA 3MP8A 3MP6A 3KUFA 4N4GA 2XDPA 4PLIA 5IAYA 4PLLA 1OI1A 2DAQA 3META 4FL6A 5CIUA 4LD6A 4PL6A 2K3YA 3PMTA 3LYIA 4OVAA 5IN1A 5KCHA 3L2WA 3OS0A 1MHNA 2K3XA 3NTIA 2EQKA 2RHYA 2GF7A 3H8ZA 3OYJA 3QJ6A 5D6YA 3EAEA 4BE1A 3L2VA 2EQJA 3UWNA 4FU6A 3P8DA 5M9OA 1WGSA 3PNWC 3MEVA 5J39A 1OZ2A 5KE3A 3DB3A 2L3RA 2G3RA 2RJDA 3FEOA 4BD3A 2PQWA 2X4YA 2X4XA 4QW2A 4BDZA 3MO8A 2YRVA 5KE2A 4IURA 5D6WA 2RI2A 4A4HA 4B9WA 2RHXA 2R5MA 1WJQA 4E7IA 1WJRA 4IUUA 3GOXA 3BDLA 4ZTJA 4EDUA 2P0KA 2JTFA 2M16A 2IG0A 2RJEA 3UT1A 1SSFA 5KH6A 3NTKA 3CEYA 5J26A 3OS1A 4C5GA 3L2UA 4BACA 2QQSA 5D6XA 4BE0A 4E7HA 2GFAA 4L59A 2RJFA 4IUQA 4C5EA 2R57A 2RI3A 3DLMA 2X35A
chains in the Genus database with same CATH superfamily
2QA4A 1U5SA 3QWYA 2CZ0B 1N9RA 3A8OB 1W2BP 2D0QB 3CC2A 2LJ1A 3QG1A 4UC4A 1QLYA 1FX7A 4GBQA 1VQPA 3SB2A 1ZSZC 2LTOA 4J9GA 2PVOB 3E9GA 2KXDA 5CQXA 1YNZA 3X24B 4FCYA 1UTIA 4PK4A 4QKUA 2K79A 4EMHA 3GLXA 1HJDA 3CPWS 4C0DC 4Y91A 1Q95G 3M0TA 3O8VA 5AT1B 2RA2A 5FU7C 2O4XA 1OZ3A 5LJ5f 2A08A 1ABOA 2HMAA 2YSQA 1AWOA 1Q82C 4DBRA 5LL6S 3CCVQ 5LJ5d 2IIMA 4A4EA 1I1JA 3NPFA 3WVDB 1NLPC 1ACMB 3REAB 2FPDA 3GPLA 3EH1A 3CCUQ 2BZ8A 1OQKA 2DXBA 3KUFA 4L5GA 4XTWA 4F7UG 1W6XA 1T3SA 1QVFP 4D6WA 4KUDK 5L8RE 3GF5A 4R56A 1VQ7T 1UGPB 4ZN3A 3QJYA 3CCEQ 2L3RA 5GAMh 4C92D 4LDUA 2DXUA 2RI2A 2K6DA 3IQLA 4XTXA 2MCNA 3V7CA 2XIDA 3T9NA 3CCUT 1VUBA 4PJOG 1V1CA 4F17A 1KC8C 1S72A 1AOJA 3VYHB 4DQ2A 4NOYA 1ZUUA 5GANf 4KULA 3DLMA 1P92A 1VQMQ 3CC7Q 1WPYA 2DL7A 3I5RA 2NUPB 2NLUA 4C8QD 3FLGA 1YFNA 1WHKA 1UHCA 2RK1A 5GANd 3QIIA 2M02A 3CC4A 2R58A 2WSEE 2RH2A 1I07A 2H3EB 4MDWA 2MPXC 1YJNT 2LQNA 2DFUA 1SHGA 3A8MB 2G6FX 4OGCA 2L0AA 2K5LA 4FYWB 5GAOr 3OYLA 4IUPA 5CO7A 1RLPC 1EFNA 2ZCFB 1N8RU 3OQ5A 4F16A 1AEYA 2K2VA 4LE9A 1YITQ 4BUGA 5A0DA 2HCKA 1YJWQ 1RUWA 3Q1JA 1QMCA 4C92C 4QVDA 3CCJQ 4JS4A 2ZAEA 1VQ8T 2CZ6B 1J3TA 5HK0A 2RJCA 2COYA 4E7LA 3OW2S 3URGA 3C12A 3L2WA 1RL2A 2EQKA 2ZPHB 3JCMh 3E2UA 4PJOE 2DBMA 2V26A 4FU6A 2K5FA 2NYSA 4C8QC 3JB9F 2YRDA 2DLPA 3UDCA 1N8RC 1YIJA 3CBPA 4ZGJB 3M53A 1WJQA 1ZLMA 4JUVA 3RKWA 2D1XA 2GTJA 5GAOq 1VQ6T 3V8LA 5LJ5e 3SWNC 4J9IA 2F69A 3GIBA 5LJ3h 1VYVA 1ZX6A 1QVPA 1M1KU 3QDRB 4M75D 1VYUA 4FW1A 3CCSA 2DIGA 1YI2Q 4HKEA 2QQBA 1ZSGA 3ZL7C 2RHZA 3OYMA 4MDXA 2DJQA 3OMCA 3VJPA 2YT6A 5FU6B 1I5LA 1WHGA 3OB9A 3P8HA 2KT8A 4IUTA 4HCCA 2CZ7B 3RDVA 4A54A 4FSXA 4M77A 2EKHA 2H8HA 2M9UA 1NE8A 2CDTA 3EG9A 2L3QA 3JCMf 1OOTA 1K0SA 4N4IA 1OPKA 2PTKA 2JJ9A 4LDYA 3CMAT 5FRMA 2E6ZA 1YCYA 2JXBA 1E7OA 3JCMd 4J6YA 3F70A 2EQIA 5IH2A 2MWOA 2BE7D 2OI3A 2YRCA 5IXBA 1M1KC 2QQRA 4M77E 3QSUA 2LJ3A 4OB2B 2BZYA 3LWIA 5CQYA 4JJCA 4RTZA 3S6WA 3FC3A 1G3WA 3BW1A 2LX9A 2J6KA 1KQSA 5GANe 1KK7A 2OX7A 1RAIB 3C95A 2HQXA 4ELYC 1KQSP 3M0RA 1ZBJA 3MP6A 2KDSA 2OTJA 2JT4A 3EG2A 5A0LA 1K73C 3CCQT 5DM7R 2WSFE 2DVEA 1GL5A 2FZGB 3I56Q 2NUZA 1XOVA 5J39A 1JO8A 4N0AC 2RQVA 1Q86R 1QKXA 4M75C 3QUIA 3CD6A 1WXUA 2MK5A 3EGDB 3MO8A 3A98A 1R0BG 3CMEQ 1K8AR 3EG1A 1BI2A 2V8IA 2DA9A 2P0KA 1QQJA 2NWMA 1N6AA 5I2SA 4PFZA 4LD9K 4JJNK 1RAEB 2HZYA 1G3YA 4L59A 5GAMe 2ED0A 1BCMA 2LX7A 3CCLT 1CKBA 1B7TA 3H0HA 1ZSZB 4HCZA 1VQOT 2K5IA 1VQ5A 2X4WA 2QG9B 2QA4Q 2DMOA 2DL8A 3CC2Q 1NYGA 3NTHA 4WCIA 3M0SA 1VQLA 3TSWA 1HD3A 4EMKC 4JRQA 1VQPQ 4C0DB 1M5Q1 3JRZA 3CCRA 1SPKA 4J9CA 1IHVA 2HBWA 1YHQA 2LQWA 1JQQA 1NZ9A 2K9GA 1M9SA 4GY5A 3KFVA 4HT9A 1UJYA 4JDSA 4FM4B 4C92G 2X3WD 3VKIA 4Z02A 3QZ9B 3DB4A 2DD5A 1MMGA 3QHSA 1AT1B 3CC2T 2MYSA 2P0QA 3P8BB 1R77A 2L8DA 4E7JA 1VQPT 4JS5A 1OX9A 4KH0B 2FPEA 2Y4YA 3OY9A 1PC0A 1WHJA 1WQWA 4C8QG 4PJOD 2CP7A 4D8DA 3HFOA 1KFZA 4RTWA 4DEXA 2VASA 2KRMA 1H8KA 3M54A 1X2KA 2LQKA 4DOVA 5KE2A 3J81E 1LNXA 3AT1B 4ME7A 3G6EA 3TU4K 2PZ1A 3EFOB 2DRKA 5KYXA 1NJIU 5GAN3 3JCMe 4PJNA 2K2MA 3EFSA 2XHCA 1VQ9A 1O75A 4C92A 1K9AA 3MJXA 2RI3A 5HK3A 1S72Q 1U1TA 2JTEA 3VS6A 2F1LA 2FPFA 4OB0B 3D7SB 1TG0A 2E3IA 1PCXA 2DEQA 2PVGB 3MPUB 4R55A 3CC4Q 2PUOB 2M0OA 2FO0A 3BE3A 4C92E 1UDLA 3MHXA 4C8QA 2XICA 2KVQG 2LCCA 5LJ3g 3S3MA 2ZPEB 2E4HA 4KGZB 1WZOA 2E6NA 2L3PA 2X3XD 3JSCA 4C5IA 1ZUKA 1NJIC 4DEYA 2EYWA 2MOXA 4PJOC 4J9BA 3SWNA 4JRIA 1YJ9T 2V1RA 4C8QE 1IHWA 3L2RA 3HTRA 4QVZA 1WHHA 4EMGA 1TUDA 2DVJA 2R5AA 3CBMA 2ZGWA 1D1CA 3HSBA 3EGUA 2HBPA 4E47A 1LVKA 3LW5E 2PUKB 1M2VB 1VQNT 4PLIA 5CK9A 3I55A 4HVUA 1SG5A 4J5YA 5IN1A 1EX4A 3PMTA 1H92A 1KD1R 1VQ4A 4LDVA 2K3XA 1B34B 1D0YA 2L5QA 2QQ9A 5GAN7 1KIKA 4DBFA 5CCAA 3JB9J 2FZCB 2KYMA 5GAOn 1WA7A 2RQUA 2LZ6B 2KT1A 3VS7A 3JCMW 1QWEA 1OV3A 4DBQA 4JJDA 1MMDA 1Q7YR 2F5TX 2QTXA 1VQKT 1WX6A 4C5GA 2LQ8A 5CKDA 2RJFA 6AT1B 2P4RA 5KYYB 5LJ5h 1Q81R 2M51A 3OMGA 4II1A 4A4GA 2DYIA 2CGHA 2ECZA 4X34A 4C5HA 1N9SA 3OYEA 2FYKA 3CCSQ 3C4SA 2FG0A 2CSQA 3ASKA 1RI0A 3UA7A 2QEXA 1X2QA 2QASA 2BIVA 4JZ4A 4N0AA 2LMJA 4M75A 2ZPBB 4XTYA 3G71T 2J06A 4ZGDB 1W2BA 2E5KA 1YP5A 1Q82U 2CT3A 2VV5A 1PKSA 4J9DA 4RCBA 3OA6A 4WTOB 2D9TA 3OBWA 3PMIA 4J6XA 2FHDA 2DERA 1SKUB 3GBQA 5I21A 3PFSA 2EIFA 3FDRA 2HQEA 5I2MA 1O9SA 4M75E 4QQGA 1AD5A 2AKKA 1E6HA 3H0FA 1VIFA 1D3BB 1TUCA 4N4HA 1YWPA 1MUZA 5L23A 1K0XA 2Z0WA 4M7AD 3GNFB 2KRSA 4RTYA 4EMKA 2J7IA 1VA7A 4OMFB 1M4ZA 1WIEA 4X1VA 2C0OA 2L3SA 4M78B 5GANh 4PLLA 2CUBA 3NTIA 1VOMA 2OTJQ 3CCMA 5D6YA 1MV0B 3WVEB 1KC8U 1AZGB 1OEBA 3VUZA 2PQWA 5CKEA 3U23A 3X20B 4C0GA 1WQ7A 4M78F 4OMLA 4A4HA 2RHXA 1SHFA 3CD6Q 1RAHB 2HL3A 1V29B 1QVFA 2M16A 2DF6A 1Y71A 2O01E 1OPLA 4BE0A 5I22A 3CCVT 2OTJT 5AYFA 3VRZA 4BE2A 2O4XB 3X26B 4PJLA 1W2BS 2EBPA 3LX7A 1PWTA 2W10A 1VQ5Q 4HCKA 1RLQC 4OMPA 3DLLA 4IKFA 4OB1B 3EG3A 5C6SA 4DOWA 2DILA 3CD6T 3WXMB 1VQLQ 1JJ2P 1IB8A 3L42A 7AT1B 3OS5A 1ZHIA 4M7AC 1QW1A 3THKA 3GNGA 3CCRQ 3QKJA 1YHQQ 1OU8A 2CSIA 2L89A 3SFMA 5J3BA 1JRIA 4QVCA 3CCET 1GCQC 1WJSA 3OBYA 3SD4A 4BI4A 1I0CA 1YBYA 1T3LA 1UECA 4F7UA 2WACA 3MEWA 3QYGB 1CKAA 2CP5A 4J9HA 3UPUA 2OAUA 1VQMT 3CC7T 2VWFA 2HL5C 5GAN5 3VS5A 4GLKA 3RERA 2KGTA 1T0JA 4OMQA 4C0ZA 1OI1A 2RM4A 5CIUA 4LD6A 4PL6A 3LYIA 2CREA 3ZBDA 1C1AA 1QVFS 2EQJA 4F7UE 4NL3A 1MMNA 4X9DA 1T0HA 4PJJA 4PJOA 4A53A 4BDZA 4BD3A 2X4YA 1QP2A 3EGXA 1WLPB 2WSCE 4HT8A 2QXFA 4BY6B 1WJRA 3G6EQ 4OMOA 2BTTA 5HY6A 4YTLA 4AFQC 5KH6A 2MMPA 3RBBB 1BU1A 2R57A 2EYZA 2JN0A 5GAN2 4QT7A 3OYAA 1EZZB 1YITT 4J83A 1X6OA 3O5ZA 3FJPA 1YJWT 3LH0A 3I35A 1VYTA 3CCJT 2AIRB 2EYXA 2KROA 3OYFA 1K8AU 2DEUA 1ZBXA 3HFNA 2KEAA 4MMLA 5FW9A 2XDBA 1UE9A 1JB0E 2LRQA 2XI9A 1NEBA 5LJ5g 2FVUA 3OYCA 2YDLA 1OULA 3G4SA 4A4FA 2KE9A 1I81A 1SRMA 2DZCA 4JZ3A 1M90R 2QGFB 3QXEB 3BFMA 2I0NA 5FWBA 2O88A 2VUBA 2YLBA 1X6BA 4PJOF 1NG2A 2CP0A 4NL2A 1UGQB 1Q86C 3R6OA 1K73U 3MCAB 5FROA 2E65A 3OYGA 2RPNA 1K8AC 3JCMQ 1BI3A 1FYNA 1KHIA 2C0TA 2PNIA 2VC8A 4MZTA 5KCHA 1YI2T 5KYWA 3I55Q 2JM9A 4JJBA 1G2BA 1PNJA 2EYYA 1VQ4Q 1NYFA 2J6OA 1M1FA 3M55A 2GQIA 2EAYA 2O31A 2B86A 3QYHB 1XQHA 4KGXB 1PD0A 2DK3A 4M4ZA 3V8JA 2NUTA 5GANg 3PTAA 2KQWA 1IGUA 4EDUA 5D6XA 2XDDA 1UHFA 4M77B 1M3AA 5GAN6 2K57A 2QGGA 3G7ZA 2ESWA 5GJWB 3I55T 1U06A 3EG9B 2E1HA 1VQ4T 4M7AG 2KR3A 3V7SA 1GFCA 3E19A 1VQ7A 2RF0A 4KH1B 1KHCA 2EJGA 2A0FB 4M77F 2ZPGB 2QEXQ 1LCKA 3BDUA 3V7RA 1M27C 1RACB 1MNDA 2X4JA 2QDLA 2MF2A 3RMSA 1BI0A 5GAMg 2E70A 3JCMV 2RQTA 1SEMA 4J7IA 3I56T 2KK4A 2COZA 2D6FA 2DX1A 3QBYA 2M0YA 4RTTA 3PIOA 2JS0A 1BB9A 3M58A 1M30A 3CMET 1K1ZA 4LN2A 1PHTA 4KT0E 5FU7B 2F2WA 3E9FA 1QVGP 3HRSA 4NS5A 1YJNA 1UB4A 1BBZA 2SRCA 4OF1A 3RUXA 3A5ZB 2EQMA 4MMKA 3M0UA 4O5VA 1TWBA 2VXFA 1FXXA 2YUPA 2VVKA 4DA4A 5GAN8 4MZMA 1G83A 2XDPA 1KQSS 3HP9A 2QA4T 3META 4M7AA 3JB9D 3REBB 3RKYA 3OYJA 3UWNA 3CQTA 1ARKA 3CCMQ 2CP3A 3NHNA 1GCQA 3A8LB 3QWXX 1X43A 1LJOA 2V8JA 3DKMA 3QDFA 4D8KA 4K11A 4JLIA 4M7AE 1VQ8A 2PU9B 1Y96A 1PG5B 2JTFA 4HVWA 5DY9A 2KSSA 1FWZA 2JMCA 2GFAA 1UUEA 4IUQA 1KD1U 1LPLA 2C06A 5KYUA 1NM7A 2AK5A 4FT2A 2K3BA 5CAIA 4ATOA 3M57A 4BB7A 4AT1B 4CC4B 1I4K1 2HDAA 4XQ3A 1HXDA 2E3HA 2QAZA 3L2ZA 3MEUA 1MNEA 2RHUA 1UGSB 2DE0X 4QQ6A 3TCJA 3CXCA 3OYKA 4KGVB 3MEAA 3CXCP 3HPWA 5CVIA 3QO3A 3JCMg 4LDXA 1MV3A 1Y07A 3MP1A 2KRNA 4OB3B 1VQ6A 3H0IA 2VB6A 1W1FA 2VGMA 4M7DG 1Q81U 2RN8A 1IO6A 4F04B 4KUIA 2LVMA 4LDWA 1KD1C 2HD0A 1CSKA 1UGVA 2RQRA 5GAOp 2LCLA 5EC7A 5FWCA 3A8GB 2EW3A 4O6JA 2AKLA 2P4TA 1OYXA 3H41A 2YLCA 2JS2A 1S72T 3M0PA 5FLXE 1Q7YC 3MP8A 5KYXB 1TTHB 2ENMA 2MIOA 2K3YA 4OVAA 4ESRA 1QCOA 4C92B 1TS9A 3PVQA 3QJ6A 4XU3A 3CMAA 1BI1A 1WI7A 3VV0A 4P5NA 3CC4T 3JV3A 1Q81C 2DL3A 3MEVA 1XTDA 1OZ2A 4BI8B 2YRVA 1G3TA 4IURA 2LNHB 2YHTA 5GMKj 2LNVA 4J9EA 4PFOA 1JU5C 1WXBA 4FIBA 4C92F 4IUUA 2FRYA 2DPPB 4C8QB 4M7DA 1AVZC 2FB7A 4Z89A 4DBHA 2QQSA 3VU3C 3OSVA 2CYZB 1IRXA 1RAGB 5LJ3j 1XJWB 1WNLA 2CP2A 5FU6C 1TXQA 4A4KA 4M78G 3CCQA 3RNJA 1UEBA 2FEIA 2EKOA 3EHRA 4E6RA 2EVRA 4C8QF 3SWNB 2V1QA 1NLOC 4AFSC 5C0MA 2EQUA 4M7DE 2COWA 1YIJQ 2VGNA 4CRIA 4IUVA 1WYXA 3CPWP 1I8FA 1X69A 3INZA 2K7AA 1I5OB 2CT4A 3OYHA 2P0PA 2VXEA 3OS2A 1RI9A 3CCLA 3VRYA 2D8JA 1BCOA 1FMWA 1M8MA 2EYQA 1YWOA 4XU0A 1VQOA 1BYMA 2LP5A 1HK9A 1K9MC 4RCCA 4AMCA 1SF9A 3JB9I 1YIJT 2JZ2A 4JLGA 3BY7A 3RKXA 1BIAA 3OSSC 4C0FA 4LUEA 4VUBA 4RG2A 1NPRA 5CKFA 3VS3A 4PNOA 2YXYA 4EPCA 5IAYA 4KBMB 4XTZA 2DAQA 2EGEA 2J6FA 1B3QA 2RHYA 2GF7A 3GP8A 4XU2A 3EAEA 3CCST 1QCFA 4PFPA 1GBQA 2C0IA 4AFZC 2A36A 3JCMX 2RJDA 2X4XA 1ZQ1A 4OP0A 2KI7A 4RG8A 4B9WA 3VS1A 2A7YA 4M78E 2XMFA 5GAOl 1NPPA 2Y90A 2FL7A 4CC7A 3BDLA 3M59A 4RTUA 3UA6A 3NTKA 4J8OA 4XK8E 3PGGA 4M75B 1HYOA 4R0KA 3FB9A 4J9FA 1K9MR 2F2VA 5IXFA 3S3OA 1U8RA 3VS4A 3M4YA 4ELZC 1H3ZA 3M4GA 3PIPA 2E41A 8ATCB 3A1PA 4M75F 1GFDA 1WHLA 4B6MA 1KG1A 4A63B 1VQ7Q 3R6NA 1PRLC 1N5ZA 5ECAA 3JB9G 2XKOC 2HAXA 3S3NA 2NUPA 3CBOA 2DO3A 2DZ9A 2XK0A 4ZGEB 4EMKB 2QYZA 3LGFA 2A28A 2OAWA 2BUDA 1TUGB 4FYVB 1KSWA 1IGQA 1IXDA 2ROLA 1JJ2A 2HQHA 2B8AA 2IVWA 2HEQA 2JVVA 4FYXB 2DNUA 3HL8A 2MWPA 4GLMA 4LUDA 2L2PA 1X75C 4FYYB 1R8OB 3OW2A 4XAXB 2CKKA 3OW2P 2DIQA 1TOVA 1YJNQ 1XNIA 1TSFA 5KCOA 2VYTA 1M90U 2P84A 4F14A 1U3OA 4FL6A 2CS7A 1Q82R 2QTVA 1VQ5T 4FSSA 2LT4A 3C0CA 5M9OA 1MMAA 1YJ9A 5CR2A 2DXCA 2DRMA 1VQLT 1K76A 3DB3A 1NEGA 2G3RA 3ZFJA 2ZZDA 4AFUC 3PE0A 4Y92A 3M5AA 4JPBW 2DBKA 1M1GA 3QPHA 3CCRT 1YHQT 2GNCA 1RADB 4BACA 3M56A 4IIOA 1VQ8Q 1VQNA 3E1SA 2JNGA 4PKCC 2M1HA 4OMMA 3JAME 4M7DD 1KQ2A 4FT4A 1M90C 3TEEA 1AWJA 2BKDN 1QP3A 2O2OA 3HHTB 1WFWA 4QQDA 2O9VA 3OYIA 3UF4A 3JB9H 2GQVA 2RO0A 5GAMf 1YCSB 4E7KA 3PVLA 4RKUE 1K4US 2YUNA 4KRTA 5KYNA 1G5VA 1DJ7B 1UGRB 1KC8R 1Z9QA 1UG1A 2RMOA 5GAMd 1JJ2S 2KYBA 4F7UB 1VQ9Q 5HKCA 4HXJA 4LNPA 1RAAB 1VQKA 2EJ9A 3OYDA 2BZXA 2JTMA 1VQ6Q 2OTLA 2RB6A 3RESA 1Q86U 2ZPFB 3NGPA 2ABLA 1WHMA 4M77G 4CC3A 4IIMA 3RMQA 2X9HA 2ED1A 2JMAA 3RR6A 4F7UF 4BDYA 1YN8A 3VS0A 4RMOA 2H3JA 3G6ET 4ZTFA 2LJ0A 1R0CB 4PJOB 3KXTA 4ZN1A 3EGXB 5GMKh 3L1AA 1VQ9T 1PSFA 3G71A 5GMKi 1D0ZA 4ZNXA 3OS0A 1Z9ZA 3H8ZA 5IHIA 2GCXA 3L2VA 1X01A 4M78D 2DETA 2DTIA 3PNWC 4M7DC 1RABB 3CMAQ 3TSZA 3EHQA 1D0XA 2EJFA 2PVDB 2XU8A 4ZTJA 2HKQB 2ZPIB 1D1AA 4Z8AA 4E7HA 4XTUA 1EIFA 2LC4A 1E6GA 1V76A 2X51A 2RD1A 1H641 3EH2A 1BKBA 5LJ5j 5A2QE 1AZEA 2MAMA 1D1BA 3EGDA 2VKNA 1PRMC 4JRKA 3CCQQ 4TVRA 1N8RR 1PSEA 9ATCB 3HRUA 1X6GA 1M3BA 2E10A 2CH4A 2GGRA 3LH5A 1M8VA 1ZSZA 5LJ3f 2FRWA 4HA8A 3KBGA 2XD0A 2KXCA 1GBRA 3CCVA 2J05A 5FRNA 1Y57A 3VUBA 5LJ3d 5D7UA 2CUDA 5KYWB 3CCLQ 4AG1C 4RTXA 1VQOQ 2YUOA 4M78C 2CH4W 2JUFA 3JCMJ 1FMVA 4EIKA 4L6V5 2RI5A 3CCUA 2AZSA 4J7FA 4B9XA 3SDZA 2IPOB 2GBQA 2K4YA 3ME9A 4XTVA 1C0MA 1PM3A 2E12A 3UATA 1KQ1A 2DTOA 2NUTB 5GANj 1VIEA 1UJ0A 1JXMA 3TQ7P 4FW2A 1OX8A 2HSEB 1MHNA 2YWWA 3CCEA 1QVGA 1M1KR 2LCSA 1BIBA 2DL5A 2EGAA 3FEOA 3SEMA 4CI0C 2QEXT 2F2XA 1D09B 3VYGA 2ROTA 5D6WA 2ATCB 2EPDA 1G8XA 2R5MA 2OJ2A 1C6VX 2CP6A 2QDYB 1B07A 1QKWA 5J26A 2E64A 3CEYA 5HCKA 3CC7A 1VQMA 3RIRA 1K73R 5CKBA 1MGQA 4C5EA 2X35A 1JEGA 5CKHA 2KBTA 5GAMj 1PKTA 3TVTA 3OYYA 1JXOA 1M3CA 1WXTA 2DKGA 5GAN4 3EFOA 5I11A 1IREB 3I9QA 3OYNA 1IZ6A 3ER0A 4ORZA 2QK0A 5IHNA 5GJVB 1N27A 5GMKm 4X9CA 2XG8D 2LDMA 4XU1A 3CCMT 1W4SA 3QZ5B 1OU9A 4Y28E 1YITA 1AHJB 3OYBA 4M7AB 2Y4XA 1WDXA 2W0ZA 3FIFA 4RTVA 2DTHA 3LWHA 1YJWA 1Q7YU 3JCMb 2LT1A 2DYBA 3CCJA 1AWXA 4BI3A 2RQWA 3VS2A 4WF2A 3M0QA 1ZA2B 4MZPA 1A0NB 1KJWA 1QVGS 4ANJA 1BK2A 2GFUA 4M7AF 2AZVA 3M9QA 1TU0B 3NFCA 2MI6A 1Y96B 2DXTA 1QCNA 3EG0A 4Z88A 1NBEB 4BY6C 2AHJB 1SRLA 5EG2A 5GMKe 3P8DA 5KYUB 2HNIA 2A37A 2V8KA 2EWNA 1YJ9Q 4E7SA 2DM1A 1GCPA 4JRPA 1M2VA 3AHUA 4E7IA 4HVVA 3GOXA 3MKDA 5LJ3e 3UT1A 1LOJA 1Y0MA 1SSFA 1JBMA 3H9NA 1B34A 5DLOA 2HSPA 2GTOA 3X28B 1ZA1B 5GMKl 3LLRA 4Q5WA 2O9SA 1VQNQ 2KMTA 1YI2A 5DLQE 2A3LA 3ULRB 3L2QA 3N5BB 2HKNA 4V2SA 2EGCA 1ZUYA 2RHIA 3J7AF 1W70A 4OMNA 2DL4A 4M77D 1FMKA 3I5SA 3PT9A 2YUQA 3HRTA 2CZ1B 1Y7XA 1SSHA 3C94A 4PJMA 1UFFA 2FZKB 3G1JA 3X25B 3CXCS 2QQAA 2JOYA 2JM8A 5KYYA 1K9MU 3ZEHA 1QWFA 1VQKQ 4OGEA 4M75G 2EFIA 3JCMP 1ABQA 4E2FB 1U1SA 1X27A 1GRIA 3H6ZA 2DD4A 2QI2A 2OTLQ 5A0GA 5GAOm 3FRNA 4AG2C 2E5QA 2AT1B 4RUGA 3CPWA 3FJ5A 3J80E 3EFRA 4HCBA 4E7ZA 2JW4A 5IHKA 1TH7A 2D0NA 2KY9A 5IT9E 3LGLA 2DJZA 8AT1B 1NJIR 1RAFB 1G3SA 2F5KA 2SEMA 3G4SQ 4N4GA 3SHWA 3G71Q 1AWWA 3TREA 4M7DB 4J6WA 3HKSA 4BE1A 1S1NA 3I56A 2RNAA 2OTLT 1D3BA 1WGSA 2KNBB 5KE3A 4QW2A 3JCMc 3CMEA 2RK2A 4M77C 2KAFA 4LXCA 4M7DF 1GXIE 2I2LA 2D8HA 1M2OA 2BE9B 4CC2A 1F1BB 4M78A 2RJEA 2IG0A 3V8KA 3L2UA 3OS1A 1PD1A 3G4ST 3NMZC 1HSQA 3A8HB 1H3HA 3CPFA
chains in the Genus database with same CATH topology
4PKCC 3G7ZA 2M1HA 3JAME 2QA4A 2CZ0B 1N9RA 3A8OB 3I55T 4M7DD 2D0QB 1KQ2A 3CC2A 4FT4A 1M90C 2E1HA 1VQ4T 3TEEA 3QG1A 4OB0B 2BKDN 1QP3A 4QQDA 3HHTB 3V7SA 3OYIA 3JB9H 4M7AG 4UC4A 1FX7A 2GQVA 1VQPA 2RO0A 3E19A 3SB2A 2DEQA 2PVGB 5GAMf 1VQ7A 2LTOA 4E7KA 2PVOB 3E9GA 4R55A 1KHCA 2EJGA 2PUOB 4RKUE 4M77F 2M0OA 5CQXA 1G5VA 1DJ7B 4C92E 3MHXA 2ZPGB 4C8QA 1UGRB 3X24B 3BDUA 3V7RA 5GAMd 2XICA 2KVQG 2LCCA 5LJ3g 2X4JA 4EMHA 1JJ2S 3S3MA 2ZPEB 2MF2A 3GLXA 4F7UB 5HKCA 3CPWS 4C0DC 3RMSA 2E6NA 3JSCA 1VQKA 4C5IA 4Y91A 2EJ9A 1BI0A 3OYDA 5GAMg 3O8VA 2E70A 3JCMV 2JTMA 2RA2A 1NJIC 4J7IA 5FU7C 2O4XA 1OZ3A 2OTLA 4PJOC 2RB6A 3RESA 5LJ5f 2ZPFB 3I56T 1Q86U 2KK4A 2D6FA 4M77G 3SWNA 4JRIA 3QBYA 3RMQA 1YJ9T 4C8QE 1Q82C 3PIOA 5LL6S 3L2RA 3M58A 4F7UF 4BDYA 3CMET 5LJ5d 4QVZA 4A4EA 4EMGA 4RMOA 2H3JA 3G6ET 4KT0E 3WVDB 4ZTFA 5FU7B 3E9FA 2R5AA 3CBMA 2ZGWA 4PJOB 3HRSA 4NS5A 3GPLA 3KXTA 3HSBA 1YJNA 2HBPA 4ZN1A 1UB4A 4OF1A 3RUXA 4E47A 3A5ZB 2EQMA 4MMKA 3LW5E 4O5VA 2PUKB 5GMKh 2VXFA 3L1AA 1VQ9T 1FXXA 1PSFA 3G71A 5GMKi 4DA4A 5GAN8 4MZMA 1VQNT 4L5GA 2DXBA 3KUFA 4XTWA 2XDPA 4PLIA 4F7UG 5CK9A 3I55A 3HP9A 1KQSS 2QA4T 3META 4J5YA 5IN1A 3PMTA 1VQ4A 4M7AA 4LDVA 3JB9D 3OS0A 2K3XA 1B34B 3RKYA 3H8ZA 3OYJA 4D6WA 2GCXA 2L5QA 1X01A 3L2VA 2QQ9A 5GAN7 3UWNA 4M78D 4KUDK 5L8RE 2DTIA 3GF5A 3PNWC 5CCAA 4R56A 1VQ7T 4M7DC 1UGPB 3JB9J 4ZN3A 3QJYA 2L3RA 5GAOn 5GAMh 4C92D 4LDUA 3A8LB 2DXUA 2EJFA 2RI2A 3JCMW 2PVDB 1LJOA 4XTXA 2XU8A 2V8JA 3DKMA 3V7CA 2F5TX 2XIDA 3T9NA 4JLIA 3CCUT 1VUBA 4PJOG 2PU9B 2ZPIB 2QTXA 1Y96A 2JTFA 1VQ8A 1VQKT 5DY9A 1KC8C 1S72A 4C5GA 3VYHB 2KSSA 2LQ8A 1FWZA 4DQ2A 4NOYA 4E7HA 4XTUA 2GFAA 1EIFA 5CKDA 2RJFA 4IUQA 2LC4A 5GANf 1KD1U 4KULA 2RD1A 3DLMA 1P92A 1H641 1WPYA 2C06A 1BKBA 5LJ5j 5LJ5h 2NLUA 4C8QD 3FLGA 4FT2A 5A2QE 5CAIA 3OMGA 4ATOA 3M57A 4BB7A 4II1A 4A4GA 1I4K1 2RK1A 2MAMA 5GANd 4XQ3A 2CGHA 1HXDA 3L2ZA 3MEUA 3QIIA 4JRKA 4TVRA 4X34A 1N9SA 4C5HA 1PSEA 2FYKA 3OYEA 3CC4A 2R58A 2WSEE 3HRUA 2RH2A 3C4SA 2RHUA 1UGSB 3ASKA 1RI0A 4MDWA 2QEXA 4QQ6A 3TCJA 3CXCA 2BIVA 1YJNT 3OYKA 3MEAA 2E10A 3HPWA 4N0AA 4M75A 5CVIA 3QO3A 3JCMg 2ZPBB 4XTYA 3G71T 4LDXA 3A8MB 4ZGDB 1W2BA 1Y07A 3MP1A 4OGCA 1Q82U 4M7AE 1M8VA 2VV5A 2K5LA 4OB3B 1VQ6A 4RCBA 3OA6A 5LJ3f 3OYLA 2VGMA 4HA8A 5GAOr 4M7DG 3KBGA 4IUPA 1Q81U 2D9TA 5CO7A 2XD0A 3CMAT 3OBWA 3PMIA 4J6XA 3CCVA 4KUIA 2FHDA 2LVMA 2ZCFB 5FRNA 4LDWA 3PFSA 5I21A 1KD1C 1N8RU 3VUBA 2EIFA 3OQ5A 3FDRA 5LJ3d 2HD0A 2HQEA 5I2MA 1O9SA 4M75E 4QQGA 5GAOp 2K2VA 2LCLA 4M78C 1VIFA 3A8GB 1D3BB 2JUFA 4N4HA 4BUGA 5A0DA 3JCMJ 4O6JA 3Q1JA 2RI5A 3GNFB 4L6V5 4J7FA 4B9XA 3CCUA 4M7AD 2P4TA 4C92C 4QVDA 4JS4A 3SDZA 2K4YA 1VQ8T 1OYXA 2CZ6B 2YLCA 3ME9A 4XTVA 1S72T 2E12A 4EMKA 5HK0A 5FLXE 1KQ1A 2RJCA 1Q7YC 2DTOA 4OMFB 1M4ZA 4E7LA 3OW2S 3MP8A 4M78B 3URGA 5GANj 5GANh 1VIEA 3C12A 4PLLA 5GAOq 2K3YA 4OVAA 3L2WA 1RL2A 1MHNA 3NTIA 2EQKA 4C92B 2ZPHB 4XU3A 3QJ6A 5D6YA 3CCMA 3CMAA 1BI1A 3VV0A 3CCEA 3JCMh 1QVGA 4PJOE 4FU6A 2K5FA 4P5NA 3CC4T 1Q81C 3WVEB 3MEVA 1XTDA 4C8QC 1KC8U 3JB9F 1BIBA 1OZ2A 3FEOA 3VUZA 2PQWA 5CKEA 4BI8B 4CI0C 2QEXT 3UDCA 2YRVA 3VYGA 1G3TA 4IURA 1WQ7A 5D6WA 2YHTA 4M78F 3X20B 4C0GA 2LNVA 4A4HA 5GMKj 1YIJA 2RHXA 1N8RC 3CBPA 2R5MA 4FIBA 3M53A 4ZGJB 1WJQA 1V29B 4C92F 4JUVA 3RKWA 4IUUA 1QVFA 2QDYB 2M16A 1Y71A 2O01E 2E64A 3CEYA 2DPPB 5J26A 3V8LA 4C8QB 5LJ5e 2FB7A 1VQ6T 3SWNC 3CC7A 1VQMA 2QQSA 3RIRA 3VU3C 4BE0A 3OSVA 5CKBA 4IKFA 2CYZB 1MGQA 2F69A 3GIBA 4C5EA 5LJ3j 5LJ3h 1WNLA 5FU6C 2X35A 3CCVT 5CKHA 4A4KA 4M78G 2OTJT 1QVPA 3CCQA 1M1KU 5AYFA 3QDRB 4M75D 5GAMj 1UEBA 2EKOA 4BE2A 2O4XB 3X26B 3CCSA 1W2BS 2DIGA 3OYYA 3LX7A 4HKEA 2DKGA 4C8QF 5GAN4 3SWNB 2QQBA 3DLLA 2RHZA 3OYMA 5C0MA 2EQUA 4MDXA 1IREB 4M7DE 3OMCA 3VJPA 4OB1B 2VGNA 5C6SA 3OYNA 4CRIA 1IZ6A 5FU6B 4DOWA 4IUVA 1I5LA 3OB9A 3WXMB 3ER0A 3P8HA 3CD6T 4IUTA 3L42A 4HCCA 1I8FA 1N27A 2CZ7B 3OS5A 1ZHIA 4A54A 4M7AC 3INZA 4FSXA 4M77A 1QW1A 5GMKm 3GNGA 3QKJA 2M9UA 1NE8A 4X9CA 2L89A 2XG8D 3SFMA 3JCMf 3OYHA 5J3BA 2LDMA 4N4IA 2P0PA 2VXEA 4XU1A 3OS2A 3CCMT 4LDYA 1JRIA 1W4SA 4QVCA 4ZTJA 2E6ZA 1YCYA 3QZ5B 3CCET 3CCLA 1WJSA 3OBYA 2EYQA 4Y28E 3SD4A 1VQOA 1AHJB 4XU0A 1YITA 3JCMd 4J6YA 4M7AB 3OYBA 2Y4XA 1BYMA 3F70A 3FIFA 2DTHA 3LWHA 1YJWA 1HK9A 4BI4A 1Q7YU 4RCCA 1K9MC 2MWOA 3JCMb 1M1KC 1YBYA 3QSUA 2QQRA 2LT1A 4M77E 3JB9I 3CCJA 1YIJT 4OB2B 2JZ2A 4JLGA 4BI3A 3LWIA 3BY7A 5CQYA 4WF2A 4F7UA 4MZPA 2WACA 3RKXA 1BIAA 3MEWA 3QYGB 3S6WA 3FC3A 1G3WA 3BW1A 3OSSC 4C0FA 2LX9A 1KQSA 1QVGS 4VUBA 5GANe 4RG2A 3UPUA 1NPRA 2GFUA 2OAUA 3C95A 5CKFA 1VQMT 2HQXA 3CC7T 4ELYC 4M7AF 5GAN5 3M9QA 4PNOA 4GLKA 3MP6A 3NFCA 2KDSA 2MI6A 4EPCA 3RERA 5IAYA 4KBMB 1Y96B 4C0ZA 4XTZA 2OTJA 1OI1A 2DAQA 2RM4A 5CIUA 5A0LA 4LD6A 4PL6A 3LYIA 1K73C 3ZBDA 3CCQT 2DXTA 4BY6C 2RHYA 2GF7A 3GP8A 4XU2A 3EAEA 5DM7R 2AHJB 2WSFE 3CCST 1QVFS 2DVEA 2EQJA 5EG2A 4F7UE 4NL3A 5GMKe 3P8DA 4X9DA 5J39A 1XOVA 2HNIA 4N0AC 4PJOA 3JCMX 4M75C 2RJDA 4A53A 3QUIA 2V8KA 2X4YA 2EWNA 2X4XA 4BD3A 4BDZA 1QP2A 3CD6A 3MO8A 1ZQ1A 4OP0A 4RG8A 4B9WA 2A7YA 5FRMA 2WSCE 4M78E 4HT8A 4JRPA 2QXFA 4BY6B 1BI2A 5GAOl 1NPPA 4E7IA 3AHUA 2Y90A 2FL7A 1WJRA 3GOXA 3BDLA 2V8IA 5LJ3e 3M59A 2P0KA 3UT1A 1LOJA 1SSFA 4YTLA 1N6AA 3NTKA 5HY6A 5KH6A 2MMPA 4J8OA 1JBMA 4XK8E 3PGGA 5I2SA 4M75B 1B34A 5DLOA 4JJNK 4LD9K 1G3YA 4L59A 5GAMe 3X28B 2R57A 3FB9A 5GMKl 2JN0A 3LLRA 4Q5WA 3CCLT 5GAN2 4HCZA 3OYAA 3S3OA 1U8RA 2KMTA 1VQOT 1YI2A 3M4YA 4J83A 5DLQE 1YITT 2A3LA 2K5IA 1X6OA 2X4WA 3N5BB 3L2QA 1VQ5A 2RHIA 3J7AF 4V2SA 4ELZC 3FJPA 1YJWT 4M77D 1H3ZA 3M4GA 3LH0A 3NTHA 3PIPA 3CCJT 3PT9A 2E41A 1VQLA 4M75F 3HRTA 2CZ1B 3OYFA 4EMKC 1KG1A 4JRQA 1K8AU 4C0DB 1ZBXA 1Y7XA 1M5Q1 3C94A 3HFNA 4MMLA 3JRZA 2XDBA 3CCRA 1JB0E 2LRQA 3JB9G 2XI9A 2XKOC 2HAXA 1YHQA 3X25B 3CXCS 2QQAA 5LJ5g 1NZ9A 2FVUA 2JOYA 3S3NA 1M9SA 4GY5A 3CBOA 1K9MU 2DO3A 3OYCA 2DZ9A 2XK0A 3G4SA 4A4FA 4ZGEB 4EMKB 4HT9A 1I81A 2DZCA 3LGFA 3ZEHA 4OGEA 4JDSA 4FM4B 2EFIA 4M75G 4C92G 3QXEB 3JCMP 2BUDA 3BFMA 3VKIA 4Z02A 2VUBA 1U1SA 3QZ9B 3H6ZA 2DD4A 2QI2A 2YLBA 3DB4A 5A0GA 5GAOm 3FRNA 2DD5A 2E5QA 1JJ2A 3QHSA 3CC2T 2B8AA 2IVWA 4PJOF 2P0QA 3P8BB 3CPWA 3J80E 3EFRA 4HCBA 4NL2A 2JVVA 3HL8A 2L8DA 2MWPA 4E7JA 1VQPT 4JS5A 1X75C 1UGQB 1Q86C 2Y4YA 1TH7A 3R6OA 1K73U 1R8OB 3OY9A 3OW2A 3MCAB 4XAXB 5FROA 2CKKA 2E65A 3OYGA 1WQWA 2DIQA 2KY9A 4C8QG 3LGLA 2DJZA 5IT9E 1K8AC 1G3SA 2F5KA 1XNIA 5KCOA 4PJOD 2VYTA 3JCMQ 1M90U 1BI3A 4N4GA 1KHIA 3HFOA 2VC8A 4FL6A 4MZTA 3TREA 5KCHA 4M7DB 4J6WA 2CS7A 1YI2T 3HKSA 1VQ5T 4BE1A 3I56A 2OTLT 2LT4A 1D3BA 5M9OA 1WGSA 3M54A 1M1FA 1YJ9A 2LQKA 5CR2A 2DXCA 1VQLT 3M55A 5KE3A 3DB3A 4DOVA 2EAYA 2G3RA 3ZFJA 2ZZDA 4QW2A 3JCMc 3CMEA 2RK2A 3QYHB 5KE2A 1XQHA 3M5AA 4M77C 3J81E 2KAFA 1LNXA 1M1GA 3QPHA 4ME7A 3G6EA 4M7DF 3TU4K 2DK3A 2I2LA 3CCRT 1GXIE 3V8JA 1YHQT 5GANg 3PTAA 1NJIU 2KQWA 4M78A 4EDUA 2RJEA 3JCMe 2IG0A 3V8KA 5GAN3 3L2UA 4BACA 3OS1A 3EFSA 2XHCA 1VQ9A 1O75A 3M56A 5D6XA 3G4ST 4C92A 4M7DA 3A8HB 1VQNA 3E1SA 2JNGA 2XDDA 2RI3A 5HK3A 4M77B 5GAN6 1U1TA 2K57A 3CPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLR A;  2M1H A;  4Q5W A;  4HCZ A;  2NLU A;  3OYA A;  3S3O A;  3FLG A;  3OMG A;  4II1 A;  4A4G A;  2X4W A;  3L2Q A;  2EKO A;  2BKD N;  4QQD A;  2O4X B;  2RHI A;  3OYI A;  4BE2 A;  2DIG A;  4UC4 A;  3QII A;  3MEU A;  3LX7 A;  1H3Z A;  4X34 A;  4C5H A;  3LH0 A;  3NTH A;  2RO0 A;  3OYE A;  2R58 A;  2LTO A;  2RHZ A;  3C4S A;  2RHU A;  2EQU A;  3ASK A;  1RI0 A;  3E9G A;  5C0M A;  4QQ6 A;  1KHC A;  3OMC A;  3OYN A;  5C6S A;  3OYF A;  4IKF A;  4CRI A;  2BIV A;  2M0O A;  4IUV A;  3OYK A;  3OB9 A;  1G5V A;  3MEA A;  3P8H A;  4IUT A;  2LCC A;  3L42 A;  2LRQ A;  1N27 A;  3OYM A;  3S3M A;  3MP1 A;  2E6N A;  3S3N A;  4GY5 A;  4C5I A;  3QKJ A;  3OYD A;  3O8V A;  3OYC A;  3OA6 A;  2XK0 A;  2L89 A;  4A4F A;  3OYL A;  3LGF A;  3OYH A;  3ZEH A;  4IUP A;  2O4X A;  1OZ3 A;  2D9T A;  2LDM A;  2EFI A;  4N4I A;  3OS2 A;  2BUD A;  5FRM A;  4Z02 A;  3PMI A;  2FHD A;  2LVM A;  3H6Z A;  5FRN A;  1WJS A;  3SD4 A;  3PFS A;  3DB4 A;  3QBY A;  3OQ5 A;  3FDR A;  2E5Q A;  3OYB A;  2HQE A;  2B8A A;  3L2R A;  4BDY A;  3F70 A;  4QQG A;  4QVZ A;  4A4E A;  2MWO A;  2QQR A;  2L8D A;  2MWP A;  4E7J A;  4N4H A;  2JZ2 A;  4ZTF A;  3E9F A;  2R5A A;  3Q1J A;  2RI5 A;  4NS5 A;  4B9X A;  2WAC A;  3S6W A;  3MEW A;  3OY9 A;  3FC3 A;  4E7K A;  1OYX A;  5FRO A;  2CKK A;  2EQM A;  3OYG A;  4RG2 A;  3ME9 A;  2DIQ A;  2GFU A;  3LGL A;  2HQX A;  2RJC A;  2F5K A;  1XNI A;  3M9Q A;  5KCO A;  4E7L A;  2VYT A;  3MP8 A;  3MP6 A;  3KUF A;  4N4G A;  2XDP A;  4PLI A;  5IAY A;  4PLL A;  1OI1 A;  2DAQ A;  3MET A;  4FL6 A;  5CIU A;  4LD6 A;  4PL6 A;  2K3Y A;  3PMT A;  3LYI A;  4OVA A;  5IN1 A;  5KCH A;  3L2W A;  3OS0 A;  1MHN A;  2K3X A;  3NTI A;  2EQK A;  2RHY A;  2GF7 A;  3H8Z A;  3OYJ A;  3QJ6 A;  5D6Y A;  3EAE A;  4BE1 A;  3L2V A;  2EQJ A;  3UWN A;  4FU6 A;  3P8D A;  5M9O A;  1WGS A;  3PNW C;  3MEV A;  5J39 A;  1OZ2 A;  5KE3 A;  3DB3 A;  2L3R A;  2G3R A;  2RJD A;  3FEO A;  4BD3 A;  2PQW A;  2X4Y A;  2X4X A;  4QW2 A;  4BDZ A;  3MO8 A;  2YRV A;  5KE2 A;  4IUR A;  5D6W A;  2RI2 A;  4A4H A;  4B9W A;  2RHX A;  2R5M A;  1WJQ A;  4E7I A;  1WJR A;  4IUU A;  3GOX A;  3BDL A;  4ZTJ A;  4EDU A;  2P0K A;  2JTF A;  2M16 A;  2IG0 A;  2RJE A;  3UT1 A;  1SSF A;  5KH6 A;  3NTK A;  3CEY A;  5J26 A;  3OS1 A;  4C5G A;  3L2U A;  4BAC A;  2QQS A;  5D6X A;  4BE0 A;  4E7H A;  2GFA A;  4L59 A;  2RJF A;  4IUQ A;  4C5E A;  2R57 A;  2RI3 A;  3DLM A;  2X35 A; 
#chains in the Genus database with same CATH topology
 2QA4 A;  1U5S A;  3QWY A;  2CZ0 B;  1N9R A;  3A8O B;  1W2B P;  2D0Q B;  3CC2 A;  2LJ1 A;  3QG1 A;  4UC4 A;  1QLY A;  1FX7 A;  4GBQ A;  1VQP A;  3SB2 A;  1ZSZ C;  2LTO A;  4J9G A;  2PVO B;  3E9G A;  2KXD A;  5CQX A;  1YNZ A;  3X24 B;  4FCY A;  1UTI A;  4PK4 A;  4QKU A;  2K79 A;  4EMH A;  3GLX A;  1HJD A;  3CPW S;  4C0D C;  4Y91 A;  1Q95 G;  3M0T A;  3O8V A;  5AT1 B;  2RA2 A;  5FU7 C;  2O4X A;  1OZ3 A;  5LJ5 f;  2A08 A;  1ABO A;  2HMA A;  2YSQ A;  1AWO A;  1Q82 C;  4DBR A;  5LL6 S;  3CCV Q;  5LJ5 d;  2IIM A;  4A4E A;  1I1J A;  3NPF A;  3WVD B;  1NLP C;  1ACM B;  3REA B;  2FPD A;  3GPL A;  3EH1 A;  3CCU Q;  2BZ8 A;  1OQK A;  2DXB A;  3KUF A;  4L5G A;  4XTW A;  4F7U G;  1W6X A;  1T3S A;  1QVF P;  4D6W A;  4KUD K;  5L8R E;  3GF5 A;  4R56 A;  1VQ7 T;  1UGP B;  4ZN3 A;  3QJY A;  3CCE Q;  2L3R A;  5GAM h;  4C92 D;  4LDU A;  2DXU A;  2RI2 A;  2K6D A;  3IQL A;  4XTX A;  2MCN A;  3V7C A;  2XID A;  3T9N A;  3CCU T;  1VUB A;  4PJO G;  1V1C A;  4F17 A;  1KC8 C;  1S72 A;  1AOJ A;  3VYH B;  4DQ2 A;  4NOY A;  1ZUU A;  5GAN f;  4KUL A;  3DLM A;  1P92 A;  1VQM Q;  3CC7 Q;  1WPY A;  2DL7 A;  3I5R A;  2NUP B;  2NLU A;  4C8Q D;  3FLG A;  1YFN A;  1WHK A;  1UHC A;  2RK1 A;  5GAN d;  3QII A;  2M02 A;  3CC4 A;  2R58 A;  2WSE E;  2RH2 A;  1I07 A;  2H3E B;  4MDW A;  2MPX C;  1YJN T;  2LQN A;  2DFU A;  1SHG A;  3A8M B;  2G6F X;  4OGC A;  2L0A A;  2K5L A;  4FYW B;  5GAO r;  3OYL A;  4IUP A;  5CO7 A;  1RLP C;  1EFN A;  2ZCF B;  1N8R U;  3OQ5 A;  4F16 A;  1AEY A;  2K2V A;  4LE9 A;  1YIT Q;  4BUG A;  5A0D A;  2HCK A;  1YJW Q;  1RUW A;  3Q1J A;  1QMC A;  4C92 C;  4QVD A;  3CCJ Q;  4JS4 A;  2ZAE A;  1VQ8 T;  2CZ6 B;  1J3T A;  5HK0 A;  2RJC A;  2COY A;  4E7L A;  3OW2 S;  3URG A;  3C12 A;  3L2W A;  1RL2 A;  2EQK A;  2ZPH B;  3JCM h;  3E2U A;  4PJO E;  2DBM A;  2V26 A;  4FU6 A;  2K5F A;  2NYS A;  4C8Q C;  3JB9 F;  2YRD A;  2DLP A;  3UDC A;  1N8R C;  1YIJ A;  3CBP A;  4ZGJ B;  3M53 A;  1WJQ A;  1ZLM A;  4JUV A;  3RKW A;  2D1X A;  2GTJ A;  5GAO q;  1VQ6 T;  3V8L A;  5LJ5 e;  3SWN C;  4J9I A;  2F69 A;  3GIB A;  5LJ3 h;  1VYV A;  1ZX6 A;  1QVP A;  1M1K U;  3QDR B;  4M75 D;  1VYU A;  4FW1 A;  3CCS A;  2DIG A;  1YI2 Q;  4HKE A;  2QQB A;  1ZSG A;  3ZL7 C;  2RHZ A;  3OYM A;  4MDX A;  2DJQ A;  3OMC A;  3VJP A;  2YT6 A;  5FU6 B;  1I5L A;  1WHG A;  3OB9 A;  3P8H A;  2KT8 A;  4IUT A;  4HCC A;  2CZ7 B;  3RDV A;  4A54 A;  4FSX A;  4M77 A;  2EKH A;  2H8H A;  2M9U A;  1NE8 A;  2CDT A;  3EG9 A;  2L3Q A;  3JCM f;  1OOT A;  1K0S A;  4N4I A;  1OPK A;  2PTK A;  2JJ9 A;  4LDY A;  3CMA T;  5FRM A;  2E6Z A;  1YCY A;  2JXB A;  1E7O A;  3JCM d;  4J6Y A;  3F70 A;  2EQI A;  5IH2 A;  2MWO A;  2BE7 D;  2OI3 A;  2YRC A;  5IXB A;  1M1K C;  2QQR A;  4M77 E;  3QSU A;  2LJ3 A;  4OB2 B;  2BZY A;  3LWI A;  5CQY A;  4JJC A;  4RTZ A;  3S6W A;  3FC3 A;  1G3W A;  3BW1 A;  2LX9 A;  2J6K A;  1KQS A;  5GAN e;  1KK7 A;  2OX7 A;  1RAI B;  3C95 A;  2HQX A;  4ELY C;  1KQS P;  3M0R A;  1ZBJ A;  3MP6 A;  2KDS A;  2OTJ A;  2JT4 A;  3EG2 A;  5A0L A;  1K73 C;  3CCQ T;  5DM7 R;  2WSF E;  2DVE A;  1GL5 A;  2FZG B;  3I56 Q;  2NUZ A;  1XOV A;  5J39 A;  1JO8 A;  4N0A C;  2RQV A;  1Q86 R;  1QKX A;  4M75 C;  3QUI A;  3CD6 A;  1WXU A;  2MK5 A;  3EGD B;  3MO8 A;  3A98 A;  1R0B G;  3CME Q;  1K8A R;  3EG1 A;  1BI2 A;  2V8I A;  2DA9 A;  2P0K A;  1QQJ A;  2NWM A;  1N6A A;  5I2S A;  4PFZ A;  4LD9 K;  4JJN K;  1RAE B;  2HZY A;  1G3Y A;  4L59 A;  5GAM e;  2ED0 A;  1BCM A;  2LX7 A;  3CCL T;  1CKB A;  1B7T A;  3H0H A;  1ZSZ B;  4HCZ A;  1VQO T;  2K5I A;  1VQ5 A;  2X4W A;  2QG9 B;  2QA4 Q;  2DMO A;  2DL8 A;  3CC2 Q;  1NYG A;  3NTH A;  4WCI A;  3M0S A;  1VQL A;  3TSW A;  1HD3 A;  4EMK C;  4JRQ A;  1VQP Q;  4C0D B;  1M5Q 1;  3JRZ A;  3CCR A;  1SPK A;  4J9C A;  1IHV A;  2HBW A;  1YHQ A;  2LQW A;  1JQQ A;  1NZ9 A;  2K9G A;  1M9S A;  4GY5 A;  3KFV A;  4HT9 A;  1UJY A;  4JDS A;  4FM4 B;  4C92 G;  2X3W D;  3VKI A;  4Z02 A;  3QZ9 B;  3DB4 A;  2DD5 A;  1MMG A;  3QHS A;  1AT1 B;  3CC2 T;  2MYS A;  2P0Q A;  3P8B B;  1R77 A;  2L8D A;  4E7J A;  1VQP T;  4JS5 A;  1OX9 A;  4KH0 B;  2FPE A;  2Y4Y A;  3OY9 A;  1PC0 A;  1WHJ A;  1WQW A;  4C8Q G;  4PJO D;  2CP7 A;  4D8D A;  3HFO A;  1KFZ A;  4RTW A;  4DEX A;  2VAS A;  2KRM A;  1H8K A;  3M54 A;  1X2K A;  2LQK A;  4DOV A;  5KE2 A;  3J81 E;  1LNX A;  3AT1 B;  4ME7 A;  3G6E A;  3TU4 K;  2PZ1 A;  3EFO B;  2DRK A;  5KYX A;  1NJI U;  5GAN 3;  3JCM e;  4PJN A;  2K2M A;  3EFS A;  2XHC A;  1VQ9 A;  1O75 A;  4C92 A;  1K9A A;  3MJX A;  2RI3 A;  5HK3 A;  1S72 Q;  1U1T A;  2JTE A;  3VS6 A;  2F1L A;  2FPF A;  4OB0 B;  3D7S B;  1TG0 A;  2E3I A;  1PCX A;  2DEQ A;  2PVG B;  3MPU B;  4R55 A;  3CC4 Q;  2PUO B;  2M0O A;  2FO0 A;  3BE3 A;  4C92 E;  1UDL A;  3MHX A;  4C8Q A;  2XIC A;  2KVQ G;  2LCC A;  5LJ3 g;  3S3M A;  2ZPE B;  2E4H A;  4KGZ B;  1WZO A;  2E6N A;  2L3P A;  2X3X D;  3JSC A;  4C5I A;  1ZUK A;  1NJI C;  4DEY A;  2EYW A;  2MOX A;  4PJO C;  4J9B A;  3SWN A;  4JRI A;  1YJ9 T;  2V1R A;  4C8Q E;  1IHW A;  3L2R A;  3HTR A;  4QVZ A;  1WHH A;  4EMG A;  1TUD A;  2DVJ A;  2R5A A;  3CBM A;  2ZGW A;  1D1C A;  3HSB A;  3EGU A;  2HBP A;  4E47 A;  1LVK A;  3LW5 E;  2PUK B;  1M2V B;  1VQN T;  4PLI A;  5CK9 A;  3I55 A;  4HVU A;  1SG5 A;  4J5Y A;  5IN1 A;  1EX4 A;  3PMT A;  1H92 A;  1KD1 R;  1VQ4 A;  4LDV A;  2K3X A;  1B34 B;  1D0Y A;  2L5Q A;  2QQ9 A;  5GAN 7;  1KIK A;  4DBF A;  5CCA A;  3JB9 J;  2FZC B;  2KYM A;  5GAO n;  1WA7 A;  2RQU A;  2LZ6 B;  2KT1 A;  3VS7 A;  3JCM W;  1QWE A;  1OV3 A;  4DBQ A;  4JJD A;  1MMD A;  1Q7Y R;  2F5T X;  2QTX A;  1VQK T;  1WX6 A;  4C5G A;  2LQ8 A;  5CKD A;  2RJF A;  6AT1 B;  2P4R A;  5KYY B;  5LJ5 h;  1Q81 R;  2M51 A;  3OMG A;  4II1 A;  4A4G A;  2DYI A;  2CGH A;  2ECZ A;  4X34 A;  4C5H A;  1N9S A;  3OYE A;  2FYK A;  3CCS Q;  3C4S A;  2FG0 A;  2CSQ A;  3ASK A;  1RI0 A;  3UA7 A;  2QEX A;  1X2Q A;  2QAS A;  2BIV A;  4JZ4 A;  4N0A A;  2LMJ A;  4M75 A;  2ZPB B;  4XTY A;  3G71 T;  2J06 A;  4ZGD B;  1W2B A;  2E5K A;  1YP5 A;  1Q82 U;  2CT3 A;  2VV5 A;  1PKS A;  4J9D A;  4RCB A;  3OA6 A;  4WTO B;  2D9T A;  3OBW A;  3PMI A;  4J6X A;  2FHD A;  2DER A;  1SKU B;  3GBQ A;  5I21 A;  3PFS A;  2EIF A;  3FDR A;  2HQE A;  5I2M A;  1O9S A;  4M75 E;  4QQG A;  1AD5 A;  2AKK A;  1E6H A;  3H0F A;  1VIF A;  1D3B B;  1TUC A;  4N4H A;  1YWP A;  1MUZ A;  5L23 A;  1K0X A;  2Z0W A;  4M7A D;  3GNF B;  2KRS A;  4RTY A;  4EMK A;  2J7I A;  1VA7 A;  4OMF B;  1M4Z A;  1WIE A;  4X1V A;  2C0O A;  2L3S A;  4M78 B;  5GAN h;  4PLL A;  2CUB A;  3NTI A;  1VOM A;  2OTJ Q;  3CCM A;  5D6Y A;  1MV0 B;  3WVE B;  1KC8 U;  1AZG B;  1OEB A;  3VUZ A;  2PQW A;  5CKE A;  3U23 A;  3X20 B;  4C0G A;  1WQ7 A;  4M78 F;  4OML A;  4A4H A;  2RHX A;  1SHF A;  3CD6 Q;  1RAH B;  2HL3 A;  1V29 B;  1QVF A;  2M16 A;  2DF6 A;  1Y71 A;  2O01 E;  1OPL A;  4BE0 A;  5I22 A;  3CCV T;  2OTJ T;  5AYF A;  3VRZ A;  4BE2 A;  2O4X B;  3X26 B;  4PJL A;  1W2B S;  2EBP A;  3LX7 A;  1PWT A;  2W10 A;  1VQ5 Q;  4HCK A;  1RLQ C;  4OMP A;  3DLL A;  4IKF A;  4OB1 B;  3EG3 A;  5C6S A;  4DOW A;  2DIL A;  3CD6 T;  3WXM B;  1VQL Q;  1JJ2 P;  1IB8 A;  3L42 A;  7AT1 B;  3OS5 A;  1ZHI A;  4M7A C;  1QW1 A;  3THK A;  3GNG A;  3CCR Q;  3QKJ A;  1YHQ Q;  1OU8 A;  2CSI A;  2L89 A;  3SFM A;  5J3B A;  1JRI A;  4QVC A;  3CCE T;  1GCQ C;  1WJS A;  3OBY A;  3SD4 A;  4BI4 A;  1I0C A;  1YBY A;  1T3L A;  1UEC A;  4F7U A;  2WAC A;  3MEW A;  3QYG B;  1CKA A;  2CP5 A;  4J9H A;  3UPU A;  2OAU A;  1VQM T;  3CC7 T;  2VWF A;  2HL5 C;  5GAN 5;  3VS5 A;  4GLK A;  3RER A;  2KGT A;  1T0J A;  4OMQ A;  4C0Z A;  1OI1 A;  2RM4 A;  5CIU A;  4LD6 A;  4PL6 A;  3LYI A;  2CRE A;  3ZBD A;  1C1A A;  1QVF S;  2EQJ A;  4F7U E;  4NL3 A;  1MMN A;  4X9D A;  1T0H A;  4PJJ A;  4PJO A;  4A53 A;  4BDZ A;  4BD3 A;  2X4Y A;  1QP2 A;  3EGX A;  1WLP B;  2WSC E;  4HT8 A;  2QXF A;  4BY6 B;  1WJR A;  3G6E Q;  4OMO A;  2BTT A;  5HY6 A;  4YTL A;  4AFQ C;  5KH6 A;  2MMP A;  3RBB B;  1BU1 A;  2R57 A;  2EYZ A;  2JN0 A;  5GAN 2;  4QT7 A;  3OYA A;  1EZZ B;  1YIT T;  4J83 A;  1X6O A;  3O5Z A;  3FJP A;  1YJW T;  3LH0 A;  3I35 A;  1VYT A;  3CCJ T;  2AIR B;  2EYX A;  2KRO A;  3OYF A;  1K8A U;  2DEU A;  1ZBX A;  3HFN A;  2KEA A;  4MML A;  5FW9 A;  2XDB A;  1UE9 A;  1JB0 E;  2LRQ A;  2XI9 A;  1NEB A;  5LJ5 g;  2FVU A;  3OYC A;  2YDL A;  1OUL A;  3G4S A;  4A4F A;  2KE9 A;  1I81 A;  1SRM A;  2DZC A;  4JZ3 A;  1M90 R;  2QGF B;  3QXE B;  3BFM A;  2I0N A;  5FWB A;  2O88 A;  2VUB A;  2YLB A;  1X6B A;  4PJO F;  1NG2 A;  2CP0 A;  4NL2 A;  1UGQ B;  1Q86 C;  3R6O A;  1K73 U;  3MCA B;  5FRO A;  2E65 A;  3OYG A;  2RPN A;  1K8A C;  3JCM Q;  1BI3 A;  1FYN A;  1KHI A;  2C0T A;  2PNI A;  2VC8 A;  4MZT A;  5KCH A;  1YI2 T;  5KYW A;  3I55 Q;  2JM9 A;  4JJB A;  1G2B A;  1PNJ A;  2EYY A;  1VQ4 Q;  1NYF A;  2J6O A;  1M1F A;  3M55 A;  2GQI A;  2EAY A;  2O31 A;  2B86 A;  3QYH B;  1XQH A;  4KGX B;  1PD0 A;  2DK3 A;  4M4Z A;  3V8J A;  2NUT A;  5GAN g;  3PTA A;  2KQW A;  1IGU A;  4EDU A;  5D6X A;  2XDD A;  1UHF A;  4M77 B;  1M3A A;  5GAN 6;  2K57 A;  2QGG A;  3G7Z A;  2ESW A;  5GJW B;  3I55 T;  1U06 A;  3EG9 B;  2E1H A;  1VQ4 T;  4M7A G;  2KR3 A;  3V7S A;  1GFC A;  3E19 A;  1VQ7 A;  2RF0 A;  4KH1 B;  1KHC A;  2EJG A;  2A0F B;  4M77 F;  2ZPG B;  2QEX Q;  1LCK A;  3BDU A;  3V7R A;  1M27 C;  1RAC B;  1MND A;  2X4J A;  2QDL A;  2MF2 A;  3RMS A;  1BI0 A;  5GAM g;  2E70 A;  3JCM V;  2RQT A;  1SEM A;  4J7I A;  3I56 T;  2KK4 A;  2COZ A;  2D6F A;  2DX1 A;  3QBY A;  2M0Y A;  4RTT A;  3PIO A;  2JS0 A;  1BB9 A;  3M58 A;  1M30 A;  3CME T;  1K1Z A;  4LN2 A;  1PHT A;  4KT0 E;  5FU7 B;  2F2W A;  3E9F A;  1QVG P;  3HRS A;  4NS5 A;  1YJN A;  1UB4 A;  1BBZ A;  2SRC A;  4OF1 A;  3RUX A;  3A5Z B;  2EQM A;  4MMK A;  3M0U A;  4O5V A;  1TWB A;  2VXF A;  1FXX A;  2YUP A;  2VVK A;  4DA4 A;  5GAN 8;  4MZM A;  1G83 A;  2XDP A;  1KQS S;  3HP9 A;  2QA4 T;  3MET A;  4M7A A;  3JB9 D;  3REB B;  3RKY A;  3OYJ A;  3UWN A;  3CQT A;  1ARK A;  3CCM Q;  2CP3 A;  3NHN A;  1GCQ A;  3A8L B;  3QWX X;  1X43 A;  1LJO A;  2V8J A;  3DKM A;  3QDF A;  4D8K A;  4K11 A;  4JLI A;  4M7A E;  1VQ8 A;  2PU9 B;  1Y96 A;  1PG5 B;  2JTF A;  4HVW A;  5DY9 A;  2KSS A;  1FWZ A;  2JMC A;  2GFA A;  1UUE A;  4IUQ A;  1KD1 U;  1LPL A;  2C06 A;  5KYU A;  1NM7 A;  2AK5 A;  4FT2 A;  2K3B A;  5CAI A;  4ATO A;  3M57 A;  4BB7 A;  4AT1 B;  4CC4 B;  1I4K 1;  2HDA A;  4XQ3 A;  1HXD A;  2E3H A;  2QAZ A;  3L2Z A;  3MEU A;  1MNE A;  2RHU A;  1UGS B;  2DE0 X;  4QQ6 A;  3TCJ A;  3CXC A;  3OYK A;  4KGV B;  3MEA A;  3CXC P;  3HPW A;  5CVI A;  3QO3 A;  3JCM g;  4LDX A;  1MV3 A;  1Y07 A;  3MP1 A;  2KRN A;  4OB3 B;  1VQ6 A;  3H0I A;  2VB6 A;  1W1F A;  2VGM A;  4M7D G;  1Q81 U;  2RN8 A;  1IO6 A;  4F04 B;  4KUI A;  2LVM A;  4LDW A;  1KD1 C;  2HD0 A;  1CSK A;  1UGV A;  2RQR A;  5GAO p;  2LCL A;  5EC7 A;  5FWC A;  3A8G B;  2EW3 A;  4O6J A;  2AKL A;  2P4T A;  1OYX A;  3H41 A;  2YLC A;  2JS2 A;  1S72 T;  3M0P A;  5FLX E;  1Q7Y C;  3MP8 A;  5KYX B;  1TTH B;  2ENM A;  2MIO A;  2K3Y A;  4OVA A;  4ESR A;  1QCO A;  4C92 B;  1TS9 A;  3PVQ A;  3QJ6 A;  4XU3 A;  3CMA A;  1BI1 A;  1WI7 A;  3VV0 A;  4P5N A;  3CC4 T;  3JV3 A;  1Q81 C;  2DL3 A;  3MEV A;  1XTD A;  1OZ2 A;  4BI8 B;  2YRV A;  1G3T A;  4IUR A;  2LNH B;  2YHT A;  5GMK j;  2LNV A;  4J9E A;  4PFO A;  1JU5 C;  1WXB A;  4FIB A;  4C92 F;  4IUU A;  2FRY A;  2DPP B;  4C8Q B;  4M7D A;  1AVZ C;  2FB7 A;  4Z89 A;  4DBH A;  2QQS A;  3VU3 C;  3OSV A;  2CYZ B;  1IRX A;  1RAG B;  5LJ3 j;  1XJW B;  1WNL A;  2CP2 A;  5FU6 C;  1TXQ A;  4A4K A;  4M78 G;  3CCQ A;  3RNJ A;  1UEB A;  2FEI A;  2EKO A;  3EHR A;  4E6R A;  2EVR A;  4C8Q F;  3SWN B;  2V1Q A;  1NLO C;  4AFS C;  5C0M A;  2EQU A;  4M7D E;  2COW A;  1YIJ Q;  2VGN A;  4CRI A;  4IUV A;  1WYX A;  3CPW P;  1I8F A;  1X69 A;  3INZ A;  2K7A A;  1I5O B;  2CT4 A;  3OYH A;  2P0P A;  2VXE A;  3OS2 A;  1RI9 A;  3CCL A;  3VRY A;  2D8J A;  1BCO A;  1FMW A;  1M8M A;  2EYQ A;  1YWO A;  4XU0 A;  1VQO A;  1BYM A;  2LP5 A;  1HK9 A;  1K9M C;  4RCC A;  4AMC A;  1SF9 A;  3JB9 I;  1YIJ T;  2JZ2 A;  4JLG A;  3BY7 A;  3RKX A;  1BIA A;  3OSS C;  4C0F A;  4LUE A;  4VUB A;  4RG2 A;  1NPR A;  5CKF A;  3VS3 A;  4PNO A;  2YXY A;  4EPC A;  5IAY A;  4KBM B;  4XTZ A;  2DAQ A;  2EGE A;  2J6F A;  1B3Q A;  2RHY A;  2GF7 A;  3GP8 A;  4XU2 A;  3EAE A;  3CCS T;  1QCF A;  4PFP A;  1GBQ A;  2C0I A;  4AFZ C;  2A36 A;  3JCM X;  2RJD A;  2X4X A;  1ZQ1 A;  4OP0 A;  2KI7 A;  4RG8 A;  4B9W A;  3VS1 A;  2A7Y A;  4M78 E;  2XMF A;  5GAO l;  1NPP A;  2Y90 A;  2FL7 A;  4CC7 A;  3BDL A;  3M59 A;  4RTU A;  3UA6 A;  3NTK A;  4J8O A;  4XK8 E;  3PGG A;  4M75 B;  1HYO A;  4R0K A;  3FB9 A;  4J9F A;  1K9M R;  2F2V A;  5IXF A;  3S3O A;  1U8R A;  3VS4 A;  3M4Y A;  4ELZ C;  1H3Z A;  3M4G A;  3PIP A;  2E41 A;  8ATC B;  3A1P A;  4M75 F;  1GFD A;  1WHL A;  4B6M A;  1KG1 A;  4A63 B;  1VQ7 Q;  3R6N A;  1PRL C;  1N5Z A;  5ECA A;  3JB9 G;  2XKO C;  2HAX A;  3S3N A;  2NUP A;  3CBO A;  2DO3 A;  2DZ9 A;  2XK0 A;  4ZGE B;  4EMK B;  2QYZ A;  3LGF A;  2A28 A;  2OAW A;  2BUD A;  1TUG B;  4FYV B;  1KSW A;  1IGQ A;  1IXD A;  2ROL A;  1JJ2 A;  2HQH A;  2B8A A;  2IVW A;  2HEQ A;  2JVV A;  4FYX B;  2DNU A;  3HL8 A;  2MWP A;  4GLM A;  4LUD A;  2L2P A;  1X75 C;  4FYY B;  1R8O B;  3OW2 A;  4XAX B;  2CKK A;  3OW2 P;  2DIQ A;  1TOV A;  1YJN Q;  1XNI A;  1TSF A;  5KCO A;  2VYT A;  1M90 U;  2P84 A;  4F14 A;  1U3O A;  4FL6 A;  2CS7 A;  1Q82 R;  2QTV A;  1VQ5 T;  4FSS A;  2LT4 A;  3C0C A;  5M9O A;  1MMA A;  1YJ9 A;  5CR2 A;  2DXC A;  2DRM A;  1VQL T;  1K76 A;  3DB3 A;  1NEG A;  2G3R A;  3ZFJ A;  2ZZD A;  4AFU C;  3PE0 A;  4Y92 A;  3M5A A;  4JPB W;  2DBK A;  1M1G A;  3QPH A;  3CCR T;  1YHQ T;  2GNC A;  1RAD B;  4BAC A;  3M56 A;  4IIO A;  1VQ8 Q;  1VQN A;  3E1S A;  2JNG A;  4PKC C;  2M1H A;  4OMM A;  3JAM E;  4M7D D;  1KQ2 A;  4FT4 A;  1M90 C;  3TEE A;  1AWJ A;  2BKD N;  1QP3 A;  2O2O A;  3HHT B;  1WFW A;  4QQD A;  2O9V A;  3OYI A;  3UF4 A;  3JB9 H;  2GQV A;  2RO0 A;  5GAM f;  1YCS B;  4E7K A;  3PVL A;  4RKU E;  1K4U S;  2YUN A;  4KRT A;  5KYN A;  1G5V A;  1DJ7 B;  1UGR B;  1KC8 R;  1Z9Q A;  1UG1 A;  2RMO A;  5GAM d;  1JJ2 S;  2KYB A;  4F7U B;  1VQ9 Q;  5HKC A;  4HXJ A;  4LNP A;  1RAA B;  1VQK A;  2EJ9 A;  3OYD A;  2BZX A;  2JTM A;  1VQ6 Q;  2OTL A;  2RB6 A;  3RES A;  1Q86 U;  2ZPF B;  3NGP A;  2ABL A;  1WHM A;  4M77 G;  4CC3 A;  4IIM A;  3RMQ A;  2X9H A;  2ED1 A;  2JMA A;  3RR6 A;  4F7U F;  4BDY A;  1YN8 A;  3VS0 A;  4RMO A;  2H3J A;  3G6E T;  4ZTF A;  2LJ0 A;  1R0C B;  4PJO B;  3KXT A;  4ZN1 A;  3EGX B;  5GMK h;  3L1A A;  1VQ9 T;  1PSF A;  3G71 A;  5GMK i;  1D0Z A;  4ZNX A;  3OS0 A;  1Z9Z A;  3H8Z A;  5IHI A;  2GCX A;  3L2V A;  1X01 A;  4M78 D;  2DET A;  2DTI A;  3PNW C;  4M7D C;  1RAB B;  3CMA Q;  3TSZ A;  3EHQ A;  1D0X A;  2EJF A;  2PVD B;  2XU8 A;  4ZTJ A;  2HKQ B;  2ZPI B;  1D1A A;  4Z8A A;  4E7H A;  4XTU A;  1EIF A;  2LC4 A;  1E6G A;  1V76 A;  2X51 A;  2RD1 A;  1H64 1;  3EH2 A;  1BKB A;  5LJ5 j;  5A2Q E;  1AZE A;  2MAM A;  1D1B A;  3EGD A;  2VKN A;  1PRM C;  4JRK A;  3CCQ Q;  4TVR A;  1N8R R;  1PSE A;  9ATC B;  3HRU A;  1X6G A;  1M3B A;  2E10 A;  2CH4 A;  2GGR A;  3LH5 A;  1M8V A;  1ZSZ A;  5LJ3 f;  2FRW A;  4HA8 A;  3KBG A;  2XD0 A;  2KXC A;  1GBR A;  3CCV A;  2J05 A;  5FRN A;  1Y57 A;  3VUB A;  5LJ3 d;  5D7U A;  2CUD A;  5KYW B;  3CCL Q;  4AG1 C;  4RTX A;  1VQO Q;  2YUO A;  4M78 C;  2CH4 W;  2JUF A;  3JCM J;  1FMV A;  4EIK A;  4L6V 5;  2RI5 A;  3CCU A;  2AZS A;  4J7F A;  4B9X A;  3SDZ A;  2IPO B;  2GBQ A;  2K4Y A;  3ME9 A;  4XTV A;  1C0M A;  1PM3 A;  2E12 A;  3UAT A;  1KQ1 A;  2DTO A;  2NUT B;  5GAN j;  1VIE A;  1UJ0 A;  1JXM A;  3TQ7 P;  4FW2 A;  1OX8 A;  2HSE B;  1MHN A;  2YWW A;  3CCE A;  1QVG A;  1M1K R;  2LCS A;  1BIB A;  2DL5 A;  2EGA A;  3FEO A;  3SEM A;  4CI0 C;  2QEX T;  2F2X A;  1D09 B;  3VYG A;  2ROT A;  5D6W A;  2ATC B;  2EPD A;  1G8X A;  2R5M A;  2OJ2 A;  1C6V X;  2CP6 A;  2QDY B;  1B07 A;  1QKW A;  5J26 A;  2E64 A;  3CEY A;  5HCK A;  3CC7 A;  1VQM A;  3RIR A;  1K73 R;  5CKB A;  1MGQ A;  4C5E A;  2X35 A;  1JEG A;  5CKH A;  2KBT A;  5GAM j;  1PKT A;  3TVT A;  3OYY A;  1JXO A;  1M3C A;  1WXT A;  2DKG A;  5GAN 4;  3EFO A;  5I11 A;  1IRE B;  3I9Q A;  3OYN A;  1IZ6 A;  3ER0 A;  4ORZ A;  2QK0 A;  5IHN A;  5GJV B;  1N27 A;  5GMK m;  4X9C A;  2XG8 D;  2LDM A;  4XU1 A;  3CCM T;  1W4S A;  3QZ5 B;  1OU9 A;  4Y28 E;  1YIT A;  1AHJ B;  3OYB A;  4M7A B;  2Y4X A;  1WDX A;  2W0Z A;  3FIF A;  4RTV A;  2DTH A;  3LWH A;  1YJW A;  1Q7Y U;  3JCM b;  2LT1 A;  2DYB A;  3CCJ A;  1AWX A;  4BI3 A;  2RQW A;  3VS2 A;  4WF2 A;  3M0Q A;  1ZA2 B;  4MZP A;  1A0N B;  1KJW A;  1QVG S;  4ANJ A;  1BK2 A;  2GFU A;  4M7A F;  2AZV A;  3M9Q A;  1TU0 B;  3NFC A;  2MI6 A;  1Y96 B;  2DXT A;  1QCN A;  3EG0 A;  4Z88 A;  1NBE B;  4BY6 C;  2AHJ B;  1SRL A;  5EG2 A;  5GMK e;  3P8D A;  5KYU B;  2HNI A;  2A37 A;  2V8K A;  2EWN A;  1YJ9 Q;  4E7S A;  2DM1 A;  1GCP A;  4JRP A;  1M2V A;  3AHU A;  4E7I A;  4HVV A;  3GOX A;  3MKD A;  5LJ3 e;  3UT1 A;  1LOJ A;  1Y0M A;  1SSF A;  1JBM A;  3H9N A;  1B34 A;  5DLO A;  2HSP A;  2GTO A;  3X28 B;  1ZA1 B;  5GMK l;  3LLR A;  4Q5W A;  2O9S A;  1VQN Q;  2KMT A;  1YI2 A;  5DLQ E;  2A3L A;  3ULR B;  3L2Q A;  3N5B B;  2HKN A;  4V2S A;  2EGC A;  1ZUY A;  2RHI A;  3J7A F;  1W70 A;  4OMN A;  2DL4 A;  4M77 D;  1FMK A;  3I5S A;  3PT9 A;  2YUQ A;  3HRT A;  2CZ1 B;  1Y7X A;  1SSH A;  3C94 A;  4PJM A;  1UFF A;  2FZK B;  3G1J A;  3X25 B;  3CXC S;  2QQA A;  2JOY A;  2JM8 A;  5KYY A;  1K9M U;  3ZEH A;  1QWF A;  1VQK Q;  4OGE A;  4M75 G;  2EFI A;  3JCM P;  1ABQ A;  4E2F B;  1U1S A;  1X27 A;  1GRI A;  3H6Z A;  2DD4 A;  2QI2 A;  2OTL Q;  5A0G A;  5GAO m;  3FRN A;  4AG2 C;  2E5Q A;  2AT1 B;  4RUG A;  3CPW A;  3FJ5 A;  3J80 E;  3EFR A;  4HCB A;  4E7Z A;  2JW4 A;  5IHK A;  1TH7 A;  2D0N A;  2KY9 A;  5IT9 E;  3LGL A;  2DJZ A;  8AT1 B;  1NJI R;  1RAF B;  1G3S A;  2F5K A;  2SEM A;  3G4S Q;  4N4G A;  3SHW A;  3G71 Q;  1AWW A;  3TRE A;  4M7D B;  4J6W A;  3HKS A;  4BE1 A;  1S1N A;  3I56 A;  2RNA A;  2OTL T;  1D3B A;  1WGS A;  2KNB B;  5KE3 A;  4QW2 A;  3JCM c;  3CME A;  2RK2 A;  4M77 C;  2KAF A;  4LXC A;  4M7D F;  1GXI E;  2I2L A;  2D8H A;  1M2O A;  2BE9 B;  4CC2 A;  1F1B B;  4M78 A;  2RJE A;  2IG0 A;  3V8K A;  3L2U A;  3OS1 A;  1PD1 A;  3G4S T;  3NMZ C;  1HSQ A;  3A8H B;  1H3H A;  3CPF A; 
#chains in the Genus database with same CATH homology
 4PKC C;  3G7Z A;  2M1H A;  3JAM E;  2QA4 A;  2CZ0 B;  1N9R A;  3A8O B;  3I55 T;  4M7D D;  2D0Q B;  1KQ2 A;  3CC2 A;  4FT4 A;  1M90 C;  2E1H A;  1VQ4 T;  3TEE A;  3QG1 A;  4OB0 B;  2BKD N;  1QP3 A;  4QQD A;  3HHT B;  3V7S A;  3OYI A;  3JB9 H;  4M7A G;  4UC4 A;  1FX7 A;  2GQV A;  1VQP A;  2RO0 A;  3E19 A;  3SB2 A;  2DEQ A;  2PVG B;  5GAM f;  1VQ7 A;  2LTO A;  4E7K A;  2PVO B;  3E9G A;  4R55 A;  1KHC A;  2EJG A;  2PUO B;  4RKU E;  4M77 F;  2M0O A;  5CQX A;  1G5V A;  1DJ7 B;  4C92 E;  3MHX A;  2ZPG B;  4C8Q A;  1UGR B;  3X24 B;  3BDU A;  3V7R A;  5GAM d;  2XIC A;  2KVQ G;  2LCC A;  5LJ3 g;  2X4J A;  4EMH A;  1JJ2 S;  3S3M A;  2ZPE B;  2MF2 A;  3GLX A;  4F7U B;  5HKC A;  3CPW S;  4C0D C;  3RMS A;  2E6N A;  3JSC A;  1VQK A;  4C5I A;  4Y91 A;  2EJ9 A;  1BI0 A;  3OYD A;  5GAM g;  3O8V A;  2E70 A;  3JCM V;  2JTM A;  2RA2 A;  1NJI C;  4J7I A;  5FU7 C;  2O4X A;  1OZ3 A;  2OTL A;  4PJO C;  2RB6 A;  3RES A;  5LJ5 f;  2ZPF B;  3I56 T;  1Q86 U;  2KK4 A;  2D6F A;  4M77 G;  3SWN A;  4JRI A;  3QBY A;  3RMQ A;  1YJ9 T;  4C8Q E;  1Q82 C;  3PIO A;  5LL6 S;  3L2R A;  3M58 A;  4F7U F;  4BDY A;  3CME T;  5LJ5 d;  4QVZ A;  4A4E A;  4EMG A;  4RMO A;  2H3J A;  3G6E T;  4KT0 E;  3WVD B;  4ZTF A;  5FU7 B;  3E9F A;  2R5A A;  3CBM A;  2ZGW A;  4PJO B;  3HRS A;  4NS5 A;  3GPL A;  3KXT A;  3HSB A;  1YJN A;  2HBP A;  4ZN1 A;  1UB4 A;  4OF1 A;  3RUX A;  4E47 A;  3A5Z B;  2EQM A;  4MMK A;  3LW5 E;  4O5V A;  2PUK B;  5GMK h;  2VXF A;  3L1A A;  1VQ9 T;  1FXX A;  1PSF A;  3G71 A;  5GMK i;  4DA4 A;  5GAN 8;  4MZM A;  1VQN T;  4L5G A;  2DXB A;  3KUF A;  4XTW A;  2XDP A;  4PLI A;  4F7U G;  5CK9 A;  3I55 A;  3HP9 A;  1KQS S;  2QA4 T;  3MET A;  4J5Y A;  5IN1 A;  3PMT A;  1VQ4 A;  4M7A A;  4LDV A;  3JB9 D;  3OS0 A;  2K3X A;  1B34 B;  3RKY A;  3H8Z A;  3OYJ A;  4D6W A;  2GCX A;  2L5Q A;  1X01 A;  3L2V A;  2QQ9 A;  5GAN 7;  3UWN A;  4M78 D;  4KUD K;  5L8R E;  2DTI A;  3GF5 A;  3PNW C;  5CCA A;  4R56 A;  1VQ7 T;  4M7D C;  1UGP B;  3JB9 J;  4ZN3 A;  3QJY A;  2L3R A;  5GAO n;  5GAM h;  4C92 D;  4LDU A;  3A8L B;  2DXU A;  2EJF A;  2RI2 A;  3JCM W;  2PVD B;  1LJO A;  4XTX A;  2XU8 A;  2V8J A;  3DKM A;  3V7C A;  2F5T X;  2XID A;  3T9N A;  4JLI A;  3CCU T;  1VUB A;  4PJO G;  2PU9 B;  2ZPI B;  2QTX A;  1Y96 A;  2JTF A;  1VQ8 A;  1VQK T;  5DY9 A;  1KC8 C;  1S72 A;  4C5G A;  3VYH B;  2KSS A;  2LQ8 A;  1FWZ A;  4DQ2 A;  4NOY A;  4E7H A;  4XTU A;  2GFA A;  1EIF A;  5CKD A;  2RJF A;  4IUQ A;  2LC4 A;  5GAN f;  1KD1 U;  4KUL A;  2RD1 A;  3DLM A;  1P92 A;  1H64 1;  1WPY A;  2C06 A;  1BKB A;  5LJ5 j;  5LJ5 h;  2NLU A;  4C8Q D;  3FLG A;  4FT2 A;  5A2Q E;  5CAI A;  3OMG A;  4ATO A;  3M57 A;  4BB7 A;  4II1 A;  4A4G A;  1I4K 1;  2RK1 A;  2MAM A;  5GAN d;  4XQ3 A;  2CGH A;  1HXD A;  3L2Z A;  3MEU A;  3QII A;  4JRK A;  4TVR A;  4X34 A;  1N9S A;  4C5H A;  1PSE A;  2FYK A;  3OYE A;  3CC4 A;  2R58 A;  2WSE E;  3HRU A;  2RH2 A;  3C4S A;  2RHU A;  1UGS B;  3ASK A;  1RI0 A;  4MDW A;  2QEX A;  4QQ6 A;  3TCJ A;  3CXC A;  2BIV A;  1YJN T;  3OYK A;  3MEA A;  2E10 A;  3HPW A;  4N0A A;  4M75 A;  5CVI A;  3QO3 A;  3JCM g;  2ZPB B;  4XTY A;  3G71 T;  4LDX A;  3A8M B;  4ZGD B;  1W2B A;  1Y07 A;  3MP1 A;  4OGC A;  1Q82 U;  4M7A E;  1M8V A;  2VV5 A;  2K5L A;  4OB3 B;  1VQ6 A;  4RCB A;  3OA6 A;  5LJ3 f;  3OYL A;  2VGM A;  4HA8 A;  5GAO r;  4M7D G;  3KBG A;  4IUP A;  1Q81 U;  2D9T A;  5CO7 A;  2XD0 A;  3CMA T;  3OBW A;  3PMI A;  4J6X A;  3CCV A;  4KUI A;  2FHD A;  2LVM A;  2ZCF B;  5FRN A;  4LDW A;  3PFS A;  5I21 A;  1KD1 C;  1N8R U;  3VUB A;  2EIF A;  3OQ5 A;  3FDR A;  5LJ3 d;  2HD0 A;  2HQE A;  5I2M A;  1O9S A;  4M75 E;  4QQG A;  5GAO p;  2K2V A;  2LCL A;  4M78 C;  1VIF A;  3A8G B;  1D3B B;  2JUF A;  4N4H A;  4BUG A;  5A0D A;  3JCM J;  4O6J A;  3Q1J A;  2RI5 A;  3GNF B;  4L6V 5;  4J7F A;  4B9X A;  3CCU A;  4M7A D;  2P4T A;  4C92 C;  4QVD A;  4JS4 A;  3SDZ A;  2K4Y A;  1VQ8 T;  1OYX A;  2CZ6 B;  2YLC A;  3ME9 A;  4XTV A;  1S72 T;  2E12 A;  4EMK A;  5HK0 A;  5FLX E;  1KQ1 A;  2RJC A;  1Q7Y C;  2DTO A;  4OMF B;  1M4Z A;  4E7L A;  3OW2 S;  3MP8 A;  4M78 B;  3URG A;  5GAN j;  5GAN h;  1VIE A;  3C12 A;  4PLL A;  5GAO q;  2K3Y A;  4OVA A;  3L2W A;  1RL2 A;  1MHN A;  3NTI A;  2EQK A;  4C92 B;  2ZPH B;  4XU3 A;  3QJ6 A;  5D6Y A;  3CCM A;  3CMA A;  1BI1 A;  3VV0 A;  3CCE A;  3JCM h;  1QVG A;  4PJO E;  4FU6 A;  2K5F A;  4P5N A;  3CC4 T;  1Q81 C;  3WVE B;  3MEV A;  1XTD A;  4C8Q C;  1KC8 U;  3JB9 F;  1BIB A;  1OZ2 A;  3FEO A;  3VUZ A;  2PQW A;  5CKE A;  4BI8 B;  4CI0 C;  2QEX T;  3UDC A;  2YRV A;  3VYG A;  1G3T A;  4IUR A;  1WQ7 A;  5D6W A;  2YHT A;  4M78 F;  3X20 B;  4C0G A;  2LNV A;  4A4H A;  5GMK j;  1YIJ A;  2RHX A;  1N8R C;  3CBP A;  2R5M A;  4FIB A;  3M53 A;  4ZGJ B;  1WJQ A;  1V29 B;  4C92 F;  4JUV A;  3RKW A;  4IUU A;  1QVF A;  2QDY B;  2M16 A;  1Y71 A;  2O01 E;  2E64 A;  3CEY A;  2DPP B;  5J26 A;  3V8L A;  4C8Q B;  5LJ5 e;  2FB7 A;  1VQ6 T;  3SWN C;  3CC7 A;  1VQM A;  2QQS A;  3RIR A;  3VU3 C;  4BE0 A;  3OSV A;  5CKB A;  4IKF A;  2CYZ B;  1MGQ A;  2F69 A;  3GIB A;  4C5E A;  5LJ3 j;  5LJ3 h;  1WNL A;  5FU6 C;  2X35 A;  3CCV T;  5CKH A;  4A4K A;  4M78 G;  2OTJ T;  1QVP A;  3CCQ A;  1M1K U;  5AYF A;  3QDR B;  4M75 D;  5GAM j;  1UEB A;  2EKO A;  4BE2 A;  2O4X B;  3X26 B;  3CCS A;  1W2B S;  2DIG A;  3OYY A;  3LX7 A;  4HKE A;  2DKG A;  4C8Q F;  5GAN 4;  3SWN B;  2QQB A;  3DLL A;  2RHZ A;  3OYM A;  5C0M A;  2EQU A;  4MDX A;  1IRE B;  4M7D E;  3OMC A;  3VJP A;  4OB1 B;  2VGN A;  5C6S A;  3OYN A;  4CRI A;  1IZ6 A;  5FU6 B;  4DOW A;  4IUV A;  1I5L A;  3OB9 A;  3WXM B;  3ER0 A;  3P8H A;  3CD6 T;  4IUT A;  3L42 A;  4HCC A;  1I8F A;  1N27 A;  2CZ7 B;  3OS5 A;  1ZHI A;  4A54 A;  4M7A C;  3INZ A;  4FSX A;  4M77 A;  1QW1 A;  5GMK m;  3GNG A;  3QKJ A;  2M9U A;  1NE8 A;  4X9C A;  2L89 A;  2XG8 D;  3SFM A;  3JCM f;  3OYH A;  5J3B A;  2LDM A;  4N4I A;  2P0P A;  2VXE A;  4XU1 A;  3OS2 A;  3CCM T;  4LDY A;  1JRI A;  1W4S A;  4QVC A;  4ZTJ A;  2E6Z A;  1YCY A;  3QZ5 B;  3CCE T;  3CCL A;  1WJS A;  3OBY A;  2EYQ A;  4Y28 E;  3SD4 A;  1VQO A;  1AHJ B;  4XU0 A;  1YIT A;  3JCM d;  4J6Y A;  4M7A B;  3OYB A;  2Y4X A;  1BYM A;  3F70 A;  3FIF A;  2DTH A;  3LWH A;  1YJW A;  1HK9 A;  4BI4 A;  1Q7Y U;  4RCC A;  1K9M C;  2MWO A;  3JCM b;  1M1K C;  1YBY A;  3QSU A;  2QQR A;  2LT1 A;  4M77 E;  3JB9 I;  3CCJ A;  1YIJ T;  4OB2 B;  2JZ2 A;  4JLG A;  4BI3 A;  3LWI A;  3BY7 A;  5CQY A;  4WF2 A;  4F7U A;  4MZP A;  2WAC A;  3RKX A;  1BIA A;  3MEW A;  3QYG B;  3S6W A;  3FC3 A;  1G3W A;  3BW1 A;  3OSS C;  4C0F A;  2LX9 A;  1KQS A;  1QVG S;  4VUB A;  5GAN e;  4RG2 A;  3UPU A;  1NPR A;  2GFU A;  2OAU A;  3C95 A;  5CKF A;  1VQM T;  2HQX A;  3CC7 T;  4ELY C;  4M7A F;  5GAN 5;  3M9Q A;  4PNO A;  4GLK A;  3MP6 A;  3NFC A;  2KDS A;  2MI6 A;  4EPC A;  3RER A;  5IAY A;  4KBM B;  1Y96 B;  4C0Z A;  4XTZ A;  2OTJ A;  1OI1 A;  2DAQ A;  2RM4 A;  5CIU A;  5A0L A;  4LD6 A;  4PL6 A;  3LYI A;  1K73 C;  3ZBD A;  3CCQ T;  2DXT A;  4BY6 C;  2RHY A;  2GF7 A;  3GP8 A;  4XU2 A;  3EAE A;  5DM7 R;  2AHJ B;  2WSF E;  3CCS T;  1QVF S;  2DVE A;  2EQJ A;  5EG2 A;  4F7U E;  4NL3 A;  5GMK e;  3P8D A;  4X9D A;  5J39 A;  1XOV A;  2HNI A;  4N0A C;  4PJO A;  3JCM X;  4M75 C;  2RJD A;  4A53 A;  3QUI A;  2V8K A;  2X4Y A;  2EWN A;  2X4X A;  4BD3 A;  4BDZ A;  1QP2 A;  3CD6 A;  3MO8 A;  1ZQ1 A;  4OP0 A;  4RG8 A;  4B9W A;  2A7Y A;  5FRM A;  2WSC E;  4M78 E;  4HT8 A;  4JRP A;  2QXF A;  4BY6 B;  1BI2 A;  5GAO l;  1NPP A;  4E7I A;  3AHU A;  2Y90 A;  2FL7 A;  1WJR A;  3GOX A;  3BDL A;  2V8I A;  5LJ3 e;  3M59 A;  2P0K A;  3UT1 A;  1LOJ A;  1SSF A;  4YTL A;  1N6A A;  3NTK A;  5HY6 A;  5KH6 A;  2MMP A;  4J8O A;  1JBM A;  4XK8 E;  3PGG A;  5I2S A;  4M75 B;  1B34 A;  5DLO A;  4JJN K;  4LD9 K;  1G3Y A;  4L59 A;  5GAM e;  3X28 B;  2R57 A;  3FB9 A;  5GMK l;  2JN0 A;  3LLR A;  4Q5W A;  3CCL T;  5GAN 2;  4HCZ A;  3OYA A;  3S3O A;  1U8R A;  2KMT A;  1VQO T;  1YI2 A;  3M4Y A;  4J83 A;  5DLQ E;  1YIT T;  2A3L A;  2K5I A;  1X6O A;  2X4W A;  3N5B B;  3L2Q A;  1VQ5 A;  2RHI A;  3J7A F;  4V2S A;  4ELZ C;  3FJP A;  1YJW T;  4M77 D;  1H3Z A;  3M4G A;  3LH0 A;  3NTH A;  3PIP A;  3CCJ T;  3PT9 A;  2E41 A;  1VQL A;  4M75 F;  3HRT A;  2CZ1 B;  3OYF A;  4EMK C;  1KG1 A;  4JRQ A;  1K8A U;  4C0D B;  1ZBX A;  1Y7X A;  1M5Q 1;  3C94 A;  3HFN A;  4MML A;  3JRZ A;  2XDB A;  3CCR A;  1JB0 E;  2LRQ A;  3JB9 G;  2XI9 A;  2XKO C;  2HAX A;  1YHQ A;  3X25 B;  3CXC S;  2QQA A;  5LJ5 g;  1NZ9 A;  2FVU A;  2JOY A;  3S3N A;  1M9S A;  4GY5 A;  3CBO A;  1K9M U;  2DO3 A;  3OYC A;  2DZ9 A;  2XK0 A;  3G4S A;  4A4F A;  4ZGE B;  4EMK B;  4HT9 A;  1I81 A;  2DZC A;  3LGF A;  3ZEH A;  4OGE A;  4JDS A;  4FM4 B;  2EFI A;  4M75 G;  4C92 G;  3QXE B;  3JCM P;  2BUD A;  3BFM A;  3VKI A;  4Z02 A;  2VUB A;  1U1S A;  3QZ9 B;  3H6Z A;  2DD4 A;  2QI2 A;  2YLB A;  3DB4 A;  5A0G A;  5GAO m;  3FRN A;  2DD5 A;  2E5Q A;  1JJ2 A;  3QHS A;  3CC2 T;  2B8A A;  2IVW A;  4PJO F;  2P0Q A;  3P8B B;  3CPW A;  3J80 E;  3EFR A;  4HCB A;  4NL2 A;  2JVV A;  3HL8 A;  2L8D A;  2MWP A;  4E7J A;  1VQP T;  4JS5 A;  1X75 C;  1UGQ B;  1Q86 C;  2Y4Y A;  1TH7 A;  3R6O A;  1K73 U;  1R8O B;  3OY9 A;  3OW2 A;  3MCA B;  4XAX B;  5FRO A;  2CKK A;  2E65 A;  3OYG A;  1WQW A;  2DIQ A;  2KY9 A;  4C8Q G;  3LGL A;  2DJZ A;  5IT9 E;  1K8A C;  1G3S A;  2F5K A;  1XNI A;  5KCO A;  4PJO D;  2VYT A;  3JCM Q;  1M90 U;  1BI3 A;  4N4G A;  1KHI A;  3HFO A;  2VC8 A;  4FL6 A;  4MZT A;  3TRE A;  5KCH A;  4M7D B;  4J6W A;  2CS7 A;  1YI2 T;  3HKS A;  1VQ5 T;  4BE1 A;  3I56 A;  2OTL T;  2LT4 A;  1D3B A;  5M9O A;  1WGS A;  3M54 A;  1M1F A;  1YJ9 A;  2LQK A;  5CR2 A;  2DXC A;  1VQL T;  3M55 A;  5KE3 A;  3DB3 A;  4DOV A;  2EAY A;  2G3R A;  3ZFJ A;  2ZZD A;  4QW2 A;  3JCM c;  3CME A;  2RK2 A;  3QYH B;  5KE2 A;  1XQH A;  3M5A A;  4M77 C;  3J81 E;  2KAF A;  1LNX A;  1M1G A;  3QPH A;  4ME7 A;  3G6E A;  4M7D F;  3TU4 K;  2DK3 A;  2I2L A;  3CCR T;  1GXI E;  3V8J A;  1YHQ T;  5GAN g;  3PTA A;  1NJI U;  2KQW A;  4M78 A;  4EDU A;  2RJE A;  3JCM e;  2IG0 A;  3V8K A;  5GAN 3;  3L2U A;  4BAC A;  3OS1 A;  3EFS A;  2XHC A;  1VQ9 A;  1O75 A;  3M56 A;  5D6X A;  3G4S T;  4C92 A;  4M7D A;  3A8H B;  1VQN A;  3E1S A;  2JNG A;  2XDD A;  2RI3 A;  5HK3 A;  4M77 B;  5GAN 6;  1U1T A;  2K57 A;  3CPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...