2R5AA

Crystal structure of the two mbt repeats from sex-comb on midleg (scm) in complex with methyl lysine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
b'AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPGHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycomb protein Scm
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5aA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5aA01
4PLIA 3OYIA 3S3MA 2RI2A 2RJCA 3CEYA 3QKJA 4E7IA 4N4IA 5KH6A 3OYCA 4IURA 3LLRA 3MO8A 3ZEHA 3KUFA 3OYAA 3OYDA 2RHZA 3OYEA 4PLLA 3QJ6A 2R58A 3MEAA 3LX7A 3DB3A 3C4SA 2LTOA 5J39A 3P8DA 2X35A 3OYMA 3OYHA 5FROA 1OI1A 3NTIA 4Q5WA 1N27A 3MEVA 2RI5A 2K3XA 2IG0A 3FDRA 5FRMA 4N4HA 2GFAA 4CRIA 3MP8A 5CIUA 2D9TA 3FLGA 3MP6A 4RG2A 2L3RA 3META 3S3NA 3OS1A 2DAQA 2L8DA 2LCCA 2EQMA 4IUPA 3FC3A 2CKKA 2BIVA 3OYFA 2R5AA 4A4HA 2P0KA 3OYKA 3OB9A 2XDPA 3NTHA 2RHUA 2G3RA 2JZ2A 4IKFA 2RJEA 5KE3A 3OQ5A 1KHCA 2EQUA 4BE0A 1H3ZA 1WJSA 3OMCA 5D6WA 3FEOA 4QQ6A 4BE2A 2EQKA 5IN1A 3L2UA 4C5EA 2RO0A 4BDYA 3NTKA 3F70A 4ZTFA 1RI0A 2E5QA 4X34A 4FU6A 4EDUA 5M9OA 4E7HA 2K3YA 4PL6A 2JTFA 2XK0A 2M0OA 4L59A 4E7JA 3OYJA 3OY9A 2LDMA 4B9WA 4FL6A 2M16A 4LD6A 2EQJA 3PMIA 2O4XA 4BDZA 2O4XB 4BD3A 3PFSA 3PNWC 4E7KA 2X4WA 3LH0A 2MWPA 2NLUA 4GY5A 3L2WA 4C5HA 5KCHA 3QIIA 5IAYA 2QQSA 2R57A 2HQXA 2WACA 4NS5A 2R5MA 1OYXA 2QQRA 4BE1A 5C0MA 2EFIA 4II1A 2LRQA 3GOXA 5KCOA 2GF7A 3S3OA 3Q1JA 1MHNA 2EKOA 1OZ3A 2X4YA 4ZTJA 3MEUA 3LGFA 3S6WA 1G5VA 2YRVA 4A4FA 3BDLA 4B9XA 5C6SA 2X4XA 3SD4A 2F5KA 3E9GA 3EAEA 2BUDA 2PQWA 4QQGA 4C5GA 2RHYA 3UWNA 2FHDA 3QBYA 2DIGA 3L2RA 3OS2A 1WJRA 3L42A 4IUUA 2L89A 3MP1A 2HQEA 2M1HA 3O8VA 4A4GA 4E7LA 2RJFA 1OZ2A 2RI3A 2BKDN 2B8AA 4QW2A 2DIQA 3ME9A 3OS0A 2E6NA 3OMGA 2RHIA 4N4GA 3OYNA 3H6ZA 4HCZA 3UT1A 4A4EA 3OYBA 3OYGA 4OVAA 5FRNA 3DB4A 3LYIA 5D6YA 4IUVA 3OA6A 3H8ZA 3L2QA 3L2VA 3ASKA 2RJDA 4IUTA 4QQDA 5J26A 4IUQA 4UC4A 5KE2A 4C5IA 2LVMA 2VYTA 1WJQA 1WGSA 3OYLA 4BACA 2MWOA 5D6XA 2RHXA 3LGLA 2GFUA 3M9QA 3MEWA 3PMTA 4Z02A 4QVZA 3DLMA 1SSFA 3P8HA 3E9FA 1XNIA
chains in the Genus database with same CATH superfamily
1VQPA 3QYGB 2KY9A 1Y07A 4XU3A 5CKDA 2COYA 4PLLA 1P92A 2YLCA 4MZTA 1WHMA 2HBPA 1XQHA 2LQNA 1EIFA 3QPHA 3NTIA 1G83A 3BY7A 2LC4A 2RI5A 2IG0A 4DEYA 5GAMg 1N5ZA 1VQ6A 2FRYA 2X3XD 4J6YA 3CMAA 3H41A 1WHJA 1Y7XA 4JLGA 3PIPA 4FCYA 4HCKA 1TU0B 1SKUB 1TH7A 5KE3A 5FWCA 4MDXA 1NJIC 1Q95G 3MCAB 4M7AE 2RN8A 5DM7R 4QQ6A 4HT8A 1QKXA 1QVGP 4RTUA 2EYQA 3H0HA 1VQ8A 2K3YA 3HPWA 3OYJA 1QVFP 1BYMA 5GAMj 3JCMb 3CC7Q 1AT1B 1PKSA 4M7DA 4C5HA 3X28B 4EMHA 1UGVA 1M4ZA 1VQKA 1YWPA 1NE8A 4L6V5 3JB9J 3CPFA 1PKTA 2X4YA 4GBQA 1OX9A 3HRSA 5LJ5h 2L2PA 3T9NA 4DOVA 2O01E 2RQRA 3CQTA 1GCPA 1WJRA 3L42A 4JDSA 2RJFA 4MDWA 1EZZB 3OMGA 3X26B 3OYNA 3UDCA 4KUDK 3OYGA 3OA6A 2CSIA 5HK3A 1NJIU 3FJ5A 1W70A 1Y96B 4QQDA 2VYTA 1ZSZA 2PVDB 5D6XA 4NL3A 3QYHB 1VIFA 5CQYA 1KC8C 1QW1A 2K2MA 3OYIA 4E6RA 1Y0MA 5KH6A 3JB9G 3CC2T 2QTXA 3EH1A 5GAOq 3QJ6A 2FPEA 1VQ7A 3CCLA 4PJOD 3INZA 4BB7A 2VKNA 5GAN6 2X35A 3LH5A 3OYMA 2CT4A 1N27A 2QAZA 4OMFB 1CSKA 2DD4A 2P4TA 4C92D 2DXCA 2DTIA 1B7TA 2O9VA 2EVRA 3M4YA 3JCMh 5CCAA 4XU0A 4HVVA 1M90U 1FX7A 3CCET 4M77E 1YHQQ 2PUKB 2EQUA 1NBEB 3V8JA 3VV0A 2DERA 1H3ZA 2O31A 1A0NB 1GRIA 1LJOA 2EQKA 2Y90A 3CCJA 4PJOB 2A37A 4C5EA 1I07A 3J80E 4RUGA 2Z0WA 3TSZA 2H3EB 2DYBA 2CUDA 1GCQC 2YHTA 3G71T 6AT1B 2ZPHB 1WLPB 5CAIA 4KGXB 1I81A 4C92B 3HTRA 3QHSA 1K73R 2PUOB 4A54A 2HEQA 4BDZA 5CR2A 2QGFB 1AEYA 1AHJB 2GBQA 4ANJA 2ZPFB 4ATOA 2RMOA 3CCRQ 1OYXA 3M0PA 2LRQA 1WHKA 4JRPA 3S6WA 1G5VA 3SB2A 1M3AA 1KQSA 3SD4A 1HJDA 2DZCA 4J9HA 5GANf 3HP9A 1S72A 2HZYA 2DX1A 4M7AA 1D1AA 2W0ZA 2AT1B 1YFNA 2LZ6B 3ZL7C 5GAN4 1ZUKA 9ATCB 2K9GA 2D6FA 5GAN2 5IXBA 2MK5A 4FIBA 1TS9A 4C8QA 4DEXA 4F7UE 3DKMA 4Z02A 3RUXA 3JCMJ 1VQMT 5CO7A 3CEYA 2EYWA 3ZEHA 1UJ0A 4OGEA 3M5AA 1BI3A 3G4ST 4P5NA 3JV3A 3MEVA 2X51A 3H9NA 3CC4A 5FU7B 2FZGB 1MNDA 1M3BA 2LJ1A 3QJYA 3REAB 1H92A 3UA6A 3OYKA 4KH0B 4AG2C 1OV3A 2RJEA 1VQNQ 2QYZA 1YJWQ 1AVZC 3EFOB 4BE2A 2ZPGB 2QDLA 4XTYA 4MMKA 1M1KU 1GFDA 1I1JA 4F04B 4M75F 3NMZC 2LQWA 2RQTA 5LL6S 1BKBA 5GANe 4M7DC 3SDZA 1NYGA 2C0IA 5KCHA 4RTZA 2KEAA 3ULRB 1YITQ 1QCOA 1X2KA 2QQRA 1JO8A 5C0MA 4J5YA 4EMKB 1UGRB 1BCMA 2QI2A 3SFMA 1Q7YC 2DRKA 2PNIA 4OMQA 2HL5C 1YI2T 1N8RC 3CMET 4M77A 5D7UA 3OSVA 3PT9A 1Q81C 4IUUA 3O8VA 4J9BA 4TVRA 3VUBA 1AWWA 5KYYB 2OTLT 1OULA 3QDRB 1SRLA 1UDLA 3DB4A 1WNLA 3HKSA 2FEIA 4JS4A 1EFNA 1VQ5T 2FYKA 1PD0A 2SEMA 5IHKA 3FIFA 1ABOA 4M78D 3JCMW 1AWXA 1TUGB 1U3OA 4M7DG 2NUTB 5A0GA 1WZOA 5EG2A 3FRNA 3ZFJA 2KR3A 2RH2A 3CC2A 3MEAA 2KI7A 1SEMA 2DVEA 3JCMP 1M9SA 2E70A 2K3XA 4PJLA 1K0SA 4JRQA 4BI3A 3MP8A 2AZVA 2JNGA 4WF2A 2EAYA 3GPLA 5EC7A 3VUZA 2VB6A 3META 3S3NA 4FT2A 1VQOQ 2EQIA 3M0TA 5CKEA 4M78B 3I55Q 1KQ2A 1VQLQ 2AK5A 3OQ5A 2DEQA 3CCEA 2F5TX 2QEXQ 5FU6C 4F7UA 2DKGA 5GJWB 1JJ2A 2HMAA 2CUBA 5IH2A 5I11A 2K5FA 2KT8A 2DXBA 2PZ1A 4EDUA 2EW3A 4PL6A 4L5GA 4LNPA 1PRMC 3RBBB 1TTHB 3G71A 3RDVA 2LT1A 4JRIA 1MV0B 4FL6A 2EQJA 1MNEA 5LJ3e 1QWFA 3L2ZA 2E1HA 4RCBA 3CC7T 2E64A 3EGUA 4NS5A 2LCSA 1X2QA 1T0HA 3MHXA 4II1A 2QK0A 2V8KA 2ZPBB 1BK2A 2X4XA 3CCUQ 3EFRA 3QBYA 2DIGA 4A4GA 5GMKm 4HCCA 4XAXB 3M56A 5IT9E 1G3SA 5AYFA 4OVAA 3J81E 4XTWA 3CCST 4GLKA 2DBKA 3GF5A 2MPXC 2KRNA 4PJOF 5KYWB 4JJDA 3PTAA 1HXDA 4JRKA 1VQMA 2VUBA 3MO8A 3RKWA 5KYUA 3OYEA 4C92F 1K73U 4QVCA 1VQ4Q 1X27A 2CP2A 4AFSC 1K0XA 2C06A 3G4SA 4QKUA 3V7SA 3JAME 2V1QA 2E3HA 2DL8A 1I4K1 1GXIE 4M7AG 1AOJA 4IUPA 1E7OA 2P0KA 2ZPEB 4HA8A 1XOVA 3O5ZA 4O5VA 1TUCA 4FYXB 3N5BB 5IHIA 3M53A 3UA7A 5LJ5g 5GANd 1VUBA 3RMQA 2O88A 4HKEA 2RQUA 1PHTA 1QVPA 2A0FB 2DJZA 4XTVA 2JUFA 3L2WA 4DA4A 4OMLA 5CQXA 1BU1A 2K5IA 2COWA 2D1XA 1WXBA 5L23A 1PRLC 1M2OA 1NPPA 2KVQG 1K9MC 5C6SA 3V7RA 4M77C 1O75A 1GL5A 3CCRT 2DXUA 1YI2A 1I5LA 2BZYA 2VXFA 2OTJQ 1JU5C 3CCQQ 3CCMQ 4IIMA 3REBB 1FMVA 3THKA 2BKDN 2BZ8A 1VIEA 2KBTA 3ME9A 2K4YA 3LWHA 2K7AA 5GMKj 1E6HA 2QTVA 1KQSP 3L2QA 1MMNA 1V1CA 1YNZA 4IUQA 4RTYA 1U1TA 5CKBA 3JCMg 2XICA 4OP0A 1VQ5A 4BI8B 4XK8E 4PLIA 2RJCA 1MGQA 1PNJA 4CC7A 1VOMA 4J7FA 5FWBA 5IHNA 1IZ6A 3M0RA 1QLYA 3CBOA 3ER0A 2KQWA 4M77G 1E6GA 2PVGB 1WHGA 2DEUA 2ZGWA 3NFCA 2L8DA 2ROTA 2H8HA 1SHFA 2BIVA 2CDTA 2V8JA 4HVUA 2PVOB 3SWNC 2RK2A 1ZHIA 3A8LB 3PGGA 2AIRB 4BE0A 2LMJA 3OS5A 2RO0A 5LJ3d 2CP7A 4BDYA 1D0XA 4E7HA 2DL4A 1OU8A 3M59A 5AT1B 4FSXA 8ATCB 1I5OB 4ZGJB 3PMIA 2O4XA 1RL2A 4GY5A 2ZPIB 3NHNA 3UF4A 3JCMQ 2P0PA 4FW2A 4DBRA 2JW4A 5GAN8 2KSSA 1VQPQ 3CC7A 2LX9A 2YUNA 3C94A 3VS6A 2MI6A 2EKOA 2GTOA 2J6OA 2YRVA 3QG1A 2AKKA 2BUDA 1YITT 1M5Q1 3JB9H 1QMCA 3PVLA 4JS5A 4O6JA 3A8MB 2QGGA 2EPDA 4C8QE 4J7IA 1OZ2A 1UHCA 2RI3A 2EYYA 3R6NA 4F7UG 3CMAQ 2RHIA 3VS5A 4N4GA 3CPWS 2D8HA 2XMFA 4M75A 4M78F 1ZBJA 4OB2B 2KGTA 1KFZA 5HY6A 3X25B 3ZBDA 2DL3A 3CCSA 1MMGA 1Q7YR 4E2FB 3CXCA 2MWOA 2OX7A 4PJOE 2DM1A 2GFUA 3G6ET 1N8RR 4CI0C 1R77A 5FROA 1Q81R 1YJNA 1QVGS 1HD3A 3OYAA 1RAEB 3KUFA 2EJFA 1VQ8Q 4C92E 2FO0A 4XU2A 2MOXA 1BBZA 1QVFS 4RTWA 5GMKe 4Q5WA 2KK4A 2ZCFB 4PJJA 2OI3A 3FLGA 3CD6A 1VQKQ 2K2VA 2VASA 3RR6A 3VRYA 4J8OA 4EPCA 5GAMf 2V1RA 3WVDB 4A4HA 3OW2A 2P4RA 3VYHB 2FPDA 5GAOl 1EX4A 4XTZA 1M2VB 1AD5A 2EKHA 1H3HA 1NM7A 1W2BS 2KNBB 3EHRA 1RAHB 4Y28E 2OAWA 4HCBA 2AKLA 2E65A 4QT7A 3C0CA 4X1VA 1AWOA 4FW1A 4BUGA 1G3TA 4KRTA 2PU9B 1JJ2P 5CK9A 3VS4A 2QQSA 1JQQA 2DLPA 1F1BB 1IHVA 4DOWA 4Z88A 3GOXA 5KCOA 1NLPC 1VQ7Q 3CCLQ 1T3SA 1X01A 1IO6A 3HL8A 1SRMA 2BE9B 1LCKA 4AFZC 4KGZB 2I2LA 3CCRA 1WHHA 4XTUA 2JM9A 3VS1A 2D8JA 3EG0A 1KC8U 7AT1B 1OEBA 3G7ZA 3EG1A 3UT1A 1N9RA 3VU3C 3LYIA 1AZGB 2DE0X 2RD1A 2K6DA 1Y96A 4XQ3A 4UC4A 2HAXA 2MF2A 2RHXA 1TUDA 3MEWA 3CCVA 3V8LA 3CCJQ 1ZQ1A 1OQKA 5GAMe 4E7IA 2MAMA 2YUQA 2MCNA 2R58A 2NYSA 1R0BG 1UECA 3KXTA 3OSSC 1X75C 1FWZA 5GAOp 2I0NA 1OPKA 4LDYA 2L5QA 2DFUA 1WXUA 1VQ4T 1YJ9T 4ELZC 3P8BB 1W4SA 2ESWA 1VQ9T 2MMPA 2JTEA 1AWJA 1SPKA 2XIDA 4OB0B 2DBMA 2FG0A 2EJGA 5FW9A 1S72Q 4PJOA 2XHCA 1PC0A 4R56A 1IXDA 3C12A 2Y4XA 4RKUE 3A8OB 4C92A 1NEGA 3UPUA 1KHIA 4B9WA 4LD6A 1WQ7A 4BD3A 3MJXA 4PJNA 4KBMB 2BTTA 4ZGDB 3M55A 4OGCA 4EMGA 4V2SA 4B6MA 4OMOA 4PKCC 2PTKA 4NL2A 4MZPA 3HHTB 2W10A 2J7IA 2CP3A 1YIJT 2FZKB 1QCNA 2PQWA 4QQGA 4C5GA 4J9FA 1KK7A 1R8OB 3CPWA 1ZUUA 4ESRA 1YP5A 3PIOA 3CC4Q 1ABQA 2HBWA 3QXEB 4M78E 2P0QA 1UGSB 1B3QA 4FYVB 1BB9A 2OTJT 1H641 1VYUA 1MMDA 2C0TA 4RTTA 3CCMT 2DF6A 3H8ZA 2E4HA 2A28A 1K9MR 1WGSA 2QQBA 1K8AC 3EG9A 3QZ5B 3PMTA 3G6EA 4N0AA 5GANh 3S3MA 2VGMA 1OPLA 1WIEA 4A4KA 5LJ3f 3SWNB 3U23A 1RAAB 1OI1A 2DMOA 2Y4YA 1M27C 1ZSZC 2X3WD 1BIAA 4LE9A 2L0AA 2E41A 5GAN5 1FXXA 3J7AF 1PSEA 5I2SA 2QXFA 1TOVA 2R5AA 3JB9D 2YWWA 1KHCA 1W2BA 1IREB 4JJCA 1WJSA 3FEOA 4J83A 1Y71A 3EFOA 5A0DA 3F70A 3RIRA 2DYIA 1K76A 1WA7A 2KXCA 1C6VX 2M0OA 3EGXB 3JCMc 1Q7YU 2HL3A 4JZ3A 4R55A 1N8RU 1NPRA 3VJPA 1Q81U 4Y91A 1RAIB 1D1CA 4OMMA 4EMKA 2XKOC 2K79A 3CC2Q 3GNGA 3E2UA 1ZBXA 2JTMA 1KD1C 3KBGA 4LUEA 1XTDA 3RMSA 4DQ2A 2M1HA 4K11A 5KYYA 4E7LA 1UEBA 5DLQE 3TSWA 4IUVA 2CYZB 5GAMd 2NUZA 5ECAA 4C5IA 1T0JA 3A98A 3CCEQ 3M57A 2HNIA 2FB7A 4AFUC 2NUTA 5KYXB 4OB1B 4AMCA 2SRCA 5LJ3h 4M7AC 4IURA 3LLRA 5GAN7 1KQ1A 3LX7A 2J05A 3PE0A 2DTHA 3NGPA 3R6OA 3CXCP 3QWYA 1K1ZA 3FDRA 2RK1A 4GLMA 1LVKA 1M1FA 4C8QC 3V7CA 3JSCA 2M51A 4M78A 1YJ9A 4RTVA 1MUZA 2H3JA 1VQKT 2JZ2A 1VQ9A 5D6WA 4DBQA 4PJOC 1C0MA 4IIOA 1X6GA 4ZTFA 5M9OA 3GNFB 2QDYB 3OW2P 4C92C 2YDLA 1VA7A 1BI1A 3EGDB 3OY9A 2K57A 4BY6C 5I2MA 4D8KA 2M16A 1UGQB 2GNCA 3CBPA 2GQVA 2CS7A 2JVVA 8AT1B 5HCKA 1B34B 2YT6A 1J3TA 1WYXA 2DNUA 2KE9A 4JLIA 1VQMQ 4ORZA 1Q82R 4AFQC 2A3LA 2GF7A 4C8QG 3S3OA 2F1LA 4M75E 1YHQT 4KH1B 2F5KA 2AHJB 1YIJA 3BE3A 2CH4A 2J6FA 1TSFA 2GTJA 3G4SQ 1VQ7T 2A08A 1D3BB 2DIQA 1WXTA 2EYZA 3X24B 2ED1A 3H6ZA 4PJOG 3M0UA 4X9DA 3OYYA 1Q86C 2OTJA 2M9UA 3CCMA 1R0CB 4IUTA 4C0FA 4C92G 3I56Q 2DVJA 5LJ5j 2JN0A 5KYWA 1YCSB 2VWFA 1G2BA 3BDUA 3CMEA 2KAFA 2YSQA 4JJBA 3I9QA 2OTLA 2EGCA 3CCJT 1VYVA 1MMAA 2X9HA 2ENMA 3PVQA 5FU7C 4LXCA 3V8KA 2LP5A 3VKIA 1KJWA 5GAOn 5HKCA 3EG2A 1IGUA 4LD9K 4M7DD 2JT4A 2KYBA 2DTOA 3JCMV 1QQJA 2LQ8A 2QASA 4RTXA 2EWNA 3OMCA 1YI2Q 5IN1A 1NZ9A 1CKBA 3M4GA 3RNJA 2E5QA 4X34A 3A5ZB 2EGEA 2BZXA 4C0DC 1YWOA 1K9MU 1TWBA 1WX6A 3NPFA 3CBMA 1KQSS 1V29B 1SF9A 4D8DA 3VYGA 2YRCA 4M7DB 2MWPA 4A53A 2BE7D 4C0GA 3TEEA 1ZSGA 2MYSA 1M8VA 2QA4Q 4BE1A 1MHNA 1VQNT 1C1AA 4ZGEB 4M4ZA 1YJWT 4LUDA 1UFFA 2KXDA 4RG8A 2E12A 1T3LA 1UGPB 3FJPA 4R0KA 4E7ZA 1W6XA 4AT1B 3VS2A 2E6NA 4HCZA 4A4EA 3GBQA 3BFMA 2HKQB 3CC4T 3IQLA 4LDXA 2XU8A 1D0ZA 3CPWP 4E7SA 1WI7A 1ZSZB 2YRDA 3H0FA 4QVZA 3RESA 3JCMX 2WSCE 3JCMf 2RQVA 2M02A 5J3BA 4FT4A 2HDAA 2NUPA 2RHZA 3RKXA 3EH2A 1VQ6Q 2JMCA 1M1GA 3C4SA 2F2VA 4XTXA 4CC2A 4OMNA 3JB9F 2DXTA 1K8AR 2COZA 5LJ5e 4M78C 1QP2A 3OS1A 2CP0A 3QO3A 5GMKi 2HKNA 2AZSA 5L8RE 1WDXA 3WXMB 3E1SA 2KRSA 1BI0A 4J9DA 2LT4A 2KDSA 5FU6B 3A8GB 1RI0A 2WSEE 1UG1A 1H8KA 1I8FA 1KIKA 2DRMA 2FL7A 4M7AD 1M90C 1D0YA 1UJYA 5IXFA 1W2BP 2OJ2A 3CCSQ 5I22A 1IHWA 2JXBA 3I5SA 2FVUA 1VQOT 3TCJA 2G6FX 5GMKh 1YJNQ 3I55T 1SG5A 4C8QD 4LDWA 3JB9I 5FRMA 2ATCB 4ZTJA 5GANg 1VQLT 1QCFA 5GMKl 2WSFE 1Q82C 1U8RA 4A4FA 3AT1B 3BDLA 3EG3A 4M78G 2QEXT 1YHQA 1JXOA 3JRZA 3QZ9B 2FHDA 1NLOC 1RADB 3JCMe 2A7YA 1OU9A 3MP1A 4M7AB 5GJVB 3CD6Q 4JJNK 3M0SA 2RM4A 3OYBA 1JBMA 2YUOA 4F17A 2RJDA 5J26A 2LVMA 4C8QB 1YN8A 1RABB 3LGLA 1KD1R 5GANj 1SSFA 4LDUA 1G3WA 2CP5A 2QG9B 3OYDA 3CCUT 2CZ0B 3C95A 2LTOA 2DO3A 3OYHA 4KGVB 2O2OA 3AHUA 1U06A 2FZCB 2HCKA 3VS7A 2JS2A 3A8HB 1JJ2S 3X20B 3RERA 1M30A 3M54A 4A63B 1Q82U 1U1SA 2CP6A 5A0LA 2DL7A 4J6WA 2LJ3A 4BY6B 2CKKA 1LPLA 3OB9A 1WPYA 4PJMA 1M2VA 2D0NA 2G3RA 4J9CA 4JPBW 1YCYA 3HRTA 2XDBA 2L3QA 3LWIA 5CVIA 4EIKA 4ZN3A 3L2UA 1M8MA 2ED0A 2DPPB 2XD0A 4FU6A 4M77D 1PWTA 1W1FA 3L1AA 4J9IA 2KYMA 1Y57A 2JOYA 2LDMA 1UUEA 5GAMh 3PNWC 2VXEA 1KSWA 3LH0A 2RA2A 1BI2A 2E6ZA 1RUWA 1MV3A 4OMPA 3CCVQ 2JMAA 1M1KC 2HQXA 1D1BA 2R5MA 4PFOA 2EFIA 1BCOA 1OZ3A 3LGFA 1RAFB 4LN2A 5LJ3g 1VQNA 3MKDA 1U5SA 3EG9B 2XDDA 1YJWA 3TVTA 4M77B 2CH4W 3DLLA 1X69A 2L89A 1GFCA 2HQEA 4CC4B 1WHLA 4QW2A 1G8XA 4HT9A 1HSQA 4FM4B 2JM8A 1O9SA 1WQWA 1UHFA 4J9EA 2CT3A 1XNIA 5LJ3j 3TREA 2YXYA 3WVEB 4NOYA 2KROA 1YITA 3QKJA 1ZA2B 3I56T 2MIOA 3QWXX 4E47A 4M75C 5LJ5d 3I35A 3P8DA 1ZLMA 1AZEA 1Q86R 4M7DF 2VVKA 3CCQT 2ZAEA 3G1JA 3HFOA 4C0ZA 2DL5A 4N4HA 2D9TA 1N6AA 2E10A 5GAN3 1LOJA 2RPNA 5HK0A 3RKYA 5GAOr 2XI9A 4C0DB 1QVGA 4YTLA 3FC3A 2DETA 1OX8A 3BW1A 1TG0A 2XDPA 2IVWA 1QVFA 5KYNA 4MZMA 4KUIA 4F7UB 1NYFA 2ZZDA 5CKFA 2CZ7B 1QP3A 1PM3A 2A36A 3QUIA 2JS0A 3LW5E 2XK0A 4E7JA 3MPUB 1QKWA 4J6XA 1FMWA 2C0OA 3PFSA 1UB4A 1N9SA 1RACB 3EFSA 2RB6A 4M75G 1PG5B 2R57A 2FRWA 1GBRA 3G6EQ 1VQOA 2WACA 4D6WA 3GIBA 3JCMd 3I55A 1IB8A 3Q1JA 4WTOB 1X6OA 2KRMA 2LNVA 3D7SB 3HFNA 4B9XA 1VQLA 3E9GA 2QEXA 4ME7A 2QA4T 1K4US 3L2RA 1K8AU 2VV5A 2O9SA 2B86A 1PD1A 4HXJA 1XJWB 1HYOA 5D6YA 4CC3A 1WFWA 2DZ9A 1JEGA 3ASKA 2K3BA 2ABLA 1ACMB 1ZA1B 2EJ9A 4BACA 2NWMA 1VQPT 2RNAA 3P8HA 3E9FA 1LNXA 2ECZA 2RI2A 4N4IA 1SHGA 4PK4A 3SWNA 1BIBA 5KYUB 2X4JA 4BI4A 3CCUA 4AG1C 2J06A 2E3IA 1ZX6A 2EIFA 1GBQA 1I0CA 2GQIA 1VQ6T 1V76A 1X6BA 4KULA 5CIUA 3CMAT 4RG2A 3GLXA 2EQMA 2EYXA 1SSHA 1S1NA 3I5RA 1K73C 3OBWA 1DJ7B 1UE9A 2LCLA 3NTHA 4WCIA 2L3SA 1OOTA 4IKFA 1NJIR 3UATA 3SHWA 3G71Q 2HSPA 4M7AF 2LX7A 2CSQA 5GAOm 1VQ8T 2LJ0A 2JTFA 3EGXA 2DA9A 5A2QE 1YBYA 4ZN1A 3SEMA 3OBYA 2CZ1B 1D09B 2XG8D 2VC8A 3QDFA 1VQ4A 5DY9A 3EHQA 4C8QF 1KD1U 2F69A 5FLXE 2V26A 4Y92A 5I21A 3QSUA 1G3YA 4RCCA 4RMOA 4FYWB 3H0IA 3GP8A 2IPOB 1TXQA 4VUBA 3TQ7P 3MEUA 2CGHA 2HSEB 3KFVA 2DK3A 1YJNT 2HD0A 1M90R 1ZUYA 2K5LA 2GGRA 3CXCS 2B8AA 2L3PA 5FRNA 4X9CA 1YJ9Q 1RLPC 3CD6T 2KMTA 1HK9A 1VQ9Q 2KT1A 2GCXA 3OYLA 2HQHA 1RAGB 1KC8R 1IGQA 4JZ4A 4PFZA 3DLMA 4FSSA 5KYXA 4FYYB 3OYCA 1KG1A 1UTIA 4OF1A 3CCLT 2M0YA 5CKHA 3I56A 1JB0E 3OW2S 3DB3A 2RQWA 5J39A 4M7DE 2LNHB 3URGA 4F14A 2FPFA 2RF0A 4Z8AA 3CCQA 2GFAA 4CRIA 2P84A 3MP6A 3FB9A 2L3RA 1JRIA 3HSBA 2DAQA 2LCCA 4N0AC 3OYFA 1NG2A 1K9AA 3A1PA 2LQKA 1Z9ZA 2J6KA 4Z89A 2RHUA 4DBFA 4PNOA 4OB3B 1YIJQ 4XU1A 2ROLA 4M77F 2CREA 4ELYC 2QQAA 4DBHA 3NTKA 1PSFA 3M0QA 3HRUA 1CKAA 1GCQA 3EGDA 4L59A 2YLBA 1X43A 4J9GA 2DJQA 2O4XB 4E7KA 4M75D 2DILA 2X4WA 2NLUA 1B34A 3QIIA 5IAYA 2QQ9A 4JUVA 1M3CA 1NEBA 3CMEQ 1RLQC 4QVDA 1FYNA 4PFPA 2D0QB 2F2XA 3CCVT 1Q86U 2OTLQ 3E19A 2EGAA 3EAEA 2DD5A 5LJ5f 1S72T 2RHYA 3UWNA 2E5KA 2QA4A 4F16A 3OS2A 1FMKA 1D3BA 3VRZA 2NUPB 1IRXA 2IIMA 2CZ6B 2YUPA 1VQ5Q 1RI9A 3OS0A 1PCXA 4MMLA 1M1KR 5DLOA 4M75B 2VGNA 3M58A 4LDVA 4ZNXA 3TU4K 2F2WA 3L2VA 4EMKC 4KT0E 1B07A 5KE2A 1ARKA 2EBPA 4HVWA 1QWEA 1VYTA 1WJQA 2JJ9A 2V8IA 3VS0A 1Z9QA 4F7UF 2OAUA 3M9QA 1JXMA 3VS3A
chains in the Genus database with same CATH topology
3PTAA 1VQPA 5GANh 3S3MA 2VGMA 1HXDA 3QYGB 4JRKA 2KY9A 4A4KA 5LJ3f 1VQMA 2VUBA 3MO8A 1Y07A 3RKWA 4XU3A 3SWNB 5CKDA 3OYDA 3OYEA 4PLLA 4C92F 1K73U 3CCUT 1P92A 2CZ0B 2YLCA 3C95A 4MZTA 2LTOA 2DO3A 4QVCA 3OYHA 2HBPA 1XQHA 1OI1A 1EIFA 3QPHA 3NTIA 3AHUA 2Y4YA 3BY7A 2C06A 2LC4A 2RI5A 3G4SA 2IG0A 5GAMg 3V7SA 3JAME 3A8HB 1JJ2S 3X20B 1VQ6A 1I4K1 1BIAA 4J6YA 3RERA 2E41A 1GXIE 5GAN5 3CMAA 3M54A 1FXXA 1Q82U 3J7AF 1PSEA 1U1SA 5A0LA 4IUPA 4J6WA 2QXFA 5I2SA 4M7AG 1Y7XA 2CKKA 4BY6B 4JLGA 2R5AA 2P0KA 2ZPEB 3JB9D 3PIPA 3OB9A 4HA8A 1XOVA 4O5VA 1WPYA 2G3RA 1TH7A 5KE3A 1YCYA 1KHCA 1W2BA 4MDXA 1NJIC 3HRTA 3N5BB 1IREB 2XDBA 3MCAB 3LWIA 1WJSA 5CVIA 4M7AE 3FEOA 4J83A 5GAOr 4ZN3A 1Y71A 3M53A 4QQ6A 5DM7R 5LJ5g 5GANd 3L2UA 4HT8A 1VUBA 5A0DA 3RMQA 3F70A 2DPPB 2EYQA 3RIRA 2XD0A 4FU6A 4HKEA 4M77D 1VQ8A 2K3YA 3HPWA 3L1AA 2M0OA 1QVPA 3OYJA 1BYMA 5GAMj 2JOYA 3JCMb 2LDMA 3JCMc 5GAMh 2DJZA 4XTVA 1Q7YU 2JUFA 4M7DA 4R55A 3PNWC 2VXEA 3LH0A 3L2WA 2RA2A 1N8RU 1BI2A 1NPRA 2E6ZA 3X28B 4C5HA 4DA4A 5CQXA 4EMHA 3VJPA 1Q81U 1M4ZA 4Y91A 1VQKA 1M1KC 2K5IA 2HQXA 1NE8A 4L6V5 3JB9J 2R5MA 3CPFA 2EFIA 4EMKA 2XKOC 1NPPA 2X4YA 1OZ3A 2KVQG 3GNGA 3LGFA 1K9MC 5LJ3g 5C6SA 1VQNA 3HRSA 3V7RA 2XDDA 5LJ5h 1ZBXA 4M77C 1YJWA 3T9NA 1O75A 4DOVA 2JTMA 3CCRT 1KD1C 2O01E 2DXUA 1YI2A 4M77B 3KBGA 1I5LA 2VXFA 1XTDA 1WJRA 3L42A 4JDSA 3RMSA 2L89A 4DQ2A 2HQEA 2M1HA 3DLLA 4E7LA 2RJFA 1UEBA 2BKDN 1VIEA 4MDWA 4QW2A 3ME9A 2K4YA 5DLQE 4HT9A 3OMGA 3X26B 3OYNA 3LWHA 4FM4B 3UDCA 4KUDK 5GMKj 3OYGA 4IUVA 3OA6A 1O9SA 5HK3A 3L2QA 1NJIU 2CYZB 5GAMd 1VQLA 1Y96B 4QQDA 4IUQA 1U1TA 1WQWA 5CKBA 3JCMg 2XICA 2VYTA 4OP0A 4C5IA 1VQ5A 4BI8B 2PVDB 4XK8E 5D6XA 3M57A 4NL3A 2HNIA 2FB7A 1VIFA 3QYHB 5CQYA 1KC8C 1XNIA 1QW1A 4PLIA 3TREA 5LJ3j 3OYIA 3WVEB 4NOYA 2RJCA 4OB1B 1YITA 1MGQA 3QKJA 5LJ3h 4M7AC 5KH6A 3JB9G 4IURA 3LLRA 5GAN7 2QTXA 3I56T 3CC2T 1KQ1A 5GAOq 3QJ6A 4E47A 1VQ7A 3CCLA 3LX7A 4PJOD 3INZA 4M75C 4BB7A 5LJ5d 3P8DA 5GAN6 2X35A 3OYMA 2DTHA 4J7FA 3R6OA 4M7DF 1IZ6A 3CCQT 1N27A 4C0ZA 3HFOA 4OMFB 2DD4A 2P4TA 3FDRA 4N4HA 2RK1A 4C92D 1M1FA 3CBOA 3ER0A 2D9TA 1N6AA 2DXCA 2E10A 1LOJA 2KQWA 4M77G 3RKYA 2PVGB 2DTIA 2XI9A 3V7CA 4C0DB 5HK0A 1QVGA 4YTLA 2ZGWA 3NFCA 3JSCA 2L8DA 4M78A 3FC3A 3M4YA 2V8JA 2BIVA 3JCMh 1YJ9A 3BW1A 5CCAA 4XU0A 2H3JA 2XDPA 3SWNC 2IVWA 2PVOB 2RK2A 1QVFA 1VQKT 1M90U 1FX7A 2JZ2A 1ZHIA 3CCET 4M77E 3A8LB 1VQ9A 3PGGA 2PUKB 2EQUA 3VV0A 3V8JA 4BE0A 4MZMA 1H3ZA 5D6WA 3OS5A 4KUIA 4PJOC 4F7UB 1LJOA 2EQKA 2Y90A 3CCJA 4PJOB 4C5EA 2RO0A 5LJ3d 4BDYA 3J80E 2ZZDA 5CKFA 4ZTFA 2CZ7B 1QP3A 5M9OA 4E7HA 3GNFB 2QDYB 2YHTA 3QUIA 3G71T 3LW5E 2XK0A 4C92C 2ZPHB 1BI1A 3M59A 4E7JA 5CAIA 3OY9A 4FSXA 4C92B 1I81A 2K57A 4BY6C 3QHSA 4J6XA 5I2MA 4ZGJB 2M16A 2PUOB 4A54A 3PMIA 2O4XA 4BDZA 1UGQB 5CR2A 1UB4A 1RL2A 3CBPA 3PFSA 2GQVA 1AHJB 2ZPIB 4GY5A 1N9SA 2CS7A 3EFSA 3JCMQ 2P0PA 2RB6A 4M75G 2JVVA 1B34B 5GAN8 2R57A 2KSSA 2ZPFB 4ATOA 1VQOA 3CC7A 2WACA 4JLIA 2LX9A 4D6WA 3JCMd 1OYXA 3GIBA 3C94A 3I55A 2LRQA 2A3LA 2GF7A 2MI6A 2EKOA 3Q1JA 4C8QG 3S3OA 4JRPA 1X6OA 4M75E 3S6WA 1G5VA 2YRVA 2LNVA 3HFNA 4B9XA 3SB2A 1YHQT 1KQSA 3SD4A 2F5KA 2AHJB 3QG1A 3E9GA 1YIJA 2BUDA 1YITT 2QEXA 2DZCA 4ME7A 2QA4T 5GANf 1M5Q1 3HP9A 3L2RA 1S72A 4JS5A 1K8AU 3JB9H 4M7AA 2VV5A 4O6JA 3A8MB 1VQ7T 4C8QE 4J7IA 1D3BB 1OZ2A 2RI3A 2DIQA 4F7UG 2RHIA 3CPWS 4N4GA 3X24B 3H6ZA 4M75A 4M78F 4PJOG 5GAN4 4OB2B 4X9DA 5D6YA 5HY6A 3X25B 3ZBDA 3OYYA 1Q86C 2OTJA 2DZ9A 2D6FA 2M9UA 5GAN2 3ASKA 3CCMA 3CCSA 4IUTA 4C0FA 4FIBA 2EJ9A 4C92G 4C8QA 4F7UE 4BACA 3CXCA 2MWOA 3DKMA 5LJ5j 4PJOE 2GFUA 4Z02A 3G6ET 4CI0C 2JN0A 3RUXA 1VQPT 5FROA 3JCMJ 3P8HA 3E9FA 1LNXA 1VQMT 2RI2A 5CO7A 3BDUA 3CEYA 1YJNA 3CMEA 4N4IA 2KAFA 1QVGS 3ZEHA 3OYAA 3SWNA 3KUFA 4OGEA 1BIBA 2EJFA 4C92E 2X4JA 2OTLA 3M5AA 4XU2A 1BI3A 4BI4A 3CCJT 3CCUA 1QVFS 5GMKe 2EIFA 4Q5WA 3G4ST 4P5NA 3MEVA 5FU7C 2KK4A 3V8KA 5FRMA 1VQ6T 2ZCFB 3CC4A 5FU7B 3VKIA 5CIUA 4KULA 3FLGA 3CMAT 5GAOn 3CD6A 2K2VA 4RG2A 5HKCA 3GLXA 3G6EA 4LD9K 3QJYA 2EQMA 4EPCA 4M7DD 4J8OA 5GAMf 1K73C 3WVDB 4A4HA 2DTOA 1DJ7B 3OBWA 3JCMV 3VYHB 3OYKA 2LCLA 3NTHA 3OW2A 5GAOl 4XTZA 4IKFA 2RJEA 2LQ8A 2EWNA 3OMCA 4M7AF 4BE2A 5IN1A 1NZ9A 2ZPGB 3M4GA 4XTYA 1W2BS 5GAOm 4MMKA 1M1KU 1VQ8T 2E5QA 4X34A 3A5ZB 4M75F 4C0DC 2JTFA 4Y28E 5A2QE 4HCBA 1YBYA 4ZN1A 2E65A 3OBYA 2CZ1B 2XG8D 5LL6S 2VC8A 1K9MU 1BKBA 3CBMA 4BUGA 5GANe 1VQ4A 5DY9A 3SDZA 1V29B 1G3TA 1KQSS 4M7DC 3VYGA 4C8QF 4M7DB 2MWPA 1KD1U 2PU9B 4A53A 5KCHA 2F69A 5CK9A 5FLXE 4C0GA 2QQSA 3TEEA 5I21A 3QSUA 1G3YA 4RCCA 4RMOA 1M8VA 4DOWA 2QQRA 3GP8A 4BE1A 5C0MA 4J5YA 3GOXA 5KCOA 4EMKB 1UGRB 1MHNA 1VQNT 4VUBA 3MEUA 2QI2A 4ZGEB 1X01A 3HL8A 3SFMA 2CGHA 1YJWT 1Q7YC 2DK3A 1YI2T 1YJNT 2HD0A 1N8RC 4RG8A 3CMET 4M77A 2E12A 4C8QC 1UGPB 2I2LA 2K5LA 3FJPA 3OSVA 3CCRA 3CXCS 3PT9A 4XTUA 1Q81C 4IUUA 3O8VA 4TVRA 3VUBA 2OTLT 1KC8U 2B8AA 3G7ZA 2E6NA 3QDRB 4HCZA 3UT1A 4A4EA 1N9RA 3VU3C 5FRNA 3DB4A 3LYIA 4X9CA 3BFMA 2RD1A 3CC4T 1WNLA 1Y96A 2XU8A 3HKSA 4XQ3A 4JS4A 1VQ5T 2KMTA 4LDXA 3CD6T 4UC4A 2FYKA 1HK9A 3FIFA 2GCXA 4M78D 3OYLA 2HAXA 2MF2A 2RHXA 3JCMW 3MEWA 4QVZA 3CCVA 3DLMA 3V8LA 4M7DG 3RESA 3JCMX 1ZQ1A 2WSCE 3JCMf 5A0GA 5GAMe 4E7IA 3OYCA 1KG1A 2MAMA 5EG2A 4OF1A 3FRNA 3ZFJA 5J3BA 2RHZA 2RH2A 4FT4A 3RKXA 3CCLT 3CC2A 2R58A 3MEAA 1JB0E 5CKHA 3I56A 3OW2S 3HSBA 1M1GA 3DB3A 3C4SA 5J39A 2DVEA 3JCMP 4M7DE 3URGA 1M9SA 2E70A 3KXTA 3OSSC 4XTXA 1X75C 1FWZA 2K3XA 5GAOp 3CCQA 3JB9F 2GFAA 4CRIA 4JRQA 4BI3A 3MP8A 2DXTA 2L5QA 2JNGA 4LDYA 4WF2A 2EAYA 3GPLA 3MP6A 3FB9A 3VUZA 2L3RA 3META 1JRIA 5LJ5e 4FT2A 1QP2A 4M78C 2DAQA 2LCCA 3OS1A 3S3NA 1VQ4T 1YJ9T 4N0AC 5CKEA 4M78B 3QO3A 3OYFA 5GMKi 2LQKA 1KQ2A 5L8RE 4ELZC 3P8BB 1W4SA 1VQ9T 2RHUA 2MMPA 4PNOA 3WXMB 4OB3B 3OQ5A 4XU1A 3E1SA 2DEQA 3CCEA 4M77F 2F5TX 2XIDA 1BI0A 4OB0B 5FU6C 2LT4A 4ELYC 4F7UA 5GAN3 2KDSA 2EJGA 2DKGA 4PJOA 2QQAA 2XHCA 5FU6B 3A8GB 4R56A 1JJ2A 3NTKA 2K5FA 1RI0A 2WSEE 2DXBA 1I8FA 4EDUA 1PSFA 3C12A 3HRUA 4PL6A 2Y4XA 4L5GA 4RKUE 2FL7A 3A8OB 4L59A 3G71A 4M7AD 4C92A 3UPUA 2YLBA 2LT1A 4JRIA 1KHIA 1M90C 4B9WA 4FL6A 4LD6A 2EQJA 1WQ7A 5LJ3e 2O4XB 4BD3A 4E7KA 4M75D 2X4WA 2NLUA 4KBMB 3L2ZA 2E1HA 4RCBA 1B34A 2FVUA 3QIIA 4ZGDB 3M55A 5IAYA 1VQOT 3TCJA 3CC7T 2E64A 5GMKh 2QQ9A 4JUVA 4NS5A 4OGCA 4EMGA 3I55T 4V2SA 4C8QD 4PKCC 3MHXA 4II1A 4LDWA 3JB9I 4NL2A 4MZPA 2V8KA 4QVDA 2ZPBB 3HHTB 5GANg 4ZTJA 5GMKl 2WSFE 1Q82C 1U8RA 1YIJT 1VQLT 2D0QB 4A4FA 3BDLA 3CCVT 1Q86U 4M78G 2X4XA 3E19A 2QEXT 1YHQA 3EAEA 2DD5A 5LJ5f 2PQWA 4QQGA 4C5GA 1S72T 2RHYA 3UWNA 3JRZA 3QZ9B 2FHDA 1R8OB 3EFRA 3CPWA 3QBYA 2DIGA 2QA4A 3JCMe 3OS2A 2A7YA 3MP1A 4M7AB 4A4GA 1D3BA 5GMKm 3PIOA 4HCCA 4XAXB 3M56A 2CZ6B 5IT9E 3QXEB 4M78E 2P0QA 3OS0A 1UGSB 4MMLA 4JJNK 1G3SA 5AYFA 2RM4A 5DLOA 4M75B 4OVAA 3OYBA 3J81E 1JBMA 2VGNA 3M58A 2OTJT 1H641 4LDVA 4XTWA 3TU4K 3CCMT 3CCST 3H8ZA 4GLKA 3L2VA 2RJDA 4EMKC 4KT0E 5KE2A 5J26A 3GF5A 2LVMA 1WJQA 1WGSA 2V8IA 2QQBA 4C8QB 1K8AC 3QZ5B 4F7UF 3LGLA 3PMTA 2OAUA 3M9QA 4PJOF 5GANj 1SSFA 4LDUA 1G3WA 4N0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PLI A;  3OYI A;  3S3M A;  2RI2 A;  2RJC A;  3CEY A;  3QKJ A;  4E7I A;  4N4I A;  5KH6 A;  3OYC A;  4IUR A;  3LLR A;  3MO8 A;  3ZEH A;  3KUF A;  3OYA A;  3OYD A;  2RHZ A;  3OYE A;  4PLL A;  3QJ6 A;  2R58 A;  3MEA A;  3LX7 A;  3DB3 A;  3C4S A;  2LTO A;  5J39 A;  3P8D A;  2X35 A;  3OYM A;  3OYH A;  5FRO A;  1OI1 A;  3NTI A;  4Q5W A;  1N27 A;  3MEV A;  2RI5 A;  2K3X A;  2IG0 A;  3FDR A;  5FRM A;  4N4H A;  2GFA A;  4CRI A;  3MP8 A;  5CIU A;  2D9T A;  3FLG A;  3MP6 A;  4RG2 A;  2L3R A;  3MET A;  3S3N A;  3OS1 A;  2DAQ A;  2L8D A;  2LCC A;  2EQM A;  4IUP A;  3FC3 A;  2CKK A;  2BIV A;  3OYF A;  2R5A A;  4A4H A;  2P0K A;  3OYK A;  3OB9 A;  2XDP A;  3NTH A;  2RHU A;  2G3R A;  2JZ2 A;  4IKF A;  2RJE A;  5KE3 A;  3OQ5 A;  1KHC A;  2EQU A;  4BE0 A;  1H3Z A;  1WJS A;  3OMC A;  5D6W A;  3FEO A;  4QQ6 A;  4BE2 A;  2EQK A;  5IN1 A;  3L2U A;  4C5E A;  2RO0 A;  4BDY A;  3NTK A;  3F70 A;  4ZTF A;  1RI0 A;  2E5Q A;  4X34 A;  4FU6 A;  4EDU A;  5M9O A;  4E7H A;  2K3Y A;  4PL6 A;  2JTF A;  2XK0 A;  2M0O A;  4L59 A;  4E7J A;  3OYJ A;  3OY9 A;  2LDM A;  4B9W A;  4FL6 A;  2M16 A;  4LD6 A;  2EQJ A;  3PMI A;  2O4X A;  4BDZ A;  2O4X B;  4BD3 A;  3PFS A;  3PNW C;  4E7K A;  2X4W A;  3LH0 A;  2MWP A;  2NLU A;  4GY5 A;  3L2W A;  4C5H A;  5KCH A;  3QII A;  5IAY A;  2QQS A;  2R57 A;  2HQX A;  2WAC A;  4NS5 A;  2R5M A;  1OYX A;  2QQR A;  4BE1 A;  5C0M A;  2EFI A;  4II1 A;  2LRQ A;  3GOX A;  5KCO A;  2GF7 A;  3S3O A;  3Q1J A;  1MHN A;  2EKO A;  1OZ3 A;  2X4Y A;  4ZTJ A;  3MEU A;  3LGF A;  3S6W A;  1G5V A;  2YRV A;  4A4F A;  3BDL A;  4B9X A;  5C6S A;  2X4X A;  3SD4 A;  2F5K A;  3E9G A;  3EAE A;  2BUD A;  2PQW A;  4QQG A;  4C5G A;  2RHY A;  3UWN A;  2FHD A;  3QBY A;  2DIG A;  3L2R A;  3OS2 A;  1WJR A;  3L42 A;  4IUU A;  2L89 A;  3MP1 A;  2HQE A;  2M1H A;  3O8V A;  4A4G A;  4E7L A;  2RJF A;  1OZ2 A;  2RI3 A;  2BKD N;  2B8A A;  4QW2 A;  2DIQ A;  3ME9 A;  3OS0 A;  2E6N A;  3OMG A;  2RHI A;  4N4G A;  3OYN A;  3H6Z A;  4HCZ A;  3UT1 A;  4A4E A;  3OYB A;  3OYG A;  4OVA A;  5FRN A;  3DB4 A;  3LYI A;  5D6Y A;  4IUV A;  3OA6 A;  3H8Z A;  3L2Q A;  3L2V A;  3ASK A;  2RJD A;  4IUT A;  4QQD A;  5J26 A;  4IUQ A;  4UC4 A;  5KE2 A;  4C5I A;  2LVM A;  2VYT A;  1WJQ A;  1WGS A;  3OYL A;  4BAC A;  2MWO A;  5D6X A;  2RHX A;  3LGL A;  2GFU A;  3M9Q A;  3MEW A;  3PMT A;  4Z02 A;  4QVZ A;  3DLM A;  1SSF A;  3P8H A;  3E9F A;  1XNI A; 
#chains in the Genus database with same CATH topology
 1VQP A;  3QYG B;  2KY9 A;  1Y07 A;  4XU3 A;  5CKD A;  2COY A;  4PLL A;  1P92 A;  2YLC A;  4MZT A;  1WHM A;  2HBP A;  1XQH A;  2LQN A;  1EIF A;  3QPH A;  3NTI A;  1G83 A;  3BY7 A;  2LC4 A;  2RI5 A;  2IG0 A;  4DEY A;  5GAM g;  1N5Z A;  1VQ6 A;  2FRY A;  2X3X D;  4J6Y A;  3CMA A;  3H41 A;  1WHJ A;  1Y7X A;  4JLG A;  3PIP A;  4FCY A;  4HCK A;  1TU0 B;  1SKU B;  1TH7 A;  5KE3 A;  5FWC A;  4MDX A;  1NJI C;  1Q95 G;  3MCA B;  4M7A E;  2RN8 A;  5DM7 R;  4QQ6 A;  4HT8 A;  1QKX A;  1QVG P;  4RTU A;  2EYQ A;  3H0H A;  1VQ8 A;  2K3Y A;  3HPW A;  3OYJ A;  1QVF P;  1BYM A;  5GAM j;  3JCM b;  3CC7 Q;  1AT1 B;  1PKS A;  4M7D A;  4C5H A;  3X28 B;  4EMH A;  1UGV A;  1M4Z A;  1VQK A;  1YWP A;  1NE8 A;  4L6V 5;  3JB9 J;  3CPF A;  1PKT A;  2X4Y A;  4GBQ A;  1OX9 A;  3HRS A;  5LJ5 h;  2L2P A;  3T9N A;  4DOV A;  2O01 E;  2RQR A;  3CQT A;  1GCP A;  1WJR A;  3L42 A;  4JDS A;  2RJF A;  4MDW A;  1EZZ B;  3OMG A;  3X26 B;  3OYN A;  3UDC A;  4KUD K;  3OYG A;  3OA6 A;  2CSI A;  5HK3 A;  1NJI U;  3FJ5 A;  1W70 A;  1Y96 B;  4QQD A;  2VYT A;  1ZSZ A;  2PVD B;  5D6X A;  4NL3 A;  3QYH B;  1VIF A;  5CQY A;  1KC8 C;  1QW1 A;  2K2M A;  3OYI A;  4E6R A;  1Y0M A;  5KH6 A;  3JB9 G;  3CC2 T;  2QTX A;  3EH1 A;  5GAO q;  3QJ6 A;  2FPE A;  1VQ7 A;  3CCL A;  4PJO D;  3INZ A;  4BB7 A;  2VKN A;  5GAN 6;  2X35 A;  3LH5 A;  3OYM A;  2CT4 A;  1N27 A;  2QAZ A;  4OMF B;  1CSK A;  2DD4 A;  2P4T A;  4C92 D;  2DXC A;  2DTI A;  1B7T A;  2O9V A;  2EVR A;  3M4Y A;  3JCM h;  5CCA A;  4XU0 A;  4HVV A;  1M90 U;  1FX7 A;  3CCE T;  4M77 E;  1YHQ Q;  2PUK B;  2EQU A;  1NBE B;  3V8J A;  3VV0 A;  2DER A;  1H3Z A;  2O31 A;  1A0N B;  1GRI A;  1LJO A;  2EQK A;  2Y90 A;  3CCJ A;  4PJO B;  2A37 A;  4C5E A;  1I07 A;  3J80 E;  4RUG A;  2Z0W A;  3TSZ A;  2H3E B;  2DYB A;  2CUD A;  1GCQ C;  2YHT A;  3G71 T;  6AT1 B;  2ZPH B;  1WLP B;  5CAI A;  4KGX B;  1I81 A;  4C92 B;  3HTR A;  3QHS A;  1K73 R;  2PUO B;  4A54 A;  2HEQ A;  4BDZ A;  5CR2 A;  2QGF B;  1AEY A;  1AHJ B;  2GBQ A;  4ANJ A;  2ZPF B;  4ATO A;  2RMO A;  3CCR Q;  1OYX A;  3M0P A;  2LRQ A;  1WHK A;  4JRP A;  3S6W A;  1G5V A;  3SB2 A;  1M3A A;  1KQS A;  3SD4 A;  1HJD A;  2DZC A;  4J9H A;  5GAN f;  3HP9 A;  1S72 A;  2HZY A;  2DX1 A;  4M7A A;  1D1A A;  2W0Z A;  2AT1 B;  1YFN A;  2LZ6 B;  3ZL7 C;  5GAN 4;  1ZUK A;  9ATC B;  2K9G A;  2D6F A;  5GAN 2;  5IXB A;  2MK5 A;  4FIB A;  1TS9 A;  4C8Q A;  4DEX A;  4F7U E;  3DKM A;  4Z02 A;  3RUX A;  3JCM J;  1VQM T;  5CO7 A;  3CEY A;  2EYW A;  3ZEH A;  1UJ0 A;  4OGE A;  3M5A A;  1BI3 A;  3G4S T;  4P5N A;  3JV3 A;  3MEV A;  2X51 A;  3H9N A;  3CC4 A;  5FU7 B;  2FZG B;  1MND A;  1M3B A;  2LJ1 A;  3QJY A;  3REA B;  1H92 A;  3UA6 A;  3OYK A;  4KH0 B;  4AG2 C;  1OV3 A;  2RJE A;  1VQN Q;  2QYZ A;  1YJW Q;  1AVZ C;  3EFO B;  4BE2 A;  2ZPG B;  2QDL A;  4XTY A;  4MMK A;  1M1K U;  1GFD A;  1I1J A;  4F04 B;  4M75 F;  3NMZ C;  2LQW A;  2RQT A;  5LL6 S;  1BKB A;  5GAN e;  4M7D C;  3SDZ A;  1NYG A;  2C0I A;  5KCH A;  4RTZ A;  2KEA A;  3ULR B;  1YIT Q;  1QCO A;  1X2K A;  2QQR A;  1JO8 A;  5C0M A;  4J5Y A;  4EMK B;  1UGR B;  1BCM A;  2QI2 A;  3SFM A;  1Q7Y C;  2DRK A;  2PNI A;  4OMQ A;  2HL5 C;  1YI2 T;  1N8R C;  3CME T;  4M77 A;  5D7U A;  3OSV A;  3PT9 A;  1Q81 C;  4IUU A;  3O8V A;  4J9B A;  4TVR A;  3VUB A;  1AWW A;  5KYY B;  2OTL T;  1OUL A;  3QDR B;  1SRL A;  1UDL A;  3DB4 A;  1WNL A;  3HKS A;  2FEI A;  4JS4 A;  1EFN A;  1VQ5 T;  2FYK A;  1PD0 A;  2SEM A;  5IHK A;  3FIF A;  1ABO A;  4M78 D;  3JCM W;  1AWX A;  1TUG B;  1U3O A;  4M7D G;  2NUT B;  5A0G A;  1WZO A;  5EG2 A;  3FRN A;  3ZFJ A;  2KR3 A;  2RH2 A;  3CC2 A;  3MEA A;  2KI7 A;  1SEM A;  2DVE A;  3JCM P;  1M9S A;  2E70 A;  2K3X A;  4PJL A;  1K0S A;  4JRQ A;  4BI3 A;  3MP8 A;  2AZV A;  2JNG A;  4WF2 A;  2EAY A;  3GPL A;  5EC7 A;  3VUZ A;  2VB6 A;  3MET A;  3S3N A;  4FT2 A;  1VQO Q;  2EQI A;  3M0T A;  5CKE A;  4M78 B;  3I55 Q;  1KQ2 A;  1VQL Q;  2AK5 A;  3OQ5 A;  2DEQ A;  3CCE A;  2F5T X;  2QEX Q;  5FU6 C;  4F7U A;  2DKG A;  5GJW B;  1JJ2 A;  2HMA A;  2CUB A;  5IH2 A;  5I11 A;  2K5F A;  2KT8 A;  2DXB A;  2PZ1 A;  4EDU A;  2EW3 A;  4PL6 A;  4L5G A;  4LNP A;  1PRM C;  3RBB B;  1TTH B;  3G71 A;  3RDV A;  2LT1 A;  4JRI A;  1MV0 B;  4FL6 A;  2EQJ A;  1MNE A;  5LJ3 e;  1QWF A;  3L2Z A;  2E1H A;  4RCB A;  3CC7 T;  2E64 A;  3EGU A;  4NS5 A;  2LCS A;  1X2Q A;  1T0H A;  3MHX A;  4II1 A;  2QK0 A;  2V8K A;  2ZPB B;  1BK2 A;  2X4X A;  3CCU Q;  3EFR A;  3QBY A;  2DIG A;  4A4G A;  5GMK m;  4HCC A;  4XAX B;  3M56 A;  5IT9 E;  1G3S A;  5AYF A;  4OVA A;  3J81 E;  4XTW A;  3CCS T;  4GLK A;  2DBK A;  3GF5 A;  2MPX C;  2KRN A;  4PJO F;  5KYW B;  4JJD A;  3PTA A;  1HXD A;  4JRK A;  1VQM A;  2VUB A;  3MO8 A;  3RKW A;  5KYU A;  3OYE A;  4C92 F;  1K73 U;  4QVC A;  1VQ4 Q;  1X27 A;  2CP2 A;  4AFS C;  1K0X A;  2C06 A;  3G4S A;  4QKU A;  3V7S A;  3JAM E;  2V1Q A;  2E3H A;  2DL8 A;  1I4K 1;  1GXI E;  4M7A G;  1AOJ A;  4IUP A;  1E7O A;  2P0K A;  2ZPE B;  4HA8 A;  1XOV A;  3O5Z A;  4O5V A;  1TUC A;  4FYX B;  3N5B B;  5IHI A;  3M53 A;  3UA7 A;  5LJ5 g;  5GAN d;  1VUB A;  3RMQ A;  2O88 A;  4HKE A;  2RQU A;  1PHT A;  1QVP A;  2A0F B;  2DJZ A;  4XTV A;  2JUF A;  3L2W A;  4DA4 A;  4OML A;  5CQX A;  1BU1 A;  2K5I A;  2COW A;  2D1X A;  1WXB A;  5L23 A;  1PRL C;  1M2O A;  1NPP A;  2KVQ G;  1K9M C;  5C6S A;  3V7R A;  4M77 C;  1O75 A;  1GL5 A;  3CCR T;  2DXU A;  1YI2 A;  1I5L A;  2BZY A;  2VXF A;  2OTJ Q;  1JU5 C;  3CCQ Q;  3CCM Q;  4IIM A;  3REB B;  1FMV A;  3THK A;  2BKD N;  2BZ8 A;  1VIE A;  2KBT A;  3ME9 A;  2K4Y A;  3LWH A;  2K7A A;  5GMK j;  1E6H A;  2QTV A;  1KQS P;  3L2Q A;  1MMN A;  1V1C A;  1YNZ A;  4IUQ A;  4RTY A;  1U1T A;  5CKB A;  3JCM g;  2XIC A;  4OP0 A;  1VQ5 A;  4BI8 B;  4XK8 E;  4PLI A;  2RJC A;  1MGQ A;  1PNJ A;  4CC7 A;  1VOM A;  4J7F A;  5FWB A;  5IHN A;  1IZ6 A;  3M0R A;  1QLY A;  3CBO A;  3ER0 A;  2KQW A;  4M77 G;  1E6G A;  2PVG B;  1WHG A;  2DEU A;  2ZGW A;  3NFC A;  2L8D A;  2ROT A;  2H8H A;  1SHF A;  2BIV A;  2CDT A;  2V8J A;  4HVU A;  2PVO B;  3SWN C;  2RK2 A;  1ZHI A;  3A8L B;  3PGG A;  2AIR B;  4BE0 A;  2LMJ A;  3OS5 A;  2RO0 A;  5LJ3 d;  2CP7 A;  4BDY A;  1D0X A;  4E7H A;  2DL4 A;  1OU8 A;  3M59 A;  5AT1 B;  4FSX A;  8ATC B;  1I5O B;  4ZGJ B;  3PMI A;  2O4X A;  1RL2 A;  4GY5 A;  2ZPI B;  3NHN A;  3UF4 A;  3JCM Q;  2P0P A;  4FW2 A;  4DBR A;  2JW4 A;  5GAN 8;  2KSS A;  1VQP Q;  3CC7 A;  2LX9 A;  2YUN A;  3C94 A;  3VS6 A;  2MI6 A;  2EKO A;  2GTO A;  2J6O A;  2YRV A;  3QG1 A;  2AKK A;  2BUD A;  1YIT T;  1M5Q 1;  3JB9 H;  1QMC A;  3PVL A;  4JS5 A;  4O6J A;  3A8M B;  2QGG A;  2EPD A;  4C8Q E;  4J7I A;  1OZ2 A;  1UHC A;  2RI3 A;  2EYY A;  3R6N A;  4F7U G;  3CMA Q;  2RHI A;  3VS5 A;  4N4G A;  3CPW S;  2D8H A;  2XMF A;  4M75 A;  4M78 F;  1ZBJ A;  4OB2 B;  2KGT A;  1KFZ A;  5HY6 A;  3X25 B;  3ZBD A;  2DL3 A;  3CCS A;  1MMG A;  1Q7Y R;  4E2F B;  3CXC A;  2MWO A;  2OX7 A;  4PJO E;  2DM1 A;  2GFU A;  3G6E T;  1N8R R;  4CI0 C;  1R77 A;  5FRO A;  1Q81 R;  1YJN A;  1QVG S;  1HD3 A;  3OYA A;  1RAE B;  3KUF A;  2EJF A;  1VQ8 Q;  4C92 E;  2FO0 A;  4XU2 A;  2MOX A;  1BBZ A;  1QVF S;  4RTW A;  5GMK e;  4Q5W A;  2KK4 A;  2ZCF B;  4PJJ A;  2OI3 A;  3FLG A;  3CD6 A;  1VQK Q;  2K2V A;  2VAS A;  3RR6 A;  3VRY A;  4J8O A;  4EPC A;  5GAM f;  2V1R A;  3WVD B;  4A4H A;  3OW2 A;  2P4R A;  3VYH B;  2FPD A;  5GAO l;  1EX4 A;  4XTZ A;  1M2V B;  1AD5 A;  2EKH A;  1H3H A;  1NM7 A;  1W2B S;  2KNB B;  3EHR A;  1RAH B;  4Y28 E;  2OAW A;  4HCB A;  2AKL A;  2E65 A;  4QT7 A;  3C0C A;  4X1V A;  1AWO A;  4FW1 A;  4BUG A;  1G3T A;  4KRT A;  2PU9 B;  1JJ2 P;  5CK9 A;  3VS4 A;  2QQS A;  1JQQ A;  2DLP A;  1F1B B;  1IHV A;  4DOW A;  4Z88 A;  3GOX A;  5KCO A;  1NLP C;  1VQ7 Q;  3CCL Q;  1T3S A;  1X01 A;  1IO6 A;  3HL8 A;  1SRM A;  2BE9 B;  1LCK A;  4AFZ C;  4KGZ B;  2I2L A;  3CCR A;  1WHH A;  4XTU A;  2JM9 A;  3VS1 A;  2D8J A;  3EG0 A;  1KC8 U;  7AT1 B;  1OEB A;  3G7Z A;  3EG1 A;  3UT1 A;  1N9R A;  3VU3 C;  3LYI A;  1AZG B;  2DE0 X;  2RD1 A;  2K6D A;  1Y96 A;  4XQ3 A;  4UC4 A;  2HAX A;  2MF2 A;  2RHX A;  1TUD A;  3MEW A;  3CCV A;  3V8L A;  3CCJ Q;  1ZQ1 A;  1OQK A;  5GAM e;  4E7I A;  2MAM A;  2YUQ A;  2MCN A;  2R58 A;  2NYS A;  1R0B G;  1UEC A;  3KXT A;  3OSS C;  1X75 C;  1FWZ A;  5GAO p;  2I0N A;  1OPK A;  4LDY A;  2L5Q A;  2DFU A;  1WXU A;  1VQ4 T;  1YJ9 T;  4ELZ C;  3P8B B;  1W4S A;  2ESW A;  1VQ9 T;  2MMP A;  2JTE A;  1AWJ A;  1SPK A;  2XID A;  4OB0 B;  2DBM A;  2FG0 A;  2EJG A;  5FW9 A;  1S72 Q;  4PJO A;  2XHC A;  1PC0 A;  4R56 A;  1IXD A;  3C12 A;  2Y4X A;  4RKU E;  3A8O B;  4C92 A;  1NEG A;  3UPU A;  1KHI A;  4B9W A;  4LD6 A;  1WQ7 A;  4BD3 A;  3MJX A;  4PJN A;  4KBM B;  2BTT A;  4ZGD B;  3M55 A;  4OGC A;  4EMG A;  4V2S A;  4B6M A;  4OMO A;  4PKC C;  2PTK A;  4NL2 A;  4MZP A;  3HHT B;  2W10 A;  2J7I A;  2CP3 A;  1YIJ T;  2FZK B;  1QCN A;  2PQW A;  4QQG A;  4C5G A;  4J9F A;  1KK7 A;  1R8O B;  3CPW A;  1ZUU A;  4ESR A;  1YP5 A;  3PIO A;  3CC4 Q;  1ABQ A;  2HBW A;  3QXE B;  4M78 E;  2P0Q A;  1UGS B;  1B3Q A;  4FYV B;  1BB9 A;  2OTJ T;  1H64 1;  1VYU A;  1MMD A;  2C0T A;  4RTT A;  3CCM T;  2DF6 A;  3H8Z A;  2E4H A;  2A28 A;  1K9M R;  1WGS A;  2QQB A;  1K8A C;  3EG9 A;  3QZ5 B;  3PMT A;  3G6E A;  4N0A A;  5GAN h;  3S3M A;  2VGM A;  1OPL A;  1WIE A;  4A4K A;  5LJ3 f;  3SWN B;  3U23 A;  1RAA B;  1OI1 A;  2DMO A;  2Y4Y A;  1M27 C;  1ZSZ C;  2X3W D;  1BIA A;  4LE9 A;  2L0A A;  2E41 A;  5GAN 5;  1FXX A;  3J7A F;  1PSE A;  5I2S A;  2QXF A;  1TOV A;  2R5A A;  3JB9 D;  2YWW A;  1KHC A;  1W2B A;  1IRE B;  4JJC A;  1WJS A;  3FEO A;  4J83 A;  1Y71 A;  3EFO A;  5A0D A;  3F70 A;  3RIR A;  2DYI A;  1K76 A;  1WA7 A;  2KXC A;  1C6V X;  2M0O A;  3EGX B;  3JCM c;  1Q7Y U;  2HL3 A;  4JZ3 A;  4R55 A;  1N8R U;  1NPR A;  3VJP A;  1Q81 U;  4Y91 A;  1RAI B;  1D1C A;  4OMM A;  4EMK A;  2XKO C;  2K79 A;  3CC2 Q;  3GNG A;  3E2U A;  1ZBX A;  2JTM A;  1KD1 C;  3KBG A;  4LUE A;  1XTD A;  3RMS A;  4DQ2 A;  2M1H A;  4K11 A;  5KYY A;  4E7L A;  1UEB A;  5DLQ E;  3TSW A;  4IUV A;  2CYZ B;  5GAM d;  2NUZ A;  5ECA A;  4C5I A;  1T0J A;  3A98 A;  3CCE Q;  3M57 A;  2HNI A;  2FB7 A;  4AFU C;  2NUT A;  5KYX B;  4OB1 B;  4AMC A;  2SRC A;  5LJ3 h;  4M7A C;  4IUR A;  3LLR A;  5GAN 7;  1KQ1 A;  3LX7 A;  2J05 A;  3PE0 A;  2DTH A;  3NGP A;  3R6O A;  3CXC P;  3QWY A;  1K1Z A;  3FDR A;  2RK1 A;  4GLM A;  1LVK A;  1M1F A;  4C8Q C;  3V7C A;  3JSC A;  2M51 A;  4M78 A;  1YJ9 A;  4RTV A;  1MUZ A;  2H3J A;  1VQK T;  2JZ2 A;  1VQ9 A;  5D6W A;  4DBQ A;  4PJO C;  1C0M A;  4IIO A;  1X6G A;  4ZTF A;  5M9O A;  3GNF B;  2QDY B;  3OW2 P;  4C92 C;  2YDL A;  1VA7 A;  1BI1 A;  3EGD B;  3OY9 A;  2K57 A;  4BY6 C;  5I2M A;  4D8K A;  2M16 A;  1UGQ B;  2GNC A;  3CBP A;  2GQV A;  2CS7 A;  2JVV A;  8AT1 B;  5HCK A;  1B34 B;  2YT6 A;  1J3T A;  1WYX A;  2DNU A;  2KE9 A;  4JLI A;  1VQM Q;  4ORZ A;  1Q82 R;  4AFQ C;  2A3L A;  2GF7 A;  4C8Q G;  3S3O A;  2F1L A;  4M75 E;  1YHQ T;  4KH1 B;  2F5K A;  2AHJ B;  1YIJ A;  3BE3 A;  2CH4 A;  2J6F A;  1TSF A;  2GTJ A;  3G4S Q;  1VQ7 T;  2A08 A;  1D3B B;  2DIQ A;  1WXT A;  2EYZ A;  3X24 B;  2ED1 A;  3H6Z A;  4PJO G;  3M0U A;  4X9D A;  3OYY A;  1Q86 C;  2OTJ A;  2M9U A;  3CCM A;  1R0C B;  4IUT A;  4C0F A;  4C92 G;  3I56 Q;  2DVJ A;  5LJ5 j;  2JN0 A;  5KYW A;  1YCS B;  2VWF A;  1G2B A;  3BDU A;  3CME A;  2KAF A;  2YSQ A;  4JJB A;  3I9Q A;  2OTL A;  2EGC A;  3CCJ T;  1VYV A;  1MMA A;  2X9H A;  2ENM A;  3PVQ A;  5FU7 C;  4LXC A;  3V8K A;  2LP5 A;  3VKI A;  1KJW A;  5GAO n;  5HKC A;  3EG2 A;  1IGU A;  4LD9 K;  4M7D D;  2JT4 A;  2KYB A;  2DTO A;  3JCM V;  1QQJ A;  2LQ8 A;  2QAS A;  4RTX A;  2EWN A;  3OMC A;  1YI2 Q;  5IN1 A;  1NZ9 A;  1CKB A;  3M4G A;  3RNJ A;  2E5Q A;  4X34 A;  3A5Z B;  2EGE A;  2BZX A;  4C0D C;  1YWO A;  1K9M U;  1TWB A;  1WX6 A;  3NPF A;  3CBM A;  1KQS S;  1V29 B;  1SF9 A;  4D8D A;  3VYG A;  2YRC A;  4M7D B;  2MWP A;  4A53 A;  2BE7 D;  4C0G A;  3TEE A;  1ZSG A;  2MYS A;  1M8V A;  2QA4 Q;  4BE1 A;  1MHN A;  1VQN T;  1C1A A;  4ZGE B;  4M4Z A;  1YJW T;  4LUD A;  1UFF A;  2KXD A;  4RG8 A;  2E12 A;  1T3L A;  1UGP B;  3FJP A;  4R0K A;  4E7Z A;  1W6X A;  4AT1 B;  3VS2 A;  2E6N A;  4HCZ A;  4A4E A;  3GBQ A;  3BFM A;  2HKQ B;  3CC4 T;  3IQL A;  4LDX A;  2XU8 A;  1D0Z A;  3CPW P;  4E7S A;  1WI7 A;  1ZSZ B;  2YRD A;  3H0F A;  4QVZ A;  3RES A;  3JCM X;  2WSC E;  3JCM f;  2RQV A;  2M02 A;  5J3B A;  4FT4 A;  2HDA A;  2NUP A;  2RHZ A;  3RKX A;  3EH2 A;  1VQ6 Q;  2JMC A;  1M1G A;  3C4S A;  2F2V A;  4XTX A;  4CC2 A;  4OMN A;  3JB9 F;  2DXT A;  1K8A R;  2COZ A;  5LJ5 e;  4M78 C;  1QP2 A;  3OS1 A;  2CP0 A;  3QO3 A;  5GMK i;  2HKN A;  2AZS A;  5L8R E;  1WDX A;  3WXM B;  3E1S A;  2KRS A;  1BI0 A;  4J9D A;  2LT4 A;  2KDS A;  5FU6 B;  3A8G B;  1RI0 A;  2WSE E;  1UG1 A;  1H8K A;  1I8F A;  1KIK A;  2DRM A;  2FL7 A;  4M7A D;  1M90 C;  1D0Y A;  1UJY A;  5IXF A;  1W2B P;  2OJ2 A;  3CCS Q;  5I22 A;  1IHW A;  2JXB A;  3I5S A;  2FVU A;  1VQO T;  3TCJ A;  2G6F X;  5GMK h;  1YJN Q;  3I55 T;  1SG5 A;  4C8Q D;  4LDW A;  3JB9 I;  5FRM A;  2ATC B;  4ZTJ A;  5GAN g;  1VQL T;  1QCF A;  5GMK l;  2WSF E;  1Q82 C;  1U8R A;  4A4F A;  3AT1 B;  3BDL A;  3EG3 A;  4M78 G;  2QEX T;  1YHQ A;  1JXO A;  3JRZ A;  3QZ9 B;  2FHD A;  1NLO C;  1RAD B;  3JCM e;  2A7Y A;  1OU9 A;  3MP1 A;  4M7A B;  5GJV B;  3CD6 Q;  4JJN K;  3M0S A;  2RM4 A;  3OYB A;  1JBM A;  2YUO A;  4F17 A;  2RJD A;  5J26 A;  2LVM A;  4C8Q B;  1YN8 A;  1RAB B;  3LGL A;  1KD1 R;  5GAN j;  1SSF A;  4LDU A;  1G3W A;  2CP5 A;  2QG9 B;  3OYD A;  3CCU T;  2CZ0 B;  3C95 A;  2LTO A;  2DO3 A;  3OYH A;  4KGV B;  2O2O A;  3AHU A;  1U06 A;  2FZC B;  2HCK A;  3VS7 A;  2JS2 A;  3A8H B;  1JJ2 S;  3X20 B;  3RER A;  1M30 A;  3M54 A;  4A63 B;  1Q82 U;  1U1S A;  2CP6 A;  5A0L A;  2DL7 A;  4J6W A;  2LJ3 A;  4BY6 B;  2CKK A;  1LPL A;  3OB9 A;  1WPY A;  4PJM A;  1M2V A;  2D0N A;  2G3R A;  4J9C A;  4JPB W;  1YCY A;  3HRT A;  2XDB A;  2L3Q A;  3LWI A;  5CVI A;  4EIK A;  4ZN3 A;  3L2U A;  1M8M A;  2ED0 A;  2DPP B;  2XD0 A;  4FU6 A;  4M77 D;  1PWT A;  1W1F A;  3L1A A;  4J9I A;  2KYM A;  1Y57 A;  2JOY A;  2LDM A;  1UUE A;  5GAM h;  3PNW C;  2VXE A;  1KSW A;  3LH0 A;  2RA2 A;  1BI2 A;  2E6Z A;  1RUW A;  1MV3 A;  4OMP A;  3CCV Q;  2JMA A;  1M1K C;  2HQX A;  1D1B A;  2R5M A;  4PFO A;  2EFI A;  1BCO A;  1OZ3 A;  3LGF A;  1RAF B;  4LN2 A;  5LJ3 g;  1VQN A;  3MKD A;  1U5S A;  3EG9 B;  2XDD A;  1YJW A;  3TVT A;  4M77 B;  2CH4 W;  3DLL A;  1X69 A;  2L89 A;  1GFC A;  2HQE A;  4CC4 B;  1WHL A;  4QW2 A;  1G8X A;  4HT9 A;  1HSQ A;  4FM4 B;  2JM8 A;  1O9S A;  1WQW A;  1UHF A;  4J9E A;  2CT3 A;  1XNI A;  5LJ3 j;  3TRE A;  2YXY A;  3WVE B;  4NOY A;  2KRO A;  1YIT A;  3QKJ A;  1ZA2 B;  3I56 T;  2MIO A;  3QWX X;  4E47 A;  4M75 C;  5LJ5 d;  3I35 A;  3P8D A;  1ZLM A;  1AZE A;  1Q86 R;  4M7D F;  2VVK A;  3CCQ T;  2ZAE A;  3G1J A;  3HFO A;  4C0Z A;  2DL5 A;  4N4H A;  2D9T A;  1N6A A;  2E10 A;  5GAN 3;  1LOJ A;  2RPN A;  5HK0 A;  3RKY A;  5GAO r;  2XI9 A;  4C0D B;  1QVG A;  4YTL A;  3FC3 A;  2DET A;  1OX8 A;  3BW1 A;  1TG0 A;  2XDP A;  2IVW A;  1QVF A;  5KYN A;  4MZM A;  4KUI A;  4F7U B;  1NYF A;  2ZZD A;  5CKF A;  2CZ7 B;  1QP3 A;  1PM3 A;  2A36 A;  3QUI A;  2JS0 A;  3LW5 E;  2XK0 A;  4E7J A;  3MPU B;  1QKW A;  4J6X A;  1FMW A;  2C0O A;  3PFS A;  1UB4 A;  1N9S A;  1RAC B;  3EFS A;  2RB6 A;  4M75 G;  1PG5 B;  2R57 A;  2FRW A;  1GBR A;  3G6E Q;  1VQO A;  2WAC A;  4D6W A;  3GIB A;  3JCM d;  3I55 A;  1IB8 A;  3Q1J A;  4WTO B;  1X6O A;  2KRM A;  2LNV A;  3D7S B;  3HFN A;  4B9X A;  1VQL A;  3E9G A;  2QEX A;  4ME7 A;  2QA4 T;  1K4U S;  3L2R A;  1K8A U;  2VV5 A;  2O9S A;  2B86 A;  1PD1 A;  4HXJ A;  1XJW B;  1HYO A;  5D6Y A;  4CC3 A;  1WFW A;  2DZ9 A;  1JEG A;  3ASK A;  2K3B A;  2ABL A;  1ACM B;  1ZA1 B;  2EJ9 A;  4BAC A;  2NWM A;  1VQP T;  2RNA A;  3P8H A;  3E9F A;  1LNX A;  2ECZ A;  2RI2 A;  4N4I A;  1SHG A;  4PK4 A;  3SWN A;  1BIB A;  5KYU B;  2X4J A;  4BI4 A;  3CCU A;  4AG1 C;  2J06 A;  2E3I A;  1ZX6 A;  2EIF A;  1GBQ A;  1I0C A;  2GQI A;  1VQ6 T;  1V76 A;  1X6B A;  4KUL A;  5CIU A;  3CMA T;  4RG2 A;  3GLX A;  2EQM A;  2EYX A;  1SSH A;  1S1N A;  3I5R A;  1K73 C;  3OBW A;  1DJ7 B;  1UE9 A;  2LCL A;  3NTH A;  4WCI A;  2L3S A;  1OOT A;  4IKF A;  1NJI R;  3UAT A;  3SHW A;  3G71 Q;  2HSP A;  4M7A F;  2LX7 A;  2CSQ A;  5GAO m;  1VQ8 T;  2LJ0 A;  2JTF A;  3EGX A;  2DA9 A;  5A2Q E;  1YBY A;  4ZN1 A;  3SEM A;  3OBY A;  2CZ1 B;  1D09 B;  2XG8 D;  2VC8 A;  3QDF A;  1VQ4 A;  5DY9 A;  3EHQ A;  4C8Q F;  1KD1 U;  2F69 A;  5FLX E;  2V26 A;  4Y92 A;  5I21 A;  3QSU A;  1G3Y A;  4RCC A;  4RMO A;  4FYW B;  3H0I A;  3GP8 A;  2IPO B;  1TXQ A;  4VUB A;  3TQ7 P;  3MEU A;  2CGH A;  2HSE B;  3KFV A;  2DK3 A;  1YJN T;  2HD0 A;  1M90 R;  1ZUY A;  2K5L A;  2GGR A;  3CXC S;  2B8A A;  2L3P A;  5FRN A;  4X9C A;  1YJ9 Q;  1RLP C;  3CD6 T;  2KMT A;  1HK9 A;  1VQ9 Q;  2KT1 A;  2GCX A;  3OYL A;  2HQH A;  1RAG B;  1KC8 R;  1IGQ A;  4JZ4 A;  4PFZ A;  3DLM A;  4FSS A;  5KYX A;  4FYY B;  3OYC A;  1KG1 A;  1UTI A;  4OF1 A;  3CCL T;  2M0Y A;  5CKH A;  3I56 A;  1JB0 E;  3OW2 S;  3DB3 A;  2RQW A;  5J39 A;  4M7D E;  2LNH B;  3URG A;  4F14 A;  2FPF A;  2RF0 A;  4Z8A A;  3CCQ A;  2GFA A;  4CRI A;  2P84 A;  3MP6 A;  3FB9 A;  2L3R A;  1JRI A;  3HSB A;  2DAQ A;  2LCC A;  4N0A C;  3OYF A;  1NG2 A;  1K9A A;  3A1P A;  2LQK A;  1Z9Z A;  2J6K A;  4Z89 A;  2RHU A;  4DBF A;  4PNO A;  4OB3 B;  1YIJ Q;  4XU1 A;  2ROL A;  4M77 F;  2CRE A;  4ELY C;  2QQA A;  4DBH A;  3NTK A;  1PSF A;  3M0Q A;  3HRU A;  1CKA A;  1GCQ A;  3EGD A;  4L59 A;  2YLB A;  1X43 A;  4J9G A;  2DJQ A;  2O4X B;  4E7K A;  4M75 D;  2DIL A;  2X4W A;  2NLU A;  1B34 A;  3QII A;  5IAY A;  2QQ9 A;  4JUV A;  1M3C A;  1NEB A;  3CME Q;  1RLQ C;  4QVD A;  1FYN A;  4PFP A;  2D0Q B;  2F2X A;  3CCV T;  1Q86 U;  2OTL Q;  3E19 A;  2EGA A;  3EAE A;  2DD5 A;  5LJ5 f;  1S72 T;  2RHY A;  3UWN A;  2E5K A;  2QA4 A;  4F16 A;  3OS2 A;  1FMK A;  1D3B A;  3VRZ A;  2NUP B;  1IRX A;  2IIM A;  2CZ6 B;  2YUP A;  1VQ5 Q;  1RI9 A;  3OS0 A;  1PCX A;  4MML A;  1M1K R;  5DLO A;  4M75 B;  2VGN A;  3M58 A;  4LDV A;  4ZNX A;  3TU4 K;  2F2W A;  3L2V A;  4EMK C;  4KT0 E;  1B07 A;  5KE2 A;  1ARK A;  2EBP A;  4HVW A;  1QWE A;  1VYT A;  1WJQ A;  2JJ9 A;  2V8I A;  3VS0 A;  1Z9Q A;  4F7U F;  2OAU A;  3M9Q A;  1JXM A;  3VS3 A; 
#chains in the Genus database with same CATH homology
 3PTA A;  1VQP A;  5GAN h;  3S3M A;  2VGM A;  1HXD A;  3QYG B;  4JRK A;  2KY9 A;  4A4K A;  5LJ3 f;  1VQM A;  2VUB A;  3MO8 A;  1Y07 A;  3RKW A;  4XU3 A;  3SWN B;  5CKD A;  3OYD A;  3OYE A;  4PLL A;  4C92 F;  1K73 U;  3CCU T;  1P92 A;  2CZ0 B;  2YLC A;  3C95 A;  4MZT A;  2LTO A;  2DO3 A;  4QVC A;  3OYH A;  2HBP A;  1XQH A;  1OI1 A;  1EIF A;  3QPH A;  3NTI A;  3AHU A;  2Y4Y A;  3BY7 A;  2C06 A;  2LC4 A;  2RI5 A;  3G4S A;  2IG0 A;  5GAM g;  3V7S A;  3JAM E;  3A8H B;  1JJ2 S;  3X20 B;  1VQ6 A;  1I4K 1;  1BIA A;  4J6Y A;  3RER A;  2E41 A;  1GXI E;  5GAN 5;  3CMA A;  3M54 A;  1FXX A;  1Q82 U;  3J7A F;  1PSE A;  1U1S A;  5A0L A;  4IUP A;  4J6W A;  2QXF A;  5I2S A;  4M7A G;  1Y7X A;  2CKK A;  4BY6 B;  4JLG A;  2R5A A;  2P0K A;  2ZPE B;  3JB9 D;  3PIP A;  3OB9 A;  4HA8 A;  1XOV A;  4O5V A;  1WPY A;  2G3R A;  1TH7 A;  5KE3 A;  1YCY A;  1KHC A;  1W2B A;  4MDX A;  1NJI C;  3HRT A;  3N5B B;  1IRE B;  2XDB A;  3MCA B;  3LWI A;  1WJS A;  5CVI A;  4M7A E;  3FEO A;  4J83 A;  5GAO r;  4ZN3 A;  1Y71 A;  3M53 A;  4QQ6 A;  5DM7 R;  5LJ5 g;  5GAN d;  3L2U A;  4HT8 A;  1VUB A;  5A0D A;  3RMQ A;  3F70 A;  2DPP B;  2EYQ A;  3RIR A;  2XD0 A;  4FU6 A;  4HKE A;  4M77 D;  1VQ8 A;  2K3Y A;  3HPW A;  3L1A A;  2M0O A;  1QVP A;  3OYJ A;  1BYM A;  5GAM j;  2JOY A;  3JCM b;  2LDM A;  3JCM c;  5GAM h;  2DJZ A;  4XTV A;  1Q7Y U;  2JUF A;  4M7D A;  4R55 A;  3PNW C;  2VXE A;  3LH0 A;  3L2W A;  2RA2 A;  1N8R U;  1BI2 A;  1NPR A;  2E6Z A;  3X28 B;  4C5H A;  4DA4 A;  5CQX A;  4EMH A;  3VJP A;  1Q81 U;  1M4Z A;  4Y91 A;  1VQK A;  1M1K C;  2K5I A;  2HQX A;  1NE8 A;  4L6V 5;  3JB9 J;  2R5M A;  3CPF A;  2EFI A;  4EMK A;  2XKO C;  1NPP A;  2X4Y A;  1OZ3 A;  2KVQ G;  3GNG A;  3LGF A;  1K9M C;  5LJ3 g;  5C6S A;  1VQN A;  3HRS A;  3V7R A;  2XDD A;  5LJ5 h;  1ZBX A;  4M77 C;  1YJW A;  3T9N A;  1O75 A;  4DOV A;  2JTM A;  3CCR T;  1KD1 C;  2O01 E;  2DXU A;  1YI2 A;  4M77 B;  3KBG A;  1I5L A;  2VXF A;  1XTD A;  1WJR A;  3L42 A;  4JDS A;  3RMS A;  2L89 A;  4DQ2 A;  2HQE A;  2M1H A;  3DLL A;  4E7L A;  2RJF A;  1UEB A;  2BKD N;  1VIE A;  4MDW A;  4QW2 A;  3ME9 A;  2K4Y A;  5DLQ E;  4HT9 A;  3OMG A;  3X26 B;  3OYN A;  3LWH A;  4FM4 B;  3UDC A;  4KUD K;  5GMK j;  3OYG A;  4IUV A;  3OA6 A;  1O9S A;  5HK3 A;  3L2Q A;  1NJI U;  2CYZ B;  5GAM d;  1VQL A;  1Y96 B;  4QQD A;  4IUQ A;  1U1T A;  1WQW A;  5CKB A;  3JCM g;  2XIC A;  2VYT A;  4OP0 A;  4C5I A;  1VQ5 A;  4BI8 B;  2PVD B;  4XK8 E;  5D6X A;  3M57 A;  4NL3 A;  2HNI A;  2FB7 A;  1VIF A;  3QYH B;  5CQY A;  1KC8 C;  1XNI A;  1QW1 A;  4PLI A;  3TRE A;  5LJ3 j;  3OYI A;  3WVE B;  4NOY A;  2RJC A;  4OB1 B;  1YIT A;  1MGQ A;  3QKJ A;  5LJ3 h;  4M7A C;  5KH6 A;  3JB9 G;  4IUR A;  3LLR A;  5GAN 7;  2QTX A;  3I56 T;  3CC2 T;  1KQ1 A;  5GAO q;  3QJ6 A;  4E47 A;  1VQ7 A;  3CCL A;  3LX7 A;  4PJO D;  3INZ A;  4M75 C;  4BB7 A;  5LJ5 d;  3P8D A;  5GAN 6;  2X35 A;  3OYM A;  2DTH A;  4J7F A;  3R6O A;  4M7D F;  1IZ6 A;  3CCQ T;  1N27 A;  4C0Z A;  3HFO A;  4OMF B;  2DD4 A;  2P4T A;  3FDR A;  4N4H A;  2RK1 A;  4C92 D;  1M1F A;  3CBO A;  3ER0 A;  2D9T A;  1N6A A;  2DXC A;  2E10 A;  1LOJ A;  2KQW A;  4M77 G;  3RKY A;  2PVG B;  2DTI A;  2XI9 A;  3V7C A;  4C0D B;  5HK0 A;  1QVG A;  4YTL A;  2ZGW A;  3NFC A;  3JSC A;  2L8D A;  4M78 A;  3FC3 A;  3M4Y A;  2V8J A;  2BIV A;  3JCM h;  1YJ9 A;  3BW1 A;  5CCA A;  4XU0 A;  2H3J A;  2XDP A;  3SWN C;  2IVW A;  2PVO B;  2RK2 A;  1QVF A;  1VQK T;  1M90 U;  1FX7 A;  2JZ2 A;  1ZHI A;  3CCE T;  4M77 E;  3A8L B;  1VQ9 A;  3PGG A;  2PUK B;  2EQU A;  3VV0 A;  3V8J A;  4BE0 A;  4MZM A;  1H3Z A;  5D6W A;  3OS5 A;  4KUI A;  4PJO C;  4F7U B;  1LJO A;  2EQK A;  2Y90 A;  3CCJ A;  4PJO B;  4C5E A;  2RO0 A;  5LJ3 d;  4BDY A;  3J80 E;  2ZZD A;  5CKF A;  4ZTF A;  2CZ7 B;  1QP3 A;  5M9O A;  4E7H A;  3GNF B;  2QDY B;  2YHT A;  3QUI A;  3G71 T;  3LW5 E;  2XK0 A;  4C92 C;  2ZPH B;  1BI1 A;  3M59 A;  4E7J A;  5CAI A;  3OY9 A;  4FSX A;  4C92 B;  1I81 A;  2K57 A;  4BY6 C;  3QHS A;  4J6X A;  5I2M A;  4ZGJ B;  2M16 A;  2PUO B;  4A54 A;  3PMI A;  2O4X A;  4BDZ A;  1UGQ B;  5CR2 A;  1UB4 A;  1RL2 A;  3CBP A;  3PFS A;  2GQV A;  1AHJ B;  2ZPI B;  4GY5 A;  1N9S A;  2CS7 A;  3EFS A;  3JCM Q;  2P0P A;  2RB6 A;  4M75 G;  2JVV A;  1B34 B;  5GAN 8;  2R57 A;  2KSS A;  2ZPF B;  4ATO A;  1VQO A;  3CC7 A;  2WAC A;  4JLI A;  2LX9 A;  4D6W A;  3JCM d;  1OYX A;  3GIB A;  3C94 A;  3I55 A;  2LRQ A;  2A3L A;  2GF7 A;  2MI6 A;  2EKO A;  3Q1J A;  4C8Q G;  3S3O A;  4JRP A;  1X6O A;  4M75 E;  3S6W A;  1G5V A;  2YRV A;  2LNV A;  3HFN A;  4B9X A;  3SB2 A;  1YHQ T;  1KQS A;  3SD4 A;  2F5K A;  2AHJ B;  3QG1 A;  3E9G A;  1YIJ A;  2BUD A;  1YIT T;  2QEX A;  2DZC A;  4ME7 A;  2QA4 T;  5GAN f;  1M5Q 1;  3HP9 A;  3L2R A;  1S72 A;  4JS5 A;  1K8A U;  3JB9 H;  4M7A A;  2VV5 A;  4O6J A;  3A8M B;  1VQ7 T;  4C8Q E;  4J7I A;  1D3B B;  1OZ2 A;  2RI3 A;  2DIQ A;  4F7U G;  2RHI A;  3CPW S;  4N4G A;  3X24 B;  3H6Z A;  4M75 A;  4M78 F;  4PJO G;  5GAN 4;  4OB2 B;  4X9D A;  5D6Y A;  5HY6 A;  3X25 B;  3ZBD A;  3OYY A;  1Q86 C;  2OTJ A;  2DZ9 A;  2D6F A;  2M9U A;  5GAN 2;  3ASK A;  3CCM A;  3CCS A;  4IUT A;  4C0F A;  4FIB A;  2EJ9 A;  4C92 G;  4C8Q A;  4F7U E;  4BAC A;  3CXC A;  2MWO A;  3DKM A;  5LJ5 j;  4PJO E;  2GFU A;  4Z02 A;  3G6E T;  4CI0 C;  2JN0 A;  3RUX A;  1VQP T;  5FRO A;  3JCM J;  3P8H A;  3E9F A;  1LNX A;  1VQM T;  2RI2 A;  5CO7 A;  3BDU A;  3CEY A;  1YJN A;  3CME A;  4N4I A;  2KAF A;  1QVG S;  3ZEH A;  3OYA A;  3SWN A;  3KUF A;  4OGE A;  1BIB A;  2EJF A;  4C92 E;  2X4J A;  2OTL A;  3M5A A;  4XU2 A;  1BI3 A;  4BI4 A;  3CCJ T;  3CCU A;  1QVF S;  5GMK e;  2EIF A;  4Q5W A;  3G4S T;  4P5N A;  3MEV A;  5FU7 C;  2KK4 A;  3V8K A;  5FRM A;  1VQ6 T;  2ZCF B;  3CC4 A;  5FU7 B;  3VKI A;  5CIU A;  4KUL A;  3FLG A;  3CMA T;  5GAO n;  3CD6 A;  2K2V A;  4RG2 A;  5HKC A;  3GLX A;  3G6E A;  4LD9 K;  3QJY A;  2EQM A;  4EPC A;  4M7D D;  4J8O A;  5GAM f;  1K73 C;  3WVD B;  4A4H A;  2DTO A;  1DJ7 B;  3OBW A;  3JCM V;  3VYH B;  3OYK A;  2LCL A;  3NTH A;  3OW2 A;  5GAO l;  4XTZ A;  4IKF A;  2RJE A;  2LQ8 A;  2EWN A;  3OMC A;  4M7A F;  4BE2 A;  5IN1 A;  1NZ9 A;  2ZPG B;  3M4G A;  4XTY A;  1W2B S;  5GAO m;  4MMK A;  1M1K U;  1VQ8 T;  2E5Q A;  4X34 A;  3A5Z B;  4M75 F;  4C0D C;  2JTF A;  4Y28 E;  5A2Q E;  4HCB A;  1YBY A;  4ZN1 A;  2E65 A;  3OBY A;  2CZ1 B;  2XG8 D;  5LL6 S;  2VC8 A;  1K9M U;  1BKB A;  3CBM A;  4BUG A;  5GAN e;  1VQ4 A;  5DY9 A;  3SDZ A;  1V29 B;  1G3T A;  1KQS S;  4M7D C;  3VYG A;  4C8Q F;  4M7D B;  2MWP A;  1KD1 U;  2PU9 B;  4A53 A;  5KCH A;  2F69 A;  5CK9 A;  5FLX E;  4C0G A;  2QQS A;  3TEE A;  5I21 A;  3QSU A;  1G3Y A;  4RCC A;  4RMO A;  1M8V A;  4DOW A;  2QQR A;  3GP8 A;  4BE1 A;  5C0M A;  4J5Y A;  3GOX A;  5KCO A;  4EMK B;  1UGR B;  1MHN A;  1VQN T;  4VUB A;  3MEU A;  2QI2 A;  4ZGE B;  1X01 A;  3HL8 A;  3SFM A;  2CGH A;  1YJW T;  1Q7Y C;  2DK3 A;  1YI2 T;  1YJN T;  2HD0 A;  1N8R C;  4RG8 A;  3CME T;  4M77 A;  2E12 A;  4C8Q C;  1UGP B;  2I2L A;  2K5L A;  3FJP A;  3OSV A;  3CCR A;  3CXC S;  3PT9 A;  4XTU A;  1Q81 C;  4IUU A;  3O8V A;  4TVR A;  3VUB A;  2OTL T;  1KC8 U;  2B8A A;  3G7Z A;  2E6N A;  3QDR B;  4HCZ A;  3UT1 A;  4A4E A;  1N9R A;  3VU3 C;  5FRN A;  3DB4 A;  3LYI A;  4X9C A;  3BFM A;  2RD1 A;  3CC4 T;  1WNL A;  1Y96 A;  2XU8 A;  3HKS A;  4XQ3 A;  4JS4 A;  1VQ5 T;  2KMT A;  4LDX A;  3CD6 T;  4UC4 A;  2FYK A;  1HK9 A;  3FIF A;  2GCX A;  4M78 D;  3OYL A;  2HAX A;  2MF2 A;  2RHX A;  3JCM W;  3MEW A;  4QVZ A;  3CCV A;  3DLM A;  3V8L A;  4M7D G;  3RES A;  3JCM X;  1ZQ1 A;  2WSC E;  3JCM f;  5A0G A;  5GAM e;  4E7I A;  3OYC A;  1KG1 A;  2MAM A;  5EG2 A;  4OF1 A;  3FRN A;  3ZFJ A;  5J3B A;  2RHZ A;  2RH2 A;  4FT4 A;  3RKX A;  3CCL T;  3CC2 A;  2R58 A;  3MEA A;  1JB0 E;  5CKH A;  3I56 A;  3OW2 S;  3HSB A;  1M1G A;  3DB3 A;  3C4S A;  5J39 A;  2DVE A;  3JCM P;  4M7D E;  3URG A;  1M9S A;  2E70 A;  3KXT A;  3OSS C;  4XTX A;  1X75 C;  1FWZ A;  2K3X A;  5GAO p;  3CCQ A;  3JB9 F;  2GFA A;  4CRI A;  4JRQ A;  4BI3 A;  3MP8 A;  2DXT A;  2L5Q A;  2JNG A;  4LDY A;  4WF2 A;  2EAY A;  3GPL A;  3MP6 A;  3FB9 A;  3VUZ A;  2L3R A;  3MET A;  1JRI A;  5LJ5 e;  4FT2 A;  1QP2 A;  4M78 C;  2DAQ A;  2LCC A;  3OS1 A;  3S3N A;  1VQ4 T;  1YJ9 T;  4N0A C;  5CKE A;  4M78 B;  3QO3 A;  3OYF A;  5GMK i;  2LQK A;  1KQ2 A;  5L8R E;  4ELZ C;  3P8B B;  1W4S A;  1VQ9 T;  2RHU A;  2MMP A;  4PNO A;  3WXM B;  4OB3 B;  3OQ5 A;  4XU1 A;  3E1S A;  2DEQ A;  3CCE A;  4M77 F;  2F5T X;  2XID A;  1BI0 A;  4OB0 B;  5FU6 C;  2LT4 A;  4ELY C;  4F7U A;  5GAN 3;  2KDS A;  2EJG A;  2DKG A;  4PJO A;  2QQA A;  2XHC A;  5FU6 B;  3A8G B;  4R56 A;  1JJ2 A;  3NTK A;  2K5F A;  1RI0 A;  2WSE E;  2DXB A;  1I8F A;  4EDU A;  1PSF A;  3C12 A;  3HRU A;  4PL6 A;  2Y4X A;  4L5G A;  4RKU E;  2FL7 A;  3A8O B;  4L59 A;  3G71 A;  4M7A D;  4C92 A;  3UPU A;  2YLB A;  2LT1 A;  4JRI A;  1KHI A;  1M90 C;  4B9W A;  4FL6 A;  4LD6 A;  2EQJ A;  1WQ7 A;  5LJ3 e;  2O4X B;  4BD3 A;  4E7K A;  4M75 D;  2X4W A;  2NLU A;  4KBM B;  3L2Z A;  2E1H A;  4RCB A;  1B34 A;  2FVU A;  3QII A;  4ZGD B;  3M55 A;  5IAY A;  1VQO T;  3TCJ A;  3CC7 T;  2E64 A;  5GMK h;  2QQ9 A;  4JUV A;  4NS5 A;  4OGC A;  4EMG A;  3I55 T;  4V2S A;  4C8Q D;  4PKC C;  3MHX A;  4II1 A;  4LDW A;  3JB9 I;  4NL2 A;  4MZP A;  2V8K A;  4QVD A;  2ZPB B;  3HHT B;  5GAN g;  4ZTJ A;  5GMK l;  2WSF E;  1Q82 C;  1U8R A;  1YIJ T;  1VQL T;  2D0Q B;  4A4F A;  3BDL A;  3CCV T;  1Q86 U;  4M78 G;  2X4X A;  3E19 A;  2QEX T;  1YHQ A;  3EAE A;  2DD5 A;  5LJ5 f;  2PQW A;  4QQG A;  4C5G A;  1S72 T;  2RHY A;  3UWN A;  3JRZ A;  3QZ9 B;  2FHD A;  1R8O B;  3EFR A;  3CPW A;  3QBY A;  2DIG A;  2QA4 A;  3JCM e;  3OS2 A;  2A7Y A;  3MP1 A;  4M7A B;  4A4G A;  1D3B A;  5GMK m;  3PIO A;  4HCC A;  4XAX B;  3M56 A;  2CZ6 B;  5IT9 E;  3QXE B;  4M78 E;  2P0Q A;  3OS0 A;  1UGS B;  4MML A;  4JJN K;  1G3S A;  5AYF A;  2RM4 A;  5DLO A;  4M75 B;  4OVA A;  3OYB A;  3J81 E;  1JBM A;  2VGN A;  3M58 A;  2OTJ T;  1H64 1;  4LDV A;  4XTW A;  3TU4 K;  3CCM T;  3CCS T;  3H8Z A;  4GLK A;  3L2V A;  2RJD A;  4EMK C;  4KT0 E;  5KE2 A;  5J26 A;  3GF5 A;  2LVM A;  1WJQ A;  1WGS A;  2V8I A;  2QQB A;  4C8Q B;  1K8A C;  3QZ5 B;  4F7U F;  3LGL A;  3PMT A;  2OAU A;  3M9Q A;  4PJO F;  5GAN j;  1SSF A;  4LDU A;  1G3W A;  4N0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...