2R5AA

Crystal structure of the two mbt repeats from sex-comb on midleg (scm) in complex with methyl lysine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPGHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Polycomb protein Scm
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5aA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5aA01
3LH0A 1WGSA 3DB3A 4II1A 2P0KA 2L3RA 4E7IA 3MO8A 2EQMA 5IN1A 2QQSA 3SD4A 2K3YA 4NS5A 3MEVA 5C6SA 2R5MA 3P8DA 3PMTA 2O4XB 3QBYA 3OYGA 5IAYA 3S3OA 4IUTA 4OVAA 4C5IA 2GFAA 4EDUA 3OYKA 4N4HA 5FROA 2BKDN 2LRQA 2X4WA 3OYMA 3GOXA 3LYIA 3MP6A 3PFSA 2EKOA 2RJDA 2LCCA 3DLMA 4BD3A 5M9OA 4L59A 3L2QA 2M1HA 4BE0A 3MEUA 4PLLA 3OYFA 2GFUA 2X4XA 2L8DA 3LLRA 3OQ5A 3MEAA 3QJ6A 3UWNA 1XNIA 4PLIA 2X4YA 4FU6A 3PMIA 4Q5WA 4A4FA 3FC3A 2MWOA 3DB4A 3LGFA 4IUPA 5C0MA 3LGLA 3OA6A 2DIGA 3ME9A 2X35A 3M9QA 1WJRA 2RO0A 5J39A 2F5KA 2MWPA 2RHYA 4A4HA 3OYLA 2EFIA 4IURA 2EQKA 3OB9A 3OYEA 2WACA 3NTKA 1KHCA 3FEOA 2EQJA 4B9WA 4QQ6A 3O8VA 2R58A 2R57A 1H3ZA 3FDRA 5FRMA 3S3NA 2O4XA 3OS2A 3MP8A 2NLUA 3E9FA 3OYNA 2VYTA 2JTFA 5KCOA 3UT1A 3OYCA 4UC4A 2RHZA 5CIUA 4BDYA 2QQRA 1WJQA 2JZ2A 3MEWA 2LDMA 1RI0A 3P8HA 4E7JA 2RJEA 1OI1A 2RI3A 4N4IA 4PL6A 4IUVA 4QQGA 5D6XA 3ZEHA 3ASKA 3CEYA 4C5HA 3S3MA 4IUQA 2R5AA 3OMGA 2RJCA 3F70A 2FHDA 2GF7A 3OMCA 3L2RA 2PQWA 3L2WA 4B9XA 4E7LA 3S6WA 3H8ZA 3OYBA 1OYXA 2RHIA 4E7KA 2IG0A 1N27A 2HQEA 3L2UA 4IKFA 2XDPA 4BDZA 3L42A 3Q1JA 4CRIA 4FL6A 4C5GA 1MHNA 4RG2A 3OYDA 4BE2A 3KUFA 4E7HA 2DIQA 3OYHA 2L89A 3MP1A 4ZTJA 4C5EA 3H6ZA 4LD6A 2CKKA 3NTHA 1OZ3A 3QKJA 5D6YA 2RHUA 4X34A 2HQXA 2E6NA 5KE3A 4QW2A 3FLGA 2G3RA 4ZTFA 2RI2A 2K3XA 2E5QA 2RHXA 1SSFA 5KE2A 5D6WA 5KH6A 2M0OA 3OS1A 4BACA 3OYJA 2BIVA 2EQUA 2XK0A 2LTOA 4HCZA 3BDLA 2DAQA 5J26A 4IUUA 3OS0A 3OYAA 3L2VA 1WJSA 3OYIA 4BE1A 4QQDA 4A4EA 3PNWC 3LX7A 2RI5A 3NTIA 2RJFA 3META 3EAEA 4QVZA 3E9GA 3OY9A 2YRVA 2M16A 1OZ2A 5KCHA 4GY5A 3QIIA 4A4GA 4Z02A 3C4SA 2LVMA 2BUDA 5FRNA 1G5VA 2D9TA 4N4GA 2B8AA
chains in the Genus database with same CATH superfamily
1NEBA 1JEGA 1D09B 1VQMT 1KD1U 4FT4A 2GTJA 2DEQA 4HVUA 3RNJA 1TXQA 1KD1R 1S72Q 2J06A 4N4HA 1VQNA 2CT3A 4BE0A 2X4XA 2D0NA 3BY7A 4M7DE 1ARKA 4F14A 3C95A 4J9DA 3RKYA 1E6HA 2GCXA 3DKMA 4JDSA 2RHYA 2EFIA 5GAN3 2J6FA 2KRMA 4C0DC 5IHNA 1D1AA 4X9CA 1IGUA 3G1JA 2R57A 3VS3A 4L5GA 3A98A 1H3ZA 4CI0C 2K2MA 3OBYA 2EPDA 3FRNA 1Q86C 3E2UA 1VQ7A 1AVZC 2ZPGB 2VVKA 4MZPA 3ZEHA 5GMKl 2R5AA 2CZ0B 3FJPA 3L2RA 3G6EQ 3VU3C 4ZN1A 3G4ST 3S6WA 1TU0B 4LNPA 1OQKA 2JXBA 5GAN5 1Q7YR 5EC7A 3X20B 4KUDK 2RPNA 2DJQA 4JZ3A 4RTZA 5FWCA 5GANj 1U8RA 2RHXA 3HHTB 3JB9H 5D6WA 4YTLA 2M0OA 2VGNA 3FB9A 3BDLA 3QDFA 1FWZA 2DPPB 1K8AU 2KY9A 2RJFA 3M56A 1N9RA 1UE9A 2O9VA 3RBBB 4A4GA 3C4SA 5FRNA 1Q86R 2H3JA 2P4TA 1VQ6A 3DB3A 2DL8A 5GAN7 3EGDA 1QVFS 1M5Q1 1TOVA 3LW5E 3SDZA 2LP5A 3I55Q 2QGGA 5GMKi 3S3OA 4C92B 3PE0A 3QXEB 1RAFB 3OW2P 2HDAA 1D0YA 1OOTA 3I56Q 3HRSA 3L2QA 1W6XA 1X01A 3J7AF 4JZ4A 1VQ4T 2DKGA 2GQIA 5AT1B 1QVFP 2AKLA 4D8KA 2E65A 3HKSA 1SEMA 1YBYA 1M8VA 2ZPBB 2JVVA 5GANe 2SRCA 2DZCA 4QQ6A 1OPKA 4LDYA 1BCMA 3G71T 4C8QC 4Y91A 2NYSA 4FW2A 3UT1A 2YT6A 4M4ZA 4OB0B 2JZ2A 3MEWA 3CMEQ 2P4RA 3N5BB 1J3TA 3OW2S 2E5KA 2LQKA 1NJIU 1VQPQ 3CEYA 1LVKA 3S3MA 4BY6C 3CCVA 1Y0MA 3QWXX 1QP2A 3V7CA 3H8ZA 1OYXA 1CKBA 2XDPA 3L42A 3M0QA 3J80E 1IGQA 1GBQA 3H6ZA 4LD6A 2QASA 2KMTA 2CGHA 4DBHA 4C8QA 3AT1B 1ZA1B 1G3YA 1RL2A 1FMKA 5HY6A 4BACA 1WHHA 3CC7Q 1ZBJA 4LUEA 4IUUA 4AFQC 2HKQB 2GQVA 5GAMg 4RTTA 4FSSA 2KI7A 1QP3A 3PNWC 3CCRT 3E9GA 3WVDB 2ENMA 1Q81C 5CKFA 1TG0A 2DA9A 5I21A 4HKEA 2CUDA 1MV3A 4F7UA 1VQ4A 4ELZC 3LWHA 1AOJA 1BI2A 5GJWB 3CD6A 3CBMA 2E70A 1VQ9T 1VQKA 2QA4A 2F69A 4M77C 5GAN6 2LNHB 2PUOB 2R5MA 2VXEA 5IAYA 3JB9G 3FJ5A 3FIFA 1I81A 2RJDA 2MAMA 2LQWA 1O9SA 3M59A 3CCQA 3CC7T 1OX9A 4LDXA 1ZSZA 4EMKA 1YITQ 4F7UE 3INZA 2QDLA 2RO0A 3MPUB 2VWFA 3GBQA 1VQ8A 1XOVA 1K9MR 1YN8A 3A8LB 3CCLA 3A5ZB 4V2SA 1WHJA 4RTWA 3D7SB 4E7SA 5AYFA 2L2PA 2NUPB 3HRTA 1VQ9Q 1VQPA 3P8BB 3OS2A 1SSHA 4BDYA 1K0SA 3E19A 5I2MA 3CCMT 5CKBA 2RI3A 4PL6A 4J6WA 3UDCA 3H0FA 3VS5A 1B34A 1VYTA 2A08A 4OMPA 4WF2A 2PQWA 4C0GA 2DZ9A 2RHIA 3HFNA 1U1TA 2YDLA 4BUGA 4M75F 1I07A 2MCNA 1PRLC 1JJ2P 2HNIA 1VA7A 2XICA 4C0ZA 2HQXA 2MPXC 4MMLA 5LJ5j 3FLGA 1XTDA 1OEBA 1NG2A 1RUWA 5GAMd 2EQUA 2XK0A 4LUDA 2W10A 1TWBA 3A8MB 4ELYC 1M2VA 1G2BA 3QYGB 3META 1UDLA 2EGCA 4DQ2A 2HBWA 4GLMA 2KT8A 3ULRB 3X25B 2B8AA 1MV0B 1PCXA 4XTWA 2NUZA 1LNXA 3EGXB 1HYOA 2GBQA 2KAFA 2O9SA 4OMLA 4XTYA 4PFZA 2QGFB 1GFDA 4JUVA 2JMCA 4EDUA 1GCQC 2E3HA 3H0HA 4X1VA 2HSPA 4M7AC 2KBTA 4RKUE 4JRKA 2EKOA 4C92G 2HAXA 1UGQB 2DO3A 3QYHB 2DBKA 4FU6A 1K1ZA 5CCAA 1K8AR 2FO0A 4KH1B 2HZYA 3JCMQ 1IO6A 2KQWA 4OMFB 3C0CA 4XU3A 3OB9A 2Y4YA 4NL3A 1VQ7T 1VQKT 1HK9A 1VQOA 1YJWA 5DLQE 3OYNA 1GFCA 5KYUA 2CSIA 1ZUYA 3EG3A 4UC4A 3H9NA 2ATCB 1WFWA 3J81E 4NL2A 3P8HA 2AHJB 1ZBXA 1FX7A 4ATOA 3HPWA 2RMOA 4XU0A 2EYXA 5J3BA 4D8DA 3RR6A 2BZXA 3M0RA 3OYDA 4E7HA 2CREA 1YJNQ 5GAN4 4XK8E 1Q82U 1RADB 3V7RA 3VS4A 2PUKB 1YNZA 4JRPA 2E6NA 2IPOB 2GGRA 2NUTA 3CPWS 1D0ZA 2LC4A 4JS5A 2X51A 3OS0A 2K57A 5KYYA 1WX6A 1V76A 3NTIA 1OZ2A 1YCSB 4JJBA 2FPFA 1TS9A 2DF6A 1XJWB 3JCMd 1K73C 1VQ9A 5IN1A 1B07A 2DILA 4RUGA 2MK5A 2A37A 3X24B 3P8DA 5CAIA 1SRMA 2DL5A 1MNDA 3CCRA 1YWPA 2SEMA 4PFOA 1CSKA 4M7DF 1BI0A 1VQMQ 3UPUA 4PLLA 3LLRA 3E1SA 3PMIA 3CQTA 4Q5WA 1KC8U 3BW1A 1VYUA 4IUPA 2D6FA 1SG5A 3VYHB 4M78D 3JRZA 4C8QB 3M0PA 2ROLA 4J9IA 1H92A 2RA2A 1FYNA 4PFPA 5KYXB 1N8RC 1NE8A 4RTXA 3EGXA 1VQLA 2L3SA 1Z9ZA 3A1PA 5IHKA 4KH0B 2LZ6B 1OU9A 1KJWA 1D0XA 1VIFA 2FHDA 3JCMc 1SHGA 2L3QA 1MMDA 4PKCC 3EFOA 1M2OA 2K6DA 4EMHA 2EW3A 2HQEA 5LJ5d 2JTMA 4CRIA 4QVCA 3VS1A 5LJ3j 1I5LA 2CUBA 2DRMA 2DXCA 3CCEA 2OX7A 1X6BA 1M1KU 3CXCS 5CQYA 3ZBDA 1ZUUA 5GAOn 2EJ9A 1VYVA 5GAOq 1GCQA 1GBRA 4PJJA 2E12A 1LPLA 1ABQA 1PG5B 1SRLA 4MZTA 2P0PA 1VIEA 2WSCE 2L3RA 1W2BS 2EVRA 5KYWA 1BB9A 1WIEA 1PD0A 1EZZB 2O4XB 4PJOB 4M7DG 2EGAA 2JMAA 2FRYA 1IREB 2KRNA 2DTOA 2BKDN 3ER0A 5A0DA 2QA4T 2JT4A 1RAIB 3MEUA 1R0CB 4J6XA 3CCSA 1GXIE 4FIBA 4BI3A 4OMOA 3A8OB 4WCIA 1ABOA 4Z88A 3DB4A 4OMNA 1JRIA 5A0LA 1RAAB 1TTHB 2RQVA 3M9QA 4A4KA 2XDDA 2KR3A 3FEOA 2DXTA 4IIOA 1M1GA 4AG2C 5KCOA 4M78E 2CDTA 2JS0A 4PK4A 3VYGA 1X27A 1VQKQ 2IVWA 4J7FA 1M3CA 2BE7D 2VGMA 5A2QE 3PT9A 2K4YA 2FL7A 2QAZA 1UGPB 2DM1A 4C92D 1V1CA 3VUZA 4KULA 3KBGA 2J05A 4C8QD 2KXDA 2VB6A 2RN8A 2RK2A 3IQLA 3OYJA 1QVGA 4HCZA 5J26A 1S1NA 3UA6A 1FMVA 2RQRA 4K11A 1TUCA 3EAEA 2YRVA 2M16A 5KCHA 3CCRQ 2LX9A 4M77G 3V8JA 1M8MA 1VQ7Q 3L2ZA 3CXCA 1HXDA 2D9TA 4AMCA 1Q7YC 2EYYA 4II1A 4E7IA 2ZPEB 1YJ9A 3CCVQ 1W4SA 2F2VA 4J9FA 3JB9F 2JM8A 2RQWA 5HK0A 1R77A 3MCAB 4M75G 4ANJA 5GANh 1SKUB 1U5SA 2M51A 2CT4A 4J8OA 5M9OA 1KQ1A 4KT0E 3SWNA 1QQJA 4MZMA 1NJIC 3OQ5A 3UWNA 1NM7A 1VQ6T 4XTXA 1T3SA 3CCVT 1KQSS 2MMPA 2HKNA 4JPBW 1WJRA 2DMOA 2RK1A 5CVIA 4IIMA 1YJNA 1I1JA 3OYLA 1ZX6A 4B9WA 3JAME 3I56A 2WSEE 1H3HA 3NMZC 2JTEA 2KSSA 4M7AF 4M78B 4M7AG 4BB7A 5IH2A 2FRWA 4AFSC 4QQGA 4N4IA 1NLOC 5GAN2 2NWMA 2KEAA 1N6AA 3REBB 2L0AA 4E7LA 4E7KA 3CCST 2FG0A 4DBFA 1N27A 4C8QF 1KC8R 1KQSP 2X4JA 1WHKA 4A54A 3U23A 4C5EA 2AZSA 3QKJA 1MUZA 3OW2A 1WXTA 4PJOC 1Y96A 2F1LA 2LCSA 1VQLQ 4JJNK 2G3RA 4M77B 1QKWA 2DD4A 2VASA 4KUIA 1RLPC 3M53A 4RTVA 1OX8A 1Y57A 2YRCA 1WJSA 1HD3A 4BI8B 1NYGA 4QVZA 1YI2Q 3H0IA 2LJ0A 4F7UG 2LVMA 2AZVA 4TVRA 2K79A 2M0YA 3JB9D 3G6EA 1VQPT 2VXFA 1EFNA 4C92C 2KGTA 3M4GA 4R55A 2XU8A 2EJFA 1ZHIA 1BI1A 2DVJA 3JV3A 3CPFA 4E7ZA 3EG0A 9ATCB 2PVGB 5GANd 2FVUA 1KSWA 1TUGB 2COWA 3GOXA 2LCCA 4M7AB 2M1HA 4F16A 2EQIA 3OYFA 1Q81U 2X4YA 4HVVA 3FC3A 3BDUA 1Y71A 4M78A 1LCKA 1TSFA 1S72T 4L6V5 4XTZA 5FU6B 1UJYA 4A4HA 2A7YA 1IHVA 4AFUC 2CZ7B 2FB7A 3CD6T 1NBEB 2HQHA 2FEIA 2C0OA 3HP9A 4J9GA 3MP8A 3CMET 3M54A 1RI9A 2CH4W 5FWBA 1U1SA 1WQWA 2ROTA 3CCMA 2DD5A 4RCCA 4E7JA 1OI1A 4Y92A 4FYWB 1NPPA 3F70A 4M75B 3OMCA 1NEGA 1NYFA 4KGXB 2C0TA 1YJ9Q 2KT1A 2PNIA 5GMKm 1B34B 3CCLQ 1VQNT 4PJOA 3MP1A 1AD5A 2RHUA 1KD1C 2YUQA 1PD1A 2GNCA 4PNOA 1C0MA 3VS2A 2KVQG 3OS1A 1UHFA 4MDWA 3CCQT 2BIVA 4RTUA 3JCMJ 3WXMB 4O5VA 4MMKA 2PVDB 2GTOA 4M77A 3V8LA 1ZUKA 1M90U 1UJ0A 4GY5A 1BU1A 5GAOm 3TSZA 2BUDA 3I5SA 1N5ZA 4ESRA 3JB9I 3GNFB 3JCMW 4M75E 2YWWA 4DOWA 2C0IA 2EQMA 3SD4A 1WZOA 1PSFA 3QUIA 4JS4A 2HSEB 3A8HB 5CKDA 4M77F 1VQ4Q 1FMWA 2EGEA 1QMCA 4ZGJB 4GBQA 2M9UA 2KRSA 1WI7A 3HFOA 2RQTA 5GMKe 4AFZC 1Q86U 2KYBA 1QCNA 1M2VB 3GLXA 2PVOB 4HCCA 4FSXA 4OB2B 1K9MC 2MWOA 1ZLMA 3LGFA 1ZSGA 3NGPA 5C0MA 1VQ5A 5GAMf 1UB4A 1RABB 2MWPA 1X6OA 1QKXA 3M55A 1Z9QA 1OV3A 1HJDA 2JN0A 4FT2A 1Y96B 3CC2Q 2DYIA 2DVEA 3SB2A 2CZ6B 2K2VA 1IRXA 5A0GA 2A28A 2HL3A 1T0JA 1AHJB 3ASKA 1PRMC 2CP3A 3RMSA 3L2WA 1OULA 3G71Q 5KYWB 4JRQA 5I22A 2G6FX 2DK3A 4RG2A 2CYZB 3I5RA 4ZTJA 2CKKA 2AIRB 2DX1A 3R6NA 5FW9A 4XTUA 4FYVB 2LQ8A 1WDXA 3PGGA 5HCKA 1D1BA 1AZGB 3G4SA 3CCUA 2EWNA 5L8RE 2QEXA 5GANg 4Z02A 2X3XD 1VQLT 3EG2A 4M77D 3I55A 3HTRA 2JOYA 2VKNA 3MEVA 3RKWA 2V1RA 5GJVB 3V7SA 1VQ6Q 5GAMj 1G83A 3OYGA 1JU5C 1JJ2A 3OYKA 2CP6A 2XMFA 2AT1B 2F5TX 4M7DA 1NPRA 3PFSA 1K8AC 4BD3A 3G7ZA 1M4ZA 1YFNA 2O31A 2K7AA 4L59A 2DJZA 2ED0A 2DFUA 5KYXA 3MEAA 3RMQA 5CO7A 5GMKj 1KFZA 3MJXA 2KE9A 1W2BA 2VUBA 5LJ3f 4EIKA 1Y07A 2DNUA 4HVWA 3M58A 2LJ3A 3OYEA 4RCBA 2WACA 3VJPA 1KHCA 4E47A 4KRTA 5L23A 3O8VA 2OTLA 2BZ8A 2R58A 4LDVA 1ZSZB 4EMKB 2QK0A 3M57A 1WJQA 1BK2A 1BI3A 3M4YA 1M90C 3EHQA 1MMAA 2L5QA 4J7IA 2J6KA 1PSEA 2IG0A 3TQ7P 5LJ3h 2EAYA 4BE2A 4C5GA 1MHNA 4FM4B 1UGSB 5ECAA 3OYHA 3NTHA 1U3OA 4QW2A 1PWTA 3EG1A 4F7UB 1G3TA 4M75D 1QVGP 3CCMQ 1SSFA 4OB1B 1H8KA 2RD1A 3URGA 3O5ZA 1JB0E 4LXCA 1X6GA 3OY9A 2F2XA 2C06A 2D0QB 3CXCP 1WPYA 4HT8A 1OPLA 2Z0WA 1V29B 5I11A 4XU1A 3PVQA 3MO8A 2QQSA 5LJ3d 5GAOl 1YWOA 3TVTA 1BIBA 5C6SA 2ESWA 2CH4A 2YHTA 3QZ5B 5CKHA 2YUNA 3ZFJA 3CCEQ 2LNVA 2GFAA 1UGRB 2CS7A 4M75A 4DEYA 2ZPHB 3MP6A 2NUPA 4KBMB 3EGUA 3CC4T 3OS5A 1D3BB 5GAMe 2Y4XA 2AKKA 2QEXT 4IURA 2QQAA 1YI2A 2RM4A 4M7AE 1R0BG 1RAHB 2K5LA 3QDRB 1MMNA 2DXBA 4M75C 1YHQT 3PIPA 4D6WA 2CP5A 2DERA 2ZCFB 4XU2A 2QTXA 2DXUA 4F17A 5D6XA 2LJ1A 2E64A 3CBOA 1EX4A 1SHFA 2H3EB 3M5AA 4LDWA 1GCPA 3M0TA 2QG9B 3QO3A 1LJOA 2MYSA 3SFMA 2HBPA 2PTKA 3TSWA 1WNLA 3VS6A 1N9SA 1QLYA 4EPCA 1GRIA 2E5QA 2YXYA 4RMOA 1PKSA 3M0UA 4J9CA 2ZPIB 3JCMf 2FZCB 4QQDA 4J9EA 4F7UF 3I55T 3OYYA 1GL5A 3QIIA 4HCBA 3GF5A 5CR2A 4OP0A 3QZ9B 1BCOA 1X75C 2ECZA 2K3YA 4NS5A 4AT1B 2Y90A 3VKIA 3CCLT 1VQNQ 2WSFE 1ACMB 1D3BA 1VQ8T 5GMKh 3A8GB 4WTOB 5DM7R 1UFFA 4FYYB 3NFCA 3WVEB 4C5IA 2CP2A 4OMMA 1UG1A 3OYMA 1NJIR 4ME7A 2XI9A 4M7DD 2B86A 4PJNA 2EKHA 1AWWA 4M77E 2F2WA 3EFOB 3OA6A 1D1CA 3ME9A 1EIFA 4J9HA 4QKUA 2EQKA 5KYUB 1JXOA 4M78F 3JCMb 4KGVB 2X9HA 1YJWQ 4J6YA 5FRMA 2DTHA 1VQOQ 5I2SA 2QQ9A 3BE3A 2NLUA 3E9FA 4M7DC 4JLGA 2JTFA 1AT1B 3OYCA 1WXBA 2JJ9A 3QG1A 1PM3A 3THKA 1AWJA 4IUVA 3RESA 1YHQA 4IUQA 3CCJQ 2GF7A 3VV0A 2YUPA 2ZAEA 1UECA 1RLQC 4F04B 3MKDA 3Q1JA 1VQ5Q 2HD0A 2FPEA 2IIMA 2E41A 3VRZA 4OGCA 4PJOE 1OZ3A 4Z8AA 2V8KA 3CC4A 2K3XA 1YCYA 2ZPFB 2K5IA 4CC2A 3EHRA 3X26B 2HL5C 2DAQA 2DL4A 4OGEA 1WYXA 2RI5A 3HSBA 3HRUA 1KIKA 2AK5A 2LX7A 4J5YA 5GAOr 2YUOA 1YIJQ 3RDVA 3M0SA 2O2OA 5LJ5g 1KC8C 1AZEA 2DEUA 3ZL7C 1Q82C 3CC2T 1RAEB 1M3AA 3CCSQ 2QQBA 2LQNA 1CKAA 3CPWP 2P84A 4OVAA 2RNAA 2DL7A 4LE9A 1ZA2B 2LRQA 2PU9B 3QSUA 2ZGWA 3LYIA 2OI3A 1WXUA 1TH7A 3UA7A 4OF1A 1QCFA 2RB6A 5IT9E 2FYKA 4A4FA 1KQ2A 2D8JA 3LGLA 5KYYB 2HMAA 2X35A 4PJMA 1MNEA 2F5KA 4E2FB 4FCYA 5CK9A 1XQHA 4DBQA 1B3QA 2ED1A 1ZQ1A 4PJOF 3I35A 1YJWT 3JCMe 4DA4A 2BTTA 1O75A 1R8OB 4MDXA 5CIUA 2OTJT 2QQRA 2QDYB 1JBMA 2LDMA 1W70A 5HKCA 2O88A 1X2KA 1NZ9A 2K3BA 4HT9A 5CKEA 1YITA 2YRDA 5LJ5f 4B9XA 5GANf 2YLCA 1AWOA 3OYBA 2I0NA 3CCQQ 2OTLT 2EYZA 5IXBA 1AWXA 1I0CA 4C0FA 1W1FA 7AT1B 2L89A 1QCOA 4Y28E 2EYWA 1I8FA 1N8RU 5HK3A 3SWNB 2M02A 3PVLA 4N0AC 1UEBA 3CD6Q 2DRKA 5CQXA 3G6ET 4M7AA 4BE1A 1X69A 2K9GA 2E3IA 1M27C 2JM9A 1QWFA 3QWYA 4X9DA 4QT7A 2RF0A 2XIDA 4N4GA 2KROA 4EMGA 2KNBB 3TCJA 3CC7A 4DBRA 1BBZA 4JJDA 1M1KC 2D8HA 2I2LA 4XTVA 1KQSA 1LOJA 1PKTA 2XD0A 2CP7A 4IUTA 2CSQA 6AT1B 1WA7A 3PIOA 2DYBA 5FU7C 3JCMX 2DE0X 2MOXA 3DLMA 1Q95G 4LN2A 3CCUT 1BYMA 4DEXA 1M3BA 1UUEA 3JCMh 5IHIA 1K4US 4JLIA 5IXFA 1W2BP 4HCKA 2DIGA 2QXFA 4B6MA 1QVFA 4PJOD 3CCET 1UHCA 2QI2A 3MHXA 1YP5A 1DJ7B 3CCJT 2EJGA 1QW1A 1JJ2S 3S3NA 4CC3A 1YITT 3C12A 3LWIA 3X28B 2RHZA 4FW1A 2QEXQ 2XDBA 1YJNT 1E6GA 1FXXA 2A3LA 1PNJA 4P5NA 3RUXA 1M1KR 1WLPB 2L3PA 3OMGA 3AHUA 2RJCA 1UTIA 4A63B 4NOYA 3CCUQ 3G4SQ 2DLPA 2E6ZA 5LJ3g 3L2UA 1KHIA 1X2QA 5EG2A 2KK4A 2YLBA 3OSVA 3KUFA 2DIQA 1PHTA 3VS0A 2BZYA 1I4K1 4C8QE 4KGZB 2DTIA 2RH2A 2VV5A 2RI2A 2LT4A 2V8IA 8ATCB 1RACB 3EFRA 3G71A 5KH6A 2KXCA 4M78G 2P0QA 5GAMh 1G3WA 4HXJA 1H641 3QJYA 3LX7A 1QWEA 3R6OA 5DY9A 4CC4B 3RERA 8AT1B 2PZ1A 4RG8A 4BY6B 4JRIA 2JW4A 3LH0A 1WGSA 1E7OA 2ZZDA 2P0KA 1AEYA 3CC2A 2E1HA 4QVDA 3EH2A 1M30A 3CMAA 1WHGA 3PMTA 3QBYA 4Z89A 4RTYA 2JUFA 1QVGS 1YIJA 3H41A 2RQUA 2OAWA 3GP8A 2J6OA 2W0ZA 2H8HA 5FROA 5LJ5h 2X4WA 2OTLQ 1N8RR 2EYQA 2X3WD 3HL8A 4ZN3A 2L8DA 3JCMg 4C92A 1XNIA 4PLIA 1M90R 1NLPC 3CC4Q 1Q7YU 1A0NB 2QYZA 4ZGDB 3UATA 4N0AA 2KDSA 2OTJQ 2VC8A 2XG8D 3EGDB 1X43A 1WHLA 3NTKA 4GLKA 2YSQA 3L1AA 5GAOp 3LH5A 3FDRA 2D1XA 2O4XA 4ZNXA 1KG1A 5FU6C 3BFMA 2VYTA 1G8XA 3CCJA 1YHQQ 2EBPA 1I5OB 1JXMA 3SWNC 1RI0A 3VS7A 1K9AA 2RJEA 5DLOA 2HEQA 4C92E 1Q81R 1WHMA 1K76A 4C5HA 3JCMV 1JO8A 4XAXB 4ZGEB 3QPHA 1WQ7A 2OJ2A 2DBMA 4C92F 3JSCA 3EH1A 1VQOT 1VOMA 4R56A 1K73R 1P92A 4LDUA 1T3LA 4IKFA 4FYXB 1IHWA 3VRYA 3EG9A 2NUTB 1K73U 2V8JA 1S72A 4E6RA 5D6YA 5KE3A 2E10A 2OAUA 1Y7XA 2MIOA 2LMJA 1RAGB 4BI4A 2FPDA 2COYA 2LTOA 2JS2A 3OYAA 1KK7A 3L2VA 3OYIA 4A4EA 2J7IA 3TREA 2LCLA 3SEMA 1M9SA 1IZ6A 2DETA 3JB9J 3JCMP 2ABLA 5LL6S 1VQ8Q 1TUDA 4LD9K 2HCKA 1C6VX 1BKBA 1YI2T 1SPKA 3KXTA 2O01E 2EIFA 3T9NA 2QTVA 1MGQA 3EG9B 4C0DB 3TU4K 2FZKB 1IXDA 4J9BA 2MI6A 2COZA 1IB8A 4JJCA 2K5FA 3TEEA 2GFUA 3QJ6A 4PJLA 3C94A 2MF2A 1HSQA 4CC7A 2QA4Q 3NPFA 3EFSA 5FU7B 4AG1C 3GPLA 1VUBA 1OU8A 1YIJT 1JQQA 3RIRA 5FLXE 2XHCA 5J39A 2E4HA 3OSSC 4A53A 2OTJA 1ZSZC 4EMKC 1K0XA 3PTAA 4OMQA 3REAB 2EQJA 2XKOC 4M7AD 2LT1A 1YJ9T 4XQ3A 2CP0A 4OB3B 5LJ3e 3QHSA 1BIAA 1MMGA 2V1QA 4J83A 3CPWA 1VQ5T 3I9QA 3CMAQ 2A36A 1QVPA 4C8QG 3I56T 3UF4A 4BDZA 1F1BB 1SF9A 2CZ1B 4DOVA 4FL6A 3GIBA 5D7UA 1G3SA 3SHWA 4VUBA 2KYMA 2DL3A 2V26A 3VUBA 4X34A 3RKXA 3OBWA 2BE9B 4M78C 4ORZA 4ZTFA 3NHNA 3V8KA 1B7TA 2A0FB 3CMEA 4HA8A 1VQMA 5KE2A 3GNGA 1U06A 1Q82R 4M7DB 4PJOG 1T0HA 4O6JA 1C1AA 2FZGB 3KFVA 1PC0A 1M1FA 2JNGA 5LJ5e 4R0KA 3CBPA 5KYNA 1UGVA 3DLLA 5GAN8 3CMAT 1K9MU 1G5VA
chains in the Genus database with same CATH topology
3GNFB 3JCMd 3JCMW 1K73C 4M75E 4DOWA 1VQ9A 2EQMA 5IN1A 3SD4A 1Q82C 3CC2T 1PSFA 3QUIA 4JS4A 3X24B 1VQMT 1KD1U 4FT4A 3A8HB 5CKDA 4M77F 2DEQA 3P8DA 2QQBA 4ZGJB 2M9UA 5CAIA 3HFOA 5GMKe 3CCRA 4OVAA 1Q86U 4M7DF 4N4HA 2LRQA 2PU9B 3QSUA 1BI0A 2ZGWA 1VQNA 3LYIA 3UPUA 1TH7A 4BE0A 4PLLA 4OF1A 2X4XA 3GLXA 3LLRA 2RB6A 3BY7A 4M7DE 3E1SA 2PVOB 5IT9E 4HCCA 2FYKA 3PMIA 4FSXA 4Q5WA 4OB2B 4A4FA 1KC8U 1K9MC 3C95A 2MWOA 3BW1A 3LGFA 4IUPA 1KQ2A 5C0MA 3LGLA 2D6FA 3VYHB 4M78D 3JRZA 3RKYA 2GCXA 1VQ5A 3DKMA 5GAMf 1UB4A 2X35A 4JDSA 2F5KA 2MWPA 2RHYA 4C8QB 5CK9A 1X6OA 2EFIA 5GAN3 2RA2A 3M55A 1XQHA 4C0DC 4X9CA 2JN0A 1ZQ1A 4FT2A 4PJOF 1YJWT 2R57A 1Y96B 3JCMe 4L5GA 4DA4A 1H3ZA 4CI0C 1N8RC 2DVEA 1NE8A 3FRNA 3OBYA 3SB2A 1VQLA 1O75A 1R8OB 1Q86C 4MDXA 1VQ7A 2ZPGB 5CIUA 2OTJT 2CZ6B 2QQRA 2K2VA 1JBMA 2QDYB 2LDMA 5A0GA 4MZPA 5HKCA 3ZEHA 5GMKl 3ASKA 1AHJB 3RMSA 1NZ9A 4HT9A 2R5AA 5CKEA 1YITA 2CZ0B 3FJPA 1VIFA 2FHDA 3JCMc 5LJ5f 3L2RA 3L2WA 3VU3C 4B9XA 4ZN1A 3G4ST 5GANf 2YLCA 4PKCC 3S6WA 3OYBA 4JRQA 2OTLT 4EMHA 5LJ5d 2HQEA 2DK3A 2JTMA 4CRIA 5GAN5 4RG2A 4C0FA 4QVCA 5LJ3j 2CYZB 1I5LA 2DXCA 2L89A 3X20B 4ZTJA 3CCEA 4KUDK 2CKKA 4Y28E 1I8FA 1M1KU 3CXCS 5CQYA 1N8RU 4XTUA 5HK3A 3SWNB 5GANj 3ZBDA 2LQ8A 3PGGA 2RHXA 3HHTB 1U8RA 4N0AC 3JB9H 5D6WA 1UEBA 4YTLA 2M0OA 2EJ9A 5GAOn 3G4SA 3CCUA 2VGNA 3FB9A 5CQXA 3BDLA 2EWNA 1FWZA 5L8RE 2DPPB 3G6ET 4M7AA 5GAOq 4BE1A 1K8AU 2E12A 2KY9A 2RJFA 3M56A 1N9RA 2QEXA 5GANg 4A4GA 4X9DA 3C4SA 4Z02A 5FRNA 4MZTA 2P0PA 2XIDA 1VQLT 2H3JA 2P4TA 4M77D 4N4GA 3I55A 4EMGA 1VQ6A 3DB3A 1VIEA 3TCJA 2WSCE 2L3RA 5GAN7 3CC7A 1W2BS 2JOYA 1QVFS 3RKWA 3MEVA 1M5Q1 3LW5E 3V7SA 3SDZA 1M1KC 2I2LA 5GAMj 4XTVA 1KQSA 2O4XB 1LOJA 3OYGA 2XD0A 5GMKi 3S3OA 4PJOB 1JJ2A 4C92B 4IUTA 4M7DG 3QXEB 1IREB 3PIOA 3OYKA 2DTOA 2BKDN 2F5TX 5FU7C 3JCMX 4M7DA 3ER0A 1NPRA 3PFSA 5A0DA 1K8AC 4BD3A 3DLMA 1M4ZA 3G7ZA 3HRSA 4L59A 3L2QA 4J6XA 3MEUA 2DJZA 3CCSA 3CCUT 1BYMA 1X01A 3J7AF 1GXIE 4FIBA 3MEAA 4BI3A 3A8OB 3JCMh 1VQ4T 2DKGA 3RMQA 5CO7A 5GMKj 4JLIA 3DB4A 1JRIA 2E65A 2DIGA 2QXFA 5A0LA 3HKSA 3M9QA 4PJOD 1W2BA 2VUBA 1YBYA 3CCET 1QVFA 2ZPBB 5LJ3f 1M8VA 1Y07A 4A4KA 2QI2A 2XDDA 3M58A 3MHXA 3OYEA 2JVVA 4RCBA 2WACA 3VJPA 5GANe 1KHCA 1DJ7B 3FEOA 4E47A 2DXTA 3CCJT 2EJGA 1QW1A 2DZCA 4QQ6A 3O8VA 2OTLA 4LDYA 2R58A 1JJ2S 3G71T 3S3NA 1M1GA 4C8QC 4Y91A 1YITT 3C12A 3LWIA 4LDVA 3X28B 4EMKB 5KCOA 3UT1A 4M78E 2RHZA 3M57A 4OB0B 1WJQA 2JZ2A 3MEWA 1YJNT 2XDBA 3VYGA 3N5BB 1FXXA 2A3LA 3OW2S 2LQKA 1NJIU 3CEYA 4P5NA 3RUXA 3S3MA 4BY6C 3CCVA 1BI3A 2IVWA 2RJCA 3OMGA 3AHUA 4J7FA 3M4YA 4NOYA 1M90C 1QP2A 3V7CA 2VGMA 5A2QE 2L5QA 3PT9A 3H8ZA 4J7IA 1OYXA 1PSEA 2E6ZA 2IG0A 5LJ3g 3L2UA 2K4YA 1KHIA 2FL7A 2XDPA 2EAYA 5EG2A 3L42A 5LJ3h 4BE2A 4C5GA 1MHNA 4FM4B 1UGSB 1UGPB 2KK4A 2YLBA 3OSVA 3KUFA 4C92D 2DIQA 3J80E 3OYHA 3H6ZA 4LD6A 3NTHA 1I4K1 3VUZA 4KULA 3KBGA 4C8QE 2KMTA 2CGHA 4QW2A 4C8QD 2DTIA 2RH2A 2VV5A 4C8QA 4F7UB 2RI2A 1G3TA 1G3YA 2LT4A 4M75D 1RL2A 2V8IA 1SSFA 3EFRA 3G71A 5HY6A 5KH6A 2RK2A 4OB1B 4BACA 3OYJA 1QVGA 2RD1A 4M78G 2P0QA 4HCZA 3URGA 5J26A 1G3WA 4IUUA 5GAMh 2GQVA 5GAMg 1JB0E 1QP3A 1H641 3PNWC 3QJYA 3LX7A 3R6OA 5DY9A 3EAEA 3RERA 3CCRT 3E9GA 3OY9A 2YRVA 3WVDB 2M16A 5KCHA 2C06A 1Q81C 2D0QB 2LX9A 4M77G 4RG8A 5CKFA 4JRIA 3V8JA 4BY6B 1WPYA 5I21A 4HT8A 4HKEA 3L2ZA 3CXCA 2D9TA 1HXDA 4F7UA 1Q7YC 3LH0A 1WGSA 4ELZC 3LWHA 1V29B 1VQ4A 2ZZDA 2P0KA 4II1A 4E7IA 3CC2A 2ZPEB 4XU1A 3MO8A 1BI2A 2E1HA 2QQSA 3CD6A 5LJ3d 3CBMA 1YJ9A 2E70A 1VQ9T 1VQKA 5GAOl 2QA4A 4PJOC 1W4SA 2F69A 4M77C 4QVDA 1BIBA 5C6SA 2YHTA 3QZ5B 5GAN6 3CMAA 2PUOB 2R5MA 2VXEA 5CKHA 3JB9F 3PMTA 3QBYA 5IAYA 2JUFA 4M75G 3MCAB 3ZFJA 5HK0A 1QVGS 1YIJA 2LNVA 5GANh 2GFAA 3GP8A 1UGRB 2CS7A 4M75A 3JB9G 5FROA 3FIFA 5LJ5h 2X4WA 1I81A 2ZPHB 3MP6A 2RJDA 4J8OA 2MAMA 5M9OA 1KQ1A 1O9SA 2EYQA 4KT0E 3HL8A 3SWNA 3M59A 4ZN3A 3CCQA 4MZMA 3CC7T 2L8DA 3JCMg 3OQ5A 4KBMB 3UWNA 4C92A 1NJIC 1XNIA 4PLIA 4LDXA 1VQ6T 4XTXA 4EMKA 3CC4T 3OS5A 4F7UE 3INZA 1Q7YU 1D3BB 3CCVT 5GAMe 2Y4XA 4ZGDB 1KQSS 2MMPA 2QEXT 1WJRA 2RO0A 4N0AA 2KDSA 2RK1A 2VC8A 2XG8D 5CVIA 1YJNA 1VQ8A 3OYLA 1XOVA 4IURA 3A8LB 3NTKA 2QQAA 3CCLA 4GLKA 1YI2A 3A5ZB 2RM4A 4B9WA 3JAME 3L1AA 5GAOp 4M7AE 5AYFA 4V2SA 3HRTA 3I56A 2WSEE 1VQPA 3FDRA 3P8BB 2O4XA 2K5LA 3OS2A 1KG1A 3QDRB 5FU6C 3BFMA 2DXBA 4M75C 1YHQT 2VYTA 2KSSA 3CCJA 4M7AF 4BDYA 4M78B 3PIPA 4D6WA 3SWNC 4M7AG 4BB7A 2ZCFB 1RI0A 3E19A 4XU2A 5I2MA 3CCMT 2QTXA 2DXUA 2RI3A 2RJEA 4N4IA 4PL6A 4QQGA 5CKBA 5D6XA 4C92E 5DLOA 4J6WA 3UDCA 3JCMV 4C5HA 5GAN2 1B34A 4XAXB 4ZGEB 1N6AA 3QPHA 1WQ7A 4WF2A 2PQWA 4C92F 3JSCA 4C0GA 1VQOT 2E64A 4R56A 2DZ9A 3CBOA 4E7LA 2RHIA 4E7KA 3CCST 1P92A 4LDUA 1N27A 4IKFA 3M5AA 3HFNA 1U1TA 4C8QF 4LDWA 2X4JA 4BUGA 1K73U 4M75F 2V8JA 3QO3A 4A54A 2HNIA 1LJOA 4C5EA 1S72A 2XICA 3SFMA 2HBPA 4C0ZA 3QKJA 5D6YA 3OW2A 2HQXA 2E10A 1WNLA 4MMLA 5KE3A 1Y96A 3FLGA 1XTDA 5LJ5j 2OAUA 4JJNK 1Y7XA 2G3RA 4M77B 1N9SA 2DD4A 4KUIA 4EPCA 2E5QA 3M53A 4RMOA 5GAMd 4BI4A 2EQUA 2XK0A 2LTOA 3OYAA 3L2VA 1WJSA 2ZPIB 3A8MB 4ELYC 3OYIA 4BI8B 3JCMf 4QQDA 4A4EA 4F7UF 3I55T 3TREA 2LCLA 3QYGB 3META 4QVZA 1M9SA 3OYYA 1IZ6A 3JB9J 4DQ2A 3QIIA 4F7UG 2LVMA 3JCMP 4TVRA 5LL6S 4HCBA 3GF5A 3X25B 5CR2A 2B8AA 4LD9K 4OP0A 3QZ9B 3JB9D 3G6EA 1VQPT 2VXFA 4C92C 1BKBA 1X75C 4XTWA 1LNXA 2K3YA 4NS5A 3M4GA 4R55A 1YI2T 2XU8A 2EJFA 2Y90A 1ZHIA 1BI1A 3VKIA 3CCLT 2KAFA 3CPFA 2WSFE 3KXTA 1D3BA 4XTYA 2O01E 1VQ8T 5GMKh 2EIFA 3A8GB 3T9NA 1MGQA 4C0DB 5DM7R 3TU4K 4JUVA 3NFCA 2PVGB 3WVEB 5GANd 4C5IA 2FVUA 4EDUA 2MI6A 4M7AC 2K5FA 3OYMA 3GOXA 4RKUE 4JRKA 2EKOA 2LCCA 4M7AB 3TEEA 4C92G 2M1HA 4ME7A 2HAXA 3OYFA 1UGQB 2DO3A 2GFUA 2XI9A 3QJ6A 3QYHB 1Q81U 2X4YA 3C94A 4FU6A 2MF2A 4M7DD 4M77E 5CCAA 3FC3A 3BDUA 3EFSA 1Y71A 5FU7B 3GPLA 4M78A 3OA6A 1VUBA 1YIJT 3ME9A 3RIRA 5FLXE 3JCMQ 2XHCA 1S72T 1EIFA 4L6V5 4XTZA 5J39A 5FU6B 2KQWA 4OMFB 2A7YA 3OSSC 4XU3A 4A4HA 4A53A 2OTJA 2EQKA 3OB9A 4EMKC 2Y4YA 2CZ7B 3PTAA 4NL3A 1VQ7T 2FB7A 2EQJA 2XKOC 4M78F 3JCMb 2LT1A 1YJ9T 1HK9A 1VQKT 3CD6T 4M7AD 4J6YA 4XQ3A 1VQOA 5FRMA 2DTHA 5I2SA 3HP9A 2QQ9A 1YJWA 3MP8A 3CMET 3M54A 2NLUA 3E9FA 4OB3B 5DLQE 4JLGA 5LJ3e 3OYNA 4M7DC 3QHSA 1U1SA 1BIAA 1WQWA 2JTFA 3OYCA 4UC4A 3CCMA 2DD5A 3J81E 4RCCA 4J83A 3P8HA 3QG1A 4NL2A 3CPWA 4E7JA 1OI1A 2AHJB 1ZBXA 4IUVA 1FX7A 1NPPA 1VQ5T 3RESA 4ATOA 1YHQA 4IUQA 3HPWA 3F70A 4M75B 2GF7A 3VV0A 3OMCA 4XU0A 1QVPA 4C8QG 3I56T 5J3BA 5GMKm 4BDZA 4DOVA 2CZ1B 3Q1JA 1B34B 2HD0A 4FL6A 3OYDA 1VQNT 3GIBA 4PJOA 2E41A 4E7HA 1G3SA 3MP1A 2QA4T 5GAN4 4OGCA 4XK8E 1Q82U 4VUBA 3V7RA 1OZ3A 2PUKB 4JRPA 4PJOE 3VUBA 2RHUA 4X34A 1KD1C 2E6NA 3RKXA 3OBWA 2V8KA 4M78C 4PNOA 4ZTFA 3CC4A 3V8KA 2K3XA 3CMEA 1YCYA 4HA8A 2ZPFB 1VQMA 2KVQG 5KE2A 2K5IA 3GNGA 3OS1A 4MDWA 3X26B 2BIVA 3CPWS 3CCQT 2LC4A 4JS5A 4PJOG 3JCMJ 4M7DB 2DAQA 3WXMB 4O5VA 4MMKA 4O6JA 2PVDB 3OS0A 2K57A 4OGEA 1M1FA 2RI5A 2JNGA 4M77A 3NTIA 3HSBA 5LJ5e 3V8LA 3CBPA 3HRUA 1M90U 4J5YA 5GAOr 1OZ2A 4GY5A 3DLLA 5GAOm 2BUDA 5GAN8 3CMAT 5LJ5g 3JB9I 1KC8C 1K9MU 1G5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH0 A;  1WGS A;  3DB3 A;  4II1 A;  2P0K A;  2L3R A;  4E7I A;  3MO8 A;  2EQM A;  5IN1 A;  2QQS A;  3SD4 A;  2K3Y A;  4NS5 A;  3MEV A;  5C6S A;  2R5M A;  3P8D A;  3PMT A;  2O4X B;  3QBY A;  3OYG A;  5IAY A;  3S3O A;  4IUT A;  4OVA A;  4C5I A;  2GFA A;  4EDU A;  3OYK A;  4N4H A;  5FRO A;  2BKD N;  2LRQ A;  2X4W A;  3OYM A;  3GOX A;  3LYI A;  3MP6 A;  3PFS A;  2EKO A;  2RJD A;  2LCC A;  3DLM A;  4BD3 A;  5M9O A;  4L59 A;  3L2Q A;  2M1H A;  4BE0 A;  3MEU A;  4PLL A;  3OYF A;  2GFU A;  2X4X A;  2L8D A;  3LLR A;  3OQ5 A;  3MEA A;  3QJ6 A;  3UWN A;  1XNI A;  4PLI A;  2X4Y A;  4FU6 A;  3PMI A;  4Q5W A;  4A4F A;  3FC3 A;  2MWO A;  3DB4 A;  3LGF A;  4IUP A;  5C0M A;  3LGL A;  3OA6 A;  2DIG A;  3ME9 A;  2X35 A;  3M9Q A;  1WJR A;  2RO0 A;  5J39 A;  2F5K A;  2MWP A;  2RHY A;  4A4H A;  3OYL A;  2EFI A;  4IUR A;  2EQK A;  3OB9 A;  3OYE A;  2WAC A;  3NTK A;  1KHC A;  3FEO A;  2EQJ A;  4B9W A;  4QQ6 A;  3O8V A;  2R58 A;  2R57 A;  1H3Z A;  3FDR A;  5FRM A;  3S3N A;  2O4X A;  3OS2 A;  3MP8 A;  2NLU A;  3E9F A;  3OYN A;  2VYT A;  2JTF A;  5KCO A;  3UT1 A;  3OYC A;  4UC4 A;  2RHZ A;  5CIU A;  4BDY A;  2QQR A;  1WJQ A;  2JZ2 A;  3MEW A;  2LDM A;  1RI0 A;  3P8H A;  4E7J A;  2RJE A;  1OI1 A;  2RI3 A;  4N4I A;  4PL6 A;  4IUV A;  4QQG A;  5D6X A;  3ZEH A;  3ASK A;  3CEY A;  4C5H A;  3S3M A;  4IUQ A;  2R5A A;  3OMG A;  2RJC A;  3F70 A;  2FHD A;  2GF7 A;  3OMC A;  3L2R A;  2PQW A;  3L2W A;  4B9X A;  4E7L A;  3S6W A;  3H8Z A;  3OYB A;  1OYX A;  2RHI A;  4E7K A;  2IG0 A;  1N27 A;  2HQE A;  3L2U A;  4IKF A;  2XDP A;  4BDZ A;  3L42 A;  3Q1J A;  4CRI A;  4FL6 A;  4C5G A;  1MHN A;  4RG2 A;  3OYD A;  4BE2 A;  3KUF A;  4E7H A;  2DIQ A;  3OYH A;  2L89 A;  3MP1 A;  4ZTJ A;  4C5E A;  3H6Z A;  4LD6 A;  2CKK A;  3NTH A;  1OZ3 A;  3QKJ A;  5D6Y A;  2RHU A;  4X34 A;  2HQX A;  2E6N A;  5KE3 A;  4QW2 A;  3FLG A;  2G3R A;  4ZTF A;  2RI2 A;  2K3X A;  2E5Q A;  2RHX A;  1SSF A;  5KE2 A;  5D6W A;  5KH6 A;  2M0O A;  3OS1 A;  4BAC A;  3OYJ A;  2BIV A;  2EQU A;  2XK0 A;  2LTO A;  4HCZ A;  3BDL A;  2DAQ A;  5J26 A;  4IUU A;  3OS0 A;  3OYA A;  3L2V A;  1WJS A;  3OYI A;  4BE1 A;  4QQD A;  4A4E A;  3PNW C;  3LX7 A;  2RI5 A;  3NTI A;  2RJF A;  3MET A;  3EAE A;  4QVZ A;  3E9G A;  3OY9 A;  2YRV A;  2M16 A;  1OZ2 A;  5KCH A;  4GY5 A;  3QII A;  4A4G A;  4Z02 A;  3C4S A;  2LVM A;  2BUD A;  5FRN A;  1G5V A;  2D9T A;  4N4G A;  2B8A A; 
#chains in the Genus database with same CATH topology
 1NEB A;  1JEG A;  1D09 B;  1VQM T;  1KD1 U;  4FT4 A;  2GTJ A;  2DEQ A;  4HVU A;  3RNJ A;  1TXQ A;  1KD1 R;  1S72 Q;  2J06 A;  4N4H A;  1VQN A;  2CT3 A;  4BE0 A;  2X4X A;  2D0N A;  3BY7 A;  4M7D E;  1ARK A;  4F14 A;  3C95 A;  4J9D A;  3RKY A;  1E6H A;  2GCX A;  3DKM A;  4JDS A;  2RHY A;  2EFI A;  5GAN 3;  2J6F A;  2KRM A;  4C0D C;  5IHN A;  1D1A A;  4X9C A;  1IGU A;  3G1J A;  2R57 A;  3VS3 A;  4L5G A;  3A98 A;  1H3Z A;  4CI0 C;  2K2M A;  3OBY A;  2EPD A;  3FRN A;  1Q86 C;  3E2U A;  1VQ7 A;  1AVZ C;  2ZPG B;  2VVK A;  4MZP A;  3ZEH A;  5GMK l;  2R5A A;  2CZ0 B;  3FJP A;  3L2R A;  3G6E Q;  3VU3 C;  4ZN1 A;  3G4S T;  3S6W A;  1TU0 B;  4LNP A;  1OQK A;  2JXB A;  5GAN 5;  1Q7Y R;  5EC7 A;  3X20 B;  4KUD K;  2RPN A;  2DJQ A;  4JZ3 A;  4RTZ A;  5FWC A;  5GAN j;  1U8R A;  2RHX A;  3HHT B;  3JB9 H;  5D6W A;  4YTL A;  2M0O A;  2VGN A;  3FB9 A;  3BDL A;  3QDF A;  1FWZ A;  2DPP B;  1K8A U;  2KY9 A;  2RJF A;  3M56 A;  1N9R A;  1UE9 A;  2O9V A;  3RBB B;  4A4G A;  3C4S A;  5FRN A;  1Q86 R;  2H3J A;  2P4T A;  1VQ6 A;  3DB3 A;  2DL8 A;  5GAN 7;  3EGD A;  1QVF S;  1M5Q 1;  1TOV A;  3LW5 E;  3SDZ A;  2LP5 A;  3I55 Q;  2QGG A;  5GMK i;  3S3O A;  4C92 B;  3PE0 A;  3QXE B;  1RAF B;  3OW2 P;  2HDA A;  1D0Y A;  1OOT A;  3I56 Q;  3HRS A;  3L2Q A;  1W6X A;  1X01 A;  3J7A F;  4JZ4 A;  1VQ4 T;  2DKG A;  2GQI A;  5AT1 B;  1QVF P;  2AKL A;  4D8K A;  2E65 A;  3HKS A;  1SEM A;  1YBY A;  1M8V A;  2ZPB B;  2JVV A;  5GAN e;  2SRC A;  2DZC A;  4QQ6 A;  1OPK A;  4LDY A;  1BCM A;  3G71 T;  4C8Q C;  4Y91 A;  2NYS A;  4FW2 A;  3UT1 A;  2YT6 A;  4M4Z A;  4OB0 B;  2JZ2 A;  3MEW A;  3CME Q;  2P4R A;  3N5B B;  1J3T A;  3OW2 S;  2E5K A;  2LQK A;  1NJI U;  1VQP Q;  3CEY A;  1LVK A;  3S3M A;  4BY6 C;  3CCV A;  1Y0M A;  3QWX X;  1QP2 A;  3V7C A;  3H8Z A;  1OYX A;  1CKB A;  2XDP A;  3L42 A;  3M0Q A;  3J80 E;  1IGQ A;  1GBQ A;  3H6Z A;  4LD6 A;  2QAS A;  2KMT A;  2CGH A;  4DBH A;  4C8Q A;  3AT1 B;  1ZA1 B;  1G3Y A;  1RL2 A;  1FMK A;  5HY6 A;  4BAC A;  1WHH A;  3CC7 Q;  1ZBJ A;  4LUE A;  4IUU A;  4AFQ C;  2HKQ B;  2GQV A;  5GAM g;  4RTT A;  4FSS A;  2KI7 A;  1QP3 A;  3PNW C;  3CCR T;  3E9G A;  3WVD B;  2ENM A;  1Q81 C;  5CKF A;  1TG0 A;  2DA9 A;  5I21 A;  4HKE A;  2CUD A;  1MV3 A;  4F7U A;  1VQ4 A;  4ELZ C;  3LWH A;  1AOJ A;  1BI2 A;  5GJW B;  3CD6 A;  3CBM A;  2E70 A;  1VQ9 T;  1VQK A;  2QA4 A;  2F69 A;  4M77 C;  5GAN 6;  2LNH B;  2PUO B;  2R5M A;  2VXE A;  5IAY A;  3JB9 G;  3FJ5 A;  3FIF A;  1I81 A;  2RJD A;  2MAM A;  2LQW A;  1O9S A;  3M59 A;  3CCQ A;  3CC7 T;  1OX9 A;  4LDX A;  1ZSZ A;  4EMK A;  1YIT Q;  4F7U E;  3INZ A;  2QDL A;  2RO0 A;  3MPU B;  2VWF A;  3GBQ A;  1VQ8 A;  1XOV A;  1K9M R;  1YN8 A;  3A8L B;  3CCL A;  3A5Z B;  4V2S A;  1WHJ A;  4RTW A;  3D7S B;  4E7S A;  5AYF A;  2L2P A;  2NUP B;  3HRT A;  1VQ9 Q;  1VQP A;  3P8B B;  3OS2 A;  1SSH A;  4BDY A;  1K0S A;  3E19 A;  5I2M A;  3CCM T;  5CKB A;  2RI3 A;  4PL6 A;  4J6W A;  3UDC A;  3H0F A;  3VS5 A;  1B34 A;  1VYT A;  2A08 A;  4OMP A;  4WF2 A;  2PQW A;  4C0G A;  2DZ9 A;  2RHI A;  3HFN A;  1U1T A;  2YDL A;  4BUG A;  4M75 F;  1I07 A;  2MCN A;  1PRL C;  1JJ2 P;  2HNI A;  1VA7 A;  2XIC A;  4C0Z A;  2HQX A;  2MPX C;  4MML A;  5LJ5 j;  3FLG A;  1XTD A;  1OEB A;  1NG2 A;  1RUW A;  5GAM d;  2EQU A;  2XK0 A;  4LUD A;  2W10 A;  1TWB A;  3A8M B;  4ELY C;  1M2V A;  1G2B A;  3QYG B;  3MET A;  1UDL A;  2EGC A;  4DQ2 A;  2HBW A;  4GLM A;  2KT8 A;  3ULR B;  3X25 B;  2B8A A;  1MV0 B;  1PCX A;  4XTW A;  2NUZ A;  1LNX A;  3EGX B;  1HYO A;  2GBQ A;  2KAF A;  2O9S A;  4OML A;  4XTY A;  4PFZ A;  2QGF B;  1GFD A;  4JUV A;  2JMC A;  4EDU A;  1GCQ C;  2E3H A;  3H0H A;  4X1V A;  2HSP A;  4M7A C;  2KBT A;  4RKU E;  4JRK A;  2EKO A;  4C92 G;  2HAX A;  1UGQ B;  2DO3 A;  3QYH B;  2DBK A;  4FU6 A;  1K1Z A;  5CCA A;  1K8A R;  2FO0 A;  4KH1 B;  2HZY A;  3JCM Q;  1IO6 A;  2KQW A;  4OMF B;  3C0C A;  4XU3 A;  3OB9 A;  2Y4Y A;  4NL3 A;  1VQ7 T;  1VQK T;  1HK9 A;  1VQO A;  1YJW A;  5DLQ E;  3OYN A;  1GFC A;  5KYU A;  2CSI A;  1ZUY A;  3EG3 A;  4UC4 A;  3H9N A;  2ATC B;  1WFW A;  3J81 E;  4NL2 A;  3P8H A;  2AHJ B;  1ZBX A;  1FX7 A;  4ATO A;  3HPW A;  2RMO A;  4XU0 A;  2EYX A;  5J3B A;  4D8D A;  3RR6 A;  2BZX A;  3M0R A;  3OYD A;  4E7H A;  2CRE A;  1YJN Q;  5GAN 4;  4XK8 E;  1Q82 U;  1RAD B;  3V7R A;  3VS4 A;  2PUK B;  1YNZ A;  4JRP A;  2E6N A;  2IPO B;  2GGR A;  2NUT A;  3CPW S;  1D0Z A;  2LC4 A;  4JS5 A;  2X51 A;  3OS0 A;  2K57 A;  5KYY A;  1WX6 A;  1V76 A;  3NTI A;  1OZ2 A;  1YCS B;  4JJB A;  2FPF A;  1TS9 A;  2DF6 A;  1XJW B;  3JCM d;  1K73 C;  1VQ9 A;  5IN1 A;  1B07 A;  2DIL A;  4RUG A;  2MK5 A;  2A37 A;  3X24 B;  3P8D A;  5CAI A;  1SRM A;  2DL5 A;  1MND A;  3CCR A;  1YWP A;  2SEM A;  4PFO A;  1CSK A;  4M7D F;  1BI0 A;  1VQM Q;  3UPU A;  4PLL A;  3LLR A;  3E1S A;  3PMI A;  3CQT A;  4Q5W A;  1KC8 U;  3BW1 A;  1VYU A;  4IUP A;  2D6F A;  1SG5 A;  3VYH B;  4M78 D;  3JRZ A;  4C8Q B;  3M0P A;  2ROL A;  4J9I A;  1H92 A;  2RA2 A;  1FYN A;  4PFP A;  5KYX B;  1N8R C;  1NE8 A;  4RTX A;  3EGX A;  1VQL A;  2L3S A;  1Z9Z A;  3A1P A;  5IHK A;  4KH0 B;  2LZ6 B;  1OU9 A;  1KJW A;  1D0X A;  1VIF A;  2FHD A;  3JCM c;  1SHG A;  2L3Q A;  1MMD A;  4PKC C;  3EFO A;  1M2O A;  2K6D A;  4EMH A;  2EW3 A;  2HQE A;  5LJ5 d;  2JTM A;  4CRI A;  4QVC A;  3VS1 A;  5LJ3 j;  1I5L A;  2CUB A;  2DRM A;  2DXC A;  3CCE A;  2OX7 A;  1X6B A;  1M1K U;  3CXC S;  5CQY A;  3ZBD A;  1ZUU A;  5GAO n;  2EJ9 A;  1VYV A;  5GAO q;  1GCQ A;  1GBR A;  4PJJ A;  2E12 A;  1LPL A;  1ABQ A;  1PG5 B;  1SRL A;  4MZT A;  2P0P A;  1VIE A;  2WSC E;  2L3R A;  1W2B S;  2EVR A;  5KYW A;  1BB9 A;  1WIE A;  1PD0 A;  1EZZ B;  2O4X B;  4PJO B;  4M7D G;  2EGA A;  2JMA A;  2FRY A;  1IRE B;  2KRN A;  2DTO A;  2BKD N;  3ER0 A;  5A0D A;  2QA4 T;  2JT4 A;  1RAI B;  3MEU A;  1R0C B;  4J6X A;  3CCS A;  1GXI E;  4FIB A;  4BI3 A;  4OMO A;  3A8O B;  4WCI A;  1ABO A;  4Z88 A;  3DB4 A;  4OMN A;  1JRI A;  5A0L A;  1RAA B;  1TTH B;  2RQV A;  3M9Q A;  4A4K A;  2XDD A;  2KR3 A;  3FEO A;  2DXT A;  4IIO A;  1M1G A;  4AG2 C;  5KCO A;  4M78 E;  2CDT A;  2JS0 A;  4PK4 A;  3VYG A;  1X27 A;  1VQK Q;  2IVW A;  4J7F A;  1M3C A;  2BE7 D;  2VGM A;  5A2Q E;  3PT9 A;  2K4Y A;  2FL7 A;  2QAZ A;  1UGP B;  2DM1 A;  4C92 D;  1V1C A;  3VUZ A;  4KUL A;  3KBG A;  2J05 A;  4C8Q D;  2KXD A;  2VB6 A;  2RN8 A;  2RK2 A;  3IQL A;  3OYJ A;  1QVG A;  4HCZ A;  5J26 A;  1S1N A;  3UA6 A;  1FMV A;  2RQR A;  4K11 A;  1TUC A;  3EAE A;  2YRV A;  2M16 A;  5KCH A;  3CCR Q;  2LX9 A;  4M77 G;  3V8J A;  1M8M A;  1VQ7 Q;  3L2Z A;  3CXC A;  1HXD A;  2D9T A;  4AMC A;  1Q7Y C;  2EYY A;  4II1 A;  4E7I A;  2ZPE B;  1YJ9 A;  3CCV Q;  1W4S A;  2F2V A;  4J9F A;  3JB9 F;  2JM8 A;  2RQW A;  5HK0 A;  1R77 A;  3MCA B;  4M75 G;  4ANJ A;  5GAN h;  1SKU B;  1U5S A;  2M51 A;  2CT4 A;  4J8O A;  5M9O A;  1KQ1 A;  4KT0 E;  3SWN A;  1QQJ A;  4MZM A;  1NJI C;  3OQ5 A;  3UWN A;  1NM7 A;  1VQ6 T;  4XTX A;  1T3S A;  3CCV T;  1KQS S;  2MMP A;  2HKN A;  4JPB W;  1WJR A;  2DMO A;  2RK1 A;  5CVI A;  4IIM A;  1YJN A;  1I1J A;  3OYL A;  1ZX6 A;  4B9W A;  3JAM E;  3I56 A;  2WSE E;  1H3H A;  3NMZ C;  2JTE A;  2KSS A;  4M7A F;  4M78 B;  4M7A G;  4BB7 A;  5IH2 A;  2FRW A;  4AFS C;  4QQG A;  4N4I A;  1NLO C;  5GAN 2;  2NWM A;  2KEA A;  1N6A A;  3REB B;  2L0A A;  4E7L A;  4E7K A;  3CCS T;  2FG0 A;  4DBF A;  1N27 A;  4C8Q F;  1KC8 R;  1KQS P;  2X4J A;  1WHK A;  4A54 A;  3U23 A;  4C5E A;  2AZS A;  3QKJ A;  1MUZ A;  3OW2 A;  1WXT A;  4PJO C;  1Y96 A;  2F1L A;  2LCS A;  1VQL Q;  4JJN K;  2G3R A;  4M77 B;  1QKW A;  2DD4 A;  2VAS A;  4KUI A;  1RLP C;  3M53 A;  4RTV A;  1OX8 A;  1Y57 A;  2YRC A;  1WJS A;  1HD3 A;  4BI8 B;  1NYG A;  4QVZ A;  1YI2 Q;  3H0I A;  2LJ0 A;  4F7U G;  2LVM A;  2AZV A;  4TVR A;  2K79 A;  2M0Y A;  3JB9 D;  3G6E A;  1VQP T;  2VXF A;  1EFN A;  4C92 C;  2KGT A;  3M4G A;  4R55 A;  2XU8 A;  2EJF A;  1ZHI A;  1BI1 A;  2DVJ A;  3JV3 A;  3CPF A;  4E7Z A;  3EG0 A;  9ATC B;  2PVG B;  5GAN d;  2FVU A;  1KSW A;  1TUG B;  2COW A;  3GOX A;  2LCC A;  4M7A B;  2M1H A;  4F16 A;  2EQI A;  3OYF A;  1Q81 U;  2X4Y A;  4HVV A;  3FC3 A;  3BDU A;  1Y71 A;  4M78 A;  1LCK A;  1TSF A;  1S72 T;  4L6V 5;  4XTZ A;  5FU6 B;  1UJY A;  4A4H A;  2A7Y A;  1IHV A;  4AFU C;  2CZ7 B;  2FB7 A;  3CD6 T;  1NBE B;  2HQH A;  2FEI A;  2C0O A;  3HP9 A;  4J9G A;  3MP8 A;  3CME T;  3M54 A;  1RI9 A;  2CH4 W;  5FWB A;  1U1S A;  1WQW A;  2ROT A;  3CCM A;  2DD5 A;  4RCC A;  4E7J A;  1OI1 A;  4Y92 A;  4FYW B;  1NPP A;  3F70 A;  4M75 B;  3OMC A;  1NEG A;  1NYF A;  4KGX B;  2C0T A;  1YJ9 Q;  2KT1 A;  2PNI A;  5GMK m;  1B34 B;  3CCL Q;  1VQN T;  4PJO A;  3MP1 A;  1AD5 A;  2RHU A;  1KD1 C;  2YUQ A;  1PD1 A;  2GNC A;  4PNO A;  1C0M A;  3VS2 A;  2KVQ G;  3OS1 A;  1UHF A;  4MDW A;  3CCQ T;  2BIV A;  4RTU A;  3JCM J;  3WXM B;  4O5V A;  4MMK A;  2PVD B;  2GTO A;  4M77 A;  3V8L A;  1ZUK A;  1M90 U;  1UJ0 A;  4GY5 A;  1BU1 A;  5GAO m;  3TSZ A;  2BUD A;  3I5S A;  1N5Z A;  4ESR A;  3JB9 I;  3GNF B;  3JCM W;  4M75 E;  2YWW A;  4DOW A;  2C0I A;  2EQM A;  3SD4 A;  1WZO A;  1PSF A;  3QUI A;  4JS4 A;  2HSE B;  3A8H B;  5CKD A;  4M77 F;  1VQ4 Q;  1FMW A;  2EGE A;  1QMC A;  4ZGJ B;  4GBQ A;  2M9U A;  2KRS A;  1WI7 A;  3HFO A;  2RQT A;  5GMK e;  4AFZ C;  1Q86 U;  2KYB A;  1QCN A;  1M2V B;  3GLX A;  2PVO B;  4HCC A;  4FSX A;  4OB2 B;  1K9M C;  2MWO A;  1ZLM A;  3LGF A;  1ZSG A;  3NGP A;  5C0M A;  1VQ5 A;  5GAM f;  1UB4 A;  1RAB B;  2MWP A;  1X6O A;  1QKX A;  3M55 A;  1Z9Q A;  1OV3 A;  1HJD A;  2JN0 A;  4FT2 A;  1Y96 B;  3CC2 Q;  2DYI A;  2DVE A;  3SB2 A;  2CZ6 B;  2K2V A;  1IRX A;  5A0G A;  2A28 A;  2HL3 A;  1T0J A;  1AHJ B;  3ASK A;  1PRM C;  2CP3 A;  3RMS A;  3L2W A;  1OUL A;  3G71 Q;  5KYW B;  4JRQ A;  5I22 A;  2G6F X;  2DK3 A;  4RG2 A;  2CYZ B;  3I5R A;  4ZTJ A;  2CKK A;  2AIR B;  2DX1 A;  3R6N A;  5FW9 A;  4XTU A;  4FYV B;  2LQ8 A;  1WDX A;  3PGG A;  5HCK A;  1D1B A;  1AZG B;  3G4S A;  3CCU A;  2EWN A;  5L8R E;  2QEX A;  5GAN g;  4Z02 A;  2X3X D;  1VQL T;  3EG2 A;  4M77 D;  3I55 A;  3HTR A;  2JOY A;  2VKN A;  3MEV A;  3RKW A;  2V1R A;  5GJV B;  3V7S A;  1VQ6 Q;  5GAM j;  1G83 A;  3OYG A;  1JU5 C;  1JJ2 A;  3OYK A;  2CP6 A;  2XMF A;  2AT1 B;  2F5T X;  4M7D A;  1NPR A;  3PFS A;  1K8A C;  4BD3 A;  3G7Z A;  1M4Z A;  1YFN A;  2O31 A;  2K7A A;  4L59 A;  2DJZ A;  2ED0 A;  2DFU A;  5KYX A;  3MEA A;  3RMQ A;  5CO7 A;  5GMK j;  1KFZ A;  3MJX A;  2KE9 A;  1W2B A;  2VUB A;  5LJ3 f;  4EIK A;  1Y07 A;  2DNU A;  4HVW A;  3M58 A;  2LJ3 A;  3OYE A;  4RCB A;  2WAC A;  3VJP A;  1KHC A;  4E47 A;  4KRT A;  5L23 A;  3O8V A;  2OTL A;  2BZ8 A;  2R58 A;  4LDV A;  1ZSZ B;  4EMK B;  2QK0 A;  3M57 A;  1WJQ A;  1BK2 A;  1BI3 A;  3M4Y A;  1M90 C;  3EHQ A;  1MMA A;  2L5Q A;  4J7I A;  2J6K A;  1PSE A;  2IG0 A;  3TQ7 P;  5LJ3 h;  2EAY A;  4BE2 A;  4C5G A;  1MHN A;  4FM4 B;  1UGS B;  5ECA A;  3OYH A;  3NTH A;  1U3O A;  4QW2 A;  1PWT A;  3EG1 A;  4F7U B;  1G3T A;  4M75 D;  1QVG P;  3CCM Q;  1SSF A;  4OB1 B;  1H8K A;  2RD1 A;  3URG A;  3O5Z A;  1JB0 E;  4LXC A;  1X6G A;  3OY9 A;  2F2X A;  2C06 A;  2D0Q B;  3CXC P;  1WPY A;  4HT8 A;  1OPL A;  2Z0W A;  1V29 B;  5I11 A;  4XU1 A;  3PVQ A;  3MO8 A;  2QQS A;  5LJ3 d;  5GAO l;  1YWO A;  3TVT A;  1BIB A;  5C6S A;  2ESW A;  2CH4 A;  2YHT A;  3QZ5 B;  5CKH A;  2YUN A;  3ZFJ A;  3CCE Q;  2LNV A;  2GFA A;  1UGR B;  2CS7 A;  4M75 A;  4DEY A;  2ZPH B;  3MP6 A;  2NUP A;  4KBM B;  3EGU A;  3CC4 T;  3OS5 A;  1D3B B;  5GAM e;  2Y4X A;  2AKK A;  2QEX T;  4IUR A;  2QQA A;  1YI2 A;  2RM4 A;  4M7A E;  1R0B G;  1RAH B;  2K5L A;  3QDR B;  1MMN A;  2DXB A;  4M75 C;  1YHQ T;  3PIP A;  4D6W A;  2CP5 A;  2DER A;  2ZCF B;  4XU2 A;  2QTX A;  2DXU A;  4F17 A;  5D6X A;  2LJ1 A;  2E64 A;  3CBO A;  1EX4 A;  1SHF A;  2H3E B;  3M5A A;  4LDW A;  1GCP A;  3M0T A;  2QG9 B;  3QO3 A;  1LJO A;  2MYS A;  3SFM A;  2HBP A;  2PTK A;  3TSW A;  1WNL A;  3VS6 A;  1N9S A;  1QLY A;  4EPC A;  1GRI A;  2E5Q A;  2YXY A;  4RMO A;  1PKS A;  3M0U A;  4J9C A;  2ZPI B;  3JCM f;  2FZC B;  4QQD A;  4J9E A;  4F7U F;  3I55 T;  3OYY A;  1GL5 A;  3QII A;  4HCB A;  3GF5 A;  5CR2 A;  4OP0 A;  3QZ9 B;  1BCO A;  1X75 C;  2ECZ A;  2K3Y A;  4NS5 A;  4AT1 B;  2Y90 A;  3VKI A;  3CCL T;  1VQN Q;  2WSF E;  1ACM B;  1D3B A;  1VQ8 T;  5GMK h;  3A8G B;  4WTO B;  5DM7 R;  1UFF A;  4FYY B;  3NFC A;  3WVE B;  4C5I A;  2CP2 A;  4OMM A;  1UG1 A;  3OYM A;  1NJI R;  4ME7 A;  2XI9 A;  4M7D D;  2B86 A;  4PJN A;  2EKH A;  1AWW A;  4M77 E;  2F2W A;  3EFO B;  3OA6 A;  1D1C A;  3ME9 A;  1EIF A;  4J9H A;  4QKU A;  2EQK A;  5KYU B;  1JXO A;  4M78 F;  3JCM b;  4KGV B;  2X9H A;  1YJW Q;  4J6Y A;  5FRM A;  2DTH A;  1VQO Q;  5I2S A;  2QQ9 A;  3BE3 A;  2NLU A;  3E9F A;  4M7D C;  4JLG A;  2JTF A;  1AT1 B;  3OYC A;  1WXB A;  2JJ9 A;  3QG1 A;  1PM3 A;  3THK A;  1AWJ A;  4IUV A;  3RES A;  1YHQ A;  4IUQ A;  3CCJ Q;  2GF7 A;  3VV0 A;  2YUP A;  2ZAE A;  1UEC A;  1RLQ C;  4F04 B;  3MKD A;  3Q1J A;  1VQ5 Q;  2HD0 A;  2FPE A;  2IIM A;  2E41 A;  3VRZ A;  4OGC A;  4PJO E;  1OZ3 A;  4Z8A A;  2V8K A;  3CC4 A;  2K3X A;  1YCY A;  2ZPF B;  2K5I A;  4CC2 A;  3EHR A;  3X26 B;  2HL5 C;  2DAQ A;  2DL4 A;  4OGE A;  1WYX A;  2RI5 A;  3HSB A;  3HRU A;  1KIK A;  2AK5 A;  2LX7 A;  4J5Y A;  5GAO r;  2YUO A;  1YIJ Q;  3RDV A;  3M0S A;  2O2O A;  5LJ5 g;  1KC8 C;  1AZE A;  2DEU A;  3ZL7 C;  1Q82 C;  3CC2 T;  1RAE B;  1M3A A;  3CCS Q;  2QQB A;  2LQN A;  1CKA A;  3CPW P;  2P84 A;  4OVA A;  2RNA A;  2DL7 A;  4LE9 A;  1ZA2 B;  2LRQ A;  2PU9 B;  3QSU A;  2ZGW A;  3LYI A;  2OI3 A;  1WXU A;  1TH7 A;  3UA7 A;  4OF1 A;  1QCF A;  2RB6 A;  5IT9 E;  2FYK A;  4A4F A;  1KQ2 A;  2D8J A;  3LGL A;  5KYY B;  2HMA A;  2X35 A;  4PJM A;  1MNE A;  2F5K A;  4E2F B;  4FCY A;  5CK9 A;  1XQH A;  4DBQ A;  1B3Q A;  2ED1 A;  1ZQ1 A;  4PJO F;  3I35 A;  1YJW T;  3JCM e;  4DA4 A;  2BTT A;  1O75 A;  1R8O B;  4MDX A;  5CIU A;  2OTJ T;  2QQR A;  2QDY B;  1JBM A;  2LDM A;  1W70 A;  5HKC A;  2O88 A;  1X2K A;  1NZ9 A;  2K3B A;  4HT9 A;  5CKE A;  1YIT A;  2YRD A;  5LJ5 f;  4B9X A;  5GAN f;  2YLC A;  1AWO A;  3OYB A;  2I0N A;  3CCQ Q;  2OTL T;  2EYZ A;  5IXB A;  1AWX A;  1I0C A;  4C0F A;  1W1F A;  7AT1 B;  2L89 A;  1QCO A;  4Y28 E;  2EYW A;  1I8F A;  1N8R U;  5HK3 A;  3SWN B;  2M02 A;  3PVL A;  4N0A C;  1UEB A;  3CD6 Q;  2DRK A;  5CQX A;  3G6E T;  4M7A A;  4BE1 A;  1X69 A;  2K9G A;  2E3I A;  1M27 C;  2JM9 A;  1QWF A;  3QWY A;  4X9D A;  4QT7 A;  2RF0 A;  2XID A;  4N4G A;  2KRO A;  4EMG A;  2KNB B;  3TCJ A;  3CC7 A;  4DBR A;  1BBZ A;  4JJD A;  1M1K C;  2D8H A;  2I2L A;  4XTV A;  1KQS A;  1LOJ A;  1PKT A;  2XD0 A;  2CP7 A;  4IUT A;  2CSQ A;  6AT1 B;  1WA7 A;  3PIO A;  2DYB A;  5FU7 C;  3JCM X;  2DE0 X;  2MOX A;  3DLM A;  1Q95 G;  4LN2 A;  3CCU T;  1BYM A;  4DEX A;  1M3B A;  1UUE A;  3JCM h;  5IHI A;  1K4U S;  4JLI A;  5IXF A;  1W2B P;  4HCK A;  2DIG A;  2QXF A;  4B6M A;  1QVF A;  4PJO D;  3CCE T;  1UHC A;  2QI2 A;  3MHX A;  1YP5 A;  1DJ7 B;  3CCJ T;  2EJG A;  1QW1 A;  1JJ2 S;  3S3N A;  4CC3 A;  1YIT T;  3C12 A;  3LWI A;  3X28 B;  2RHZ A;  4FW1 A;  2QEX Q;  2XDB A;  1YJN T;  1E6G A;  1FXX A;  2A3L A;  1PNJ A;  4P5N A;  3RUX A;  1M1K R;  1WLP B;  2L3P A;  3OMG A;  3AHU A;  2RJC A;  1UTI A;  4A63 B;  4NOY A;  3CCU Q;  3G4S Q;  2DLP A;  2E6Z A;  5LJ3 g;  3L2U A;  1KHI A;  1X2Q A;  5EG2 A;  2KK4 A;  2YLB A;  3OSV A;  3KUF A;  2DIQ A;  1PHT A;  3VS0 A;  2BZY A;  1I4K 1;  4C8Q E;  4KGZ B;  2DTI A;  2RH2 A;  2VV5 A;  2RI2 A;  2LT4 A;  2V8I A;  8ATC B;  1RAC B;  3EFR A;  3G71 A;  5KH6 A;  2KXC A;  4M78 G;  2P0Q A;  5GAM h;  1G3W A;  4HXJ A;  1H64 1;  3QJY A;  3LX7 A;  1QWE A;  3R6O A;  5DY9 A;  4CC4 B;  3RER A;  8AT1 B;  2PZ1 A;  4RG8 A;  4BY6 B;  4JRI A;  2JW4 A;  3LH0 A;  1WGS A;  1E7O A;  2ZZD A;  2P0K A;  1AEY A;  3CC2 A;  2E1H A;  4QVD A;  3EH2 A;  1M30 A;  3CMA A;  1WHG A;  3PMT A;  3QBY A;  4Z89 A;  4RTY A;  2JUF A;  1QVG S;  1YIJ A;  3H41 A;  2RQU A;  2OAW A;  3GP8 A;  2J6O A;  2W0Z A;  2H8H A;  5FRO A;  5LJ5 h;  2X4W A;  2OTL Q;  1N8R R;  2EYQ A;  2X3W D;  3HL8 A;  4ZN3 A;  2L8D A;  3JCM g;  4C92 A;  1XNI A;  4PLI A;  1M90 R;  1NLP C;  3CC4 Q;  1Q7Y U;  1A0N B;  2QYZ A;  4ZGD B;  3UAT A;  4N0A A;  2KDS A;  2OTJ Q;  2VC8 A;  2XG8 D;  3EGD B;  1X43 A;  1WHL A;  3NTK A;  4GLK A;  2YSQ A;  3L1A A;  5GAO p;  3LH5 A;  3FDR A;  2D1X A;  2O4X A;  4ZNX A;  1KG1 A;  5FU6 C;  3BFM A;  2VYT A;  1G8X A;  3CCJ A;  1YHQ Q;  2EBP A;  1I5O B;  1JXM A;  3SWN C;  1RI0 A;  3VS7 A;  1K9A A;  2RJE A;  5DLO A;  2HEQ A;  4C92 E;  1Q81 R;  1WHM A;  1K76 A;  4C5H A;  3JCM V;  1JO8 A;  4XAX B;  4ZGE B;  3QPH A;  1WQ7 A;  2OJ2 A;  2DBM A;  4C92 F;  3JSC A;  3EH1 A;  1VQO T;  1VOM A;  4R56 A;  1K73 R;  1P92 A;  4LDU A;  1T3L A;  4IKF A;  4FYX B;  1IHW A;  3VRY A;  3EG9 A;  2NUT B;  1K73 U;  2V8J A;  1S72 A;  4E6R A;  5D6Y A;  5KE3 A;  2E10 A;  2OAU A;  1Y7X A;  2MIO A;  2LMJ A;  1RAG B;  4BI4 A;  2FPD A;  2COY A;  2LTO A;  2JS2 A;  3OYA A;  1KK7 A;  3L2V A;  3OYI A;  4A4E A;  2J7I A;  3TRE A;  2LCL A;  3SEM A;  1M9S A;  1IZ6 A;  2DET A;  3JB9 J;  3JCM P;  2ABL A;  5LL6 S;  1VQ8 Q;  1TUD A;  4LD9 K;  2HCK A;  1C6V X;  1BKB A;  1YI2 T;  1SPK A;  3KXT A;  2O01 E;  2EIF A;  3T9N A;  2QTV A;  1MGQ A;  3EG9 B;  4C0D B;  3TU4 K;  2FZK B;  1IXD A;  4J9B A;  2MI6 A;  2COZ A;  1IB8 A;  4JJC A;  2K5F A;  3TEE A;  2GFU A;  3QJ6 A;  4PJL A;  3C94 A;  2MF2 A;  1HSQ A;  4CC7 A;  2QA4 Q;  3NPF A;  3EFS A;  5FU7 B;  4AG1 C;  3GPL A;  1VUB A;  1OU8 A;  1YIJ T;  1JQQ A;  3RIR A;  5FLX E;  2XHC A;  5J39 A;  2E4H A;  3OSS C;  4A53 A;  2OTJ A;  1ZSZ C;  4EMK C;  1K0X A;  3PTA A;  4OMQ A;  3REA B;  2EQJ A;  2XKO C;  4M7A D;  2LT1 A;  1YJ9 T;  4XQ3 A;  2CP0 A;  4OB3 B;  5LJ3 e;  3QHS A;  1BIA A;  1MMG A;  2V1Q A;  4J83 A;  3CPW A;  1VQ5 T;  3I9Q A;  3CMA Q;  2A36 A;  1QVP A;  4C8Q G;  3I56 T;  3UF4 A;  4BDZ A;  1F1B B;  1SF9 A;  2CZ1 B;  4DOV A;  4FL6 A;  3GIB A;  5D7U A;  1G3S A;  3SHW A;  4VUB A;  2KYM A;  2DL3 A;  2V26 A;  3VUB A;  4X34 A;  3RKX A;  3OBW A;  2BE9 B;  4M78 C;  4ORZ A;  4ZTF A;  3NHN A;  3V8K A;  1B7T A;  2A0F B;  3CME A;  4HA8 A;  1VQM A;  5KE2 A;  3GNG A;  1U06 A;  1Q82 R;  4M7D B;  4PJO G;  1T0H A;  4O6J A;  1C1A A;  2FZG B;  3KFV A;  1PC0 A;  1M1F A;  2JNG A;  5LJ5 e;  4R0K A;  3CBP A;  5KYN A;  1UGV A;  3DLL A;  5GAN 8;  3CMA T;  1K9M U;  1G5V A; 
#chains in the Genus database with same CATH homology
 3GNF B;  3JCM d;  3JCM W;  1K73 C;  4M75 E;  4DOW A;  1VQ9 A;  2EQM A;  5IN1 A;  3SD4 A;  1Q82 C;  3CC2 T;  1PSF A;  3QUI A;  4JS4 A;  3X24 B;  1VQM T;  1KD1 U;  4FT4 A;  3A8H B;  5CKD A;  4M77 F;  2DEQ A;  3P8D A;  2QQB A;  4ZGJ B;  2M9U A;  5CAI A;  3HFO A;  5GMK e;  3CCR A;  4OVA A;  1Q86 U;  4M7D F;  4N4H A;  2LRQ A;  2PU9 B;  3QSU A;  1BI0 A;  2ZGW A;  1VQN A;  3LYI A;  3UPU A;  1TH7 A;  4BE0 A;  4PLL A;  4OF1 A;  2X4X A;  3GLX A;  3LLR A;  2RB6 A;  3BY7 A;  4M7D E;  3E1S A;  2PVO B;  5IT9 E;  4HCC A;  2FYK A;  3PMI A;  4FSX A;  4Q5W A;  4OB2 B;  4A4F A;  1KC8 U;  1K9M C;  3C95 A;  2MWO A;  3BW1 A;  3LGF A;  4IUP A;  1KQ2 A;  5C0M A;  3LGL A;  2D6F A;  3VYH B;  4M78 D;  3JRZ A;  3RKY A;  2GCX A;  1VQ5 A;  3DKM A;  5GAM f;  1UB4 A;  2X35 A;  4JDS A;  2F5K A;  2MWP A;  2RHY A;  4C8Q B;  5CK9 A;  1X6O A;  2EFI A;  5GAN 3;  2RA2 A;  3M55 A;  1XQH A;  4C0D C;  4X9C A;  2JN0 A;  1ZQ1 A;  4FT2 A;  4PJO F;  1YJW T;  2R57 A;  1Y96 B;  3JCM e;  4L5G A;  4DA4 A;  1H3Z A;  4CI0 C;  1N8R C;  2DVE A;  1NE8 A;  3FRN A;  3OBY A;  3SB2 A;  1VQL A;  1O75 A;  1R8O B;  1Q86 C;  4MDX A;  1VQ7 A;  2ZPG B;  5CIU A;  2OTJ T;  2CZ6 B;  2QQR A;  2K2V A;  1JBM A;  2QDY B;  2LDM A;  5A0G A;  4MZP A;  5HKC A;  3ZEH A;  5GMK l;  3ASK A;  1AHJ B;  3RMS A;  1NZ9 A;  4HT9 A;  2R5A A;  5CKE A;  1YIT A;  2CZ0 B;  3FJP A;  1VIF A;  2FHD A;  3JCM c;  5LJ5 f;  3L2R A;  3L2W A;  3VU3 C;  4B9X A;  4ZN1 A;  3G4S T;  5GAN f;  2YLC A;  4PKC C;  3S6W A;  3OYB A;  4JRQ A;  2OTL T;  4EMH A;  5LJ5 d;  2HQE A;  2DK3 A;  2JTM A;  4CRI A;  5GAN 5;  4RG2 A;  4C0F A;  4QVC A;  5LJ3 j;  2CYZ B;  1I5L A;  2DXC A;  2L89 A;  3X20 B;  4ZTJ A;  3CCE A;  4KUD K;  2CKK A;  4Y28 E;  1I8F A;  1M1K U;  3CXC S;  5CQY A;  1N8R U;  4XTU A;  5HK3 A;  3SWN B;  5GAN j;  3ZBD A;  2LQ8 A;  3PGG A;  2RHX A;  3HHT B;  1U8R A;  4N0A C;  3JB9 H;  5D6W A;  1UEB A;  4YTL A;  2M0O A;  2EJ9 A;  5GAO n;  3G4S A;  3CCU A;  2VGN A;  3FB9 A;  5CQX A;  3BDL A;  2EWN A;  1FWZ A;  5L8R E;  2DPP B;  3G6E T;  4M7A A;  5GAO q;  4BE1 A;  1K8A U;  2E12 A;  2KY9 A;  2RJF A;  3M56 A;  1N9R A;  2QEX A;  5GAN g;  4A4G A;  4X9D A;  3C4S A;  4Z02 A;  5FRN A;  4MZT A;  2P0P A;  2XID A;  1VQL T;  2H3J A;  2P4T A;  4M77 D;  4N4G A;  3I55 A;  4EMG A;  1VQ6 A;  3DB3 A;  1VIE A;  3TCJ A;  2WSC E;  2L3R A;  5GAN 7;  3CC7 A;  1W2B S;  2JOY A;  1QVF S;  3RKW A;  3MEV A;  1M5Q 1;  3LW5 E;  3V7S A;  3SDZ A;  1M1K C;  2I2L A;  5GAM j;  4XTV A;  1KQS A;  2O4X B;  1LOJ A;  3OYG A;  2XD0 A;  5GMK i;  3S3O A;  4PJO B;  1JJ2 A;  4C92 B;  4IUT A;  4M7D G;  3QXE B;  1IRE B;  3PIO A;  3OYK A;  2DTO A;  2BKD N;  2F5T X;  5FU7 C;  3JCM X;  4M7D A;  3ER0 A;  1NPR A;  3PFS A;  5A0D A;  1K8A C;  4BD3 A;  3DLM A;  1M4Z A;  3G7Z A;  3HRS A;  4L59 A;  3L2Q A;  4J6X A;  3MEU A;  2DJZ A;  3CCS A;  3CCU T;  1BYM A;  1X01 A;  3J7A F;  1GXI E;  4FIB A;  3MEA A;  4BI3 A;  3A8O B;  3JCM h;  1VQ4 T;  2DKG A;  3RMQ A;  5CO7 A;  5GMK j;  4JLI A;  3DB4 A;  1JRI A;  2E65 A;  2DIG A;  2QXF A;  5A0L A;  3HKS A;  3M9Q A;  4PJO D;  1W2B A;  2VUB A;  1YBY A;  3CCE T;  1QVF A;  2ZPB B;  5LJ3 f;  1M8V A;  1Y07 A;  4A4K A;  2QI2 A;  2XDD A;  3M58 A;  3MHX A;  3OYE A;  2JVV A;  4RCB A;  2WAC A;  3VJP A;  5GAN e;  1KHC A;  1DJ7 B;  3FEO A;  4E47 A;  2DXT A;  3CCJ T;  2EJG A;  1QW1 A;  2DZC A;  4QQ6 A;  3O8V A;  2OTL A;  4LDY A;  2R58 A;  1JJ2 S;  3G71 T;  3S3N A;  1M1G A;  4C8Q C;  4Y91 A;  1YIT T;  3C12 A;  3LWI A;  4LDV A;  3X28 B;  4EMK B;  5KCO A;  3UT1 A;  4M78 E;  2RHZ A;  3M57 A;  4OB0 B;  1WJQ A;  2JZ2 A;  3MEW A;  1YJN T;  2XDB A;  3VYG A;  3N5B B;  1FXX A;  2A3L A;  3OW2 S;  2LQK A;  1NJI U;  3CEY A;  4P5N A;  3RUX A;  3S3M A;  4BY6 C;  3CCV A;  1BI3 A;  2IVW A;  2RJC A;  3OMG A;  3AHU A;  4J7F A;  3M4Y A;  4NOY A;  1M90 C;  1QP2 A;  3V7C A;  2VGM A;  5A2Q E;  2L5Q A;  3PT9 A;  3H8Z A;  4J7I A;  1OYX A;  1PSE A;  2E6Z A;  2IG0 A;  5LJ3 g;  3L2U A;  2K4Y A;  1KHI A;  2FL7 A;  2XDP A;  2EAY A;  5EG2 A;  3L42 A;  5LJ3 h;  4BE2 A;  4C5G A;  1MHN A;  4FM4 B;  1UGS B;  1UGP B;  2KK4 A;  2YLB A;  3OSV A;  3KUF A;  4C92 D;  2DIQ A;  3J80 E;  3OYH A;  3H6Z A;  4LD6 A;  3NTH A;  1I4K 1;  3VUZ A;  4KUL A;  3KBG A;  4C8Q E;  2KMT A;  2CGH A;  4QW2 A;  4C8Q D;  2DTI A;  2RH2 A;  2VV5 A;  4C8Q A;  4F7U B;  2RI2 A;  1G3T A;  1G3Y A;  2LT4 A;  4M75 D;  1RL2 A;  2V8I A;  1SSF A;  3EFR A;  3G71 A;  5HY6 A;  5KH6 A;  2RK2 A;  4OB1 B;  4BAC A;  3OYJ A;  1QVG A;  2RD1 A;  4M78 G;  2P0Q A;  4HCZ A;  3URG A;  5J26 A;  1G3W A;  4IUU A;  5GAM h;  2GQV A;  5GAM g;  1JB0 E;  1QP3 A;  1H64 1;  3PNW C;  3QJY A;  3LX7 A;  3R6O A;  5DY9 A;  3EAE A;  3RER A;  3CCR T;  3E9G A;  3OY9 A;  2YRV A;  3WVD B;  2M16 A;  5KCH A;  2C06 A;  1Q81 C;  2D0Q B;  2LX9 A;  4M77 G;  4RG8 A;  5CKF A;  4JRI A;  3V8J A;  4BY6 B;  1WPY A;  5I21 A;  4HT8 A;  4HKE A;  3L2Z A;  3CXC A;  2D9T A;  1HXD A;  4F7U A;  1Q7Y C;  3LH0 A;  1WGS A;  4ELZ C;  3LWH A;  1V29 B;  1VQ4 A;  2ZZD A;  2P0K A;  4II1 A;  4E7I A;  3CC2 A;  2ZPE B;  4XU1 A;  3MO8 A;  1BI2 A;  2E1H A;  2QQS A;  3CD6 A;  5LJ3 d;  3CBM A;  1YJ9 A;  2E70 A;  1VQ9 T;  1VQK A;  5GAO l;  2QA4 A;  4PJO C;  1W4S A;  2F69 A;  4M77 C;  4QVD A;  1BIB A;  5C6S A;  2YHT A;  3QZ5 B;  5GAN 6;  3CMA A;  2PUO B;  2R5M A;  2VXE A;  5CKH A;  3JB9 F;  3PMT A;  3QBY A;  5IAY A;  2JUF A;  4M75 G;  3MCA B;  3ZFJ A;  5HK0 A;  1QVG S;  1YIJ A;  2LNV A;  5GAN h;  2GFA A;  3GP8 A;  1UGR B;  2CS7 A;  4M75 A;  3JB9 G;  5FRO A;  3FIF A;  5LJ5 h;  2X4W A;  1I81 A;  2ZPH B;  3MP6 A;  2RJD A;  4J8O A;  2MAM A;  5M9O A;  1KQ1 A;  1O9S A;  2EYQ A;  4KT0 E;  3HL8 A;  3SWN A;  3M59 A;  4ZN3 A;  3CCQ A;  4MZM A;  3CC7 T;  2L8D A;  3JCM g;  3OQ5 A;  4KBM B;  3UWN A;  4C92 A;  1NJI C;  1XNI A;  4PLI A;  4LDX A;  1VQ6 T;  4XTX A;  4EMK A;  3CC4 T;  3OS5 A;  4F7U E;  3INZ A;  1Q7Y U;  1D3B B;  3CCV T;  5GAM e;  2Y4X A;  4ZGD B;  1KQS S;  2MMP A;  2QEX T;  1WJR A;  2RO0 A;  4N0A A;  2KDS A;  2RK1 A;  2VC8 A;  2XG8 D;  5CVI A;  1YJN A;  1VQ8 A;  3OYL A;  1XOV A;  4IUR A;  3A8L B;  3NTK A;  2QQA A;  3CCL A;  4GLK A;  1YI2 A;  3A5Z B;  2RM4 A;  4B9W A;  3JAM E;  3L1A A;  5GAO p;  4M7A E;  5AYF A;  4V2S A;  3HRT A;  3I56 A;  2WSE E;  1VQP A;  3FDR A;  3P8B B;  2O4X A;  2K5L A;  3OS2 A;  1KG1 A;  3QDR B;  5FU6 C;  3BFM A;  2DXB A;  4M75 C;  1YHQ T;  2VYT A;  2KSS A;  3CCJ A;  4M7A F;  4BDY A;  4M78 B;  3PIP A;  4D6W A;  3SWN C;  4M7A G;  4BB7 A;  2ZCF B;  1RI0 A;  3E19 A;  4XU2 A;  5I2M A;  3CCM T;  2QTX A;  2DXU A;  2RI3 A;  2RJE A;  4N4I A;  4PL6 A;  4QQG A;  5CKB A;  5D6X A;  4C92 E;  5DLO A;  4J6W A;  3UDC A;  3JCM V;  4C5H A;  5GAN 2;  1B34 A;  4XAX B;  4ZGE B;  1N6A A;  3QPH A;  1WQ7 A;  4WF2 A;  2PQW A;  4C92 F;  3JSC A;  4C0G A;  1VQO T;  2E64 A;  4R56 A;  2DZ9 A;  3CBO A;  4E7L A;  2RHI A;  4E7K A;  3CCS T;  1P92 A;  4LDU A;  1N27 A;  4IKF A;  3M5A A;  3HFN A;  1U1T A;  4C8Q F;  4LDW A;  2X4J A;  4BUG A;  1K73 U;  4M75 F;  2V8J A;  3QO3 A;  4A54 A;  2HNI A;  1LJO A;  4C5E A;  1S72 A;  2XIC A;  3SFM A;  2HBP A;  4C0Z A;  3QKJ A;  5D6Y A;  3OW2 A;  2HQX A;  2E10 A;  1WNL A;  4MML A;  5KE3 A;  1Y96 A;  3FLG A;  1XTD A;  5LJ5 j;  2OAU A;  4JJN K;  1Y7X A;  2G3R A;  4M77 B;  1N9S A;  2DD4 A;  4KUI A;  4EPC A;  2E5Q A;  3M53 A;  4RMO A;  5GAM d;  4BI4 A;  2EQU A;  2XK0 A;  2LTO A;  3OYA A;  3L2V A;  1WJS A;  2ZPI B;  3A8M B;  4ELY C;  3OYI A;  4BI8 B;  3JCM f;  4QQD A;  4A4E A;  4F7U F;  3I55 T;  3TRE A;  2LCL A;  3QYG B;  3MET A;  4QVZ A;  1M9S A;  3OYY A;  1IZ6 A;  3JB9 J;  4DQ2 A;  3QII A;  4F7U G;  2LVM A;  3JCM P;  4TVR A;  5LL6 S;  4HCB A;  3GF5 A;  3X25 B;  5CR2 A;  2B8A A;  4LD9 K;  4OP0 A;  3QZ9 B;  3JB9 D;  3G6E A;  1VQP T;  2VXF A;  4C92 C;  1BKB A;  1X75 C;  4XTW A;  1LNX A;  2K3Y A;  4NS5 A;  3M4G A;  4R55 A;  1YI2 T;  2XU8 A;  2EJF A;  2Y90 A;  1ZHI A;  1BI1 A;  3VKI A;  3CCL T;  2KAF A;  3CPF A;  2WSF E;  3KXT A;  1D3B A;  4XTY A;  2O01 E;  1VQ8 T;  5GMK h;  2EIF A;  3A8G B;  3T9N A;  1MGQ A;  4C0D B;  5DM7 R;  3TU4 K;  4JUV A;  3NFC A;  2PVG B;  3WVE B;  5GAN d;  4C5I A;  2FVU A;  4EDU A;  2MI6 A;  4M7A C;  2K5F A;  3OYM A;  3GOX A;  4RKU E;  4JRK A;  2EKO A;  2LCC A;  4M7A B;  3TEE A;  4C92 G;  2M1H A;  4ME7 A;  2HAX A;  3OYF A;  1UGQ B;  2DO3 A;  2GFU A;  2XI9 A;  3QJ6 A;  3QYH B;  1Q81 U;  2X4Y A;  3C94 A;  4FU6 A;  2MF2 A;  4M7D D;  4M77 E;  5CCA A;  3FC3 A;  3BDU A;  3EFS A;  1Y71 A;  5FU7 B;  3GPL A;  4M78 A;  3OA6 A;  1VUB A;  1YIJ T;  3ME9 A;  3RIR A;  5FLX E;  3JCM Q;  2XHC A;  1S72 T;  1EIF A;  4L6V 5;  4XTZ A;  5J39 A;  5FU6 B;  2KQW A;  4OMF B;  2A7Y A;  3OSS C;  4XU3 A;  4A4H A;  4A53 A;  2OTJ A;  2EQK A;  3OB9 A;  4EMK C;  2Y4Y A;  2CZ7 B;  3PTA A;  4NL3 A;  1VQ7 T;  2FB7 A;  2EQJ A;  2XKO C;  4M78 F;  3JCM b;  2LT1 A;  1YJ9 T;  1HK9 A;  1VQK T;  3CD6 T;  4M7A D;  4J6Y A;  4XQ3 A;  1VQO A;  5FRM A;  2DTH A;  5I2S A;  3HP9 A;  2QQ9 A;  1YJW A;  3MP8 A;  3CME T;  3M54 A;  2NLU A;  3E9F A;  4OB3 B;  5DLQ E;  4JLG A;  5LJ3 e;  3OYN A;  4M7D C;  3QHS A;  1U1S A;  1BIA A;  1WQW A;  2JTF A;  3OYC A;  4UC4 A;  3CCM A;  2DD5 A;  3J81 E;  4RCC A;  4J83 A;  3P8H A;  3QG1 A;  4NL2 A;  3CPW A;  4E7J A;  1OI1 A;  2AHJ B;  1ZBX A;  4IUV A;  1FX7 A;  1NPP A;  1VQ5 T;  3RES A;  4ATO A;  1YHQ A;  4IUQ A;  3HPW A;  3F70 A;  4M75 B;  2GF7 A;  3VV0 A;  3OMC A;  4XU0 A;  1QVP A;  4C8Q G;  3I56 T;  5J3B A;  5GMK m;  4BDZ A;  4DOV A;  2CZ1 B;  3Q1J A;  1B34 B;  2HD0 A;  4FL6 A;  3OYD A;  1VQN T;  3GIB A;  4PJO A;  2E41 A;  4E7H A;  1G3S A;  3MP1 A;  2QA4 T;  5GAN 4;  4OGC A;  4XK8 E;  1Q82 U;  4VUB A;  3V7R A;  1OZ3 A;  2PUK B;  4JRP A;  4PJO E;  3VUB A;  2RHU A;  4X34 A;  1KD1 C;  2E6N A;  3RKX A;  3OBW A;  2V8K A;  4M78 C;  4PNO A;  4ZTF A;  3CC4 A;  3V8K A;  2K3X A;  3CME A;  1YCY A;  4HA8 A;  2ZPF B;  1VQM A;  2KVQ G;  5KE2 A;  2K5I A;  3GNG A;  3OS1 A;  4MDW A;  3X26 B;  2BIV A;  3CPW S;  3CCQ T;  2LC4 A;  4JS5 A;  4PJO G;  3JCM J;  4M7D B;  2DAQ A;  3WXM B;  4O5V A;  4MMK A;  4O6J A;  2PVD B;  3OS0 A;  2K57 A;  4OGE A;  1M1F A;  2RI5 A;  2JNG A;  4M77 A;  3NTI A;  3HSB A;  5LJ5 e;  3V8L A;  3CBP A;  3HRU A;  1M90 U;  4J5Y A;  5GAO r;  1OZ2 A;  4GY5 A;  3DLL A;  5GAO m;  2BUD A;  5GAN 8;  3CMA T;  5LJ5 g;  3JB9 I;  1KC8 C;  1K9M U;  1G5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...