2R5BA

Structure of the gp41 n-trimer in complex with the hiv entry inhibitor pie7
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 N-peptide
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
molecule tags Viral protein/inhibitor
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r5bA00
1SLQA 2Q3IA 3V5BA 1GU4A 3M9HA 3OAKA 5AW2B 5AW4B 1GTWA 1H8AA 1T2KC 4AUWA 2XV5A 2KP8A 5AVTB 2R32A 2YNYA 3T97A 1NAFA 4GT1A 2R3CA 3KQGA 1YYCA 4M3LA 2WPQA 3HE4A 4XE5B 1H89A 5AW9B 5AVSB 3V4WA 1HJBA 4EOTA 1S9KE 5AVQB 5AW7B 2P2UA 2E43A 2YO3A 1CI6B 1MFZA 3A5TA 3VYIA 3LIDA 2QM8A 2XU6A 3A2AA 3M91A 5APTA 3VMZA 3VMXA 1S9KD 4HYTB 3VTPC 3NMDA 3O8ZA 1DH3A 2WPRA 3L37A 3B8EB 3L36A 4KHXA 2BASA 1CSBA 5CMZA 1JNMA 1KQLA 4C7NB 2N9BA 5APQA 5AVWB 1HBWA 2Q5UA 5APVA 1FAVA 3A3YB 5AVVB 2QM7A 5APYA 4AQRD 2WTYA 5AW0B 2R5BA 4C7NA 1MV8A 3M0AA 5APWA 3M0DA 3VMYA 3P7KA 1A02F 2WPSA 3MD0A 1IO4A 3HE5B 2YO2A 3NFQA 2C9LY 1CZQA 3TK1A 1GK4A 3UIAA 1GD2E 2Q7CA 3V4QA 3TYYA 4JYBA 2ZFCA 5APUA 3TNUB 1G2CB 1CI6A 3P8MC 5AVRB 5AW3B 3SWFA 1FOSF 2XZRA 1NWQA 2C9NY 4C46A 3HTKA 4GKGA 3M9BA 3MGNA 2IPPA 2P7JA 2Z5IA 2E42A 1GZLA 1HWTC 3KDPB 3M06A 1T2KD 1MUUA 4RESB 3A7OA 3P32A 5AVUB 3IR9A 1OXZA 1OWAA 5APXA 3HE4B 4DZOA 2JJLA 3VN0A 1X8YA 3L35A 1JUNA 2W27A 3NXSA 1GK6A 4I2LC 5AVYB 3HE5A 5AW6B 2WWWA 2VRSA 3NTNA 5AW8B 3I5CA 2WT7B 1GU5A 4I6MC 3TNUA 2R5DA 4B86A 5AW5B 2ZXEB 3LIEA 1HUCA 1J2JB 2W6AA 5AW1B 1H88A 2H7HA 2Z5HA 5AVXB 5AVZB 4JYCA 2WT7A 2P67A 1SP4A 5APSA 4AYCA 4LC1A 1FOSE 1A02J
chains in the Genus database with same CATH superfamily
1BE3E 3ABVC 4GT1A 3AE1C 3L70D 4OGQC 4ASVA 1S4XA 2M0BA 3N4XA 3U1AA 3SWKA 3G3ZA 5GTHH 2K9JA 3MP7B 1MFZA 4RJTA 4YPCA 3M91A 3CCRP 1N2DC 2JP3A 4PV1B 4IL6E 2CPBA 2BCCJ 1KQSO 3H6PA 2WZ7A 3WUUA 2XNXA 3HD7C 2QEXP 1LTSC 2NPSB 3MD0A 1OW6A 2D2CD 1IFDA 1N86A 1NTMD 1ZXGA 2O1JA 3TK1A 3GW6A 2Q6QA 2Y0DA 2BEZF 4WY4C 1SQPK 1GZLA 2IZ1A 5KAFE 3VMAA 3P8CD 4HJGH 1L0NE 2GA1A 2LR2A 1IFMA 1FJPA 4OH8B 3H1HD 4I2LC 3CCSP 1UIIA 2YIUC 3E1IA 1QVFO 3H25A 2M5AA 1KYOE 2WT7A 2D2CB 5CBOA 4Y99C 4EI2A 2ZXXA 3M9HA 3CD6P 2XV5A 4WWIA 2HPCB 1X22A 3H1JD 2YMKA 1S1CX 3HE4A 2B87B 4MN4C 1NTKG 1HJBA 1S9KE 2G8YA 1R5LA 1AQ5A 3H1ID 2DW3A 5KLVD 3RL0C 3L75D 1JY2O 1MZ9A 1USEA 3O8ZA 3CCEP 1HBWA 1VF5D 2QM7A 1MV8A 1L0NK 5KAIH 3P7KA 1UIXA 5BU5A 1A02F 1JTHA 3CXHD 2XKMA 2QJPC 2FFDA 1BDCA 1N7SA 2L5GB 3SWFA 1CI6A 1KQFB 1LTTC 3BVHA 1NKZB 1L0LD 1SQBD 3L73D 3MGNA 3R4YA 3LW5H 3B5ND 4BXLA 1FS0E 1DIPA 1T2KD 3BCCJ 1NGMB 3B71A 4H0LD 3II6A 2FXPA 4Z1MH 1JUNA 5AVYB 3S4RA 1VF5B 1JMMA 1K04A 3EQ2A 2H43A 3L71D 2C0WA 4W7YA 1NAYA 4IFMA 3FWNA 4H44D 2QG4A 2AEFA 1LTBC 4ZKPA 3OA7A 3Q5RA 1RE4C 1SLQA 3OAKA 3C8VA 3KQGA 4NPFX 4QMAA 3B5NB 2RKLA 1NTZK 3LW5J 1NOHA 2MJZA 1PP9G 4H0LB 1KC8Q 1VL2A 2W90A 1NU1D 2WSEH 2A06D 1SQQK 2J58A 1GL2D 3BCCE 2N9BA 1RF1A 3CCUP 1KB9I 3AEEC 3BRVB 2WTYA 5AW0B 2R5BA 4GOEA 4H44B 3AE2C 3JSVC 1LT1A 2KNCA 4JYBA 3JC22 5AVRB 4D6TG 1OX3A 2C9NY 4C46A 4O9BA 3HTKA 1YIJP 1GW3A 5TISH 1Q7YQ 3A7OA 1FE6A 2FYUG 3VN0A 1GL2B 1KV4A 3F5HA 3M9QA 5AW6B 2K9JB 1FZCC 1GU5A 3TNUA 4B86A 5AW5B 2N1TC 3C9IA 2E75D 3U1CA 1IK7A 1J1EB 2BCCD 1KYOD 5AW2B 5AW4B 3RK2C 2Y9ZA 2E76C 2IBZG 2OTJP 1JCDA 1URQA 1RHZB 2J5UA 3G6EP 1J1DC 2WSCJ 2QJKB 3GMAA 2Q3EA 4R4MA 3ITKA 1AA0A 1X79B 4OWFA 2E74B 2XU6A 1S9KD 2W83C 1YJ9P 3L72G 3EFGA 4AQRD 4C7NA 1RF0C 2E75B 1EZVG 2FYNC 3USSA 5CCHC 1LGHB 1S5LE 4N3YB 3IN6A 3IF4A 2YO2A 2IFNA 3UIAA 3CXHH 2ZYGA 4R4LA 3RL0g 2IDBA 1DX7A 2M5AB 1ZR2A 4JF7A 2K37A 3HD7A 2O1KA 1LTJB 2P7JA 2ZVOB 1VQ8P 1LTIC 1N7SD 1G1IA 3HE4B 3H1LG 4H13D 4WY4A 1QX8A 4GIFA 4ZMDA 2BEQD 2Z5HA 4JYCA 4K35A 1PGOA 2ZJSE 1BGYJ 2KLUA 1DEBA 1Y8AA 3EFFK 3VOPA 1N73C 2NZ2A 2IX7C 1FJKA 3D70A 1JTHB 1NTKK 1VQMP 1FU1A 3RK3D 1K8AQ 1SFCC 1N7SB 3V2PA 1CI6B 1T3UA 4D6TJ 4H13B 4KHXA 1ZOYC 1KMIZ 2IZ0A 5CBNA 3A3YB 3PH0A 3BCCD 1QVGO 4IL6H 1FZEA 3MUDA 4EYYQ 4NPEA 1FDOA 5KJ7D 3AEDC 2Q7CA 1SQQG 4DT0A 2ZFCA 1P84E 1PP9E 1LWUC 1SQPJ 1OMIA 1HGVA 4TLFA 3KHUA 4KT0J 4KJMA 5KAFH 3NTNA 1U57A 1Q81Q 4UB6E 4D6TE 2AXTE 3CCJP 1S3JA 2OYOA 3S1KA 1EXIA 3IAOA 5AVTB 1KFNA 1PFIA 3T97A 1OW8A 1PIXA 2OYHA 2FYUE 4DJGA 3SFEC 1OVRA 4PV1C 1TU3F 3HRNA 2LKMA 1RE4A 1KQGB 1KILC 4DCKA 3M0DC 1USDA 5BU8B 4RKUJ 3HTKB 1URQD 3JCUH 3AE9C 2QJYB 4W80A 5B5EH 1ZV8A 1JNMA 3CMEP 2NPSC 1BCCD 2Q5UA 2KB7P 4OVNF 1L0NJ 1FAVA 5APYA 1K73Q 2IBZE 4HB1A 1OVVA 1YTZT 3FXEA 4HH2A 1K9MQ 1FDIA 2W8ZA 1L4AC 3PLNA 3H1LJ 1GK4A 2KI7B 5CHXA 3CL3D 4RO0A 3TNUB 1RH5B 1NO4A 1LT9C 3AEAC 1JEKA 2A45G 3SWYA 2YKPA 3WU2E 1AV1A 2YMYA 3AECC 1JO5A 4DOJA 3L72E 3M06A 1VQ5P 1MUUA 3CXHI 3KXDA 2P10A 1EZVE 1URQB 1SQXK 2FYUK 2W6BA 3CWBG 2D2CC 3AEGC 1LTGC 1VDFA 1NJIQ 1M1KQ 3TDKA 3CI9A 2OTLP 4TT3H 1N8RQ 1ZN5A 1EDKA 5AVXB 2QSIA 3GG2A 4LC1A 5M1BA 4NPDA 1E79H 1PPJD 3AE5C 1NTZJ 3H1LE 2SPZA 3D71A 2WVRA 2UWJE 4A7PA 2E43A 1AQTA 1SQVK 5CCGA 3A5TA 1SQQJ 1EXJA 4N78E 3VMXA 3I56P 1WT6A 3VTPC 4ASWA 3B8EB 3S9OA 1NU1K 5CJ0A 2HODA 1ZP0C 4XA4A 3L70G 3L4FA 2ZT9D 2XNDH 3JCUE 5B5EE 1VQ7P 3TF5A 3MIWA 2PRRA 1M90Q 1CZQA 1YI2P 2W6JH 1FBMA 2B89A 3HUSA 1FOSF 1NWQA 3RL0D 3CX5E 5CCHA 3OJAB 2WQYC 1VF5C 1NTZE 1BGYD 1JY3O 1R8EA 3NXSA 1ZRTE 3C1LA 3D6YA 3CC2P 1JMBA 2WWWA 1SQQE 2ZT9B 1YTZI 1MFTA 3SSUA 2HYNA 4I7ZB 3B5NC 1GU4A 1T2KC 4AUWA 5BVZA 4BRYA 3RL0B 2KS1B 4XE5B 4H0LC 1H89A 1EQ7A 3QH9A 3H1HG 4EOTA 1JB0J 1RE3A 1K05A 2P2UA 2JWAA 1Q86Q 2JWDA 2E5TA 1KYOI 4GODA 1DH3A 1SQPD 1WRGA 4H44C 2AEJA 1R5SA 4WBAA 3PP5A 2FXOA 4PD4H 5AVVB 1VQLP 1BE3D 2WMMA 1SFCA 4GOFA 3WUTA 3A0HE 2WPSA 1RQUA 3GHGC 2B9BA 3CWBJ 3GF7A 3MTUE 2Q9IA 3H1IG 5KLVG 3RGUA 1GMJA 1S5LH 2KZJA 1YITP 5E79E 2OYIC 1QL1A 1GL2C 3L74G 2R44A 2K1AA 3V2RA 3T97B 2OYHB 1VQKP 2H88C 4K3AA 2LXCB 2WSSH 1JY2N 2I1KA 2OARA 2WSFH 2WSCH 2Y0EA 5CJ4A 1J1EC 4IFFA 1M1JA 1PGQA 1IZNB 1IFJA 3VP8A 1L0LG 1SQBG 1SQXG 1FOSE 2QJKC 2E74D 2R32A 1IFNA 1L0ND 1Y9BA 1YYCA 1NTKJ 1JM0A 3CWBE 1X9VA 1FDMA 3L71G 1X0TA 2OQQA 3KZIE 3MZWB 3VYIA 1OW7A 4L75A 1T3JA 1JY2P 2E75C 5B66E 4HKZH 2JDIH 2BASA 4N78D 1VQ6P 3QWOC 2WSFJ 3CCLP 1M57D 2K9YA 5CCGD 1KILA 3M0DA 2PAJA 4JBZA 1SQVG 3AEBC 4PD4E 1LTJC 3EWKA 4WB4A 2NPSA 2M8RA 1KILE 2FBWC 1NU1G 2A06G 4L74A 1L4AA 1P84H 1HWTC 1Q82Q 1NTKE 3L70E 1OXZA 1LT9A 1X8YA 2GUSA 5KLIC 1FZAA 1NTZD 1Q2NA 2HLOA 1OIPA 3HE5A 2VRSA 2WT7B 1ZRTD 2Y9YA 2R5DA 1S72P 2H7HA 1SQQD 1VQPP 2O01J 3AE6C 1J1DB 1IC2A 4UB6H 2QRXA 2AXTH 1GTWA 1HTLC 2KOGA 1NAFA 2KIKA 3CMAP 1N7SC 2WPQA 3AE8C 5AVSB 4H13C 2POHA 2KSEA 5KKZB 2B87A 1PP9J 2MKVA 2YO3A 3HUSB 2YXQB 5APTA 3Q5SA 4UB8E 2QA4P 4HYTB 3CC7P 3FXDA 2BCCG 4GDOA 4U3FG 3L74J 2GM4A 1EC5A 1T6AA 1EDJA 2FFDB 2P1JA 3H1HE 3RK3C 1KORA 3V6IA 1KTMA 3TYYA 5APUA 1FZFA 1GW4A 1U7MA 3P8MC 5AW3B 3H1KG 1FZBA 2KUBA 1W5CE 4ZKUA 4EDFA 1L0LJ 1SQXJ 4RESB 3WU2H 3PHLA 4BRYB 2FYUJ 1AFOA 2E5YA 2LXBA 3E1RA 2FYZA 4PJ0E 1NTMK 1YHQP 5KJ7C 4LLHA 3H1IE 1XTGB 1G2CA 2OGUA 4L73A 1EDLA 1IFPA 3VP9A 3WUVA 3L74E 1YQ4C 5K5GB 1PGPA 3Q1MA 5DJTB 1DD4A 3CCMP 3I55P 3H32A 1SQVJ 3MHVA 2QJYC 2M3EA 4I1LA 3AE3C 1RF1B 1L0LE 1SQBE 1NU1J 3L72J 1KQLA 1SQXE 1IJDB 2V4HA 2RH0A 2JEEA 2FY8A 2KNCB 3SFDC 1JCCA 3NFQA 2YKOA 1D7MA 5KLVK 1M1JB 4PD4D 4LGDE 4GKGA 2PFXA 1KILD 2IPPA 2M3BA 1IK9A 2Q1KA 3GHGA 1DD3A 1LNQA 3CCVP 3P32A 3CX5H 1MKMA 4OGQD 1SQVE 1NTKD 2KLVA 5H2FE 1L4AD 2OYIA 1P84I 1GL2A 3Q3DA 1PGJA 1YJNP 1KB9H 1KN7A 1H88A 1NU1E 2A06E 4IOIH 1SS1A 1NHLA 1L0LK 1SQBK 2P67A 1SP4A 1KFMA 2YXRB 2ZAEB 3TGUG 2C0XA 1H8AA 4U3FJ 2FXMA 1EDIA 3G9RA 3HD7D 1KILB 1GDTA 2JR8A 3W67A 1QLED 1LTAC 3ZDMA 2KXPB 2H89C 4OGQB 3LIDA 2QM8A 3VMZA 3H1KJ 4JQ0D 4WY4D 3L37A 1KZUB 2I8DA 1L4AB 1FZCA 4C7NB 2KZIA 1VQNP 2ZYAA 2N1TA 1PV3A 1LT9B 4EIJA 3M0AA 1KD1Q 3HE5B 1GD2E 3V4QA 1BDDA 3HD7B 3PJSK 3A0HH 2XZRA 1BCCG 2BCCE 4U3FE 2IBZI 1RQVA 1LTJA 2IYOA 5GTIE 1YQ3C 5E79H 4WY4B 2Z4EA 1WMKA 2ZT9C 1Y47A 3Q2YA 5KTBA 3OW2O 1W2BO 4I7ZC 1RF0A 1P84D 2N9YB 1PP9D 1ZLLA 3H1KE 3V2QA 1QL2A 2FKWB 2ZXEB 3AEFC 5DJUB 1J2JB 4Y28J 3MUDC 3Q5PA 5APSA 4AYCA 2YIUB 2Q3IA 2A45H 5GTHE 1EZVI 1KB9E 1NTMG 3L74D 4M3LA 2R3SA 4Y99B 3BRTB 5AW7B 1NVOA 4ZNCA 1M8OB 2L91A 1PZQA 4D6TD 1W2EA 3NMDA 3CLQA 1CSBA 5CMZA 3KZIH 2JKVA 5C39A 2RMZA 1YBKA 1PPJG 3B4SA 1SQXD 1NKNA 5B66H 2FYUD 4IL6X 1VPCA 2G3AA 1E5WA 3W68A 3FWLA 1N73A 1G2CB 1QEXA 1HF9A 1DEEG 2OYHC 1Z56A 2QJPB 3RBZA 2P58A 3RBXA 3H1JG 1BSNA 3KDPB 2GUVA 3TGUJ 2ZYDA 2IBZD 3KYQA 5APXA 2WITA 1U7JA 3H32B 4IFDK 3PTZA 3L75G 3RK3E 5AW8B 1Q90D 1SQVD 3CX5I 1H0TA 3K5BA 1RY3A 3KPEA 3O6QA 1M56D 1A02J 3V5BA 1LP1A 3L72D 3N7NA 3CCQP 5KJ7A 1LWUA 2AEMA 3F89A 1BGYG 1FC2C 3PRJA 1EZVD 1ZW0A 2HR3A 2PP6A 3E7KA 3L73G 2ZVNB 3L36A 5KAIE 3GHGB 5AVWB 3TGUE 1HH0A 1JY3N 2E74C 2IYPA 2QVAA 4UB8H 1BCCJ 3L70J 2WPVB 3H1LD 2PGDA 1VQ9P 1NYHA 2C9LY 2O01N 2K3RA 2H8PD 2OYIB 2WSEJ 2CPSA 3BATA 3A0BH 2N1TD 2IFMA 1SQPG 2AXCA 1S2EA 1N7LA 2K88A 4YXWH 3RK2D 2HG5D 2O01H 2E76D 1BE3G 1QGKB 1M7LA 2V7QH 1OWAA 4U3FD 5CCGC 4DZOA 1FZGA 1JY3P 1NTMJ 2W27A 2KSJA 2J59M 1HVVA 4PJ0H 1HUCA 2W6AA 5AW1B 1LJ2A 3CX5D 3H1KD 4BWNA 1FZCB 2HFED 2O3JA 1BCCE 3FX0A 1AJYA 2N1TB 3G4SP 5KKZC 1HJ0A 5CCHD 1AVOA 1L2PA 3HUSC 4WVZA 3H1HJ 2RN0A 5AW9B 1KB9D 3RK2B 1SVFA 2E76B 1G1JA 3D6ZA 2A45I 2V7QJ 2HODB 2FFDC 5APQA 4YTPC 1XTCC 5APVA 3H1JJ 5L8RJ 1L0NG 2HPCA 1NTME 3AE4C 5APWA 1IO4A 3H1IJ 5KLVJ 1T8ZA 3L75J 2FYNB 5TISE 4JPZB 1YJWP 4C7RA 3M9BA 3P8CE 4XFJA 5KLIB 2QE7H 2KYVA 3A0BE 1RE3C 1PPJE 5AVUB 1VQOP 3IR9A 2NRGA 4L76A 4N6JA 3BASA 1GK6A 4PD4I 2OTKE 1SFCD 3I5CA 3CPWO 4I6MC 3TSIA 3LIEA 1SQBJ 3L73J 1OZHA 1CW5A 3GF3A 5H2FH 2KK7A 3H1JE 5TJHA 1ZMEC 1OVUA 1NH4A 2KP8A 3WMM0 1OFCX 2YNYA 4W7ZA 2R3CA 3U59A 2JO1A 1NTZG 1RF1C 5KLVE 1ZR4A 3V4WA 3L71J 3L75E 5AVQB 2KS1A 1N73B 3CC4P 1PL5A 3A2AA 3IFMA 2WPRA 4YXDC 1SFCB 1JOCA 4CPGA 3RK3B 4U7JA 3CXHE 1BGYE 3GLMA 1BE3J 3TGUD 3AE7C 1M1JC 3VMYA 3B5NA 3CWBD 1VQ4P 2Y0CA 3L73E 3G71P 2ITAA 1S5LX 1H0TB 2CK3H 2QIWA 1IFIA 2Z5IA 3O6QB 3FGAD 2E42A 2YKQA 1LP1B 1BSHA 1LWUB 2I1JA 2JJLA 3L71E 1HGZA 1KYOH 3L35A 4PV1D 2B88A 3V2NA 1AVYA 2XDJA 5GTIH 5EFWB 1URQC 3R2PA 5AVZB 1SQPE 2NPSD 3BCCG
chains in the Genus database with same CATH topology
2Q3IA 2A45H 1DEBA 2R32A 1IFNA 4GT1A 3VOPA 1N73C 1YYCA 4M3LA 2IX7C 1FJKA 4Y99B 1JTHB 3N4XA 3BRTB 1NTKK 3U1AA 3G3ZA 1FU1A 1X9VA 3RK3D 1FDMA 5AW7B 1SFCC 1N7SB 3V2PA 1CI6B 1MFZA 1T3UA 3VYIA 3M91A 1T3JA 1N2DC 1JY2P 1W2EA 3NMDA 4KHXA 2CPBA 2BASA 3CLQA 1CSBA 5CMZA 4N78D 3H6PA 2WZ7A 3A3YB 1NKNA 1FZEA 2XNXA 5CCGD 3MUDA 3HD7C 1KILA 1LTSC 3M0DA 2NPSB 2PAJA 1VPCA 3MD0A 1IFDA 1N86A 2O1JA 5KJ7D 3TK1A 1E5WA 1LTJC 2Q7CA 4WB4A 2NPSA 2M8RA 2ZFCA 1N73A 1G2CB 1LWUC 2OYHC 4WY4C 1Z56A 1SQPK 1GZLA 1L4AA 1HWTC 3KDPB 3P8CD 2GUVA 1HGVA 1OXZA 3KYQA 5APXA 1LT9A 1X8YA 2GUSA 1FZAA 1IFMA 2WITA 1FJPA 3H32B 4OH8B 4IFDK 2HLOA 4I2LC 3HE5A 2VRSA 3NTNA 5AW8B 2WT7B 3E1IA 2R5DA 2H7HA 2WT7A 1RY3A 3KPEA 1J1DB 1IC2A 4Y99C 1A02J 3V5BA 3M9HA 3N7NA 1GTWA 5KJ7A 2XV5A 1LWUA 1HTLC 5AVTB 1KFNA 2KOGA 2HPCB 3T97A 1NAFA 1PFIA 1N7SC 2OYHA 2WPQA 3HE4A 5AVSB 2PP6A 1HJBA 1S9KE 2POHA 3HRNA 2LKMA 1RE4A 1AQ5A 2YO3A 3RL0C 3HUSB 1KILC 5APTA 1JY2O 3M0DC 5BU8B 1MZ9A 3HTKB 4HYTB 1URQD 3O8ZA 3L36A 4W80A 1ZV8A 1JNMA 2NPSC 3GHGB 5AVWB 1HBWA 1HH0A 2Q5UA 1JY3N 2KB7P 1FAVA 2QM7A 5APYA 2GM4A 1MV8A 1L0NK 1YTZT 4HH2A 2FFDB 2P1JA 3P7KA 5BU5A 1L4AC 1A02F 1JTHA 2XKMA 2C9LY 2H8PD 1GK4A 2OYIB 3RK3C 5CHXA 3CL3D 3TYYA 2FFDA 2CPSA 3BATA 5APUA 3TNUB 1N7SA 2L5GB 1GW4A 1FZFA 1NO4A 1LT9C 2N1TD 1CI6A 3P8MC 5AW3B 3SWFA 1FZBA 2A45G 3SWYA 2IFMA 2YKPA 1LTTC 3BVHA 1NKZB 4ZKUA 3MGNA 2YMYA 3LW5H 3B5ND 1JO5A 1N7LA 4DOJA 3M06A 3RK2D 2HG5D 1MUUA 2O01H 1T2KD 4RESB 1M7LA 1AFOA 1URQB 1SQXK 1OWAA 5CCGC 3II6A 4DZOA 1JY3P 1FZGA 2FYUK 2W6BA 2FYZA 1JUNA 2W27A 2KSJA 5AVYB 1NTMK 5KJ7C 1JMMA 1LTGC 1VDFA 4LLHA 2J59M 3EQ2A 2H43A 1HVVA 2C0WA 4W7YA 1XTGB 1G2CA 3CI9A 1HUCA 2W6AA 1ZN5A 4IFMA 5AW1B 5AVXB 3VP9A 1LTBC 1FZCB 4ZKPA 3OA7A 4LC1A 2HFED 1RE4C 1SLQA 3OAKA 2N1TB 5CCHD 3KQGA 3HUSC 3B5NB 5AW9B 1NTZK 3H32A 3RK2B 1SVFA 1NOHA 1G1JA 2E43A 2MJZA 1SQVK 2A45I 5CCGA 3A5TA 4I1LA 4N78E 3VMXA 1RF1B 1WT6A 3VTPC 2WSEH 1SQQK 3B8EB 2HODB 2J58A 1GL2D 1KQLA 2FFDC 2N9BA 5APQA 1RF1A 1IJDB 1NU1K 1XTCC 5CJ0A 5APVA 3BRVB 2WTYA 2HODA 5AW0B 2R5BA 2HPCA 4XA4A 2JEEA 3L4FA 5APWA 3MIWA 1IO4A 1JCCA 3NFQA 1CZQA 2YKOA 1T8ZA 4JYBA 1FBMA 5AVRB 1M1JB 5KLVK 3HUSA 1FOSF 1NWQA 2C9NY 4LGDE 4C46A 4O9BA 3HTKA 4GKGA 3RL0D 4C7RA 1KILD 3M9BA 3P8CE 1GW3A 5CCHA 2IPPA 2M3BA 1IK9A 3GHGA 3OJAB 2KYVA 1RE3C 3A7OA 3P32A 5AVUB 1JY3O 3IR9A 4N6JA 3VN0A 1GL2B 3NXSA 3BASA 1GK6A 2KLVA 3M9QA 5AW6B 2WWWA 1L4AD 2OYIA 1SFCD 1FZCC 3I5CA 1GU5A 1GL2A 4I6MC 3TNUA 3TSIA 4B86A 5AW5B 2N1TC 3LIEA 1H88A 3C9IA 1CW5A 1YTZI 1NHLA 1L0LK 1SQBK 2P67A 1SP4A 1KFMA 2HYNA 3U1CA 3B5NC 1J1EB 1GU4A 2C0XA 5AW2B 5AW4B 1H8AA 3RK2C 1T2KC 4AUWA 5BVZA 2KP8A 1NH4A 3WMM0 2YNYA 2FXMA 4W7ZA 2R3CA 3HD7D 3RL0B 1JCDA 1URQA 3U59A 1KILB 4XE5B 1GDTA 1J1DC 1H89A 1RF1C 1EQ7A 3V4WA 1ZR4A 4EOTA 1LTAC 5AVQB 1RE3A 2P2UA 1N73B 1X79B 3LIDA 2QM8A 2XU6A 3A2AA 3IFMA 3VMZA 1S9KD 4WY4D 1DH3A 2WPRA 3L37A 1KZUB 1WRGA 4WBAA 1L4AB 1SFCB 4C7NB 1FZCA 3PP5A 1JOCA 2N1TA 3EFGA 3RK3B 5AVVB 4AQRD 1SFCA 4C7NA 1RF0C 1LT9B 5CCHC 4EIJA 3M0AA 1LGHB 1M1JC 3VMYA 3B5NA 2WPSA 3GHGC 4N3YB 3HE5B 2YO2A 3MTUE 2Q9IA 2IFNA 3UIAA 1GD2E 3V4QA 1DX7A 3HD7B 1ZR2A 2XZRA 4JF7A 3HD7A 1IFIA 2O1KA 1LTJB 2P7JA 2Z5IA 2OYIC 2E42A 1QL1A 2YKQA 1GL2C 1LWUB 3V2RA 2I1JA 1LTJA 1LTIC 1N7SD 1G1IA 2OYHB 4WY4B 2Z4EA 3HE4B 2JJLA 1HGZA 3L35A 5KTBA 3V2NA 4WY4A 2XDJA 1JY2N 2I1KA 2OARA 1RF0A 2WSFH 2WSCH 5CJ4A 1J1EC 1URQC 4IFFA 3R2PA 1ZLLA 3V2QA 4GIFA 1M1JA 1QL2A 2FKWB 2ZXEB 1J2JB 3VP8A 1IFJA 2Z5HA 5AVZB 4JYCA 2NPSD 5APSA 4AYCA 1FOSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SLQ A;  2Q3I A;  3V5B A;  1GU4 A;  3M9H A;  3OAK A;  5AW2 B;  5AW4 B;  1GTW A;  1H8A A;  1T2K C;  4AUW A;  2XV5 A;  2KP8 A;  5AVT B;  2R32 A;  2YNY A;  3T97 A;  1NAF A;  4GT1 A;  2R3C A;  3KQG A;  1YYC A;  4M3L A;  2WPQ A;  3HE4 A;  4XE5 B;  1H89 A;  5AW9 B;  5AVS B;  3V4W A;  1HJB A;  4EOT A;  1S9K E;  5AVQ B;  5AW7 B;  2P2U A;  2E43 A;  2YO3 A;  1CI6 B;  1MFZ A;  3A5T A;  3VYI A;  3LID A;  2QM8 A;  2XU6 A;  3A2A A;  3M91 A;  5APT A;  3VMZ A;  3VMX A;  1S9K D;  4HYT B;  3VTP C;  3NMD A;  3O8Z A;  1DH3 A;  2WPR A;  3L37 A;  3B8E B;  3L36 A;  4KHX A;  2BAS A;  1CSB A;  5CMZ A;  1JNM A;  1KQL A;  4C7N B;  2N9B A;  5APQ A;  5AVW B;  1HBW A;  2Q5U A;  5APV A;  1FAV A;  3A3Y B;  5AVV B;  2QM7 A;  5APY A;  4AQR D;  2WTY A;  5AW0 B;  2R5B A;  4C7N A;  1MV8 A;  3M0A A;  5APW A;  3M0D A;  3VMY A;  3P7K A;  1A02 F;  2WPS A;  3MD0 A;  1IO4 A;  3HE5 B;  2YO2 A;  3NFQ A;  2C9L Y;  1CZQ A;  3TK1 A;  1GK4 A;  3UIA A;  1GD2 E;  2Q7C A;  3V4Q A;  3TYY A;  4JYB A;  2ZFC A;  5APU A;  3TNU B;  1G2C B;  1CI6 A;  3P8M C;  5AVR B;  5AW3 B;  3SWF A;  1FOS F;  2XZR A;  1NWQ A;  2C9N Y;  4C46 A;  3HTK A;  4GKG A;  3M9B A;  3MGN A;  2IPP A;  2P7J A;  2Z5I A;  2E42 A;  1GZL A;  1HWT C;  3KDP B;  3M06 A;  1T2K D;  1MUU A;  4RES B;  3A7O A;  3P32 A;  5AVU B;  3IR9 A;  1OXZ A;  1OWA A;  5APX A;  3HE4 B;  4DZO A;  2JJL A;  3VN0 A;  1X8Y A;  3L35 A;  1JUN A;  2W27 A;  3NXS A;  1GK6 A;  4I2L C;  5AVY B;  3HE5 A;  5AW6 B;  2WWW A;  2VRS A;  3NTN A;  5AW8 B;  3I5C A;  2WT7 B;  1GU5 A;  4I6M C;  3TNU A;  2R5D A;  4B86 A;  5AW5 B;  2ZXE B;  3LIE A;  1HUC A;  1J2J B;  2W6A A;  5AW1 B;  1H88 A;  2H7H A;  2Z5H A;  5AVX B;  5AVZ B;  4JYC A;  2WT7 A;  2P67 A;  1SP4 A;  5APS A;  4AYC A;  4LC1 A;  1FOS E;  1A02 J; 
#chains in the Genus database with same CATH topology
 1BE3 E;  3ABV C;  4GT1 A;  3AE1 C;  3L70 D;  4OGQ C;  4ASV A;  1S4X A;  2M0B A;  3N4X A;  3U1A A;  3SWK A;  3G3Z A;  5GTH H;  2K9J A;  3MP7 B;  1MFZ A;  4RJT A;  4YPC A;  3M91 A;  3CCR P;  1N2D C;  2JP3 A;  4PV1 B;  4IL6 E;  2CPB A;  2BCC J;  1KQS O;  3H6P A;  2WZ7 A;  3WUU A;  2XNX A;  3HD7 C;  2QEX P;  1LTS C;  2NPS B;  3MD0 A;  1OW6 A;  2D2C D;  1IFD A;  1N86 A;  1NTM D;  1ZXG A;  2O1J A;  3TK1 A;  3GW6 A;  2Q6Q A;  2Y0D A;  2BEZ F;  4WY4 C;  1SQP K;  1GZL A;  2IZ1 A;  5KAF E;  3VMA A;  3P8C D;  4HJG H;  1L0N E;  2GA1 A;  2LR2 A;  1IFM A;  1FJP A;  4OH8 B;  3H1H D;  4I2L C;  3CCS P;  1UII A;  2YIU C;  3E1I A;  1QVF O;  3H25 A;  2M5A A;  1KYO E;  2WT7 A;  2D2C B;  5CBO A;  4Y99 C;  4EI2 A;  2ZXX A;  3M9H A;  3CD6 P;  2XV5 A;  4WWI A;  2HPC B;  1X22 A;  3H1J D;  2YMK A;  1S1C X;  3HE4 A;  2B87 B;  4MN4 C;  1NTK G;  1HJB A;  1S9K E;  2G8Y A;  1R5L A;  1AQ5 A;  3H1I D;  2DW3 A;  5KLV D;  3RL0 C;  3L75 D;  1JY2 O;  1MZ9 A;  1USE A;  3O8Z A;  3CCE P;  1HBW A;  1VF5 D;  2QM7 A;  1MV8 A;  1L0N K;  5KAI H;  3P7K A;  1UIX A;  5BU5 A;  1A02 F;  1JTH A;  3CXH D;  2XKM A;  2QJP C;  2FFD A;  1BDC A;  1N7S A;  2L5G B;  3SWF A;  1CI6 A;  1KQF B;  1LTT C;  3BVH A;  1NKZ B;  1L0L D;  1SQB D;  3L73 D;  3MGN A;  3R4Y A;  3LW5 H;  3B5N D;  4BXL A;  1FS0 E;  1DIP A;  1T2K D;  3BCC J;  1NGM B;  3B71 A;  4H0L D;  3II6 A;  2FXP A;  4Z1M H;  1JUN A;  5AVY B;  3S4R A;  1VF5 B;  1JMM A;  1K04 A;  3EQ2 A;  2H43 A;  3L71 D;  2C0W A;  4W7Y A;  1NAY A;  4IFM A;  3FWN A;  4H44 D;  2QG4 A;  2AEF A;  1LTB C;  4ZKP A;  3OA7 A;  3Q5R A;  1RE4 C;  1SLQ A;  3OAK A;  3C8V A;  3KQG A;  4NPF X;  4QMA A;  3B5N B;  2RKL A;  1NTZ K;  3LW5 J;  1NOH A;  2MJZ A;  1PP9 G;  4H0L B;  1KC8 Q;  1VL2 A;  2W90 A;  1NU1 D;  2WSE H;  2A06 D;  1SQQ K;  2J58 A;  1GL2 D;  3BCC E;  2N9B A;  1RF1 A;  3CCU P;  1KB9 I;  3AEE C;  3BRV B;  2WTY A;  5AW0 B;  2R5B A;  4GOE A;  4H44 B;  3AE2 C;  3JSV C;  1LT1 A;  2KNC A;  4JYB A;  3JC2 2;  5AVR B;  4D6T G;  1OX3 A;  2C9N Y;  4C46 A;  4O9B A;  3HTK A;  1YIJ P;  1GW3 A;  5TIS H;  1Q7Y Q;  3A7O A;  1FE6 A;  2FYU G;  3VN0 A;  1GL2 B;  1KV4 A;  3F5H A;  3M9Q A;  5AW6 B;  2K9J B;  1FZC C;  1GU5 A;  3TNU A;  4B86 A;  5AW5 B;  2N1T C;  3C9I A;  2E75 D;  3U1C A;  1IK7 A;  1J1E B;  2BCC D;  1KYO D;  5AW2 B;  5AW4 B;  3RK2 C;  2Y9Z A;  2E76 C;  2IBZ G;  2OTJ P;  1JCD A;  1URQ A;  1RHZ B;  2J5U A;  3G6E P;  1J1D C;  2WSC J;  2QJK B;  3GMA A;  2Q3E A;  4R4M A;  3ITK A;  1AA0 A;  1X79 B;  4OWF A;  2E74 B;  2XU6 A;  1S9K D;  2W83 C;  1YJ9 P;  3L72 G;  3EFG A;  4AQR D;  4C7N A;  1RF0 C;  2E75 B;  1EZV G;  2FYN C;  3USS A;  5CCH C;  1LGH B;  1S5L E;  4N3Y B;  3IN6 A;  3IF4 A;  2YO2 A;  2IFN A;  3UIA A;  3CXH H;  2ZYG A;  4R4L A;  3RL0 g;  2IDB A;  1DX7 A;  2M5A B;  1ZR2 A;  4JF7 A;  2K37 A;  3HD7 A;  2O1K A;  1LTJ B;  2P7J A;  2ZVO B;  1VQ8 P;  1LTI C;  1N7S D;  1G1I A;  3HE4 B;  3H1L G;  4H13 D;  4WY4 A;  1QX8 A;  4GIF A;  4ZMD A;  2BEQ D;  2Z5H A;  4JYC A;  4K35 A;  1PGO A;  2ZJS E;  1BGY J;  2KLU A;  1DEB A;  1Y8A A;  3EFF K;  3VOP A;  1N73 C;  2NZ2 A;  2IX7 C;  1FJK A;  3D70 A;  1JTH B;  1NTK K;  1VQM P;  1FU1 A;  3RK3 D;  1K8A Q;  1SFC C;  1N7S B;  3V2P A;  1CI6 B;  1T3U A;  4D6T J;  4H13 B;  4KHX A;  1ZOY C;  1KMI Z;  2IZ0 A;  5CBN A;  3A3Y B;  3PH0 A;  3BCC D;  1QVG O;  4IL6 H;  1FZE A;  3MUD A;  4EYY Q;  4NPE A;  1FDO A;  5KJ7 D;  3AED C;  2Q7C A;  1SQQ G;  4DT0 A;  2ZFC A;  1P84 E;  1PP9 E;  1LWU C;  1SQP J;  1OMI A;  1HGV A;  4TLF A;  3KHU A;  4KT0 J;  4KJM A;  5KAF H;  3NTN A;  1U57 A;  1Q81 Q;  4UB6 E;  4D6T E;  2AXT E;  3CCJ P;  1S3J A;  2OYO A;  3S1K A;  1EXI A;  3IAO A;  5AVT B;  1KFN A;  1PFI A;  3T97 A;  1OW8 A;  1PIX A;  2OYH A;  2FYU E;  4DJG A;  3SFE C;  1OVR A;  4PV1 C;  1TU3 F;  3HRN A;  2LKM A;  1RE4 A;  1KQG B;  1KIL C;  4DCK A;  3M0D C;  1USD A;  5BU8 B;  4RKU J;  3HTK B;  1URQ D;  3JCU H;  3AE9 C;  2QJY B;  4W80 A;  5B5E H;  1ZV8 A;  1JNM A;  3CME P;  2NPS C;  1BCC D;  2Q5U A;  2KB7 P;  4OVN F;  1L0N J;  1FAV A;  5APY A;  1K73 Q;  2IBZ E;  4HB1 A;  1OVV A;  1YTZ T;  3FXE A;  4HH2 A;  1K9M Q;  1FDI A;  2W8Z A;  1L4A C;  3PLN A;  3H1L J;  1GK4 A;  2KI7 B;  5CHX A;  3CL3 D;  4RO0 A;  3TNU B;  1RH5 B;  1NO4 A;  1LT9 C;  3AEA C;  1JEK A;  2A45 G;  3SWY A;  2YKP A;  3WU2 E;  1AV1 A;  2YMY A;  3AEC C;  1JO5 A;  4DOJ A;  3L72 E;  3M06 A;  1VQ5 P;  1MUU A;  3CXH I;  3KXD A;  2P10 A;  1EZV E;  1URQ B;  1SQX K;  2FYU K;  2W6B A;  3CWB G;  2D2C C;  3AEG C;  1LTG C;  1VDF A;  1NJI Q;  1M1K Q;  3TDK A;  3CI9 A;  2OTL P;  4TT3 H;  1N8R Q;  1ZN5 A;  1EDK A;  5AVX B;  2QSI A;  3GG2 A;  4LC1 A;  5M1B A;  4NPD A;  1E79 H;  1PPJ D;  3AE5 C;  1NTZ J;  3H1L E;  2SPZ A;  3D71 A;  2WVR A;  2UWJ E;  4A7P A;  2E43 A;  1AQT A;  1SQV K;  5CCG A;  3A5T A;  1SQQ J;  1EXJ A;  4N78 E;  3VMX A;  3I56 P;  1WT6 A;  3VTP C;  4ASW A;  3B8E B;  3S9O A;  1NU1 K;  5CJ0 A;  2HOD A;  1ZP0 C;  4XA4 A;  3L70 G;  3L4F A;  2ZT9 D;  2XND H;  3JCU E;  5B5E E;  1VQ7 P;  3TF5 A;  3MIW A;  2PRR A;  1M90 Q;  1CZQ A;  1YI2 P;  2W6J H;  1FBM A;  2B89 A;  3HUS A;  1FOS F;  1NWQ A;  3RL0 D;  3CX5 E;  5CCH A;  3OJA B;  2WQY C;  1VF5 C;  1NTZ E;  1BGY D;  1JY3 O;  1R8E A;  3NXS A;  1ZRT E;  3C1L A;  3D6Y A;  3CC2 P;  1JMB A;  2WWW A;  1SQQ E;  2ZT9 B;  1YTZ I;  1MFT A;  3SSU A;  2HYN A;  4I7Z B;  3B5N C;  1GU4 A;  1T2K C;  4AUW A;  5BVZ A;  4BRY A;  3RL0 B;  2KS1 B;  4XE5 B;  4H0L C;  1H89 A;  1EQ7 A;  3QH9 A;  3H1H G;  4EOT A;  1JB0 J;  1RE3 A;  1K05 A;  2P2U A;  2JWA A;  1Q86 Q;  2JWD A;  2E5T A;  1KYO I;  4GOD A;  1DH3 A;  1SQP D;  1WRG A;  4H44 C;  2AEJ A;  1R5S A;  4WBA A;  3PP5 A;  2FXO A;  4PD4 H;  5AVV B;  1VQL P;  1BE3 D;  2WMM A;  1SFC A;  4GOF A;  3WUT A;  3A0H E;  2WPS A;  1RQU A;  3GHG C;  2B9B A;  3CWB J;  3GF7 A;  3MTU E;  2Q9I A;  3H1I G;  5KLV G;  3RGU A;  1GMJ A;  1S5L H;  2KZJ A;  1YIT P;  5E79 E;  2OYI C;  1QL1 A;  1GL2 C;  3L74 G;  2R44 A;  2K1A A;  3V2R A;  3T97 B;  2OYH B;  1VQK P;  2H88 C;  4K3A A;  2LXC B;  2WSS H;  1JY2 N;  2I1K A;  2OAR A;  2WSF H;  2WSC H;  2Y0E A;  5CJ4 A;  1J1E C;  4IFF A;  1M1J A;  1PGQ A;  1IZN B;  1IFJ A;  3VP8 A;  1L0L G;  1SQB G;  1SQX G;  1FOS E;  2QJK C;  2E74 D;  2R32 A;  1IFN A;  1L0N D;  1Y9B A;  1YYC A;  1NTK J;  1JM0 A;  3CWB E;  1X9V A;  1FDM A;  3L71 G;  1X0T A;  2OQQ A;  3KZI E;  3MZW B;  3VYI A;  1OW7 A;  4L75 A;  1T3J A;  1JY2 P;  2E75 C;  5B66 E;  4HKZ H;  2JDI H;  2BAS A;  4N78 D;  1VQ6 P;  3QWO C;  2WSF J;  3CCL P;  1M57 D;  2K9Y A;  5CCG D;  1KIL A;  3M0D A;  2PAJ A;  4JBZ A;  1SQV G;  3AEB C;  4PD4 E;  1LTJ C;  3EWK A;  4WB4 A;  2NPS A;  2M8R A;  1KIL E;  2FBW C;  1NU1 G;  2A06 G;  4L74 A;  1L4A A;  1P84 H;  1HWT C;  1Q82 Q;  1NTK E;  3L70 E;  1OXZ A;  1LT9 A;  1X8Y A;  2GUS A;  5KLI C;  1FZA A;  1NTZ D;  1Q2N A;  2HLO A;  1OIP A;  3HE5 A;  2VRS A;  2WT7 B;  1ZRT D;  2Y9Y A;  2R5D A;  1S72 P;  2H7H A;  1SQQ D;  1VQP P;  2O01 J;  3AE6 C;  1J1D B;  1IC2 A;  4UB6 H;  2QRX A;  2AXT H;  1GTW A;  1HTL C;  2KOG A;  1NAF A;  2KIK A;  3CMA P;  1N7S C;  2WPQ A;  3AE8 C;  5AVS B;  4H13 C;  2POH A;  2KSE A;  5KKZ B;  2B87 A;  1PP9 J;  2MKV A;  2YO3 A;  3HUS B;  2YXQ B;  5APT A;  3Q5S A;  4UB8 E;  2QA4 P;  4HYT B;  3CC7 P;  3FXD A;  2BCC G;  4GDO A;  4U3F G;  3L74 J;  2GM4 A;  1EC5 A;  1T6A A;  1EDJ A;  2FFD B;  2P1J A;  3H1H E;  3RK3 C;  1KOR A;  3V6I A;  1KTM A;  3TYY A;  5APU A;  1FZF A;  1GW4 A;  1U7M A;  3P8M C;  5AW3 B;  3H1K G;  1FZB A;  2KUB A;  1W5C E;  4ZKU A;  4EDF A;  1L0L J;  1SQX J;  4RES B;  3WU2 H;  3PHL A;  4BRY B;  2FYU J;  1AFO A;  2E5Y A;  2LXB A;  3E1R A;  2FYZ A;  4PJ0 E;  1NTM K;  1YHQ P;  5KJ7 C;  4LLH A;  3H1I E;  1XTG B;  1G2C A;  2OGU A;  4L73 A;  1EDL A;  1IFP A;  3VP9 A;  3WUV A;  3L74 E;  1YQ4 C;  5K5G B;  1PGP A;  3Q1M A;  5DJT B;  1DD4 A;  3CCM P;  3I55 P;  3H32 A;  1SQV J;  3MHV A;  2QJY C;  2M3E A;  4I1L A;  3AE3 C;  1RF1 B;  1L0L E;  1SQB E;  1NU1 J;  3L72 J;  1KQL A;  1SQX E;  1IJD B;  2V4H A;  2RH0 A;  2JEE A;  2FY8 A;  2KNC B;  3SFD C;  1JCC A;  3NFQ A;  2YKO A;  1D7M A;  5KLV K;  1M1J B;  4PD4 D;  4LGD E;  4GKG A;  2PFX A;  1KIL D;  2IPP A;  2M3B A;  1IK9 A;  2Q1K A;  3GHG A;  1DD3 A;  1LNQ A;  3CCV P;  3P32 A;  3CX5 H;  1MKM A;  4OGQ D;  1SQV E;  1NTK D;  2KLV A;  5H2F E;  1L4A D;  2OYI A;  1P84 I;  1GL2 A;  3Q3D A;  1PGJ A;  1YJN P;  1KB9 H;  1KN7 A;  1H88 A;  1NU1 E;  2A06 E;  4IOI H;  1SS1 A;  1NHL A;  1L0L K;  1SQB K;  2P67 A;  1SP4 A;  1KFM A;  2YXR B;  2ZAE B;  3TGU G;  2C0X A;  1H8A A;  4U3F J;  2FXM A;  1EDI A;  3G9R A;  3HD7 D;  1KIL B;  1GDT A;  2JR8 A;  3W67 A;  1QLE D;  1LTA C;  3ZDM A;  2KXP B;  2H89 C;  4OGQ B;  3LID A;  2QM8 A;  3VMZ A;  3H1K J;  4JQ0 D;  4WY4 D;  3L37 A;  1KZU B;  2I8D A;  1L4A B;  1FZC A;  4C7N B;  2KZI A;  1VQN P;  2ZYA A;  2N1T A;  1PV3 A;  1LT9 B;  4EIJ A;  3M0A A;  1KD1 Q;  3HE5 B;  1GD2 E;  3V4Q A;  1BDD A;  3HD7 B;  3PJS K;  3A0H H;  2XZR A;  1BCC G;  2BCC E;  4U3F E;  2IBZ I;  1RQV A;  1LTJ A;  2IYO A;  5GTI E;  1YQ3 C;  5E79 H;  4WY4 B;  2Z4E A;  1WMK A;  2ZT9 C;  1Y47 A;  3Q2Y A;  5KTB A;  3OW2 O;  1W2B O;  4I7Z C;  1RF0 A;  1P84 D;  2N9Y B;  1PP9 D;  1ZLL A;  3H1K E;  3V2Q A;  1QL2 A;  2FKW B;  2ZXE B;  3AEF C;  5DJU B;  1J2J B;  4Y28 J;  3MUD C;  3Q5P A;  5APS A;  4AYC A;  2YIU B;  2Q3I A;  2A45 H;  5GTH E;  1EZV I;  1KB9 E;  1NTM G;  3L74 D;  4M3L A;  2R3S A;  4Y99 B;  3BRT B;  5AW7 B;  1NVO A;  4ZNC A;  1M8O B;  2L91 A;  1PZQ A;  4D6T D;  1W2E A;  3NMD A;  3CLQ A;  1CSB A;  5CMZ A;  3KZI H;  2JKV A;  5C39 A;  2RMZ A;  1YBK A;  1PPJ G;  3B4S A;  1SQX D;  1NKN A;  5B66 H;  2FYU D;  4IL6 X;  1VPC A;  2G3A A;  1E5W A;  3W68 A;  3FWL A;  1N73 A;  1G2C B;  1QEX A;  1HF9 A;  1DEE G;  2OYH C;  1Z56 A;  2QJP B;  3RBZ A;  2P58 A;  3RBX A;  3H1J G;  1BSN A;  3KDP B;  2GUV A;  3TGU J;  2ZYD A;  2IBZ D;  3KYQ A;  5APX A;  2WIT A;  1U7J A;  3H32 B;  4IFD K;  3PTZ A;  3L75 G;  3RK3 E;  5AW8 B;  1Q90 D;  1SQV D;  3CX5 I;  1H0T A;  3K5B A;  1RY3 A;  3KPE A;  3O6Q A;  1M56 D;  1A02 J;  3V5B A;  1LP1 A;  3L72 D;  3N7N A;  3CCQ P;  5KJ7 A;  1LWU A;  2AEM A;  3F89 A;  1BGY G;  1FC2 C;  3PRJ A;  1EZV D;  1ZW0 A;  2HR3 A;  2PP6 A;  3E7K A;  3L73 G;  2ZVN B;  3L36 A;  5KAI E;  3GHG B;  5AVW B;  3TGU E;  1HH0 A;  1JY3 N;  2E74 C;  2IYP A;  2QVA A;  4UB8 H;  1BCC J;  3L70 J;  2WPV B;  3H1L D;  2PGD A;  1VQ9 P;  1NYH A;  2C9L Y;  2O01 N;  2K3R A;  2H8P D;  2OYI B;  2WSE J;  2CPS A;  3BAT A;  3A0B H;  2N1T D;  2IFM A;  1SQP G;  2AXC A;  1S2E A;  1N7L A;  2K88 A;  4YXW H;  3RK2 D;  2HG5 D;  2O01 H;  2E76 D;  1BE3 G;  1QGK B;  1M7L A;  2V7Q H;  1OWA A;  4U3F D;  5CCG C;  4DZO A;  1FZG A;  1JY3 P;  1NTM J;  2W27 A;  2KSJ A;  2J59 M;  1HVV A;  4PJ0 H;  1HUC A;  2W6A A;  5AW1 B;  1LJ2 A;  3CX5 D;  3H1K D;  4BWN A;  1FZC B;  2HFE D;  2O3J A;  1BCC E;  3FX0 A;  1AJY A;  2N1T B;  3G4S P;  5KKZ C;  1HJ0 A;  5CCH D;  1AVO A;  1L2P A;  3HUS C;  4WVZ A;  3H1H J;  2RN0 A;  5AW9 B;  1KB9 D;  3RK2 B;  1SVF A;  2E76 B;  1G1J A;  3D6Z A;  2A45 I;  2V7Q J;  2HOD B;  2FFD C;  5APQ A;  4YTP C;  1XTC C;  5APV A;  3H1J J;  5L8R J;  1L0N G;  2HPC A;  1NTM E;  3AE4 C;  5APW A;  1IO4 A;  3H1I J;  5KLV J;  1T8Z A;  3L75 J;  2FYN B;  5TIS E;  4JPZ B;  1YJW P;  4C7R A;  3M9B A;  3P8C E;  4XFJ A;  5KLI B;  2QE7 H;  2KYV A;  3A0B E;  1RE3 C;  1PPJ E;  5AVU B;  1VQO P;  3IR9 A;  2NRG A;  4L76 A;  4N6J A;  3BAS A;  1GK6 A;  4PD4 I;  2OTK E;  1SFC D;  3I5C A;  3CPW O;  4I6M C;  3TSI A;  3LIE A;  1SQB J;  3L73 J;  1OZH A;  1CW5 A;  3GF3 A;  5H2F H;  2KK7 A;  3H1J E;  5TJH A;  1ZME C;  1OVU A;  1NH4 A;  2KP8 A;  3WMM 0;  1OFC X;  2YNY A;  4W7Z A;  2R3C A;  3U59 A;  2JO1 A;  1NTZ G;  1RF1 C;  5KLV E;  1ZR4 A;  3V4W A;  3L71 J;  3L75 E;  5AVQ B;  2KS1 A;  1N73 B;  3CC4 P;  1PL5 A;  3A2A A;  3IFM A;  2WPR A;  4YXD C;  1SFC B;  1JOC A;  4CPG A;  3RK3 B;  4U7J A;  3CXH E;  1BGY E;  3GLM A;  1BE3 J;  3TGU D;  3AE7 C;  1M1J C;  3VMY A;  3B5N A;  3CWB D;  1VQ4 P;  2Y0C A;  3L73 E;  3G71 P;  2ITA A;  1S5L X;  1H0T B;  2CK3 H;  2QIW A;  1IFI A;  2Z5I A;  3O6Q B;  3FGA D;  2E42 A;  2YKQ A;  1LP1 B;  1BSH A;  1LWU B;  2I1J A;  2JJL A;  3L71 E;  1HGZ A;  1KYO H;  3L35 A;  4PV1 D;  2B88 A;  3V2N A;  1AVY A;  2XDJ A;  5GTI H;  5EFW B;  1URQ C;  3R2P A;  5AVZ B;  1SQP E;  2NPS D;  3BCC G; 
#chains in the Genus database with same CATH homology
 2Q3I A;  2A45 H;  1DEB A;  2R32 A;  1IFN A;  4GT1 A;  3VOP A;  1N73 C;  1YYC A;  4M3L A;  2IX7 C;  1FJK A;  4Y99 B;  1JTH B;  3N4X A;  3BRT B;  1NTK K;  3U1A A;  3G3Z A;  1FU1 A;  1X9V A;  3RK3 D;  1FDM A;  5AW7 B;  1SFC C;  1N7S B;  3V2P A;  1CI6 B;  1MFZ A;  1T3U A;  3VYI A;  3M91 A;  1T3J A;  1N2D C;  1JY2 P;  1W2E A;  3NMD A;  4KHX A;  2CPB A;  2BAS A;  3CLQ A;  1CSB A;  5CMZ A;  4N78 D;  3H6P A;  2WZ7 A;  3A3Y B;  1NKN A;  1FZE A;  2XNX A;  5CCG D;  3MUD A;  3HD7 C;  1KIL A;  1LTS C;  3M0D A;  2NPS B;  2PAJ A;  1VPC A;  3MD0 A;  1IFD A;  1N86 A;  2O1J A;  5KJ7 D;  3TK1 A;  1E5W A;  1LTJ C;  2Q7C A;  4WB4 A;  2NPS A;  2M8R A;  2ZFC A;  1N73 A;  1G2C B;  1LWU C;  2OYH C;  4WY4 C;  1Z56 A;  1SQP K;  1GZL A;  1L4A A;  1HWT C;  3KDP B;  3P8C D;  2GUV A;  1HGV A;  1OXZ A;  3KYQ A;  5APX A;  1LT9 A;  1X8Y A;  2GUS A;  1FZA A;  1IFM A;  2WIT A;  1FJP A;  3H32 B;  4OH8 B;  4IFD K;  2HLO A;  4I2L C;  3HE5 A;  2VRS A;  3NTN A;  5AW8 B;  2WT7 B;  3E1I A;  2R5D A;  2H7H A;  2WT7 A;  1RY3 A;  3KPE A;  1J1D B;  1IC2 A;  4Y99 C;  1A02 J;  3V5B A;  3M9H A;  3N7N A;  1GTW A;  5KJ7 A;  2XV5 A;  1LWU A;  1HTL C;  5AVT B;  1KFN A;  2KOG A;  2HPC B;  3T97 A;  1NAF A;  1PFI A;  1N7S C;  2OYH A;  2WPQ A;  3HE4 A;  5AVS B;  2PP6 A;  1HJB A;  1S9K E;  2POH A;  3HRN A;  2LKM A;  1RE4 A;  1AQ5 A;  2YO3 A;  3RL0 C;  3HUS B;  1KIL C;  5APT A;  1JY2 O;  3M0D C;  5BU8 B;  1MZ9 A;  3HTK B;  4HYT B;  1URQ D;  3O8Z A;  3L36 A;  4W80 A;  1ZV8 A;  1JNM A;  2NPS C;  3GHG B;  5AVW B;  1HBW A;  1HH0 A;  2Q5U A;  1JY3 N;  2KB7 P;  1FAV A;  2QM7 A;  5APY A;  2GM4 A;  1MV8 A;  1L0N K;  1YTZ T;  4HH2 A;  2FFD B;  2P1J A;  3P7K A;  5BU5 A;  1L4A C;  1A02 F;  1JTH A;  2XKM A;  2C9L Y;  2H8P D;  1GK4 A;  2OYI B;  3RK3 C;  5CHX A;  3CL3 D;  3TYY A;  2FFD A;  2CPS A;  3BAT A;  5APU A;  3TNU B;  1N7S A;  2L5G B;  1GW4 A;  1FZF A;  1NO4 A;  1LT9 C;  2N1T D;  1CI6 A;  3P8M C;  5AW3 B;  3SWF A;  1FZB A;  2A45 G;  3SWY A;  2IFM A;  2YKP A;  1LTT C;  3BVH A;  1NKZ B;  4ZKU A;  3MGN A;  2YMY A;  3LW5 H;  3B5N D;  1JO5 A;  1N7L A;  4DOJ A;  3M06 A;  3RK2 D;  2HG5 D;  1MUU A;  2O01 H;  1T2K D;  4RES B;  1M7L A;  1AFO A;  1URQ B;  1SQX K;  1OWA A;  5CCG C;  3II6 A;  4DZO A;  1JY3 P;  1FZG A;  2FYU K;  2W6B A;  2FYZ A;  1JUN A;  2W27 A;  2KSJ A;  5AVY B;  1NTM K;  5KJ7 C;  1JMM A;  1LTG C;  1VDF A;  4LLH A;  2J59 M;  3EQ2 A;  2H43 A;  1HVV A;  2C0W A;  4W7Y A;  1XTG B;  1G2C A;  3CI9 A;  1HUC A;  2W6A A;  1ZN5 A;  4IFM A;  5AW1 B;  5AVX B;  3VP9 A;  1LTB C;  1FZC B;  4ZKP A;  3OA7 A;  4LC1 A;  2HFE D;  1RE4 C;  1SLQ A;  3OAK A;  2N1T B;  5CCH D;  3KQG A;  3HUS C;  3B5N B;  5AW9 B;  1NTZ K;  3H32 A;  3RK2 B;  1SVF A;  1NOH A;  1G1J A;  2E43 A;  2MJZ A;  1SQV K;  2A45 I;  5CCG A;  3A5T A;  4I1L A;  4N78 E;  3VMX A;  1RF1 B;  1WT6 A;  3VTP C;  2WSE H;  1SQQ K;  3B8E B;  2HOD B;  2J58 A;  1GL2 D;  1KQL A;  2FFD C;  2N9B A;  5APQ A;  1RF1 A;  1IJD B;  1NU1 K;  1XTC C;  5CJ0 A;  5APV A;  3BRV B;  2WTY A;  2HOD A;  5AW0 B;  2R5B A;  2HPC A;  4XA4 A;  2JEE A;  3L4F A;  5APW A;  3MIW A;  1IO4 A;  1JCC A;  3NFQ A;  1CZQ A;  2YKO A;  1T8Z A;  4JYB A;  1FBM A;  5AVR B;  1M1J B;  5KLV K;  3HUS A;  1FOS F;  1NWQ A;  2C9N Y;  4LGD E;  4C46 A;  4O9B A;  3HTK A;  4GKG A;  3RL0 D;  4C7R A;  1KIL D;  3M9B A;  3P8C E;  1GW3 A;  5CCH A;  2IPP A;  2M3B A;  1IK9 A;  3GHG A;  3OJA B;  2KYV A;  1RE3 C;  3A7O A;  3P32 A;  5AVU B;  1JY3 O;  3IR9 A;  4N6J A;  3VN0 A;  1GL2 B;  3NXS A;  3BAS A;  1GK6 A;  2KLV A;  3M9Q A;  5AW6 B;  2WWW A;  1L4A D;  2OYI A;  1SFC D;  1FZC C;  3I5C A;  1GU5 A;  1GL2 A;  4I6M C;  3TNU A;  3TSI A;  4B86 A;  5AW5 B;  2N1T C;  3LIE A;  1H88 A;  3C9I A;  1CW5 A;  1YTZ I;  1NHL A;  1L0L K;  1SQB K;  2P67 A;  1SP4 A;  1KFM A;  2HYN A;  3U1C A;  3B5N C;  1J1E B;  1GU4 A;  2C0X A;  5AW2 B;  5AW4 B;  1H8A A;  3RK2 C;  1T2K C;  4AUW A;  5BVZ A;  2KP8 A;  1NH4 A;  3WMM 0;  2YNY A;  2FXM A;  4W7Z A;  2R3C A;  3HD7 D;  3RL0 B;  1JCD A;  1URQ A;  3U59 A;  1KIL B;  4XE5 B;  1GDT A;  1J1D C;  1H89 A;  1RF1 C;  1EQ7 A;  3V4W A;  1ZR4 A;  4EOT A;  1LTA C;  5AVQ B;  1RE3 A;  2P2U A;  1N73 B;  1X79 B;  3LID A;  2QM8 A;  2XU6 A;  3A2A A;  3IFM A;  3VMZ A;  1S9K D;  4WY4 D;  1DH3 A;  2WPR A;  3L37 A;  1KZU B;  1WRG A;  4WBA A;  1L4A B;  1SFC B;  4C7N B;  1FZC A;  3PP5 A;  1JOC A;  2N1T A;  3EFG A;  3RK3 B;  5AVV B;  4AQR D;  1SFC A;  4C7N A;  1RF0 C;  1LT9 B;  5CCH C;  4EIJ A;  3M0A A;  1LGH B;  1M1J C;  3VMY A;  3B5N A;  2WPS A;  3GHG C;  4N3Y B;  3HE5 B;  2YO2 A;  3MTU E;  2Q9I A;  2IFN A;  3UIA A;  1GD2 E;  3V4Q A;  1DX7 A;  3HD7 B;  1ZR2 A;  2XZR A;  4JF7 A;  3HD7 A;  1IFI A;  2O1K A;  1LTJ B;  2P7J A;  2Z5I A;  2OYI C;  2E42 A;  1QL1 A;  2YKQ A;  1GL2 C;  1LWU B;  3V2R A;  2I1J A;  1LTJ A;  1LTI C;  1N7S D;  1G1I A;  2OYH B;  4WY4 B;  2Z4E A;  3HE4 B;  2JJL A;  1HGZ A;  3L35 A;  5KTB A;  3V2N A;  4WY4 A;  2XDJ A;  1JY2 N;  2I1K A;  2OAR A;  1RF0 A;  2WSF H;  2WSC H;  5CJ4 A;  1J1E C;  1URQ C;  4IFF A;  3R2P A;  1ZLL A;  3V2Q A;  4GIF A;  1M1J A;  1QL2 A;  2FKW B;  2ZXE B;  1J2J B;  3VP8 A;  1IFJ A;  2Z5H A;  5AVZ B;  4JYC A;  2NPS D;  5APS A;  4AYC A;  1FOS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...