2R57A

Crystal structure of the two mbt repeats from sex-comb on midleg (scm)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
b'AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
molecule keywords Polycomb protein Scm
source organism Drosophila melanogaster
molecule tags Transcription
total genus 51
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r57A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r57A01
1WGSA 5KE3A 4Z02A 2RO0A 3OYEA 2E6NA 3UWNA 3QKJA 3MP8A 5KCHA 3M9QA 4BE0A 2EQJA 3LYIA 3QJ6A 2RJDA 2RJEA 4N4HA 3OYBA 4BACA 3F70A 5D6XA 4EDUA 3MEUA 3PNWC 2DIGA 2E5QA 2R5MA 3QIIA 3OYGA 2RJFA 4IKFA 2FHDA 3MEAA 2HQEA 3C4SA 3L2UA 2EKOA 3P8HA 2LVMA 4E7HA 3KUFA 1OYXA 3P8DA 5C6SA 5KH6A 2RHYA 4IUPA 2EFIA 1WJSA 2VYTA 3PMIA 1XNIA 3DB4A 2O4XA 4A4HA 3OYCA 3OYIA 2XK0A 3E9GA 2YRVA 4N4GA 4RG2A 2RI2A 4GY5A 5D6WA 5FRNA 2XDPA 2LTOA 2O4XB 4BE2A 3GOXA 3DB3A 2L89A 3E9FA 4CRIA 3OB9A 2X4WA 2GFUA 2K3XA 4N4IA 2LDMA 3OS2A 3FC3A 4OVAA 2RI5A 1OZ2A 4II1A 3LX7A 4IUVA 4IUQA 2EQKA 3NTKA 5J39A 3ME9A 1RI0A 2RHIA 2GF7A 4ZTFA 4C5EA 4BE1A 4QVZA 4FU6A 4C5HA 3QBYA 3OS0A 3L42A 2JTFA 3Q1JA 2RHXA 4C5GA 5C0MA 3L2RA 4ZTJA 4UC4A 2HQXA 1KHCA 4FL6A 4QQDA 2X4XA 3FLGA 3PFSA 3OMGA 2R57A 2RHZA 2D9TA 4A4FA 4PLLA 4QQ6A 3L2VA 3O8VA 3CEYA 3OYJA 1SSFA 4IUTA 3S6WA 5IN1A 1WJQA 2GFAA 3OYLA 2EQMA 4QQGA 3H8ZA 4BDYA 4E7JA 4PLIA 3OYDA 1WJRA 2PQWA 5J26A 4L59A 3S3OA 2BKDN 5FRMA 3L2WA 3H6ZA 2F5KA 3MO8A 3PMTA 4X34A 4B9XA 3MEVA 2MWOA 3DLMA 3SD4A 2M16A 2LCCA 5KCOA 3OYMA 1MHNA 3LGFA 3ZEHA 3S3NA 3S3MA 2RHUA 4NS5A 2DAQA 3LGLA 5FROA 2QQSA 4PL6A 2M0OA 3OYNA 3NTIA 3MP6A 3NTHA 3LH0A 3UT1A 1OZ3A 3EAEA 3FDRA 4LD6A 2BUDA 2QQRA 4IUUA 2NLUA 4A4EA 2JZ2A 4C5IA 2CKKA 2P0KA 2R5AA 1H3ZA 4E7KA 4BD3A 3OYFA 3OYAA 4HCZA 3OA6A 2DIQA 2L8DA 1OI1A 2RJCA 2R58A 3L2QA 3OYHA 2IG0A 2X35A 2G3RA 2B8AA 2EQUA 2MWPA 3MEWA 3OYKA 4B9WA 3FEOA 4E7IA 2RI3A 3ASKA 2BIVA 3META 5D6YA 2L3RA 2X4YA 2M1HA 3LLRA 4Q5WA 3OMCA 5M9OA 3OS1A 2K3YA 5KE2A 3MP1A 2LRQA 4E7LA 4BDZA 3BDLA 4IURA 4QW2A 1N27A 1G5VA 5IAYA 2WACA 3OY9A 3OQ5A 5CIUA 4A4GA
chains in the Genus database with same CATH superfamily
1VQ5Q 1SHGA 1BU1A 3OYEA 3VS5A 2E64A 5LJ5g 3TVTA 1GRIA 1MNEA 3TCJA 3RKYA 2PVDB 1TUGB 2QQAA 2QQBA 2RJFA 3C4SA 2QK0A 3JB9D 2VC8A 1G2BA 2LJ3A 5CAIA 2DM1A 2KRMA 4BI8B 2GQIA 2KSSA 2O4XB 2BZ8A 2ED1A 1VQNT 3MPUB 2KBTA 2KT8A 1OZ2A 5LJ5d 2CH4W 1Z9ZA 5L23A 3QG1A 3CCJQ 4J7FA 4ZTJA 1KHCA 3FRNA 1Q81R 3CD6T 3QDRB 1GBRA 4FYWB 4XU2A 2R57A 1AOJA 1WZOA 1JQQA 5GANe 1I07A 1YJ9T 5GAN8 2DTHA 4DOVA 4J9DA 3I5RA 3VUBA 1LJOA 3M0UA 4BI3A 2LP5A 2FPEA 1VYTA 2LCSA 3A5ZB 4ZNXA 4RKUE 3CCUQ 3X24B 1U06A 3JCMc 1JBMA 3UT1A 3FDRA 1YJNA 1RAHB 1YITT 5GAMj 1BK2A 2XHCA 3X28B 2DL8A 5KYUA 3M5AA 2K79A 3A1PA 2DK3A 4ZN1A 4J9EA 2P4RA 2RF0A 3CXCP 1EZZB 1BYMA 2NUPB 5CQXA 1WNLA 4IURA 5LJ3h 2YT6A 3JCMg 4FSSA 5KCHA 5LJ5j 4BACA 3F70A 4OB2B 4HCKA 2DIGA 3OYGA 2GGRA 3CCET 3V8JA 1K9MR 4JJDA 1QMCA 4FYVB 5J3BA 2PVGB 2CSIA 1M9SA 5AT1B 2M02A 3A8HB 4PFZA 2CP2A 2O4XA 1C0MA 4FSXA 1WFWA 4RTWA 3CPWA 2MAMA 3GOXA 8AT1B 1WQWA 4PKCC 4CRIA 4C8QB 4ELZC 2ZZDA 2L2PA 1S1NA 2WSFE 2FEIA 4M78B 3RDVA 3I55Q 1C1AA 2JOYA 2EQIA 4F7UA 5IH2A 1HK9A 3PTAA 4AT1B 1OULA 2XICA 3QZ5B 1VQ7T 4PLIA 3JB9G 2CZ6B 4OMNA 2DA9A 1VQMT 4XTUA 2F5KA 2CZ7B 1YCYA 4OMQA 2RQUA 4M7AE 2QEXQ 4DOWA 1JXMA 1MHNA 3E19A 2EYYA 2RD1A 3G6EQ 3NTHA 3INZA 4M75A 3JCMV 3JCMP 4C92C 2JJ9A 5GAN2 2A37A 1YJWT 5KYWB 4M77B 4JRQA 3PVLA 4E7IA 4B9WA 1YP5A 4RTVA 3I56Q 3OMCA 2BZXA 3VUZA 1Q81U 2CT3A 3CCSA 5GANd 1KD1R 1RABB 4LUDA 4FYXB 2GBQA 2O9SA 4J7IA 4Z02A 4C92F 2VB6A 2K7AA 2KI7A 3OS5A 5GAMf 2EQJA 2YUOA 4C8QC 1VQLQ 4JS5A 2RJEA 2CP0A 2XG8D 2DXBA 1B34A 3PNWC 2E65A 1IXDA 2E5QA 1Y57A 2X3XD 1FWZA 2EKOA 2P0QA 3RNJA 1Q82R 4V2SA 5ECAA 5IXBA 3KUFA 3LWHA 3C94A 3VYGA 5GMKj 3G71A 1M1KR 2VYTA 3PMIA 2E1HA 3OYIA 3J80E 3E9GA 2RI2A 2LTOA 3R6NA 4C8QF 1M5Q1 3OW2P 1HD3A 2AHJB 3CC4A 4OVAA 1GBQA 1JJ2A 2X3WD 4OF1A 4M78A 1YHQT 2DVEA 4ZTFA 2DTOA 1YI2Q 4M78F 3HHTB 3ZFJA 2JN0A 3HKSA 2GTJA 2V8KA 4UC4A 1QP2A 4OMOA 2K5FA 1BIAA 2D9TA 2NUZA 1VQ5A 3CEYA 2G6FX 4D8DA 4PJOA 4M77C 2PUKB 1YFNA 2OTJQ 2BKDN 2DEUA 1K9MU 3PMTA 2V1RA 5GANj 3SD4A 4KULA 1KC8C 3M4GA 3NGPA 1KQSA 1UEBA 1N9SA 2LQKA 1RADB 1YWPA 4RCCA 4DA4A 1M1FA 1M30A 4BD3A 3TEEA 4M77F 2P4TA 1QCOA 3M58A 4LNPA 2G3RA 1NEBA 1AWWA 3MEWA 2V26A 2PNIA 2XDDA 3LLRA 3PE0A 5KE2A 2YRCA 3CCJA 3CCVT 1VQNA 1SSHA 2KVQG 1WHLA 3OY9A 1K4US 3JB9H 5KE3A 1JRIA 1R8OB 2M0YA 3JSCA 3I35A 5LJ3g 3EFRA 3CC7T 2HNIA 2YUNA 4EDUA 3MEUA 2CP7A 3MHXA 3RBBB 1YJ9A 1HSQA 1VA7A 1YNZA 3QXEB 4HCCA 1MGQA 2LVMA 4M78D 3CCUA 1LVKA 4F14A 2SRCA 1EIFA 4N4GA 3JCMf 3EG3A 2DX1A 4PJOD 1E6HA 4HVUA 1ZA2B 2EGEA 4JJBA 2RN8A 3CPWS 1DJ7B 1NYFA 3KFVA 5KYNA 1WPYA 1UE9A 3M0TA 3CXCA 4PLLA 2DYBA 2I0NA 5IN1A 2DERA 4IIMA 2J7IA 2YRDA 1GL5A 1QVPA 2MI6A 3SEMA 1Q82U 3QWXX 5KYYB 4RTTA 3X26B 3DLMA 2D8JA 1Q86R 2YLCA 2RHUA 1M1KU 2EWNA 1ZHIA 4HVWA 1SRLA 1M90C 3M0SA 2OI3A 1X6OA 1IB8A 1K9AA 3RERA 3CCEA 2CH4A 5GMKi 1LNXA 2O01E 2PVOB 3EG2A 1YWOA 3HRTA 2EGAA 5GAN4 4JZ3A 3REBB 4A53A 5KYXB 5GAMe 2O31A 3OS1A 3CCRQ 4C0DB 4FM4B 2HSPA 1E7OA 1VQ6T 4FW2A 2EKHA 1B07A 2JMAA 4QW2A 2O9VA 1NE8A 2AKLA 1JB0E 1Z9QA 1UG1A 4KRTA 1X2KA 2J05A 3MP8A 2DXUA 4WF2A 1TTHB 2MPXC 2O2OA 2HKQB 2R5MA 4LDYA 3QYGB 4F7UE 3H41A 1W1FA 1K8AU 5LJ5e 2ZPHB 4C92G 5A0DA 4M7AC 4IUPA 2DJZA 4OB1B 1GXIE 3DB4A 2IVWA 2W10A 3A8LB 4RG2A 4F17A 2ESWA 4XTZA 3TU4K 3GP8A 4R0KA 3M0PA 4ELYC 3NFCA 3OYYA 3RESA 4M75E 5A0GA 4BE1A 1WIEA 1PHTA 2LCLA 4L6V5 3HSBA 4C8QG 4BUGA 3UA6A 4M7DE 4E2FB 1U3OA 4LUEA 3H8ZA 3QPHA 3LWIA 2DLPA 5KYYA 2P0PA 1N8RR 2OTLT 4WCIA 1QVGP 1WHGA 2RH2A 4ORZA 3VS6A 1M2VB 4PJMA 1SEMA 1KQSS 3EAEA 1QKXA 1XJWB 1OQKA 4C5IA 3GBQA 1UECA 4EMGA 3L2QA 3OYHA 1ZUKA 2IG0A 1N9RA 2B8AA 1YCSB 5KYXA 4CI0C 9ATCB 4Q5WA 3H0HA 4XTVA 1YBYA 2YUQA 1AZGB 4M77G 2MMPA 1WLPB 1JU5C 3BW1A 1YHQA 1KHIA 4JJNK 2CT4A 2DETA 4BE0A 3SWNA 4X9DA 2I2LA 1OV3A 1I8FA 2XKOC 4F04B 2OTJA 1MNDA 1VIEA 2OAWA 3CC4Q 1XTDA 3URGA 1X01A 1OX8A 2JVVA 1RAAB 3CMAT 2K4YA 1ZLMA 2FRYA 1MV3A 1X2QA 5GAOr 2Y4YA 5C6SA 3JB9J 4PJOE 2HKNA 1Y96B 5CK9A 1WXUA 2JNGA 2XK0A 1D1BA 2KROA 2DZCA 5GAMd 1VQKT 2X4WA 2K3XA 5GMKe 1R0CB 5LJ3f 2RI5A 4IUVA 4R55A 1RI0A 2E10A 4JZ4A 3HFNA 4DBHA 2ZPEB 4FL6A 3WXMB 5GAN6 2ZPFB 3OMGA 3HFOA 5GJVB 1FYNA 4YTLA 3FJPA 5DM7R 3CCVA 2ZAEA 3VS4A 3G1JA 2JS2A 3ER0A 2D0QB 1WXTA 4BDYA 1WJRA 3QUIA 5CKHA 1AWJA 1NBEB 1X6BA 2PZ1A 3CC7A 1JXOA 2QGFB 1KFZA 4E7SA 1VQNQ 2F2WA 3EFOB 3MP6A 3V7RA 3L2ZA 1TWBA 2BUDA 4IUUA 1K0SA 1QVFP 2J6FA 3CC2T 4JJCA 3QDFA 1OI1A 2R58A 3CD6Q 1M4ZA 4MZMA 4XAXB 3KBGA 1PD0A 5D7UA 2V8JA 1AZEA 2FB7A 1M27C 3M53A 4HCBA 2VV5A 2X4YA 1YJ9Q 2E6ZA 1VQ9T 4RMOA 1PM3A 1ZSZC 3VS3A 2CP3A 4OB3B 4LN2A 4JUVA 1BI0A 1VQ4T 2B86A 3QKJA 2CSQA 4P5NA 1N8RU 1UB4A 4JPBW 1TXQA 4QVCA 1YITQ 3AHUA 3GNGA 1Q7YC 1K73C 1V1CA 2Y90A 1X69A 3GF5A 4E7HA 2QI2A 3CCQT 3VYHB 4RCBA 4O6JA 4GLKA 3CBMA 2EIFA 2LX9A 1I81A 2LQWA 3LH5A 1I5LA 5CKBA 5FLXE 3VRZA 2FZKB 4C92B 2M9UA 4OMPA 3HL8A 2CZ0B 2OJ2A 4II1A 3VS7A 3CMET 4F16A 3CCRA 3PGGA 3OS0A 1NPRA 4RTXA 1W2BS 1IHVA 1RL2A 1WDXA 2ZGWA 3X20B 3C12A 3CCMT 4VUBA 5I22A 2KMTA 1VQ6A 3CCEQ 3S6WA 4J83A 2ZPIB 2EQMA 3JCMd 2VUBA 5J26A 4EIKA 1PC0A 4KT0E 3MO8A 3I5SA 4M7AG 2DYIA 2DTIA 2LCCA 2M16A 2BZYA 1M90R 1ZQ1A 2M0OA 3LH0A 2JTMA 5DLOA 3OSSC 2F2XA 1F1BB 2R5AA 3HTRA 4E7KA 4AFQC 1B7TA 2JXBA 1NLPC 3A98A 4QKUA 2DIQA 2RJCA 1WI7A 5CKEA 2QTVA 1Y7XA 4J9CA 3V8KA 2LC4A 2YUPA 1VQ7Q 1W4SA 2QDYB 1UGVA 1MUZA 2CGHA 1O9SA 1ABOA 4M75C 2X4JA 4NL3A 1VQMQ 3SDZA 1RACB 3NMZC 1CKAA 2RA2A 3M57A 4A63B 5GJWB 3UWNA 1KC8U 3MKDA 1M3BA 3LYIA 2DXCA 2K6DA 1UGRB 3EGUA 4M7DC 1JEGA 2DXTA 2KGTA 2BE9B 2V1QA 2IIMA 4KBMB 1T0HA 2NUPA 2A7YA 3BDUA 5FWBA 2COYA 2QA4T 2DL7A 2OAUA 2OTLA 1MMGA 1W2BP 1WJSA 1K76A 3DLLA 1QVGA 4A4HA 2QASA 3I9QA 2QAZA 4C92A 2YRVA 4MDWA 1U1SA 1FMWA 3M55A 3P8BB 4M7DF 1D1CA 1GCPA 4NOYA 2E5KA 1C6VX 1GCQC 2KNBB 3H0FA 2HL3A 4DBFA 2CUBA 2ED0A 1RLPC 2RHXA 1WA7A 1QCNA 2FYKA 2X4XA 3CCLT 2KRSA 2LT4A 2M51A 3EG0A 1VQOT 4IUTA 5DLQE 2D1XA 1NJIC 4KGZB 4C8QA 3J81E 3L2WA 4ZGJB 4NL2A 1PSFA 2VASA 8ATCB 4KUDK 5EG2A 3LGFA 2EYXA 1QQJA 1BBZA 2DMOA 1Y71A 2NLUA 1WX6A 1YHQQ 2NYSA 4LD9K 1R0BG 4HCZA 3UATA 3OA6A 2NWMA 1LPLA 3M0RA 2RI3A 4OMMA 2BIVA 2KT1A 5LL6S 4ZGDB 5AYFA 5HK0A 2K3YA 1ARKA 3M0QA 2JTEA 4XK8E 2A28A 1YIJT 1D3BB 4D8KA 1K8AR 4L5GA 1AVZC 1WGSA 1QW1A 4C92D 2KR3A 5KYWA 4M77A 2HL5C 2EYZA 2OX7A 3SFMA 2E41A 1FXXA 1M90U 1FMKA 2LT1A 4IKFA 1VQPT 2YHTA 4A54A 1PSEA 2K5LA 2DE0X 1T3SA 1I5OB 4FT2A 1U5SA 1Q81C 2VWFA 4MMLA 3CCVQ 1M8VA 2E3IA 2AZSA 1RAEB 2L89A 3CD6A 4C8QD 3E1SA 1IGQA 2GFUA 4N4IA 5GAOn 1SRMA 3REAB 3LX7A 4JRIA 3NTKA 1PKTA 3CC2A 4JRPA 3CC7Q 5GAOl 3Q1JA 5C0MA 5GAN7 2K5IA 1G3TA 3FLGA 4AG2C 3CBOA 2DD4A 4A4FA 1LCKA 1VUBA 3OYJA 2ZPGB 1SSFA 3EFSA 1WJQA 4OB0B 2GFAA 4AG1C 4AFSC 2JT4A 1ZX6A 5A0LA 4KUIA 1BB9A 4JLIA 3OBYA 1VQ4A 1YITA 3C0CA 3H6ZA 4X34A 4B9XA 5LJ3d 5LJ5h 1B3QA 3G7ZA 2RM4A 2HMAA 3G4ST 1E6GA 3QZ9B 4M7AB 4FT4A 2DVJA 3EGXB 2ATCB 3OYAA 3EG9B 2H3EB 4J6YA 1ZSGA 3VKIA 2L3PA 2RQVA 4CC2A 4HVVA 1K0XA 1TUDA 4M77D 2F5TX 4AFUC 1PWTA 1XQHA 3META 4DEYA 1YJNT 2PU9B 1VYUA 1QWEA 5CKDA 2A3LA 1D3BA 5CQYA 2ECZA 4MZTA 3L1AA 2HZYA 3FIFA 5IAYA 1AWOA 3LW5E 1FMVA 1Q95G 1N5ZA 2BE7D 3JV3A 1BCMA 2HEQA 2QQ9A 1RI9A 3M9QA 5FWCA 2MK5A 2VGMA 3QHSA 3CCMA 5FW9A 2DKGA 1K1ZA 4Y28E 1VQ8T 3L2UA 3P8HA 2DD5A 2VVKA 1HXDA 2RHYA 4DEXA 5FU6C 5FU7C 4HT8A 2DILA 2RQTA 2JM9A 1VQ6Q 5D6WA 5FRNA 2RQRA 4GY5A 3EGDB 2CUDA 3TSZA 1PNJA 2KXCA 2XU8A 3VRYA 5LJ3j 1WHHA 3OB9A 2LDMA 1OU9A 5GAOm 1AEYA 4CC3A 2H3JA 3JCMb 1S72T 2QGGA 3CPWP 1VQ7A 1BIBA 3L42A 4OMLA 1IGUA 4MDXA 1UJ0A 1QLYA 2LNVA 3VS2A 3JRZA 1VQMA 1M1GA 3HP9A 2DNUA 4M7DG 2K3BA 2JW4A 2C0TA 2E12A 7AT1B 2L3SA 3QYHB 2RNAA 3MEVA 3TSWA 4FYYB 2KEAA 3QSUA 1YJWA 3V8LA 1JJ2S 2CP5A 1JO8A 2AT1B 4M7AA 4M7AF 3EGXA 1KD1C 4EMKC 1IHWA 1KJWA 2QA4A 4OP0A 2FZGB 1OPLA 2F69A 5GMKh 3V7CA 5CCAA 1X27A 1QKWA 3NPFA 1UJYA 4ANJA 1D09B 3BDLA 1Q82C 2FZCB 2EJGA 1D1AA 2IPOB 2OTLQ 5CIUA 1AT1B 2K2MA 5IHIA 1ZA1B 2QYZA 2KYMA 4N0AC 6AT1B 3CCST 1A0NB 3CCLA 4PJLA 1HJDA 5D6XA 4LDUA 1VQOA 4PFOA 3H0IA 4KGXB 3HPWA 2LZ6B 3X25B 3P8DA 3OW2A 2RK2A 3VS1A 4C8QE 4PJJA 3M59A 5GANh 3OYCA 1M3CA 1GFCA 1VOMA 2AK5A 2A36A 3SWNC 4BE2A 2C0IA 2DO3A 2CREA 2DBKA 2XIDA 3E9FA 4M78E 2W0ZA 3G71T 2YLBA 4XTWA 2HDAA 4J9IA 2GCXA 2EPDA 3JCMe 1WHMA 3QBYA 2V8IA 2MCNA 4C5GA 2JTFA 3THKA 5HK3A 2FPFA 3L2RA 4XTYA 1HYOA 1MMAA 1ZSZB 4QQDA 2YDLA 1G3WA 1NJIR 4M7AD 2RHZA 2DEQA 2F2VA 4QQ6A 4RTZA 3L2VA 4FIBA 4Z89A 3JAME 3EG1A 1EX4A 2RMOA 3S3OA 2XMFA 5GAN3 1NLOC 4J9HA 4K11A 1T0JA 1AWXA 1VQ5T 2J6OA 3EHRA 1AHJB 5IXFA 3OYMA 1G83A 1IRXA 3V7SA 3S3MA 2PTKA 4X1VA 1VQKQ 2QQSA 4ME7A 2XDBA 4M77E 1VQPA 1KQSP 1NYGA 3ZL7C 1IREB 2HSEB 3CXCS 2F1LA 1KC8R 3ASKA 3PIPA 1W70A 2L3RA 3M4YA 2EVRA 2BTTA 1M2VA 2QG9B 4J9BA 1SHFA 2WACA 1TH7A 4A4GA 1M3AA 1TUCA 2COZA 3GNFB 3QWYA 2KQWA 2LQ8A 2VGNA 3CCJT 4N4HA 3H9NA 4BY6C 4JRKA 2CDTA 2VXFA 3SB2A 4C0GA 3QIIA 2HD0A 3MEAA 3CC2Q 1EFNA 2JMCA 2ENMA 4CC4B 4D6WA 2DFUA 2DRMA 4PNOA 1BI2A 2EFIA 4ZGEB 2AIRB 2AZVA 1SKUB 2KXDA 1VQ9Q 4F7UB 4M4ZA 3CCUT 1ACMB 2NUTB 3G4SA 1I0CA 1VQ4Q 2K9GA 3TREA 2EQKA 3A8OB 4QVZA 1ZSZA 5L8RE 1SG5A 1Y96A 1Q86C 4RTYA 5CR2A 2DJQA 4M75B 3UA7A 3JCMW 3JB9I 2DRKA 2A0FB 1H641 4XU0A 3CCQQ 2YSQA 4BI4A 2XI9A 3CQTA 3EH1A 2LX7A 1H3HA 2PQWA 5FRMA 1WHJA 2MIOA 1D0YA 4M7DB 2JUFA 4R56A 3FB9A 5DY9A 2RPNA 2WSCE 5I2MA 3NTIA 4LD6A 1V29B 1WXBA 1PRLC 1VQ8A 3CMEQ 2P0KA 2FL7A 2X35A 2EW3A 1U8RA 3CCMQ 3RIRA 4Z88A 4QT7A 4PK4A 1B34B 3VU3C 4ATOA 4HA8A 4JLGA 2LRQA 2RK1A 3EFOA 2KAFA 4TVRA 1NJIU 3FJ5A 1N27A 1G5VA 1FX7A 4LDXA 3O5ZA 1S72A 1NEGA 1GFDA 2RO0A 3A8MB 5CO7A 2Z0WA 3I55T 1OPKA 2A08A 2HQEA 2JS0A 2C0OA 3GIBA 1KQ1A 2KK4A 2MYSA 5KH6A 4Y91A 2DL5A 5CKFA 1MV0B 2LMJA 4F7UF 2ROLA 3RKXA 2YXYA 3RUXA 3OW2S 2QEXT 1BI3A 2NUTA 2EJFA 2MF2A 1PCXA 4PJOB 1P92A 1TOVA 5GANg 3G6ET 3PIOA 3OS2A 4LDWA 1N8RC 3JCMQ 4C5HA 5I21A 1YJWQ 1PKSA 1OOTA 1QWFA 3MJXA 5LJ3e 3GPLA 4BB7A 4M75F 3R6OA 1KK7A 4ZN3A 4PJNA 3EHQA 3O8VA 2QA4Q 3I56T 1QP3A 1WYXA 4KH1B 1UGSB 4C0ZA 4E7JA 4M7DA 1N6AA 2C06A 4E6RA 5I2SA 5KCOA 4KGVB 3ZEHA 1NZ9A 2DPPB 4NS5A 1WQ7A 3LGLA 4HKEA 5FROA 2GQVA 1VQLT 3IQLA 1YN8A 3E2UA 4A4EA 2JZ2A 1OU8A 2CKKA 1KSWA 2FG0A 1NM7A 1IZ6A 2QXFA 3RR6A 4IIOA 1O75A 2J6KA 2L3QA 3CCLQ 5CVIA 5GMKl 3OYKA 1GCQA 3DKMA 1H8KA 1VQOQ 1UUEA 4M78C 5M9OA 1I1JA 3AT1B 3BFMA 1ZUUA 3GLXA 3ULRB 4OMFB 1TS9A 3NHNA 5IHKA 4HT9A 2E6NA 3CMAA 4PJOC 3QJYA 1YI2T 3QJ6A 5LJ5f 1X43A 4DBRA 4RUGA 2CYZB 2QDLA 1MMNA 5I11A 2FHDA 2HBPA 4FCYA 1VQKA 2Y4XA 2AKKA 4J6XA 1OX9A 3M56A 4J5YA 4M75D 2OTJT 1ZUYA 4DQ2A 2LJ0A 3J7AF 2XDPA 1BKBA 4PJOF 2CP6A 3DB3A 2FVUA 1YIJQ 1RUWA 4EMHA 4XU1A 3FC3A 4M7DD 1J3TA 4GBQA 1I4K1 1KQ2A 2SEMA 2GF7A 2VKNA 4C5EA 3WVDB 1QCFA 4PFPA 4B6MA 3BY7A 4EPCA 3PFSA 2CZ1B 1VQPQ 1VYVA 2KE9A 1X6GA 1UDLA 2XD0A 1D0XA 2K57A 3EH2A 4L59A 1UGQB 4LXCA 3UDCA 2MWOA 2DZ9A 1QVFA 3PT9A 5HY6A 5GAMh 2LQNA 4C0FA 4E7ZA 2GTOA 1TSFA 2EAYA 2EBPA 4J8OA 4XU3A 1VQ9A 5FU6B 1VIFA 4FW1A 5FU7B 1H3ZA 1G8XA 2RB6A 3OYFA 1U1TA 3UPUA 5GMKm 4RG8A 2L8DA 1NPPA 3N5BB 1G3YA 3BE3A 2EQUA 2D6FA 5D6YA 2M1HA 2ZCFB 3MP1A 4ESRA 1BI1A 4BDZA 4JDSA 4KH0B 4OGCA 3OQ5A 4J9GA 3CCQA 4Y92A 2FPDA 1ZBJA 4O5VA 3OYBA 2VXEA 3G4SQ 2E70A 2EYQA 4QVDA 3HRUA 2L0AA 1KD1U 4RTUA 2HBWA 1OYXA 5IT9E 1SF9A 3MCAB 2X51A 1YJNQ 1K9MC 1UHCA 5A2QE 3A8GB 1XNIA 2ABLA 3CMEA 1RAFB 5IHNA 4J6WA 4EMKB 2EYWA 1XOVA 2DL3A 4WTOB 3TQ7P 3QO3A 1Q7YR 1K73R 5GAN5 1CSKA 2O88A 1KIKA 4OGEA 3ME9A 4LE9A 2RHIA 3VS0A 3WVEB 4E47A 2GNCA 4FU6A 4F7UG 1UGPB 2K2VA 5HKCA 5GAOp 2HQHA 2FO0A 1VQ8Q 1D0ZA 2E4HA 2KRNA 3CCRT 5HCKA 1RLQC 3CBPA 3RMSA 3OYDA 1QVGS 1OEBA 2D8HA 4CC7A 3RKWA 2D0NA 1UHFA 2PUOB 3ZBDA 4Z8AA 4M75G 5GANf 1V76A 1TU0B 3RMQA 2KDSA 3I55A 4HXJA 2RQWA 2L5QA 1OZ3A 2HCKA 2MOXA 4MZPA 1S72Q 2EJ9A 1W6XA 2KY9A 3D7SB 4JS4A 3U23A 3KXTA 3SWNB 2MWPA 1UFFA 2COWA 1T3LA 2YWWA 3JCMh 2QEXA 3M54A 5GAOq 3JCMX 4E7LA 1TG0A 1UTIA 4XQ3A 3G6EA 3VJPA 1RAGB 1LOJA 3EG9A 4J9FA 3OBWA 2RJDA 1ABQA 3PVQA 1ZBXA 5EC7A 2H8HA 1MMDA 1W2BA 3I56A 2QTXA 4X9CA 4A4KA 2HAXA 3VV0A 4C92E 2KYBA 2CS7A 2ZPBB 2DL4A 4EMKA 1RAIB 1SPKA 1M1KC 1Y0MA 1VQLA 2JM8A 4M78G 1KG1A 1M8MA 3SHWA 4C0DC 3C95A 4IUQA 5J39A 4AFZC 3JB9F 3CCSQ 2DF6A 2EGCA 4DBQA 1IO6A 2HQXA 3UF4A 3JCMJ 4PJOG 1WHKA 1X75C 1CKBA 3EGDA 2X9HA 4N0AA 3OYLA 4QQGA 2FRWA 1Y07A 2P84A 2WSEE 3T9NA 1AD5A 3OSVA 4BY6B 1PG5B 2E3HA 1YI2A 3S3NA 2DAQA 2J06A 4GLMA 4PL6A 1QVFS 3OYNA 3G71Q 2LNHB 4AMCA 1PD1A 5GAMg 2QQRA 1R77A 1JJ2P 3CC4T 3CPFA 1Q7YU 1K8AC 3CMAQ 1K73U 2ROTA 1PRMC 2LJ1A 1M2OA 3HRSA 1YIJA 1Q86U 5KYUB 3FEOA 1G3SA 2DBMA 1BCOA 1H92A 1NG2A 4LDVA 4MMKA 4XTXA
chains in the Genus database with same CATH topology
1FX7A 4LDXA 4L5GA 1WGSA 1JB0E 1S72A 3OYEA 2RO0A 1QW1A 2E64A 5LJ5g 3MP8A 2DXUA 4WF2A 3A8MB 4C92D 4M77A 5CO7A 3TCJA 3RKYA 2PVDB 3SFMA 3I55T 2E41A 1FXXA 1M90U 2R5MA 2LT1A 2QQAA 2QQBA 2RJFA 4LDYA 4IKFA 2HQEA 3C4SA 1VQPT 3QYGB 4F7UE 3GIBA 1KQ1A 2YHTA 3JB9D 1K8AU 2KK4A 2VC8A 4A54A 5CAIA 5LJ5e 2ZPHB 1PSEA 2K5LA 4C92G 5A0DA 4M7AC 5KH6A 4Y91A 4IUPA 2DJZA 4OB1B 1GXIE 5CKFA 4F7UF 4FT2A 3DB4A 1Q81C 4MMLA 3RKXA 1VQMA 4BI8B 2IVWA 3A8LB 1M8VA 4RG2A 3RUXA 3OW2S 2QEXT 2KSSA 2O4XB 1BI3A 2EJFA 2MF2A 4PJOB 2L89A 4XTZA 3CD6A 1P92A 3TU4K 1VQNT 4C8QD 3E1SA 3GP8A 5GANg 2GFUA 4N4IA 3G6ET 3PIOA 4ELYC 5GAOn 3OS2A 1OZ2A 5LJ5d 3NFCA 4LDWA 3LX7A 4JRIA 3OYYA 3NTKA 3RESA 4M75E 3QG1A 3CC2A 1N8RC 3JCMQ 5A0GA 4JRPA 4BE1A 5GAOl 4C5HA 4J7FA 5I21A 3Q1JA 4ZTJA 5C0MA 5GAN7 2LCLA 2K5IA 1KHCA 3FRNA 3CD6T 5LJ3e 3GPLA 3QDRB 1G3TA 3FLGA 4M7AG 4L6V5 4XU2A 4M75F 3R6OA 4BB7A 3CBOA 2R57A 4C8QG 2DD4A 4BUGA 5GANe 4A4FA 3HSBA 1VUBA 4M7DE 3O8VA 5GAN8 2DTHA 3OYJA 4DOVA 2ZPGB 1SSFA 1YJ9T 3I56T 1QP3A 1WJQA 3EFSA 2GFAA 4OB0B 3VUBA 1LJOA 1UGSB 3H8ZA 3QPHA 3LWIA 4C0ZA 4E7JA 5A0LA 4KUIA 4BI3A 1N6AA 4M7DA 4JLIA 3OBYA 1VQ4A 2P0PA 2C06A 2OTLT 1YITA 3H6ZA 4X34A 4B9XA 3A5ZB 5I2SA 5LJ3d 5KCOA 4RKUE 2RH2A 3ZEHA 1NZ9A 2DPPB 4NS5A 1WQ7A 3X24B 3LGLA 5LJ5h 4HKEA 5FROA 2GQVA 3JCMc 1JBMA 3G7ZA 1VQLT 1KQSS 3UT1A 3FDRA 3EAEA 2RM4A 1YJNA 3G4ST 4A4EA 2JZ2A 3QZ9B 4M7AB 4FT4A 4C5IA 5GAMj 1YITT 2CKKA 1IZ6A 2QXFA 2XHCA 4EMGA 3OYAA 3X28B 1O75A 4J6YA 3VKIA 3M5AA 3L2QA 3OYHA 2DK3A 4ZN1A 2IG0A 1N9RA 4M77D 5CVIA 2F5TX 5GMKl 2B8AA 3OYKA 1XQHA 4CI0C 3META 3DKMA 1YJNT 2PU9B 4Q5WA 1BYMA 4M78C 5M9OA 5CQXA 5CKDA 4XTVA 1YBYA 2A3LA 3BFMA 1WNLA 1D3BA 5CQYA 3GLXA 4MZTA 4IURA 5LJ3h 3L1AA 3JCMg 3FIFA 5IAYA 4OMFB 3LW5E 4M77G 2MMPA 3BW1A 1YHQA 1KHIA 4JJNK 4HT9A 2E6NA 3CMAA 2QQ9A 5KCHA 3M9QA 3SWNA 4BE0A 4PJOC 3QJYA 4X9DA 3QJ6A 5LJ5j 1YI2T 2I2LA 2VGMA 1I8FA 2XKOC 3QHSA 5LJ5f 3F70A 4BACA 3CCMA 2OTJA 2CYZB 1VIEA 4OB2B 1XTDA 3URGA 1X01A 2DIGA 2DKGA 4Y28E 3OYGA 2FHDA 1VQ8T 3L2UA 2JVVA 3P8HA 3CMAT 3CCET 2K4YA 3V8JA 2HBPA 2DD5A 5J3BA 2PVGB 5GAOr 2Y4YA 5C6SA 1VQKA 1M9SA 3JB9J 4PJOE 1HXDA 2RHYA 3A8HB 2Y4XA 1Y96B 4J6XA 5FU7C 5FU6C 5CK9A 3M56A 4J5YA 4M75D 2OTJT 4DQ2A 2O4XA 4HT8A 2JNGA 2XK0A 3J7AF 5D6WA 4FSXA 5FRNA 4GY5A 2XDPA 1BKBA 4PJOF 3CPWA 2MAMA 3GOXA 2XU8A 3DB3A 2FVUA 1WQWA 4PKCC 2DZCA 4CRIA 4C8QB 5LJ3j 3OB9A 5GAMd 1VQKT 4ELZC 2X4WA 2K3XA 2ZZDA 4XU1A 2LDMA 4EMHA 5LJ3f 5GMKe 3FC3A 2RI5A 4M7DD 4IUVA 4R55A 1I4K1 5GAOm 1KQ2A 1RI0A 2WSFE 2E10A 2GF7A 4C5EA 3WVDB 2H3JA 3JCMb 1S72T 1VQ7A 1BIBA 3HFNA 3L42A 4M78B 4MDXA 2ZPEB 4FL6A 3WXMB 2LNVA 2JOYA 3BY7A 3JRZA 4EPCA 3PFSA 1M1GA 2ZPFB 3HFOA 3HP9A 1HK9A 2CZ1B 3OMGA 4YTLA 4F7UA 3PTAA 4M7DG 3FJPA 5DM7R 3CCVA 3ER0A 2D0QB 2XICA 3QZ5B 1VQ7T 2XD0A 4BDYA 3L2RA 4PLIA 1WJRA 2E12A 3QUIA 3JB9G 2K57A 4L59A 2CZ6B 1UGQB 5CKHA 3QYHB 1VQMT 4XTUA 2F5KA 2CZ7B 1YCYA 3UDCA 3MEVA 2MWOA 2DZ9A 1QVFA 3PT9A 5HY6A 5GAMh 4M7AE 4DOWA 3CC7A 4C0FA 1MHNA 3E19A 3QSUA 2RD1A 1YJWA 3V8LA 1JJ2S 3MP6A 3NTHA 3V7RA 2EAYA 3L2ZA 4M7AA 3INZA 4M75A 4M7AF 2BUDA 4IUUA 3JCMV 1KD1C 4J8OA 4EMKC 4XU3A 1VQ9A 3JCMP 5FU6B 1VIFA 5FU7B 4C92C 1H3ZA 2QA4A 2RB6A 4OP0A 3OYFA 5GAN2 1U1TA 3CC2T 3UPUA 5GMKm 4RG8A 2L8DA 1OI1A 1NPPA 2R58A 3N5BB 1M4ZA 4MZMA 1G3YA 4XAXB 1YJWT 3KBGA 2F69A 4M77B 4JRQA 5GMKh 2V8JA 2EQUA 2FB7A 3V7CA 5CCAA 4B9WA 4E7IA 3M53A 4HCBA 2VV5A 5D6YA 2D6FA 2X4YA 2E6ZA 2M1HA 2ZCFB 3OMCA 1VQ9T 4RMOA 3VUZA 1Q81U 3MP1A 1BI1A 3CCSA 4BDZA 3BDLA 5GANd 4OB3B 4JDSA 1Q82C 4JUVA 2EJGA 4OGCA 3OQ5A 1BI0A 5CIUA 1VQ4T 4J7IA 4Z02A 4C92F 3OS5A 3QKJA 4N0AC 5GAMf 2EQJA 4P5NA 4C8QC 3CCQA 1UB4A 3CCST 1N8RU 4JS5A 2RJEA 4O5VA 3OYBA 3CCLA 2VXEA 4QVCA 2XG8D 5D6XA 2DXBA 1B34A 2E70A 3PNWC 2EYQA 2E65A 3AHUA 3GNGA 4QVDA 3HRUA 4LDUA 1VQOA 1Q7YC 2E5QA 1K73C 1KD1U 5GAN6 2Y90A 1FWZA 2EKOA 2P0QA 3HPWA 3GF5A 4V2SA 4E7HA 3KUFA 1OYXA 2QI2A 3P8DA 3VYHB 3X25B 4RCBA 3LWHA 3CCQT 4O6JA 3C94A 3CBMA 4GLKA 3VYGA 2EIFA 5GMKj 3G71A 3MCAB 3OW2A 2LX9A 2RK2A 4C8QE 1I81A 1K9MC 1I5LA 2VYTA 5A2QE 3M59A 3A8GB 3PMIA 1XNIA 5CKBA 5GANh 3OYCA 3CMEA 2E1HA 3OYIA 3J80E 5FLXE 3E9GA 4J6WA 3SWNC 2RI2A 4EMKB 2LTOA 4BE2A 4C92B 4C8QF 1XOVA 2DO3A 2M9UA 1M5Q1 3E9FA 4M78E 2XIDA 3HL8A 3QO3A 2AHJB 5GAN5 3G71T 2CZ0B 2YLBA 4OVAA 3CC4A 4XTWA 4OGEA 4II1A 1JJ2A 2GCXA 4OF1A 3JCMe 3ME9A 4M78A 2RHIA 3CMET 2DVEA 4ZTFA 1YHQT 2DTOA 3WVEB 4E47A 3PGGA 4M78F 3CCRA 3HHTB 4FU6A 4F7UG 3QBYA 2V8IA 3ZFJA 4C5GA 2JN0A 2JTFA 1UGPB 3HKSA 5HK3A 2V8KA 1NPRA 2K2VA 4UC4A 1QP2A 4XTYA 1RL2A 2ZGWA 5HKCA 5GAOp 4QQDA 2K5FA 1W2BS 3X20B 1G3WA 1BIAA 3C12A 4M7AD 2RHZA 2D9TA 3CCMT 1VQ5A 4VUBA 2DEQA 2KMTA 4QQ6A 3L2VA 3CEYA 4FIBA 1VQ6A 3S6WA 4J83A 3CCRT 4PJOA 3JAME 2ZPIB 4M77C 2EQMA 3CBPA 3JCMd 2VUBA 2PUKB 3RMSA 3OYDA 1QVGS 5J26A 3S3OA 2BKDN 5GAN3 3RKWA 4KT0E 3MO8A 3PMTA 1K9MU 2PUOB 3ZBDA 5GANj 1VQ5T 3SD4A 4KULA 1KC8C 3M4GA 1KQSA 1AHJB 2M16A 2DTIA 2LCCA 1UEBA 4M75G 5GANf 3OYMA 3V7SA 3S3MA 3RMQA 1N9SA 2LQKA 2KDSA 1ZQ1A 2QQSA 3I55A 2M0OA 4ME7A 3LH0A 2JTMA 1OZ3A 2L5QA 4M77E 2XDBA 5DLOA 4RCCA 4MZPA 4DA4A 3OSSC 1VQPA 2R5AA 1M1FA 2EJ9A 4E7KA 2KY9A 4BD3A 4JS4A 3TEEA 1IREB 2DIQA 2RJCA 4M77F 3KXTA 3SWNB 2P4TA 3CXCS 3M58A 2G3RA 3MEWA 2MWPA 5CKEA 3ASKA 3PIPA 1Y7XA 2L3RA 3JCMh 2XDDA 3V8KA 3LLRA 3M4YA 2LC4A 2QEXA 5KE2A 3M54A 3CCJA 3CCVT 5GAOq 3JCMX 4E7LA 1W4SA 1VQNA 2QDYB 4XQ3A 5IT9E 2KVQG 3G6EA 2CGHA 1O9SA 4M75C 2X4JA 2WACA 4NL3A 3VJPA 1TH7A 3OY9A 3SDZA 4A4GA 3GNFB 3JB9H 1LOJA 5KE3A 1JRIA 1R8OB 2RA2A 3M57A 3OBWA 3UWNA 2KQWA 1KC8U 3JSCA 2LQ8A 5LJ3g 2VGNA 3CCJT 3EFRA 3LYIA 3CC7T 2RJDA 2DXCA 2HNIA 1UGRB 4N4HA 4M7DC 2DXTA 1ZBXA 4BY6C 4EDUA 3MEUA 4JRKA 2VXFA 3MHXA 3SB2A 4KBMB 1YJ9A 1W2BA 4C0GA 3I56A 3QIIA 2A7YA 2HD0A 2QTXA 3BDUA 3MEAA 3QXEB 4HCCA 1MGQA 2LVMA 4M78D 4X9CA 2QA4T 3CCUA 4A4KA 2HAXA 3VV0A 4D6WA 4PNOA 4C92E 1BI2A 2OAUA 2OTLA 2EFIA 4ZGEB 2CS7A 1WJSA 1EIFA 2ZPBB 3DLLA 4EMKA 1QVGA 4A4HA 4F7UB 4C92A 4N4GA 2YRVA 3JCMf 1M1KC 1VQLA 4MDWA 1U1SA 3CCUT 3M55A 4PJOD 4M78G 3P8BB 1KG1A 4M7DF 3G4SA 4NOYA 4ZN3A 4C0DC 3CPWS 1DJ7B 3C95A 4IUQA 3TREA 2EQKA 5J39A 3A8OB 3JB9F 4QVZA 5L8RE 2RHXA 2FYKA 1WPYA 1Y96A 2HQXA 1Q86C 2X4XA 3JCMJ 4PJOG 3CCLT 2LT4A 1X75C 5CR2A 3CXCA 4M75B 4PLLA 3JCMW 3JB9I 1VQOT 4IUTA 5DLQE 4N0AA 5IN1A 1H641 4XU0A 3OYLA 1NJIC 4BI4A 4QQGA 4C8QA 2XI9A 3J81E 1QVPA 2PQWA 5FRMA 2MI6A 1Y07A 2WSEE 3L2WA 3T9NA 1Q82U 4ZGJB 4M7DB 4NL2A 1PSFA 3OSVA 2JUFA 4R56A 3X26B 3DLMA 4BY6B 4KUDK 3FB9A 5EG2A 5DY9A 1YI2A 2WSCE 3LGFA 3S3NA 2YLCA 2RHUA 2DAQA 1M1KU 2EWNA 5I2MA 1ZHIA 4PL6A 1QVFS 3OYNA 3NTIA 4LD6A 1V29B 1M90C 1Y71A 5GAMg 2QQRA 2NLUA 1X6OA 1VQ8A 3CC4T 3RERA 4LD9K 2P0KA 3CPFA 3CCEA 5GMKi 1LNXA 2O01E 1Q7YU 1K8AC 2PVOB 1K73U 4HCZA 2FL7A 3OA6A 3HRTA 3HRSA 1YIJA 2X35A 5GAN4 1Q86U 1U8RA 3FEOA 3RIRA 2RI3A 2BIVA 5LL6S 1G3SA 1B34B 4ZGDB 5AYFA 4A53A 5GAMe 3OS0A 5HK0A 3OS1A 2K3YA 3VU3C 4FM4B 4C0DB 4ATOA 4HA8A 4JLGA 2LRQA 2RK1A 1VQ6T 2KAFA 4TVRA 1NJIU 4LDVA 4MMKA 4QW2A 1N27A 4XK8E 4XTXA 1G5VA 1YIJT 1NE8A 1D3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGS A;  5KE3 A;  4Z02 A;  2RO0 A;  3OYE A;  2E6N A;  3UWN A;  3QKJ A;  3MP8 A;  5KCH A;  3M9Q A;  4BE0 A;  2EQJ A;  3LYI A;  3QJ6 A;  2RJD A;  2RJE A;  4N4H A;  3OYB A;  4BAC A;  3F70 A;  5D6X A;  4EDU A;  3MEU A;  3PNW C;  2DIG A;  2E5Q A;  2R5M A;  3QII A;  3OYG A;  2RJF A;  4IKF A;  2FHD A;  3MEA A;  2HQE A;  3C4S A;  3L2U A;  2EKO A;  3P8H A;  2LVM A;  4E7H A;  3KUF A;  1OYX A;  3P8D A;  5C6S A;  5KH6 A;  2RHY A;  4IUP A;  2EFI A;  1WJS A;  2VYT A;  3PMI A;  1XNI A;  3DB4 A;  2O4X A;  4A4H A;  3OYC A;  3OYI A;  2XK0 A;  3E9G A;  2YRV A;  4N4G A;  4RG2 A;  2RI2 A;  4GY5 A;  5D6W A;  5FRN A;  2XDP A;  2LTO A;  2O4X B;  4BE2 A;  3GOX A;  3DB3 A;  2L89 A;  3E9F A;  4CRI A;  3OB9 A;  2X4W A;  2GFU A;  2K3X A;  4N4I A;  2LDM A;  3OS2 A;  3FC3 A;  4OVA A;  2RI5 A;  1OZ2 A;  4II1 A;  3LX7 A;  4IUV A;  4IUQ A;  2EQK A;  3NTK A;  5J39 A;  3ME9 A;  1RI0 A;  2RHI A;  2GF7 A;  4ZTF A;  4C5E A;  4BE1 A;  4QVZ A;  4FU6 A;  4C5H A;  3QBY A;  3OS0 A;  3L42 A;  2JTF A;  3Q1J A;  2RHX A;  4C5G A;  5C0M A;  3L2R A;  4ZTJ A;  4UC4 A;  2HQX A;  1KHC A;  4FL6 A;  4QQD A;  2X4X A;  3FLG A;  3PFS A;  3OMG A;  2R57 A;  2RHZ A;  2D9T A;  4A4F A;  4PLL A;  4QQ6 A;  3L2V A;  3O8V A;  3CEY A;  3OYJ A;  1SSF A;  4IUT A;  3S6W A;  5IN1 A;  1WJQ A;  2GFA A;  3OYL A;  2EQM A;  4QQG A;  3H8Z A;  4BDY A;  4E7J A;  4PLI A;  3OYD A;  1WJR A;  2PQW A;  5J26 A;  4L59 A;  3S3O A;  2BKD N;  5FRM A;  3L2W A;  3H6Z A;  2F5K A;  3MO8 A;  3PMT A;  4X34 A;  4B9X A;  3MEV A;  2MWO A;  3DLM A;  3SD4 A;  2M16 A;  2LCC A;  5KCO A;  3OYM A;  1MHN A;  3LGF A;  3ZEH A;  3S3N A;  3S3M A;  2RHU A;  4NS5 A;  2DAQ A;  3LGL A;  5FRO A;  2QQS A;  4PL6 A;  2M0O A;  3OYN A;  3NTI A;  3MP6 A;  3NTH A;  3LH0 A;  3UT1 A;  1OZ3 A;  3EAE A;  3FDR A;  4LD6 A;  2BUD A;  2QQR A;  4IUU A;  2NLU A;  4A4E A;  2JZ2 A;  4C5I A;  2CKK A;  2P0K A;  2R5A A;  1H3Z A;  4E7K A;  4BD3 A;  3OYF A;  3OYA A;  4HCZ A;  3OA6 A;  2DIQ A;  2L8D A;  1OI1 A;  2RJC A;  2R58 A;  3L2Q A;  3OYH A;  2IG0 A;  2X35 A;  2G3R A;  2B8A A;  2EQU A;  2MWP A;  3MEW A;  3OYK A;  4B9W A;  3FEO A;  4E7I A;  2RI3 A;  3ASK A;  2BIV A;  3MET A;  5D6Y A;  2L3R A;  2X4Y A;  2M1H A;  3LLR A;  4Q5W A;  3OMC A;  5M9O A;  3OS1 A;  2K3Y A;  5KE2 A;  3MP1 A;  2LRQ A;  4E7L A;  4BDZ A;  3BDL A;  4IUR A;  4QW2 A;  1N27 A;  1G5V A;  5IAY A;  2WAC A;  3OY9 A;  3OQ5 A;  5CIU A;  4A4G A; 
#chains in the Genus database with same CATH topology
 1VQ5 Q;  1SHG A;  1BU1 A;  3OYE A;  3VS5 A;  2E64 A;  5LJ5 g;  3TVT A;  1GRI A;  1MNE A;  3TCJ A;  3RKY A;  2PVD B;  1TUG B;  2QQA A;  2QQB A;  2RJF A;  3C4S A;  2QK0 A;  3JB9 D;  2VC8 A;  1G2B A;  2LJ3 A;  5CAI A;  2DM1 A;  2KRM A;  4BI8 B;  2GQI A;  2KSS A;  2O4X B;  2BZ8 A;  2ED1 A;  1VQN T;  3MPU B;  2KBT A;  2KT8 A;  1OZ2 A;  5LJ5 d;  2CH4 W;  1Z9Z A;  5L23 A;  3QG1 A;  3CCJ Q;  4J7F A;  4ZTJ A;  1KHC A;  3FRN A;  1Q81 R;  3CD6 T;  3QDR B;  1GBR A;  4FYW B;  4XU2 A;  2R57 A;  1AOJ A;  1WZO A;  1JQQ A;  5GAN e;  1I07 A;  1YJ9 T;  5GAN 8;  2DTH A;  4DOV A;  4J9D A;  3I5R A;  3VUB A;  1LJO A;  3M0U A;  4BI3 A;  2LP5 A;  2FPE A;  1VYT A;  2LCS A;  3A5Z B;  4ZNX A;  4RKU E;  3CCU Q;  3X24 B;  1U06 A;  3JCM c;  1JBM A;  3UT1 A;  3FDR A;  1YJN A;  1RAH B;  1YIT T;  5GAM j;  1BK2 A;  2XHC A;  3X28 B;  2DL8 A;  5KYU A;  3M5A A;  2K79 A;  3A1P A;  2DK3 A;  4ZN1 A;  4J9E A;  2P4R A;  2RF0 A;  3CXC P;  1EZZ B;  1BYM A;  2NUP B;  5CQX A;  1WNL A;  4IUR A;  5LJ3 h;  2YT6 A;  3JCM g;  4FSS A;  5KCH A;  5LJ5 j;  4BAC A;  3F70 A;  4OB2 B;  4HCK A;  2DIG A;  3OYG A;  2GGR A;  3CCE T;  3V8J A;  1K9M R;  4JJD A;  1QMC A;  4FYV B;  5J3B A;  2PVG B;  2CSI A;  1M9S A;  5AT1 B;  2M02 A;  3A8H B;  4PFZ A;  2CP2 A;  2O4X A;  1C0M A;  4FSX A;  1WFW A;  4RTW A;  3CPW A;  2MAM A;  3GOX A;  8AT1 B;  1WQW A;  4PKC C;  4CRI A;  4C8Q B;  4ELZ C;  2ZZD A;  2L2P A;  1S1N A;  2WSF E;  2FEI A;  4M78 B;  3RDV A;  3I55 Q;  1C1A A;  2JOY A;  2EQI A;  4F7U A;  5IH2 A;  1HK9 A;  3PTA A;  4AT1 B;  1OUL A;  2XIC A;  3QZ5 B;  1VQ7 T;  4PLI A;  3JB9 G;  2CZ6 B;  4OMN A;  2DA9 A;  1VQM T;  4XTU A;  2F5K A;  2CZ7 B;  1YCY A;  4OMQ A;  2RQU A;  4M7A E;  2QEX Q;  4DOW A;  1JXM A;  1MHN A;  3E19 A;  2EYY A;  2RD1 A;  3G6E Q;  3NTH A;  3INZ A;  4M75 A;  3JCM V;  3JCM P;  4C92 C;  2JJ9 A;  5GAN 2;  2A37 A;  1YJW T;  5KYW B;  4M77 B;  4JRQ A;  3PVL A;  4E7I A;  4B9W A;  1YP5 A;  4RTV A;  3I56 Q;  3OMC A;  2BZX A;  3VUZ A;  1Q81 U;  2CT3 A;  3CCS A;  5GAN d;  1KD1 R;  1RAB B;  4LUD A;  4FYX B;  2GBQ A;  2O9S A;  4J7I A;  4Z02 A;  4C92 F;  2VB6 A;  2K7A A;  2KI7 A;  3OS5 A;  5GAM f;  2EQJ A;  2YUO A;  4C8Q C;  1VQL Q;  4JS5 A;  2RJE A;  2CP0 A;  2XG8 D;  2DXB A;  1B34 A;  3PNW C;  2E65 A;  1IXD A;  2E5Q A;  1Y57 A;  2X3X D;  1FWZ A;  2EKO A;  2P0Q A;  3RNJ A;  1Q82 R;  4V2S A;  5ECA A;  5IXB A;  3KUF A;  3LWH A;  3C94 A;  3VYG A;  5GMK j;  3G71 A;  1M1K R;  2VYT A;  3PMI A;  2E1H A;  3OYI A;  3J80 E;  3E9G A;  2RI2 A;  2LTO A;  3R6N A;  4C8Q F;  1M5Q 1;  3OW2 P;  1HD3 A;  2AHJ B;  3CC4 A;  4OVA A;  1GBQ A;  1JJ2 A;  2X3W D;  4OF1 A;  4M78 A;  1YHQ T;  2DVE A;  4ZTF A;  2DTO A;  1YI2 Q;  4M78 F;  3HHT B;  3ZFJ A;  2JN0 A;  3HKS A;  2GTJ A;  2V8K A;  4UC4 A;  1QP2 A;  4OMO A;  2K5F A;  1BIA A;  2D9T A;  2NUZ A;  1VQ5 A;  3CEY A;  2G6F X;  4D8D A;  4PJO A;  4M77 C;  2PUK B;  1YFN A;  2OTJ Q;  2BKD N;  2DEU A;  1K9M U;  3PMT A;  2V1R A;  5GAN j;  3SD4 A;  4KUL A;  1KC8 C;  3M4G A;  3NGP A;  1KQS A;  1UEB A;  1N9S A;  2LQK A;  1RAD B;  1YWP A;  4RCC A;  4DA4 A;  1M1F A;  1M30 A;  4BD3 A;  3TEE A;  4M77 F;  2P4T A;  1QCO A;  3M58 A;  4LNP A;  2G3R A;  1NEB A;  1AWW A;  3MEW A;  2V26 A;  2PNI A;  2XDD A;  3LLR A;  3PE0 A;  5KE2 A;  2YRC A;  3CCJ A;  3CCV T;  1VQN A;  1SSH A;  2KVQ G;  1WHL A;  3OY9 A;  1K4U S;  3JB9 H;  5KE3 A;  1JRI A;  1R8O B;  2M0Y A;  3JSC A;  3I35 A;  5LJ3 g;  3EFR A;  3CC7 T;  2HNI A;  2YUN A;  4EDU A;  3MEU A;  2CP7 A;  3MHX A;  3RBB B;  1YJ9 A;  1HSQ A;  1VA7 A;  1YNZ A;  3QXE B;  4HCC A;  1MGQ A;  2LVM A;  4M78 D;  3CCU A;  1LVK A;  4F14 A;  2SRC A;  1EIF A;  4N4G A;  3JCM f;  3EG3 A;  2DX1 A;  4PJO D;  1E6H A;  4HVU A;  1ZA2 B;  2EGE A;  4JJB A;  2RN8 A;  3CPW S;  1DJ7 B;  1NYF A;  3KFV A;  5KYN A;  1WPY A;  1UE9 A;  3M0T A;  3CXC A;  4PLL A;  2DYB A;  2I0N A;  5IN1 A;  2DER A;  4IIM A;  2J7I A;  2YRD A;  1GL5 A;  1QVP A;  2MI6 A;  3SEM A;  1Q82 U;  3QWX X;  5KYY B;  4RTT A;  3X26 B;  3DLM A;  2D8J A;  1Q86 R;  2YLC A;  2RHU A;  1M1K U;  2EWN A;  1ZHI A;  4HVW A;  1SRL A;  1M90 C;  3M0S A;  2OI3 A;  1X6O A;  1IB8 A;  1K9A A;  3RER A;  3CCE A;  2CH4 A;  5GMK i;  1LNX A;  2O01 E;  2PVO B;  3EG2 A;  1YWO A;  3HRT A;  2EGA A;  5GAN 4;  4JZ3 A;  3REB B;  4A53 A;  5KYX B;  5GAM e;  2O31 A;  3OS1 A;  3CCR Q;  4C0D B;  4FM4 B;  2HSP A;  1E7O A;  1VQ6 T;  4FW2 A;  2EKH A;  1B07 A;  2JMA A;  4QW2 A;  2O9V A;  1NE8 A;  2AKL A;  1JB0 E;  1Z9Q A;  1UG1 A;  4KRT A;  1X2K A;  2J05 A;  3MP8 A;  2DXU A;  4WF2 A;  1TTH B;  2MPX C;  2O2O A;  2HKQ B;  2R5M A;  4LDY A;  3QYG B;  4F7U E;  3H41 A;  1W1F A;  1K8A U;  5LJ5 e;  2ZPH B;  4C92 G;  5A0D A;  4M7A C;  4IUP A;  2DJZ A;  4OB1 B;  1GXI E;  3DB4 A;  2IVW A;  2W10 A;  3A8L B;  4RG2 A;  4F17 A;  2ESW A;  4XTZ A;  3TU4 K;  3GP8 A;  4R0K A;  3M0P A;  4ELY C;  3NFC A;  3OYY A;  3RES A;  4M75 E;  5A0G A;  4BE1 A;  1WIE A;  1PHT A;  2LCL A;  4L6V 5;  3HSB A;  4C8Q G;  4BUG A;  3UA6 A;  4M7D E;  4E2F B;  1U3O A;  4LUE A;  3H8Z A;  3QPH A;  3LWI A;  2DLP A;  5KYY A;  2P0P A;  1N8R R;  2OTL T;  4WCI A;  1QVG P;  1WHG A;  2RH2 A;  4ORZ A;  3VS6 A;  1M2V B;  4PJM A;  1SEM A;  1KQS S;  3EAE A;  1QKX A;  1XJW B;  1OQK A;  4C5I A;  3GBQ A;  1UEC A;  4EMG A;  3L2Q A;  3OYH A;  1ZUK A;  2IG0 A;  1N9R A;  2B8A A;  1YCS B;  5KYX A;  4CI0 C;  9ATC B;  4Q5W A;  3H0H A;  4XTV A;  1YBY A;  2YUQ A;  1AZG B;  4M77 G;  2MMP A;  1WLP B;  1JU5 C;  3BW1 A;  1YHQ A;  1KHI A;  4JJN K;  2CT4 A;  2DET A;  4BE0 A;  3SWN A;  4X9D A;  2I2L A;  1OV3 A;  1I8F A;  2XKO C;  4F04 B;  2OTJ A;  1MND A;  1VIE A;  2OAW A;  3CC4 Q;  1XTD A;  3URG A;  1X01 A;  1OX8 A;  2JVV A;  1RAA B;  3CMA T;  2K4Y A;  1ZLM A;  2FRY A;  1MV3 A;  1X2Q A;  5GAO r;  2Y4Y A;  5C6S A;  3JB9 J;  4PJO E;  2HKN A;  1Y96 B;  5CK9 A;  1WXU A;  2JNG A;  2XK0 A;  1D1B A;  2KRO A;  2DZC A;  5GAM d;  1VQK T;  2X4W A;  2K3X A;  5GMK e;  1R0C B;  5LJ3 f;  2RI5 A;  4IUV A;  4R55 A;  1RI0 A;  2E10 A;  4JZ4 A;  3HFN A;  4DBH A;  2ZPE B;  4FL6 A;  3WXM B;  5GAN 6;  2ZPF B;  3OMG A;  3HFO A;  5GJV B;  1FYN A;  4YTL A;  3FJP A;  5DM7 R;  3CCV A;  2ZAE A;  3VS4 A;  3G1J A;  2JS2 A;  3ER0 A;  2D0Q B;  1WXT A;  4BDY A;  1WJR A;  3QUI A;  5CKH A;  1AWJ A;  1NBE B;  1X6B A;  2PZ1 A;  3CC7 A;  1JXO A;  2QGF B;  1KFZ A;  4E7S A;  1VQN Q;  2F2W A;  3EFO B;  3MP6 A;  3V7R A;  3L2Z A;  1TWB A;  2BUD A;  4IUU A;  1K0S A;  1QVF P;  2J6F A;  3CC2 T;  4JJC A;  3QDF A;  1OI1 A;  2R58 A;  3CD6 Q;  1M4Z A;  4MZM A;  4XAX B;  3KBG A;  1PD0 A;  5D7U A;  2V8J A;  1AZE A;  2FB7 A;  1M27 C;  3M53 A;  4HCB A;  2VV5 A;  2X4Y A;  1YJ9 Q;  2E6Z A;  1VQ9 T;  4RMO A;  1PM3 A;  1ZSZ C;  3VS3 A;  2CP3 A;  4OB3 B;  4LN2 A;  4JUV A;  1BI0 A;  1VQ4 T;  2B86 A;  3QKJ A;  2CSQ A;  4P5N A;  1N8R U;  1UB4 A;  4JPB W;  1TXQ A;  4QVC A;  1YIT Q;  3AHU A;  3GNG A;  1Q7Y C;  1K73 C;  1V1C A;  2Y90 A;  1X69 A;  3GF5 A;  4E7H A;  2QI2 A;  3CCQ T;  3VYH B;  4RCB A;  4O6J A;  4GLK A;  3CBM A;  2EIF A;  2LX9 A;  1I81 A;  2LQW A;  3LH5 A;  1I5L A;  5CKB A;  5FLX E;  3VRZ A;  2FZK B;  4C92 B;  2M9U A;  4OMP A;  3HL8 A;  2CZ0 B;  2OJ2 A;  4II1 A;  3VS7 A;  3CME T;  4F16 A;  3CCR A;  3PGG A;  3OS0 A;  1NPR A;  4RTX A;  1W2B S;  1IHV A;  1RL2 A;  1WDX A;  2ZGW A;  3X20 B;  3C12 A;  3CCM T;  4VUB A;  5I22 A;  2KMT A;  1VQ6 A;  3CCE Q;  3S6W A;  4J83 A;  2ZPI B;  2EQM A;  3JCM d;  2VUB A;  5J26 A;  4EIK A;  1PC0 A;  4KT0 E;  3MO8 A;  3I5S A;  4M7A G;  2DYI A;  2DTI A;  2LCC A;  2M16 A;  2BZY A;  1M90 R;  1ZQ1 A;  2M0O A;  3LH0 A;  2JTM A;  5DLO A;  3OSS C;  2F2X A;  1F1B B;  2R5A A;  3HTR A;  4E7K A;  4AFQ C;  1B7T A;  2JXB A;  1NLP C;  3A98 A;  4QKU A;  2DIQ A;  2RJC A;  1WI7 A;  5CKE A;  2QTV A;  1Y7X A;  4J9C A;  3V8K A;  2LC4 A;  2YUP A;  1VQ7 Q;  1W4S A;  2QDY B;  1UGV A;  1MUZ A;  2CGH A;  1O9S A;  1ABO A;  4M75 C;  2X4J A;  4NL3 A;  1VQM Q;  3SDZ A;  1RAC B;  3NMZ C;  1CKA A;  2RA2 A;  3M57 A;  4A63 B;  5GJW B;  3UWN A;  1KC8 U;  3MKD A;  1M3B A;  3LYI A;  2DXC A;  2K6D A;  1UGR B;  3EGU A;  4M7D C;  1JEG A;  2DXT A;  2KGT A;  2BE9 B;  2V1Q A;  2IIM A;  4KBM B;  1T0H A;  2NUP A;  2A7Y A;  3BDU A;  5FWB A;  2COY A;  2QA4 T;  2DL7 A;  2OAU A;  2OTL A;  1MMG A;  1W2B P;  1WJS A;  1K76 A;  3DLL A;  1QVG A;  4A4H A;  2QAS A;  3I9Q A;  2QAZ A;  4C92 A;  2YRV A;  4MDW A;  1U1S A;  1FMW A;  3M55 A;  3P8B B;  4M7D F;  1D1C A;  1GCP A;  4NOY A;  2E5K A;  1C6V X;  1GCQ C;  2KNB B;  3H0F A;  2HL3 A;  4DBF A;  2CUB A;  2ED0 A;  1RLP C;  2RHX A;  1WA7 A;  1QCN A;  2FYK A;  2X4X A;  3CCL T;  2KRS A;  2LT4 A;  2M51 A;  3EG0 A;  1VQO T;  4IUT A;  5DLQ E;  2D1X A;  1NJI C;  4KGZ B;  4C8Q A;  3J81 E;  3L2W A;  4ZGJ B;  4NL2 A;  1PSF A;  2VAS A;  8ATC B;  4KUD K;  5EG2 A;  3LGF A;  2EYX A;  1QQJ A;  1BBZ A;  2DMO A;  1Y71 A;  2NLU A;  1WX6 A;  1YHQ Q;  2NYS A;  4LD9 K;  1R0B G;  4HCZ A;  3UAT A;  3OA6 A;  2NWM A;  1LPL A;  3M0R A;  2RI3 A;  4OMM A;  2BIV A;  2KT1 A;  5LL6 S;  4ZGD B;  5AYF A;  5HK0 A;  2K3Y A;  1ARK A;  3M0Q A;  2JTE A;  4XK8 E;  2A28 A;  1YIJ T;  1D3B B;  4D8K A;  1K8A R;  4L5G A;  1AVZ C;  1WGS A;  1QW1 A;  4C92 D;  2KR3 A;  5KYW A;  4M77 A;  2HL5 C;  2EYZ A;  2OX7 A;  3SFM A;  2E41 A;  1FXX A;  1M90 U;  1FMK A;  2LT1 A;  4IKF A;  1VQP T;  2YHT A;  4A54 A;  1PSE A;  2K5L A;  2DE0 X;  1T3S A;  1I5O B;  4FT2 A;  1U5S A;  1Q81 C;  2VWF A;  4MML A;  3CCV Q;  1M8V A;  2E3I A;  2AZS A;  1RAE B;  2L89 A;  3CD6 A;  4C8Q D;  3E1S A;  1IGQ A;  2GFU A;  4N4I A;  5GAO n;  1SRM A;  3REA B;  3LX7 A;  4JRI A;  3NTK A;  1PKT A;  3CC2 A;  4JRP A;  3CC7 Q;  5GAO l;  3Q1J A;  5C0M A;  5GAN 7;  2K5I A;  1G3T A;  3FLG A;  4AG2 C;  3CBO A;  2DD4 A;  4A4F A;  1LCK A;  1VUB A;  3OYJ A;  2ZPG B;  1SSF A;  3EFS A;  1WJQ A;  4OB0 B;  2GFA A;  4AG1 C;  4AFS C;  2JT4 A;  1ZX6 A;  5A0L A;  4KUI A;  1BB9 A;  4JLI A;  3OBY A;  1VQ4 A;  1YIT A;  3C0C A;  3H6Z A;  4X34 A;  4B9X A;  5LJ3 d;  5LJ5 h;  1B3Q A;  3G7Z A;  2RM4 A;  2HMA A;  3G4S T;  1E6G A;  3QZ9 B;  4M7A B;  4FT4 A;  2DVJ A;  3EGX B;  2ATC B;  3OYA A;  3EG9 B;  2H3E B;  4J6Y A;  1ZSG A;  3VKI A;  2L3P A;  2RQV A;  4CC2 A;  4HVV A;  1K0X A;  1TUD A;  4M77 D;  2F5T X;  4AFU C;  1PWT A;  1XQH A;  3MET A;  4DEY A;  1YJN T;  2PU9 B;  1VYU A;  1QWE A;  5CKD A;  2A3L A;  1D3B A;  5CQY A;  2ECZ A;  4MZT A;  3L1A A;  2HZY A;  3FIF A;  5IAY A;  1AWO A;  3LW5 E;  1FMV A;  1Q95 G;  1N5Z A;  2BE7 D;  3JV3 A;  1BCM A;  2HEQ A;  2QQ9 A;  1RI9 A;  3M9Q A;  5FWC A;  2MK5 A;  2VGM A;  3QHS A;  3CCM A;  5FW9 A;  2DKG A;  1K1Z A;  4Y28 E;  1VQ8 T;  3L2U A;  3P8H A;  2DD5 A;  2VVK A;  1HXD A;  2RHY A;  4DEX A;  5FU6 C;  5FU7 C;  4HT8 A;  2DIL A;  2RQT A;  2JM9 A;  1VQ6 Q;  5D6W A;  5FRN A;  2RQR A;  4GY5 A;  3EGD B;  2CUD A;  3TSZ A;  1PNJ A;  2KXC A;  2XU8 A;  3VRY A;  5LJ3 j;  1WHH A;  3OB9 A;  2LDM A;  1OU9 A;  5GAO m;  1AEY A;  4CC3 A;  2H3J A;  3JCM b;  1S72 T;  2QGG A;  3CPW P;  1VQ7 A;  1BIB A;  3L42 A;  4OML A;  1IGU A;  4MDX A;  1UJ0 A;  1QLY A;  2LNV A;  3VS2 A;  3JRZ A;  1VQM A;  1M1G A;  3HP9 A;  2DNU A;  4M7D G;  2K3B A;  2JW4 A;  2C0T A;  2E12 A;  7AT1 B;  2L3S A;  3QYH B;  2RNA A;  3MEV A;  3TSW A;  4FYY B;  2KEA A;  3QSU A;  1YJW A;  3V8L A;  1JJ2 S;  2CP5 A;  1JO8 A;  2AT1 B;  4M7A A;  4M7A F;  3EGX A;  1KD1 C;  4EMK C;  1IHW A;  1KJW A;  2QA4 A;  4OP0 A;  2FZG B;  1OPL A;  2F69 A;  5GMK h;  3V7C A;  5CCA A;  1X27 A;  1QKW A;  3NPF A;  1UJY A;  4ANJ A;  1D09 B;  3BDL A;  1Q82 C;  2FZC B;  2EJG A;  1D1A A;  2IPO B;  2OTL Q;  5CIU A;  1AT1 B;  2K2M A;  5IHI A;  1ZA1 B;  2QYZ A;  2KYM A;  4N0A C;  6AT1 B;  3CCS T;  1A0N B;  3CCL A;  4PJL A;  1HJD A;  5D6X A;  4LDU A;  1VQO A;  4PFO A;  3H0I A;  4KGX B;  3HPW A;  2LZ6 B;  3X25 B;  3P8D A;  3OW2 A;  2RK2 A;  3VS1 A;  4C8Q E;  4PJJ A;  3M59 A;  5GAN h;  3OYC A;  1M3C A;  1GFC A;  1VOM A;  2AK5 A;  2A36 A;  3SWN C;  4BE2 A;  2C0I A;  2DO3 A;  2CRE A;  2DBK A;  2XID A;  3E9F A;  4M78 E;  2W0Z A;  3G71 T;  2YLB A;  4XTW A;  2HDA A;  4J9I A;  2GCX A;  2EPD A;  3JCM e;  1WHM A;  3QBY A;  2V8I A;  2MCN A;  4C5G A;  2JTF A;  3THK A;  5HK3 A;  2FPF A;  3L2R A;  4XTY A;  1HYO A;  1MMA A;  1ZSZ B;  4QQD A;  2YDL A;  1G3W A;  1NJI R;  4M7A D;  2RHZ A;  2DEQ A;  2F2V A;  4QQ6 A;  4RTZ A;  3L2V A;  4FIB A;  4Z89 A;  3JAM E;  3EG1 A;  1EX4 A;  2RMO A;  3S3O A;  2XMF A;  5GAN 3;  1NLO C;  4J9H A;  4K11 A;  1T0J A;  1AWX A;  1VQ5 T;  2J6O A;  3EHR A;  1AHJ B;  5IXF A;  3OYM A;  1G83 A;  1IRX A;  3V7S A;  3S3M A;  2PTK A;  4X1V A;  1VQK Q;  2QQS A;  4ME7 A;  2XDB A;  4M77 E;  1VQP A;  1KQS P;  1NYG A;  3ZL7 C;  1IRE B;  2HSE B;  3CXC S;  2F1L A;  1KC8 R;  3ASK A;  3PIP A;  1W70 A;  2L3R A;  3M4Y A;  2EVR A;  2BTT A;  1M2V A;  2QG9 B;  4J9B A;  1SHF A;  2WAC A;  1TH7 A;  4A4G A;  1M3A A;  1TUC A;  2COZ A;  3GNF B;  3QWY A;  2KQW A;  2LQ8 A;  2VGN A;  3CCJ T;  4N4H A;  3H9N A;  4BY6 C;  4JRK A;  2CDT A;  2VXF A;  3SB2 A;  4C0G A;  3QII A;  2HD0 A;  3MEA A;  3CC2 Q;  1EFN A;  2JMC A;  2ENM A;  4CC4 B;  4D6W A;  2DFU A;  2DRM A;  4PNO A;  1BI2 A;  2EFI A;  4ZGE B;  2AIR B;  2AZV A;  1SKU B;  2KXD A;  1VQ9 Q;  4F7U B;  4M4Z A;  3CCU T;  1ACM B;  2NUT B;  3G4S A;  1I0C A;  1VQ4 Q;  2K9G A;  3TRE A;  2EQK A;  3A8O B;  4QVZ A;  1ZSZ A;  5L8R E;  1SG5 A;  1Y96 A;  1Q86 C;  4RTY A;  5CR2 A;  2DJQ A;  4M75 B;  3UA7 A;  3JCM W;  3JB9 I;  2DRK A;  2A0F B;  1H64 1;  4XU0 A;  3CCQ Q;  2YSQ A;  4BI4 A;  2XI9 A;  3CQT A;  3EH1 A;  2LX7 A;  1H3H A;  2PQW A;  5FRM A;  1WHJ A;  2MIO A;  1D0Y A;  4M7D B;  2JUF A;  4R56 A;  3FB9 A;  5DY9 A;  2RPN A;  2WSC E;  5I2M A;  3NTI A;  4LD6 A;  1V29 B;  1WXB A;  1PRL C;  1VQ8 A;  3CME Q;  2P0K A;  2FL7 A;  2X35 A;  2EW3 A;  1U8R A;  3CCM Q;  3RIR A;  4Z88 A;  4QT7 A;  4PK4 A;  1B34 B;  3VU3 C;  4ATO A;  4HA8 A;  4JLG A;  2LRQ A;  2RK1 A;  3EFO A;  2KAF A;  4TVR A;  1NJI U;  3FJ5 A;  1N27 A;  1G5V A;  1FX7 A;  4LDX A;  3O5Z A;  1S72 A;  1NEG A;  1GFD A;  2RO0 A;  3A8M B;  5CO7 A;  2Z0W A;  3I55 T;  1OPK A;  2A08 A;  2HQE A;  2JS0 A;  2C0O A;  3GIB A;  1KQ1 A;  2KK4 A;  2MYS A;  5KH6 A;  4Y91 A;  2DL5 A;  5CKF A;  1MV0 B;  2LMJ A;  4F7U F;  2ROL A;  3RKX A;  2YXY A;  3RUX A;  3OW2 S;  2QEX T;  1BI3 A;  2NUT A;  2EJF A;  2MF2 A;  1PCX A;  4PJO B;  1P92 A;  1TOV A;  5GAN g;  3G6E T;  3PIO A;  3OS2 A;  4LDW A;  1N8R C;  3JCM Q;  4C5H A;  5I21 A;  1YJW Q;  1PKS A;  1OOT A;  1QWF A;  3MJX A;  5LJ3 e;  3GPL A;  4BB7 A;  4M75 F;  3R6O A;  1KK7 A;  4ZN3 A;  4PJN A;  3EHQ A;  3O8V A;  2QA4 Q;  3I56 T;  1QP3 A;  1WYX A;  4KH1 B;  1UGS B;  4C0Z A;  4E7J A;  4M7D A;  1N6A A;  2C06 A;  4E6R A;  5I2S A;  5KCO A;  4KGV B;  3ZEH A;  1NZ9 A;  2DPP B;  4NS5 A;  1WQ7 A;  3LGL A;  4HKE A;  5FRO A;  2GQV A;  1VQL T;  3IQL A;  1YN8 A;  3E2U A;  4A4E A;  2JZ2 A;  1OU8 A;  2CKK A;  1KSW A;  2FG0 A;  1NM7 A;  1IZ6 A;  2QXF A;  3RR6 A;  4IIO A;  1O75 A;  2J6K A;  2L3Q A;  3CCL Q;  5CVI A;  5GMK l;  3OYK A;  1GCQ A;  3DKM A;  1H8K A;  1VQO Q;  1UUE A;  4M78 C;  5M9O A;  1I1J A;  3AT1 B;  3BFM A;  1ZUU A;  3GLX A;  3ULR B;  4OMF B;  1TS9 A;  3NHN A;  5IHK A;  4HT9 A;  2E6N A;  3CMA A;  4PJO C;  3QJY A;  1YI2 T;  3QJ6 A;  5LJ5 f;  1X43 A;  4DBR A;  4RUG A;  2CYZ B;  2QDL A;  1MMN A;  5I11 A;  2FHD A;  2HBP A;  4FCY A;  1VQK A;  2Y4X A;  2AKK A;  4J6X A;  1OX9 A;  3M56 A;  4J5Y A;  4M75 D;  2OTJ T;  1ZUY A;  4DQ2 A;  2LJ0 A;  3J7A F;  2XDP A;  1BKB A;  4PJO F;  2CP6 A;  3DB3 A;  2FVU A;  1YIJ Q;  1RUW A;  4EMH A;  4XU1 A;  3FC3 A;  4M7D D;  1J3T A;  4GBQ A;  1I4K 1;  1KQ2 A;  2SEM A;  2GF7 A;  2VKN A;  4C5E A;  3WVD B;  1QCF A;  4PFP A;  4B6M A;  3BY7 A;  4EPC A;  3PFS A;  2CZ1 B;  1VQP Q;  1VYV A;  2KE9 A;  1X6G A;  1UDL A;  2XD0 A;  1D0X A;  2K57 A;  3EH2 A;  4L59 A;  1UGQ B;  4LXC A;  3UDC A;  2MWO A;  2DZ9 A;  1QVF A;  3PT9 A;  5HY6 A;  5GAM h;  2LQN A;  4C0F A;  4E7Z A;  2GTO A;  1TSF A;  2EAY A;  2EBP A;  4J8O A;  4XU3 A;  1VQ9 A;  5FU6 B;  1VIF A;  4FW1 A;  5FU7 B;  1H3Z A;  1G8X A;  2RB6 A;  3OYF A;  1U1T A;  3UPU A;  5GMK m;  4RG8 A;  2L8D A;  1NPP A;  3N5B B;  1G3Y A;  3BE3 A;  2EQU A;  2D6F A;  5D6Y A;  2M1H A;  2ZCF B;  3MP1 A;  4ESR A;  1BI1 A;  4BDZ A;  4JDS A;  4KH0 B;  4OGC A;  3OQ5 A;  4J9G A;  3CCQ A;  4Y92 A;  2FPD A;  1ZBJ A;  4O5V A;  3OYB A;  2VXE A;  3G4S Q;  2E70 A;  2EYQ A;  4QVD A;  3HRU A;  2L0A A;  1KD1 U;  4RTU A;  2HBW A;  1OYX A;  5IT9 E;  1SF9 A;  3MCA B;  2X51 A;  1YJN Q;  1K9M C;  1UHC A;  5A2Q E;  3A8G B;  1XNI A;  2ABL A;  3CME A;  1RAF B;  5IHN A;  4J6W A;  4EMK B;  2EYW A;  1XOV A;  2DL3 A;  4WTO B;  3TQ7 P;  3QO3 A;  1Q7Y R;  1K73 R;  5GAN 5;  1CSK A;  2O88 A;  1KIK A;  4OGE A;  3ME9 A;  4LE9 A;  2RHI A;  3VS0 A;  3WVE B;  4E47 A;  2GNC A;  4FU6 A;  4F7U G;  1UGP B;  2K2V A;  5HKC A;  5GAO p;  2HQH A;  2FO0 A;  1VQ8 Q;  1D0Z A;  2E4H A;  2KRN A;  3CCR T;  5HCK A;  1RLQ C;  3CBP A;  3RMS A;  3OYD A;  1QVG S;  1OEB A;  2D8H A;  4CC7 A;  3RKW A;  2D0N A;  1UHF A;  2PUO B;  3ZBD A;  4Z8A A;  4M75 G;  5GAN f;  1V76 A;  1TU0 B;  3RMQ A;  2KDS A;  3I55 A;  4HXJ A;  2RQW A;  2L5Q A;  1OZ3 A;  2HCK A;  2MOX A;  4MZP A;  1S72 Q;  2EJ9 A;  1W6X A;  2KY9 A;  3D7S B;  4JS4 A;  3U23 A;  3KXT A;  3SWN B;  2MWP A;  1UFF A;  2COW A;  1T3L A;  2YWW A;  3JCM h;  2QEX A;  3M54 A;  5GAO q;  3JCM X;  4E7L A;  1TG0 A;  1UTI A;  4XQ3 A;  3G6E A;  3VJP A;  1RAG B;  1LOJ A;  3EG9 A;  4J9F A;  3OBW A;  2RJD A;  1ABQ A;  3PVQ A;  1ZBX A;  5EC7 A;  2H8H A;  1MMD A;  1W2B A;  3I56 A;  2QTX A;  4X9C A;  4A4K A;  2HAX A;  3VV0 A;  4C92 E;  2KYB A;  2CS7 A;  2ZPB B;  2DL4 A;  4EMK A;  1RAI B;  1SPK A;  1M1K C;  1Y0M A;  1VQL A;  2JM8 A;  4M78 G;  1KG1 A;  1M8M A;  3SHW A;  4C0D C;  3C95 A;  4IUQ A;  5J39 A;  4AFZ C;  3JB9 F;  3CCS Q;  2DF6 A;  2EGC A;  4DBQ A;  1IO6 A;  2HQX A;  3UF4 A;  3JCM J;  4PJO G;  1WHK A;  1X75 C;  1CKB A;  3EGD A;  2X9H A;  4N0A A;  3OYL A;  4QQG A;  2FRW A;  1Y07 A;  2P84 A;  2WSE E;  3T9N A;  1AD5 A;  3OSV A;  4BY6 B;  1PG5 B;  2E3H A;  1YI2 A;  3S3N A;  2DAQ A;  2J06 A;  4GLM A;  4PL6 A;  1QVF S;  3OYN A;  3G71 Q;  2LNH B;  4AMC A;  1PD1 A;  5GAM g;  2QQR A;  1R77 A;  1JJ2 P;  3CC4 T;  3CPF A;  1Q7Y U;  1K8A C;  3CMA Q;  1K73 U;  2ROT A;  1PRM C;  2LJ1 A;  1M2O A;  3HRS A;  1YIJ A;  1Q86 U;  5KYU B;  3FEO A;  1G3S A;  2DBM A;  1BCO A;  1H92 A;  1NG2 A;  4LDV A;  4MMK A;  4XTX A; 
#chains in the Genus database with same CATH homology
 1FX7 A;  4LDX A;  4L5G A;  1WGS A;  1JB0 E;  1S72 A;  3OYE A;  2RO0 A;  1QW1 A;  2E64 A;  5LJ5 g;  3MP8 A;  2DXU A;  4WF2 A;  3A8M B;  4C92 D;  4M77 A;  5CO7 A;  3TCJ A;  3RKY A;  2PVD B;  3SFM A;  3I55 T;  2E41 A;  1FXX A;  1M90 U;  2R5M A;  2LT1 A;  2QQA A;  2QQB A;  2RJF A;  4LDY A;  4IKF A;  2HQE A;  3C4S A;  1VQP T;  3QYG B;  4F7U E;  3GIB A;  1KQ1 A;  2YHT A;  3JB9 D;  1K8A U;  2KK4 A;  2VC8 A;  4A54 A;  5CAI A;  5LJ5 e;  2ZPH B;  1PSE A;  2K5L A;  4C92 G;  5A0D A;  4M7A C;  5KH6 A;  4Y91 A;  4IUP A;  2DJZ A;  4OB1 B;  1GXI E;  5CKF A;  4F7U F;  4FT2 A;  3DB4 A;  1Q81 C;  4MML A;  3RKX A;  1VQM A;  4BI8 B;  2IVW A;  3A8L B;  1M8V A;  4RG2 A;  3RUX A;  3OW2 S;  2QEX T;  2KSS A;  2O4X B;  1BI3 A;  2EJF A;  2MF2 A;  4PJO B;  2L89 A;  4XTZ A;  3CD6 A;  1P92 A;  3TU4 K;  1VQN T;  4C8Q D;  3E1S A;  3GP8 A;  5GAN g;  2GFU A;  4N4I A;  3G6E T;  3PIO A;  4ELY C;  5GAO n;  3OS2 A;  1OZ2 A;  5LJ5 d;  3NFC A;  4LDW A;  3LX7 A;  4JRI A;  3OYY A;  3NTK A;  3RES A;  4M75 E;  3QG1 A;  3CC2 A;  1N8R C;  3JCM Q;  5A0G A;  4JRP A;  4BE1 A;  5GAO l;  4C5H A;  4J7F A;  5I21 A;  3Q1J A;  4ZTJ A;  5C0M A;  5GAN 7;  2LCL A;  2K5I A;  1KHC A;  3FRN A;  3CD6 T;  5LJ3 e;  3GPL A;  3QDR B;  1G3T A;  3FLG A;  4M7A G;  4L6V 5;  4XU2 A;  4M75 F;  3R6O A;  4BB7 A;  3CBO A;  2R57 A;  4C8Q G;  2DD4 A;  4BUG A;  5GAN e;  4A4F A;  3HSB A;  1VUB A;  4M7D E;  3O8V A;  5GAN 8;  2DTH A;  3OYJ A;  4DOV A;  2ZPG B;  1SSF A;  1YJ9 T;  3I56 T;  1QP3 A;  1WJQ A;  3EFS A;  2GFA A;  4OB0 B;  3VUB A;  1LJO A;  1UGS B;  3H8Z A;  3QPH A;  3LWI A;  4C0Z A;  4E7J A;  5A0L A;  4KUI A;  4BI3 A;  1N6A A;  4M7D A;  4JLI A;  3OBY A;  1VQ4 A;  2P0P A;  2C06 A;  2OTL T;  1YIT A;  3H6Z A;  4X34 A;  4B9X A;  3A5Z B;  5I2S A;  5LJ3 d;  5KCO A;  4RKU E;  2RH2 A;  3ZEH A;  1NZ9 A;  2DPP B;  4NS5 A;  1WQ7 A;  3X24 B;  3LGL A;  5LJ5 h;  4HKE A;  5FRO A;  2GQV A;  3JCM c;  1JBM A;  3G7Z A;  1VQL T;  1KQS S;  3UT1 A;  3FDR A;  3EAE A;  2RM4 A;  1YJN A;  3G4S T;  4A4E A;  2JZ2 A;  3QZ9 B;  4M7A B;  4FT4 A;  4C5I A;  5GAM j;  1YIT T;  2CKK A;  1IZ6 A;  2QXF A;  2XHC A;  4EMG A;  3OYA A;  3X28 B;  1O75 A;  4J6Y A;  3VKI A;  3M5A A;  3L2Q A;  3OYH A;  2DK3 A;  4ZN1 A;  2IG0 A;  1N9R A;  4M77 D;  5CVI A;  2F5T X;  5GMK l;  2B8A A;  3OYK A;  1XQH A;  4CI0 C;  3MET A;  3DKM A;  1YJN T;  2PU9 B;  4Q5W A;  1BYM A;  4M78 C;  5M9O A;  5CQX A;  5CKD A;  4XTV A;  1YBY A;  2A3L A;  3BFM A;  1WNL A;  1D3B A;  5CQY A;  3GLX A;  4MZT A;  4IUR A;  5LJ3 h;  3L1A A;  3JCM g;  3FIF A;  5IAY A;  4OMF B;  3LW5 E;  4M77 G;  2MMP A;  3BW1 A;  1YHQ A;  1KHI A;  4JJN K;  4HT9 A;  2E6N A;  3CMA A;  2QQ9 A;  5KCH A;  3M9Q A;  3SWN A;  4BE0 A;  4PJO C;  3QJY A;  4X9D A;  3QJ6 A;  5LJ5 j;  1YI2 T;  2I2L A;  2VGM A;  1I8F A;  2XKO C;  3QHS A;  5LJ5 f;  3F70 A;  4BAC A;  3CCM A;  2OTJ A;  2CYZ B;  1VIE A;  4OB2 B;  1XTD A;  3URG A;  1X01 A;  2DIG A;  2DKG A;  4Y28 E;  3OYG A;  2FHD A;  1VQ8 T;  3L2U A;  2JVV A;  3P8H A;  3CMA T;  3CCE T;  2K4Y A;  3V8J A;  2HBP A;  2DD5 A;  5J3B A;  2PVG B;  5GAO r;  2Y4Y A;  5C6S A;  1VQK A;  1M9S A;  3JB9 J;  4PJO E;  1HXD A;  2RHY A;  3A8H B;  2Y4X A;  1Y96 B;  4J6X A;  5FU7 C;  5FU6 C;  5CK9 A;  3M56 A;  4J5Y A;  4M75 D;  2OTJ T;  4DQ2 A;  2O4X A;  4HT8 A;  2JNG A;  2XK0 A;  3J7A F;  5D6W A;  4FSX A;  5FRN A;  4GY5 A;  2XDP A;  1BKB A;  4PJO F;  3CPW A;  2MAM A;  3GOX A;  2XU8 A;  3DB3 A;  2FVU A;  1WQW A;  4PKC C;  2DZC A;  4CRI A;  4C8Q B;  5LJ3 j;  3OB9 A;  5GAM d;  1VQK T;  4ELZ C;  2X4W A;  2K3X A;  2ZZD A;  4XU1 A;  2LDM A;  4EMH A;  5LJ3 f;  5GMK e;  3FC3 A;  2RI5 A;  4M7D D;  4IUV A;  4R55 A;  1I4K 1;  5GAO m;  1KQ2 A;  1RI0 A;  2WSF E;  2E10 A;  2GF7 A;  4C5E A;  3WVD B;  2H3J A;  3JCM b;  1S72 T;  1VQ7 A;  1BIB A;  3HFN A;  3L42 A;  4M78 B;  4MDX A;  2ZPE B;  4FL6 A;  3WXM B;  2LNV A;  2JOY A;  3BY7 A;  3JRZ A;  4EPC A;  3PFS A;  1M1G A;  2ZPF B;  3HFO A;  3HP9 A;  1HK9 A;  2CZ1 B;  3OMG A;  4YTL A;  4F7U A;  3PTA A;  4M7D G;  3FJP A;  5DM7 R;  3CCV A;  3ER0 A;  2D0Q B;  2XIC A;  3QZ5 B;  1VQ7 T;  2XD0 A;  4BDY A;  3L2R A;  4PLI A;  1WJR A;  2E12 A;  3QUI A;  3JB9 G;  2K57 A;  4L59 A;  2CZ6 B;  1UGQ B;  5CKH A;  3QYH B;  1VQM T;  4XTU A;  2F5K A;  2CZ7 B;  1YCY A;  3UDC A;  3MEV A;  2MWO A;  2DZ9 A;  1QVF A;  3PT9 A;  5HY6 A;  5GAM h;  4M7A E;  4DOW A;  3CC7 A;  4C0F A;  1MHN A;  3E19 A;  3QSU A;  2RD1 A;  1YJW A;  3V8L A;  1JJ2 S;  3MP6 A;  3NTH A;  3V7R A;  2EAY A;  3L2Z A;  4M7A A;  3INZ A;  4M75 A;  4M7A F;  2BUD A;  4IUU A;  3JCM V;  1KD1 C;  4J8O A;  4EMK C;  4XU3 A;  1VQ9 A;  3JCM P;  5FU6 B;  1VIF A;  5FU7 B;  4C92 C;  1H3Z A;  2QA4 A;  2RB6 A;  4OP0 A;  3OYF A;  5GAN 2;  1U1T A;  3CC2 T;  3UPU A;  5GMK m;  4RG8 A;  2L8D A;  1OI1 A;  1NPP A;  2R58 A;  3N5B B;  1M4Z A;  4MZM A;  1G3Y A;  4XAX B;  1YJW T;  3KBG A;  2F69 A;  4M77 B;  4JRQ A;  5GMK h;  2V8J A;  2EQU A;  2FB7 A;  3V7C A;  5CCA A;  4B9W A;  4E7I A;  3M53 A;  4HCB A;  2VV5 A;  5D6Y A;  2D6F A;  2X4Y A;  2E6Z A;  2M1H A;  2ZCF B;  3OMC A;  1VQ9 T;  4RMO A;  3VUZ A;  1Q81 U;  3MP1 A;  1BI1 A;  3CCS A;  4BDZ A;  3BDL A;  5GAN d;  4OB3 B;  4JDS A;  1Q82 C;  4JUV A;  2EJG A;  4OGC A;  3OQ5 A;  1BI0 A;  5CIU A;  1VQ4 T;  4J7I A;  4Z02 A;  4C92 F;  3OS5 A;  3QKJ A;  4N0A C;  5GAM f;  2EQJ A;  4P5N A;  4C8Q C;  3CCQ A;  1UB4 A;  3CCS T;  1N8R U;  4JS5 A;  2RJE A;  4O5V A;  3OYB A;  3CCL A;  2VXE A;  4QVC A;  2XG8 D;  5D6X A;  2DXB A;  1B34 A;  2E70 A;  3PNW C;  2EYQ A;  2E65 A;  3AHU A;  3GNG A;  4QVD A;  3HRU A;  4LDU A;  1VQO A;  1Q7Y C;  2E5Q A;  1K73 C;  1KD1 U;  5GAN 6;  2Y90 A;  1FWZ A;  2EKO A;  2P0Q A;  3HPW A;  3GF5 A;  4V2S A;  4E7H A;  3KUF A;  1OYX A;  2QI2 A;  3P8D A;  3VYH B;  3X25 B;  4RCB A;  3LWH A;  3CCQ T;  4O6J A;  3C94 A;  3CBM A;  4GLK A;  3VYG A;  2EIF A;  5GMK j;  3G71 A;  3MCA B;  3OW2 A;  2LX9 A;  2RK2 A;  4C8Q E;  1I81 A;  1K9M C;  1I5L A;  2VYT A;  5A2Q E;  3M59 A;  3A8G B;  3PMI A;  1XNI A;  5CKB A;  5GAN h;  3OYC A;  3CME A;  2E1H A;  3OYI A;  3J80 E;  5FLX E;  3E9G A;  4J6W A;  3SWN C;  2RI2 A;  4EMK B;  2LTO A;  4BE2 A;  4C92 B;  4C8Q F;  1XOV A;  2DO3 A;  2M9U A;  1M5Q 1;  3E9F A;  4M78 E;  2XID A;  3HL8 A;  3QO3 A;  2AHJ B;  5GAN 5;  3G71 T;  2CZ0 B;  2YLB A;  4OVA A;  3CC4 A;  4XTW A;  4OGE A;  4II1 A;  1JJ2 A;  2GCX A;  4OF1 A;  3JCM e;  3ME9 A;  4M78 A;  2RHI A;  3CME T;  2DVE A;  4ZTF A;  1YHQ T;  2DTO A;  3WVE B;  4E47 A;  3PGG A;  4M78 F;  3CCR A;  3HHT B;  4FU6 A;  4F7U G;  3QBY A;  2V8I A;  3ZFJ A;  4C5G A;  2JN0 A;  2JTF A;  1UGP B;  3HKS A;  5HK3 A;  2V8K A;  1NPR A;  2K2V A;  4UC4 A;  1QP2 A;  4XTY A;  1RL2 A;  2ZGW A;  5HKC A;  5GAO p;  4QQD A;  2K5F A;  1W2B S;  3X20 B;  1G3W A;  1BIA A;  3C12 A;  4M7A D;  2RHZ A;  2D9T A;  3CCM T;  1VQ5 A;  4VUB A;  2DEQ A;  2KMT A;  4QQ6 A;  3L2V A;  3CEY A;  4FIB A;  1VQ6 A;  3S6W A;  4J83 A;  3CCR T;  4PJO A;  3JAM E;  2ZPI B;  4M77 C;  2EQM A;  3CBP A;  3JCM d;  2VUB A;  2PUK B;  3RMS A;  3OYD A;  1QVG S;  5J26 A;  3S3O A;  2BKD N;  5GAN 3;  3RKW A;  4KT0 E;  3MO8 A;  3PMT A;  1K9M U;  2PUO B;  3ZBD A;  5GAN j;  1VQ5 T;  3SD4 A;  4KUL A;  1KC8 C;  3M4G A;  1KQS A;  1AHJ B;  2M16 A;  2DTI A;  2LCC A;  1UEB A;  4M75 G;  5GAN f;  3OYM A;  3V7S A;  3S3M A;  3RMQ A;  1N9S A;  2LQK A;  2KDS A;  1ZQ1 A;  2QQS A;  3I55 A;  2M0O A;  4ME7 A;  3LH0 A;  2JTM A;  1OZ3 A;  2L5Q A;  4M77 E;  2XDB A;  5DLO A;  4RCC A;  4MZP A;  4DA4 A;  3OSS C;  1VQP A;  2R5A A;  1M1F A;  2EJ9 A;  4E7K A;  2KY9 A;  4BD3 A;  4JS4 A;  3TEE A;  1IRE B;  2DIQ A;  2RJC A;  4M77 F;  3KXT A;  3SWN B;  2P4T A;  3CXC S;  3M58 A;  2G3R A;  3MEW A;  2MWP A;  5CKE A;  3ASK A;  3PIP A;  1Y7X A;  2L3R A;  3JCM h;  2XDD A;  3V8K A;  3LLR A;  3M4Y A;  2LC4 A;  2QEX A;  5KE2 A;  3M54 A;  3CCJ A;  3CCV T;  5GAO q;  3JCM X;  4E7L A;  1W4S A;  1VQN A;  2QDY B;  4XQ3 A;  5IT9 E;  2KVQ G;  3G6E A;  2CGH A;  1O9S A;  4M75 C;  2X4J A;  2WAC A;  4NL3 A;  3VJP A;  1TH7 A;  3OY9 A;  3SDZ A;  4A4G A;  3GNF B;  3JB9 H;  1LOJ A;  5KE3 A;  1JRI A;  1R8O B;  2RA2 A;  3M57 A;  3OBW A;  3UWN A;  2KQW A;  1KC8 U;  3JSC A;  2LQ8 A;  5LJ3 g;  2VGN A;  3CCJ T;  3EFR A;  3LYI A;  3CC7 T;  2RJD A;  2DXC A;  2HNI A;  1UGR B;  4N4H A;  4M7D C;  2DXT A;  1ZBX A;  4BY6 C;  4EDU A;  3MEU A;  4JRK A;  2VXF A;  3MHX A;  3SB2 A;  4KBM B;  1YJ9 A;  1W2B A;  4C0G A;  3I56 A;  3QII A;  2A7Y A;  2HD0 A;  2QTX A;  3BDU A;  3MEA A;  3QXE B;  4HCC A;  1MGQ A;  2LVM A;  4M78 D;  4X9C A;  2QA4 T;  3CCU A;  4A4K A;  2HAX A;  3VV0 A;  4D6W A;  4PNO A;  4C92 E;  1BI2 A;  2OAU A;  2OTL A;  2EFI A;  4ZGE B;  2CS7 A;  1WJS A;  1EIF A;  2ZPB B;  3DLL A;  4EMK A;  1QVG A;  4A4H A;  4F7U B;  4C92 A;  4N4G A;  2YRV A;  3JCM f;  1M1K C;  1VQL A;  4MDW A;  1U1S A;  3CCU T;  3M55 A;  4PJO D;  4M78 G;  3P8B B;  1KG1 A;  4M7D F;  3G4S A;  4NOY A;  4ZN3 A;  4C0D C;  3CPW S;  1DJ7 B;  3C95 A;  4IUQ A;  3TRE A;  2EQK A;  5J39 A;  3A8O B;  3JB9 F;  4QVZ A;  5L8R E;  2RHX A;  2FYK A;  1WPY A;  1Y96 A;  2HQX A;  1Q86 C;  2X4X A;  3JCM J;  4PJO G;  3CCL T;  2LT4 A;  1X75 C;  5CR2 A;  3CXC A;  4M75 B;  4PLL A;  3JCM W;  3JB9 I;  1VQO T;  4IUT A;  5DLQ E;  4N0A A;  5IN1 A;  1H64 1;  4XU0 A;  3OYL A;  1NJI C;  4BI4 A;  4QQG A;  4C8Q A;  2XI9 A;  3J81 E;  1QVP A;  2PQW A;  5FRM A;  2MI6 A;  1Y07 A;  2WSE E;  3L2W A;  3T9N A;  1Q82 U;  4ZGJ B;  4M7D B;  4NL2 A;  1PSF A;  3OSV A;  2JUF A;  4R56 A;  3X26 B;  3DLM A;  4BY6 B;  4KUD K;  3FB9 A;  5EG2 A;  5DY9 A;  1YI2 A;  2WSC E;  3LGF A;  3S3N A;  2YLC A;  2RHU A;  2DAQ A;  1M1K U;  2EWN A;  5I2M A;  1ZHI A;  4PL6 A;  1QVF S;  3OYN A;  3NTI A;  4LD6 A;  1V29 B;  1M90 C;  1Y71 A;  5GAM g;  2QQR A;  2NLU A;  1X6O A;  1VQ8 A;  3CC4 T;  3RER A;  4LD9 K;  2P0K A;  3CPF A;  3CCE A;  5GMK i;  1LNX A;  2O01 E;  1Q7Y U;  1K8A C;  2PVO B;  1K73 U;  4HCZ A;  2FL7 A;  3OA6 A;  3HRT A;  3HRS A;  1YIJ A;  2X35 A;  5GAN 4;  1Q86 U;  1U8R A;  3FEO A;  3RIR A;  2RI3 A;  2BIV A;  5LL6 S;  1G3S A;  1B34 B;  4ZGD B;  5AYF A;  4A53 A;  5GAM e;  3OS0 A;  5HK0 A;  3OS1 A;  2K3Y A;  3VU3 C;  4FM4 B;  4C0D B;  4ATO A;  4HA8 A;  4JLG A;  2LRQ A;  2RK1 A;  1VQ6 T;  2KAF A;  4TVR A;  1NJI U;  4LDV A;  4MMK A;  4QW2 A;  1N27 A;  4XK8 E;  4XTX A;  1G5V A;  1YIJ T;  1NE8 A;  1D3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...