2R5BA

Structure of the gp41 n-trimer in complex with the hiv entry inhibitor pie7
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
b'RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 N-peptide
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
molecule tags Viral protein/inhibitor
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r5bA00
2XV5A 3L37A 1FOSE 3M0DA 3TK1A 1GK6A 5AVTB 5APTA 3OAKA 1JUNA 5APSA 1S9KE 2VRSA 5AVXB 2R5BA 3VTPC 2C9LY 2BASA 1NWQA 5AW9B 1J2JB 3KDPB 2IPPA 1CSBA 3A2AA 1GK4A 3IR9A 5AVSB 3VYIA 2Z5HA 4XE5B 3HE4B 1SLQA 4HYTB 2WPSA 3HTKA 3TNUA 1T2KD 5AW7B 5AW6B 2XZRA 3HE5A 3M06A 5AW4B 2WT7B 1OXZA 5AW5B 1CI6A 3A7OA 2WPQA 3B8EB 2YO2A 5AVVB 5APUA 1MFZA 5AVYB 5AW8B 5AVZB 2Q3IA 5AW1B 2QM8A 1H88A 1GZLA 2W6AA 4C7NA 2E42A 1H89A 2C9NY 2QM7A 2JJLA 4C7NB 1FOSF 2R5DA 2H7HA 4C46A 1FAVA 4AQRD 3TYYA 1DH3A 1MUUA 4JYCA 1SP4A 4DZOA 1GTWA 1CZQA 3M91A 4I2LC 1T2KC 3L35A 3V5BA 1MV8A 2P67A 1OWAA 3A5TA 2WWWA 3P32A 5AW0B 5APWA 3MD0A 5APQA 4EOTA 5APVA 4GT1A 3TNUB 2WPRA 2KP8A 5APYA 1A02J 3HE5B 2WTYA 2R32A 3V4QA 4RESB 1S9KD 1H8AA 1CI6B 3MGNA 3L36A 4M3LA 2P2UA 2ZXEB 1G2CB 5AW3B 5CMZA 3P8MC 4JYBA 1GU5A 2P7JA 2ZFCA 3NFQA 1YYCA 4AYCA 4GKGA 5AVQB 3M9BA 3SWFA 1A02F 4KHXA 5APXA 2R3CA 4AUWA 3UIAA 5AVWB 1HJBA 3VMZA 5AVRB 3NTNA 1KQLA 3NMDA 3V4WA 4B86A 5AW2B 3KQGA 2YO3A 5AVUB 3I5CA 2XU6A 3VN0A 1GD2E 2Q5UA 1X8YA 3LIDA 3NXSA 4LC1A 2Z5IA 2W27A 3P7KA 2E43A 1NAFA 3O8ZA 3A3YB 3VMYA 3VMXA 3HE4A 1GU4A 1HWTC 2N9BA 3M0AA 1HBWA 3M9HA 2WT7A 2Q7CA 1JNMA 3LIEA 2YNYA 4I6MC 3T97A 1HUCA 1IO4A
chains in the Genus database with same CATH superfamily
2HFED 2OYIA 2WZ7A 1DX7A 2YKQA 3OAKA 4IL6H 1M90Q 2K9YA 3G6EP 2IX7C 2IZ1A 3AEDC 4JF7A 2KIKA 3S9OA 3BRVB 1E79H 1KQFB 1PPJD 3VYIA 4WY4C 1KILB 1JCCA 1UIIA 3I56P 2QM8A 3RL0g 1FOSF 2GA1A 2H7HA 3TYYA 1JEKA 2Y0CA 4YPCA 4DZOA 3A0BH 1JY2P 2P67A 4GOEA 1YBKA 1YITP 2V7QJ 3H1JE 3FX0A 4EI2A 3GF7A 4GODA 1G2CA 4H13D 3B71A 2P2UA 5AW3B 3B5NA 1EQ7A 1LTSC 3CWBJ 2GM4A 2P1JA 3H32B 1KTMA 4H44B 1L4AB 1GW4A 2FFDB 2O01J 1P84E 5H2FH 3KQGA 3L71E 2OYHA 1LTGC 3WU2H 1L2PA 2XNDH 3A3YB 1VF5D 3CX5I 3GW6A 2E75C 5KAIE 2C0XA 5CJ0A 3M9HA 2YNYA 5TISE 2K9JB 4H44C 2Q1KA 3L37A 1OX3A 5APTA 2FFDC 3TGUE 2Q3EA 2YIUC 3VTPC 4OWFA 5KLIB 2WT7B 5GTHH 1ZOYC 2JKVA 2PFXA 1FDIA 3U1CA 3JC22 1ZR4A 2CPBA 2W6JH 1LGHB 1RE4A 2IDBA 1N73C 2HYNA 4XFJA 2QJYB 5CBNA 2QEXP 1AV1A 2ZVNB 1NTMG 4KT0J 3E7KA 2KOGA 3CL3D 1T3JA 4GOFA 1GU5A 2P7JA 3NFQA 4GKGA 1RF1C 1JY3N 4YXWH 1EZVD 5AW2B 4PJ0H 4NPFX 5AVUB 1OVRA 1VQNP 3O6QB 2KB7P 3VMXA 3AE4C 1HBWA 1JNMA 1QGKB 1NTZG 2KZJA 2LKMA 2AXTE 4U3FD 2W90A 1SFCB 1KILD 2KUBA 2K37A 1PIXA 3BATA 2JP3A 1IZNB 1LTTC 5AW9B 3D6ZA 3AE5C 2HPCA 2FXOA 3IR9A 3BCCG 1ZRTE 1YI2P 3KPEA 2LXBA 1N86A 2E76C 1BCCJ 1SQPE 3HE5A 3M06A 1PP9E 1EZVE 3HD7C 1RH5B 2IBZE 1L0ND 1URQD 4N3YB 4A7PA 4HB1A 2IYOA 2W6BA 5KKZB 1DH3A 3AECC 3EQ2A 5DJTB 1JMBA 1HVVA 5CCGC 1YTZI 1X79B 1J1DC 1L4AD 5B66E 4U3FE 1KFNA 1H8AA 3JCUH 1PGJA 3V2PA 1J1EC 4WWIA 2QIWA 5KKZC 1DEBA 2KS1A 3NTNA 2I1KA 2ZJSE 2ZYAA 3AE8C 4U3FJ 2WSFH 5CJ4A 1RY3A 2G8YA 3LW5H 5C39A 3A0HH 2Q5UA 1L0NE 4PV1B 1S72P 1AJYA 4YXDC 1U7MA 2IYPA 4WBAA 4I7ZC 3HUSC 1FJPA 3V2NA 4XA4A 3L73J 3E1IA 2Y9YA 3TK1A 1L0NJ 1LP1A 3H1KD 4N78E 1JY3P 1N7SD 1LT9A 1JOCA 2LR2A 4DCKA 2QRXA 1IFPA 2BASA 4NPEA 4RO0A 4WVZA 1CSBA 3A2AA 2OARA 1LTJA 1KB9I 1L0NK 3CX5D 3L75G 1WT6A 1OXZA 1AQ5A 3H25A 4GIFA 2WSEH 5AVZB 4C7NA 3M0DC 2FYUG 4D6TE 1FS0E 5DJUB 2KLVA 2KNCB 1T2KC 1VQ9P 3A5TA 1SQBG 2B88A 5B5EH 1Q2NA 1NKZB 2H89C 1FZCB 3H1KE 1CI6B 1M1JA 2KSEA 3IF4A 4AYCA 2HG5D 2H8PD 2N1TB 1M56D 1Q90D 4UB6E 1OZHA 5AVWB 3H1KJ 1Y8AA 4IL6X 2YO3A 1VQ6P 2E74B 3WUUA 5KLVD 1QVGO 3R2PA 4R4MA 1YQ4C 1N8RQ 3PP5A 2E43A 1NU1E 1SQXG 1G1IA 4R4LA 4W80A 3U1AA 4ZKPA 2BCCG 1DIPA 4OGQB 3B4SA 3LIEA 3T97A 1FZGA 1UIXA 1SQQG 2ITAA 1LWUA 3H1LG 3FWLA 5E79E 2VRSA 2QA4P 2W83C 3Q5SA 4IOIH 2JR8A 2M0BA 3KDPB 1OW6A 3CXHH 3HE4B 3PH0A 3HTKA 3SSUA 3TNUA 2E5TA 1NU1K 1T3UA 2FYNC 2NPSB 2OYIC 2SPZA 1KYOE 3RK2C 2M8RA 2E42A 2QM7A 3W68A 3Q1MA 5K5GB 3CI9A 1NKNA 5AW0B 2ZT9B 5APVA 2OTKE 1RE3A 4H13C 1DD4A 5KLVJ 2Y0EA 3PTZA 3RK3D 2KI7B 2QG4A 1G2CB 5CMZA 1SQVE 2ZYDA 4PV1D 2PGDA 1EC5A 2WVRA 3B5NB 3KHUA 1LTBC 3PRJA 2KYVA 3D70A 3H1IJ 1XTCC 1RF0A 3V4WA 3CC7P 3VN0A 2QJKC 1NH4A 1BE3G 1NAYA 3VMYA 1VL2A 3L74G 2YMYA 4ZMDA 3B5NC 5CCHA 1WRGA 1SQVK 1IO4A 2PRRA 2WSCH 4BWNA 2HR3A 2XV5A 3RL0C 1FOSE 1GK6A 1IC2A 5APSA 3RK3E 3MUDA 1NO4A 1X9VA 1AQTA 1JMMA 2UWJE 2OYHC 1BGYG 5AVSB 4WY4B 1VDFA 1S3JA 2M5AB 2K88A 3L70D 5CCHD 5AW8B 3CXHI 1OVUA 1S5LE 2OTLP 1GL2A 3SFDC 2R3SA 1KB9D 2N1TD 3MD0A 3AE2C 5APQA 1R8EA 3S1KA 4YTPC 4HJGH 5KJ7D 3II6A 2E74D 1HF9A 4H0LD 4JYBA 1IFNA 1Q7YQ 2A06D 3IAOA 3CWBE 5AVRB 1RE4C 1GL2D 3PLNA 1M7LA 2G3AA 3H1JG 3SFEC 2QJPC 3L70E 3NXSA 3S4RA 2P58A 1HGZA 3KYQA 1OW7A 4WB4A 2E75B 2YMKA 2N9BA 4N6JA 3USSA 1PPJE 3V2QA 1KB9E 3L70J 2YIUB 4PD4D 2NPSD 3L71G 3GHGA 3QWOC 1GK4A 2A06E 1L0LD 1PZQA 2HODA 2AXCA 3ABVC 3RBZA 1PFIA 1QX8A 2WPQA 1OVVA 1W2EA 3TGUG 5KAFE 1NJIQ 1N73B 3FGAD 1EXIA 5GTIE 3H6PA 3AE1C 1NTMD 5APWA 1KC8Q 3H1HD 3Q2YA 4EDFA 4UB8H 1S9KD 1ZP0C 4PD4E 4M3LA 3C1LA 3OJAB 4KJMA 1RF1B 4IFDK 4AUWA 3UIAA 1L0LE 1NTKD 1BCCD 1VQPP 2LXCB 2RMZA 2O3JA 2XU6A 4LC1A 3P7KA 1NAFA 1NTZD 2ZYGA 3M0AA 1L0LJ 3CMEP 1KILA 2Q7CA 2WSFJ 4Y99B 2D2CC 3AEFC 3LW5J 1HUCA 1NTME 1PGQA 2FXMA 3H1HE 1KFMA 3RBXA 1M57D 1PGOA 1S9KE 1L0LK 4L74A 1M1KQ 1FZEA 2POHA 2E76B 1NTMJ 3H1HJ 1EXJA 5AW7B 1URQA 4Y99C 1NTKE 3HD7B 5AW5B 3VP8A 1BCCE 1QLED 1IFDA 2YO2A 5AVVB 4QMAA 5AVYB 1PV3A 3MP7B 4RJTA 1NTMK 2B87B 4C7NB 2R5DA 3H32A 4DJGA 4O9BA 1LT9C 1GW3A 1MUUA 2FYZA 1S4XA 1L4AA 2BEQD 3AE9C 5BVZA 1NTKJ 2WSEJ 2YXRB 1J1DB 1LTJC 2KP8A 1LJ2A 3FWNA 1SQPG 1PP9G 1P84H 1LTIC 3L73D 4RESB 1FU1A 1EZVG 5BU5A 1J1EB 3D71A 2MKVA 2IBZG 4BRYA 1NTZJ 1NTKK 4GDOA 3CXHD 2ZFCA 2KLUA 1A02F 4JBZA 2K9JA 3CCMP 5KAIH 2E75D 1K8AQ 1YIJP 1KZUB 5TISH 1JB0J 3D6YA 4H44D 3N4XA 3VMAA 2CPSA 1JCDA 4CPGA 2IZ0A 3SWKA 1KILE 1VPCA 4RKUJ 1JO5A 3K5BA 2WSSH 4I7ZB 1H0TB 3HUSB 1GU4A 3L72D 2P10A 5M1BA 1M1JC 1D7MA 2WT7A 1IK9A 3MZWB 3C9IA 1N7SA 3Q5RA 3CCEP 4W7YA 1RQUA 3L73E 2A45G 1J2JB 3EWKA 1TU3F 3TF5A 5AW4B 1BDCA 1VQ5P 2E5YA 2IFNA 5AW1B 1LWUC 5TJHA 1AFOA 1E5WA 3L72E 3WMM0 3MIWA 3L35A 3KZIE 3MTUE 1NVOA 1FBMA 3RGUA 1GMJA 3RK3C 2K1AA 5CHXA 3O6QA 3CMAP 2PP6A 1PL5A 3L72J 2FY8A 3JSVC 4D6TG 2XNXA 3Q5PA 1HJBA 1P84I 1SFCA 2ZVOB 2AXTH 3I5CA 4U7JA 1VQ8P 1HGVA 2JWAA 3H1KG 4ZKUA 1RE3C 2YKOA 1M8OB 3HRNA 3O8ZA 1NGMB 4TT3H 1NOHA 3CX5E 2E76D 3BRTB 2Z4EA 1RF0C 3AEBC 3HD7D 1ZR2A 1ZN5A 1EDJA 1SFCD 3P8CD 1IFIA 1W2BO 1NU1G 1AVOA 2WSCJ 4MN4C 1HTLC 2XZRA 3H1ID 2FYNB 2HLOA 5CCHC 3A7OA 4IL6E 5B66H 2OYIB 3RK2B 1NYHA 2WMMA 2C9NY 4DT0A 1KD1Q 1BSHA 2BEZF 3SWYA 3MUDC 4JYCA 2WWWA 3P32A 4GT1A 4H13B 2YXQB 2WPRA 1K9MQ 1SQXJ 2NZ2A 1LTAC 2A45H 2KZIA 2FKWB 2BCCJ 4H0LC 5KLVE 3I55P 3P8CE 1SQQJ 1AVYA 1T8ZA 1X22A 2IFMA 3A0BE 1RQVA 1R5SA 1GL2C 1BDDA 2B89A 4ASWA 3BVHA 3VMZA 1NHLA 3G71P 1U57A 2OYOA 3H1IE 2QJKB 4HH2A 1BE3D 1JTHA 1VF5B 2YKPA 1SQVG 1KMIZ 3GG2A 1Y9BA 5KLVK 1HH0A 4EIJA 1VQ4P 1FDOA 1OMIA 3AE3C 3RL0B 5H2FE 2OTJP 3CCVP 4Z1MH 1BGYD 3WU2E 2C9LY 4Y28J 4DOJA 1NWQA 3VP9A 2KNCA 2OYHB 1VF5C 3CCLP 2R44A 2Y9ZA 3CLQA 1SLQA 1EZVI 1T2KD 1HJ0A 2IBZI 1FZCA 2KSJA 1CI6A 3F89A 1AA0A 1BE3E 1MFZA 2KXPB 1H88A 3IN6A 1H89A 5KTBA 1ZMEC 2N1TA 1FAVA 2FBWC 4UB6H 3V5BA 3GHGC 5KJ7A 1BE3J 4ZNCA 1U7JA 5GTHE 1ZW0A 3L74J 2L91A 2O1KA 2ZXEB 1FZBA 3GLMA 3FXEA 3L4FA 3MHVA 1OW8A 1YYCA 5AVQB 1FZFA 3H1JD 1KQLA 3GMAA 3OA7A 2A45I 2QJPB 2J58A 1BGYJ 5E79H 4BXLA 2XKMA 3PJSK 2O1JA 3C8VA 1KN7A 3HE4A 1HWTC 4K3AA 2NPSA 1P84D 3CWBG 4OGQD 1N7LA 4LLHA 4PJ0E 2Q6QA 3L71D 5AVXB 2KK7A 1KYOH 3L70G 3RK2D 2QE7H 2WPVB 2WPSA 1JM0A 1S2EA 1PPJG 2JWDA 1URQB 1KILC 3B8EB 3TGUD 3G4SP 3OW2O 1GZLA 2W6AA 3Q3DA 1WMKA 2JJLA 4IFFA 3EFGA 1QVFO 4C46A 1VQLP 3M9QA 2C0WA 2AEJA 1GTWA 4I2LC 3H1JJ 2HPCB 2A06G 2L5GB 5APYA 3HE5B 1URQC 2ZT9D 3MGNA 3L36A 3WUVA 4BRYB 1Y47A 2Y0DA 1QL2A 2R3CA 3ZDMA 3B5ND 3U59A 3FXDA 1T6AA 1S1CX 1MFTA 1L4AC 2GUVA 3L71J 3CCUP 3RL0D 3CD6P 2J59M 3JCUE 1X8YA 1IK7A 4NPDA 4WY4A 1X0TA 2M5AA 2D2CB 1FE6A 4JPZB 1L0LG 3TGUJ 1N7SB 2KS1B 1OIPA 4L73A 2V4HA 4I1LA 3A0HE 2W8ZA 1Q82Q 1SS1A 4ASVA 2B9BA 1S5LH 3CC2P 1K73Q 5KLIC 1ZV8A 1EDLA 4WY4D 1KORA 1LNQA 3GF3A 1KYOI 3H1HG 5APUA 1Q86Q 1N7SC 2V7QH 1LP1B 1RHZB 1GDTA 2QVAA 3BCCD 1LT9B 3ITKA 1FDMA 1ZRTD 3TSIA 1BSNA 1USDA 3G3ZA 1SQPD 1PP9D 1LTJB 1DD3A 4EOTA 2QJYC 1JY2O 2IBZD 1A02J 5L8RJ 2R32A 1NTKG 1BCCG 3G9RA 2O01H 3V2RA 2ZAEB 2M3BA 3AE6C 1NTZE 2OQQA 5APXA 2FFDA 1KB9H 5B5EE 3W67A 1FJKA 3LIDA 2Z5IA 3BCCE 1M1JB 1Z56A 3BASA 3E1RA 1IJDB 5AVTB 1NTZK 4OH8B 3KXDA 4TLFA 1SFCC 4OVNF 4U3FG 1N73A 3BCCJ 1ZXGA 4K35A 1MZ9A 5KAFH 1YJ9P 1SQPJ 5GTIH 1PP9J 5AW6B 1MKMA 2WITA 3EFFK 4N78D 3T97B 2Q3IA 1LWUB 1SQPK 4PD4H 3L73G 1RF1A 1L0NG 3L75D 4AQRD 3CXHE 1SP4A 1CZQA 4EYYQ 1OWAA 5EFWB 1KV4A 3RK3B 2I8DA 3HTKB 3TNUB 3VOPA 3AE7C 2WTYA 2FYUD 1YJNP 4D6TD 1YHQP 1LT1A 1IFMA 1SQBD 4KHXA 3L72G 2D2CD 4JQ0D 2RN0A 2AEFA 2N9YB 5BU8B 1ZLLA 1JTHB 1KQSO 4PV1C 1DEEG 3L75E 4IFMA 3HD7A 4I6MC 3TDKA 3CCRP 3CCSP 1K04A 2FYUE 2B87A 1SQXD 2AEMA 1NU1D 3L75J 2JO1A 1W5CE 2BCCD 5CCGA 3AEEC 2M3EA 1SQBE 2Z5HA 1SQQD 4XE5B 2H88C 1SVFA 1YQ3C 3H1LD 2FYUJ 4D6TJ 4HKZH 3AEGC 1PGPA 1VQKP 1FZAA 1QEXA 1SQBJ 1VQOP 1VQ7P 2FYUK 1OFCX 3M91A 1MV8A 1N2DC 3WUTA 2JDIH 3CPWO 5CCGD 4W7ZA 4PD4I 1SQBK 3PHLA 1FZCC 1KYOD 4H0LB 1H0TA 3HUSA 1SQXE 3P8MC 2MJZA 3F5HA 2BCCE 2ZXXA 1XTGB 1Q81Q 1EDKA 1GL2B 1SQQE 5CBOA 2N1TC 1FC2C 3H1LE 2WQYC 3CC4P 5KJ7C 3CCQP 2RH0A 1NU1J 2JEEA 2E74C 1SQVD 2W27A 2DW3A 1IFJA 1YTZT 5KLVG 1KQGB 3H1LJ 1SQXK 1CW5A 4OGQC 3M0DA 3H1IG 1JUNA 1SQQK 4C7RA 2R5BA 3L74D 1JY2N 3R4YA 1JY3O 2K3RA 3QH9A 2IPPA 2RKLA 1K05A 3AEAC 4HYTB 4L76A 3N7NA 2J5UA 3KZIH 1VQMP 2GUSA 2NRGA 2NPSC 4L75A 2FXPA 2CK3H 3GHGB 2I1JA 1YJWP 1R5LA 3CCJP 4LGDE 2HODB 2ZT9C 2XDJA 3V4QA 1SQVJ 3L74E 3M9BA 3SWFA 1QL1A 3CX5H 2O01N 2Q9IA 3NMDA 2PAJA 3IFMA 4B86A 4UB8E 1GD2E 1USEA 2OGUA 2H43A 1BGYE 1S5LX 1EDIA 3CWBD 3V6IA 1G1JA 2QSIA
chains in the Genus database with same CATH topology
2HFED 2OYIA 2WZ7A 1DX7A 2YKQA 1N7SB 1LWUA 3OAKA 4I1LA 4W7YA 2VRSA 2IX7C 2A45G 4JF7A 1J2JB 3KDPB 3BRVB 3VYIA 3HE4B 1ZV8A 4WY4C 3HTKA 3TNUA 4WY4D 1NU1K 5AW4B 1KILB 1T3UA 1JCCA 2NPSB 2IFNA 5APUA 1N7SC 5AW1B 2QM8A 2OYIC 3RK2C 1GDTA 2E42A 2M8RA 1LWUC 2QM7A 1LT9B 1FOSF 1AFOA 2H7HA 3CI9A 1FDMA 1E5WA 3TSIA 3TYYA 4DZOA 3WMM0 3G3ZA 1JY2P 3MIWA 3L35A 1NKNA 2P67A 1LTJB 5AW0B 3MTUE 4EOTA 5APVA 1FBMA 1JY2O 1A02J 1RE3A 3RK3C 2R32A 5CHXA 3RK3D 1G2CA 2O01H 2P2UA 3V2RA 2PP6A 1G2CB 5AW3B 5CMZA 3B5NA 2M3BA 1EQ7A 1LTSC 3B5NB 1LTBC 2KYVA 2GM4A 2P1JA 3H32B 5APXA 1XTCC 1RF0A 2XNXA 1HJBA 2FFDA 1L4AB 1SFCA 3V4WA 1GW4A 2FFDB 1FJKA 3KQGA 3VN0A 3I5CA 1NH4A 1HGVA 3LIDA 2OYHA 2Z5IA 1LTGC 4ZKUA 1RE3C 2YKOA 3HRNA 3O8ZA 3A3YB 3VMYA 2YMYA 1M1JB 2C0XA 5CJ0A 1Z56A 3M9HA 3B5NC 5CCHA 1NOHA 2YNYA 3BASA 1WRGA 1SQVK 1IO4A 2WSCH 3BRTB 2XV5A 3L37A 2Z4EA 3RL0C 1FOSE 1IJDB 1GK6A 1RF0C 5AVTB 5APTA 1NTZK 4OH8B 1IC2A 2FFDC 3HD7D 5APSA 1SFCC 1ZR2A 1ZN5A 3VTPC 1SFCD 3MUDA 1N73A 1NO4A 3P8CD 1X9VA 1MZ9A 1JMMA 1IFIA 2OYHC 5AVSB 4WY4B 1VDFA 1HTLC 5AW6B 2XZRA 2HLOA 2WT7B 2WITA 4N78D 5CCHC 3A7OA 2OYIB 5CCHD 5AW8B 2Q3IA 3RK2B 1LWUB 1SQPK 3U1CA 2C9NY 1RF1A 1GL2A 1ZR4A 2CPBA 3SWYA 1LGHB 1RE4A 4AQRD 1N73C 4JYCA 1SP4A 2HYNA 1CZQA 1OWAA 2WWWA 2N1TD 3P32A 3MD0A 5APQA 3RK3B 4GT1A 3HTKB 3TNUB 2WPRA 3VOPA 2WTYA 5KJ7D 1LTAC 2A45H 2FKWB 2KOGA 3II6A 3CL3D 3P8CE 1T3JA 4JYBA 1GU5A 1IFNA 2P7JA 3NFQA 1T8ZA 1IFMA 4GKGA 2IFMA 4KHXA 1RF1C 1GL2C 1JY3N 3BVHA 3VMZA 1NHLA 1RE4C 5AVRB 1GL2D 1M7LA 5AW2B 4HH2A 5AVUB 5BU8B 1JTHA 1ZLLA 3NXSA 1JTHB 1HGZA 3KYQA 2KB7P 4WB4A 2YKPA 3VMXA 2N9BA 4N6JA 1HBWA 3V2QA 1JNMA 4IFMA 3HD7A 5KLVK 1HH0A 4I6MC 4EIJA 3RL0B 2LKMA 1SFCB 1KILD 2NPSD 2C9LY 4DOJA 3BATA 1NWQA 3VP9A 1LTTC 5AW9B 2OYHB 3GHGA 5CCGA 2HPCA 1GK4A 3IR9A 2Z5HA 4XE5B 3CLQA 3KPEA 1SLQA 1N86A 1SVFA 2HODA 1T2KD 3HE5A 3M06A 1FZCA 1PFIA 2KSJA 1CI6A 2WPQA 3HD7C 1MFZA 1URQD 1H88A 1W2EA 4N3YB 5KTBA 1H89A 1FZAA 2N1TA 2W6BA 1N73B 1FAVA 2FYUK 1DH3A 3EQ2A 3H6PA 3M91A 3V5BA 1MV8A 3GHGC 5KJ7A 1HVVA 1N2DC 5CCGC 5APWA 1YTZI 5CCGD 1X79B 4W7ZA 1J1DC 1L4AD 1SQBK 1KFNA 1S9KD 1H8AA 1FZCC 4M3LA 2O1KA 3HUSA 2ZXEB 1FZBA 1J1EC 3V2PA 3P8MC 2MJZA 3OJAB 3L4FA 1YYCA 1RF1B 1XTGB 5AVQB 1FZFA 1GL2B 4IFDK 4AUWA 2N1TC 3UIAA 1DEBA 3NTNA 2I1KA 1KQLA 3OA7A 2A45I 2WSFH 5CJ4A 1RY3A 5KJ7C 3LW5H 2J58A 2XU6A 2Q5UA 2XKMA 2JEEA 4LC1A 2W27A 2O1JA 3P7KA 1IFJA 1YTZT 1NAFA 3HE4A 4WBAA 3HUSC 3M0AA 1HWTC 1FJPA 3V2NA 1KILA 1SQXK 2Q7CA 4XA4A 4Y99B 1CW5A 1HUCA 2NPSA 2FXMA 3E1IA 1N7LA 3M0DA 4LLHA 1KFMA 3TK1A 4N78E 1JUNA 1SQQK 4C7RA 1JY3P 1S9KE 5AVXB 1N7SD 1L0LK 1LT9A 2R5BA 1JOCA 1JY2N 2BASA 3RK2D 1JY3O 2IPPA 1FZEA 1CSBA 3A2AA 2OARA 2POHA 1LTJA 1L0NK 4HYTB 2WPSA 1WT6A 3N7NA 5AW7B 1URQA 1OXZA 4Y99C 1AQ5A 3HD7B 2GUSA 1URQB 5AW5B 3VP8A 1KILC 3B8EB 1IFDA 2YO2A 5AVVB 4GIFA 2WSEH 5AVYB 2NPSC 5AVZB 1GZLA 2W6AA 4C7NA 3M0DC 1NTMK 2JJLA 4IFFA 4C7NB 3EFGA 2R5DA 3H32A 4C46A 3M9QA 4O9BA 2C0WA 1LT9C 1GW3A 2KLVA 1MUUA 2FYZA 1L4AA 3GHGB 1GTWA 4I2LC 1T2KC 5BVZA 2HPCB 2I1JA 3A5TA 4LGDE 1J1DB 1LTJC 2L5GB 2HODB 2KP8A 5APYA 1NKZB 3HE5B 2XDJA 1LTIC 1FZCB 3V4QA 4RESB 1URQC 1FU1A 1CI6B 3MGNA 5BU5A 1J1EB 3L36A 1M1JA 1NTKK 2ZFCA 4AYCA 3M9BA 2HG5D 3SWFA 1A02F 2H8PD 2N1TB 1QL2A 2R3CA 1QL1A 3B5ND 5AVWB 1KZUB 3U59A 2Q9IA 3NMDA 2PAJA 1L4AC 3N4XA 2GUVA 3IFMA 3RL0D 4B86A 2CPSA 1JCDA 2YO3A 1GD2E 2J59M 1X8YA 1VPCA 3R2PA 3PP5A 2H43A 2E43A 1JO5A 4WY4A 3HUSB 1GU4A 1M1JC 1G1IA 4W80A 3U1AA 4ZKPA 2WT7A 1IK9A 3C9IA 1G1JA 3LIEA 3T97A 1FZGA 1N7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XV5 A;  3L37 A;  1FOS E;  3M0D A;  3TK1 A;  1GK6 A;  5AVT B;  5APT A;  3OAK A;  1JUN A;  5APS A;  1S9K E;  2VRS A;  5AVX B;  2R5B A;  3VTP C;  2C9L Y;  2BAS A;  1NWQ A;  5AW9 B;  1J2J B;  3KDP B;  2IPP A;  1CSB A;  3A2A A;  1GK4 A;  3IR9 A;  5AVS B;  3VYI A;  2Z5H A;  4XE5 B;  3HE4 B;  1SLQ A;  4HYT B;  2WPS A;  3HTK A;  3TNU A;  1T2K D;  5AW7 B;  5AW6 B;  2XZR A;  3HE5 A;  3M06 A;  5AW4 B;  2WT7 B;  1OXZ A;  5AW5 B;  1CI6 A;  3A7O A;  2WPQ A;  3B8E B;  2YO2 A;  5AVV B;  5APU A;  1MFZ A;  5AVY B;  5AW8 B;  5AVZ B;  2Q3I A;  5AW1 B;  2QM8 A;  1H88 A;  1GZL A;  2W6A A;  4C7N A;  2E42 A;  1H89 A;  2C9N Y;  2QM7 A;  2JJL A;  4C7N B;  1FOS F;  2R5D A;  2H7H A;  4C46 A;  1FAV A;  4AQR D;  3TYY A;  1DH3 A;  1MUU A;  4JYC A;  1SP4 A;  4DZO A;  1GTW A;  1CZQ A;  3M91 A;  4I2L C;  1T2K C;  3L35 A;  3V5B A;  1MV8 A;  2P67 A;  1OWA A;  3A5T A;  2WWW A;  3P32 A;  5AW0 B;  5APW A;  3MD0 A;  5APQ A;  4EOT A;  5APV A;  4GT1 A;  3TNU B;  2WPR A;  2KP8 A;  5APY A;  1A02 J;  3HE5 B;  2WTY A;  2R32 A;  3V4Q A;  4RES B;  1S9K D;  1H8A A;  1CI6 B;  3MGN A;  3L36 A;  4M3L A;  2P2U A;  2ZXE B;  1G2C B;  5AW3 B;  5CMZ A;  3P8M C;  4JYB A;  1GU5 A;  2P7J A;  2ZFC A;  3NFQ A;  1YYC A;  4AYC A;  4GKG A;  5AVQ B;  3M9B A;  3SWF A;  1A02 F;  4KHX A;  5APX A;  2R3C A;  4AUW A;  3UIA A;  5AVW B;  1HJB A;  3VMZ A;  5AVR B;  3NTN A;  1KQL A;  3NMD A;  3V4W A;  4B86 A;  5AW2 B;  3KQG A;  2YO3 A;  5AVU B;  3I5C A;  2XU6 A;  3VN0 A;  1GD2 E;  2Q5U A;  1X8Y A;  3LID A;  3NXS A;  4LC1 A;  2Z5I A;  2W27 A;  3P7K A;  2E43 A;  1NAF A;  3O8Z A;  3A3Y B;  3VMY A;  3VMX A;  3HE4 A;  1GU4 A;  1HWT C;  2N9B A;  3M0A A;  1HBW A;  3M9H A;  2WT7 A;  2Q7C A;  1JNM A;  3LIE A;  2YNY A;  4I6M C;  3T97 A;  1HUC A;  1IO4 A; 
#chains in the Genus database with same CATH topology
 2HFE D;  2OYI A;  2WZ7 A;  1DX7 A;  2YKQ A;  3OAK A;  4IL6 H;  1M90 Q;  2K9Y A;  3G6E P;  2IX7 C;  2IZ1 A;  3AED C;  4JF7 A;  2KIK A;  3S9O A;  3BRV B;  1E79 H;  1KQF B;  1PPJ D;  3VYI A;  4WY4 C;  1KIL B;  1JCC A;  1UII A;  3I56 P;  2QM8 A;  3RL0 g;  1FOS F;  2GA1 A;  2H7H A;  3TYY A;  1JEK A;  2Y0C A;  4YPC A;  4DZO A;  3A0B H;  1JY2 P;  2P67 A;  4GOE A;  1YBK A;  1YIT P;  2V7Q J;  3H1J E;  3FX0 A;  4EI2 A;  3GF7 A;  4GOD A;  1G2C A;  4H13 D;  3B71 A;  2P2U A;  5AW3 B;  3B5N A;  1EQ7 A;  1LTS C;  3CWB J;  2GM4 A;  2P1J A;  3H32 B;  1KTM A;  4H44 B;  1L4A B;  1GW4 A;  2FFD B;  2O01 J;  1P84 E;  5H2F H;  3KQG A;  3L71 E;  2OYH A;  1LTG C;  3WU2 H;  1L2P A;  2XND H;  3A3Y B;  1VF5 D;  3CX5 I;  3GW6 A;  2E75 C;  5KAI E;  2C0X A;  5CJ0 A;  3M9H A;  2YNY A;  5TIS E;  2K9J B;  4H44 C;  2Q1K A;  3L37 A;  1OX3 A;  5APT A;  2FFD C;  3TGU E;  2Q3E A;  2YIU C;  3VTP C;  4OWF A;  5KLI B;  2WT7 B;  5GTH H;  1ZOY C;  2JKV A;  2PFX A;  1FDI A;  3U1C A;  3JC2 2;  1ZR4 A;  2CPB A;  2W6J H;  1LGH B;  1RE4 A;  2IDB A;  1N73 C;  2HYN A;  4XFJ A;  2QJY B;  5CBN A;  2QEX P;  1AV1 A;  2ZVN B;  1NTM G;  4KT0 J;  3E7K A;  2KOG A;  3CL3 D;  1T3J A;  4GOF A;  1GU5 A;  2P7J A;  3NFQ A;  4GKG A;  1RF1 C;  1JY3 N;  4YXW H;  1EZV D;  5AW2 B;  4PJ0 H;  4NPF X;  5AVU B;  1OVR A;  1VQN P;  3O6Q B;  2KB7 P;  3VMX A;  3AE4 C;  1HBW A;  1JNM A;  1QGK B;  1NTZ G;  2KZJ A;  2LKM A;  2AXT E;  4U3F D;  2W90 A;  1SFC B;  1KIL D;  2KUB A;  2K37 A;  1PIX A;  3BAT A;  2JP3 A;  1IZN B;  1LTT C;  5AW9 B;  3D6Z A;  3AE5 C;  2HPC A;  2FXO A;  3IR9 A;  3BCC G;  1ZRT E;  1YI2 P;  3KPE A;  2LXB A;  1N86 A;  2E76 C;  1BCC J;  1SQP E;  3HE5 A;  3M06 A;  1PP9 E;  1EZV E;  3HD7 C;  1RH5 B;  2IBZ E;  1L0N D;  1URQ D;  4N3Y B;  4A7P A;  4HB1 A;  2IYO A;  2W6B A;  5KKZ B;  1DH3 A;  3AEC C;  3EQ2 A;  5DJT B;  1JMB A;  1HVV A;  5CCG C;  1YTZ I;  1X79 B;  1J1D C;  1L4A D;  5B66 E;  4U3F E;  1KFN A;  1H8A A;  3JCU H;  1PGJ A;  3V2P A;  1J1E C;  4WWI A;  2QIW A;  5KKZ C;  1DEB A;  2KS1 A;  3NTN A;  2I1K A;  2ZJS E;  2ZYA A;  3AE8 C;  4U3F J;  2WSF H;  5CJ4 A;  1RY3 A;  2G8Y A;  3LW5 H;  5C39 A;  3A0H H;  2Q5U A;  1L0N E;  4PV1 B;  1S72 P;  1AJY A;  4YXD C;  1U7M A;  2IYP A;  4WBA A;  4I7Z C;  3HUS C;  1FJP A;  3V2N A;  4XA4 A;  3L73 J;  3E1I A;  2Y9Y A;  3TK1 A;  1L0N J;  1LP1 A;  3H1K D;  4N78 E;  1JY3 P;  1N7S D;  1LT9 A;  1JOC A;  2LR2 A;  4DCK A;  2QRX A;  1IFP A;  2BAS A;  4NPE A;  4RO0 A;  4WVZ A;  1CSB A;  3A2A A;  2OAR A;  1LTJ A;  1KB9 I;  1L0N K;  3CX5 D;  3L75 G;  1WT6 A;  1OXZ A;  1AQ5 A;  3H25 A;  4GIF A;  2WSE H;  5AVZ B;  4C7N A;  3M0D C;  2FYU G;  4D6T E;  1FS0 E;  5DJU B;  2KLV A;  2KNC B;  1T2K C;  1VQ9 P;  3A5T A;  1SQB G;  2B88 A;  5B5E H;  1Q2N A;  1NKZ B;  2H89 C;  1FZC B;  3H1K E;  1CI6 B;  1M1J A;  2KSE A;  3IF4 A;  4AYC A;  2HG5 D;  2H8P D;  2N1T B;  1M56 D;  1Q90 D;  4UB6 E;  1OZH A;  5AVW B;  3H1K J;  1Y8A A;  4IL6 X;  2YO3 A;  1VQ6 P;  2E74 B;  3WUU A;  5KLV D;  1QVG O;  3R2P A;  4R4M A;  1YQ4 C;  1N8R Q;  3PP5 A;  2E43 A;  1NU1 E;  1SQX G;  1G1I A;  4R4L A;  4W80 A;  3U1A A;  4ZKP A;  2BCC G;  1DIP A;  4OGQ B;  3B4S A;  3LIE A;  3T97 A;  1FZG A;  1UIX A;  1SQQ G;  2ITA A;  1LWU A;  3H1L G;  3FWL A;  5E79 E;  2VRS A;  2QA4 P;  2W83 C;  3Q5S A;  4IOI H;  2JR8 A;  2M0B A;  3KDP B;  1OW6 A;  3CXH H;  3HE4 B;  3PH0 A;  3HTK A;  3SSU A;  3TNU A;  2E5T A;  1NU1 K;  1T3U A;  2FYN C;  2NPS B;  2OYI C;  2SPZ A;  1KYO E;  3RK2 C;  2M8R A;  2E42 A;  2QM7 A;  3W68 A;  3Q1M A;  5K5G B;  3CI9 A;  1NKN A;  5AW0 B;  2ZT9 B;  5APV A;  2OTK E;  1RE3 A;  4H13 C;  1DD4 A;  5KLV J;  2Y0E A;  3PTZ A;  3RK3 D;  2KI7 B;  2QG4 A;  1G2C B;  5CMZ A;  1SQV E;  2ZYD A;  4PV1 D;  2PGD A;  1EC5 A;  2WVR A;  3B5N B;  3KHU A;  1LTB C;  3PRJ A;  2KYV A;  3D70 A;  3H1I J;  1XTC C;  1RF0 A;  3V4W A;  3CC7 P;  3VN0 A;  2QJK C;  1NH4 A;  1BE3 G;  1NAY A;  3VMY A;  1VL2 A;  3L74 G;  2YMY A;  4ZMD A;  3B5N C;  5CCH A;  1WRG A;  1SQV K;  1IO4 A;  2PRR A;  2WSC H;  4BWN A;  2HR3 A;  2XV5 A;  3RL0 C;  1FOS E;  1GK6 A;  1IC2 A;  5APS A;  3RK3 E;  3MUD A;  1NO4 A;  1X9V A;  1AQT A;  1JMM A;  2UWJ E;  2OYH C;  1BGY G;  5AVS B;  4WY4 B;  1VDF A;  1S3J A;  2M5A B;  2K88 A;  3L70 D;  5CCH D;  5AW8 B;  3CXH I;  1OVU A;  1S5L E;  2OTL P;  1GL2 A;  3SFD C;  2R3S A;  1KB9 D;  2N1T D;  3MD0 A;  3AE2 C;  5APQ A;  1R8E A;  3S1K A;  4YTP C;  4HJG H;  5KJ7 D;  3II6 A;  2E74 D;  1HF9 A;  4H0L D;  4JYB A;  1IFN A;  1Q7Y Q;  2A06 D;  3IAO A;  3CWB E;  5AVR B;  1RE4 C;  1GL2 D;  3PLN A;  1M7L A;  2G3A A;  3H1J G;  3SFE C;  2QJP C;  3L70 E;  3NXS A;  3S4R A;  2P58 A;  1HGZ A;  3KYQ A;  1OW7 A;  4WB4 A;  2E75 B;  2YMK A;  2N9B A;  4N6J A;  3USS A;  1PPJ E;  3V2Q A;  1KB9 E;  3L70 J;  2YIU B;  4PD4 D;  2NPS D;  3L71 G;  3GHG A;  3QWO C;  1GK4 A;  2A06 E;  1L0L D;  1PZQ A;  2HOD A;  2AXC A;  3ABV C;  3RBZ A;  1PFI A;  1QX8 A;  2WPQ A;  1OVV A;  1W2E A;  3TGU G;  5KAF E;  1NJI Q;  1N73 B;  3FGA D;  1EXI A;  5GTI E;  3H6P A;  3AE1 C;  1NTM D;  5APW A;  1KC8 Q;  3H1H D;  3Q2Y A;  4EDF A;  4UB8 H;  1S9K D;  1ZP0 C;  4PD4 E;  4M3L A;  3C1L A;  3OJA B;  4KJM A;  1RF1 B;  4IFD K;  4AUW A;  3UIA A;  1L0L E;  1NTK D;  1BCC D;  1VQP P;  2LXC B;  2RMZ A;  2O3J A;  2XU6 A;  4LC1 A;  3P7K A;  1NAF A;  1NTZ D;  2ZYG A;  3M0A A;  1L0L J;  3CME P;  1KIL A;  2Q7C A;  2WSF J;  4Y99 B;  2D2C C;  3AEF C;  3LW5 J;  1HUC A;  1NTM E;  1PGQ A;  2FXM A;  3H1H E;  1KFM A;  3RBX A;  1M57 D;  1PGO A;  1S9K E;  1L0L K;  4L74 A;  1M1K Q;  1FZE A;  2POH A;  2E76 B;  1NTM J;  3H1H J;  1EXJ A;  5AW7 B;  1URQ A;  4Y99 C;  1NTK E;  3HD7 B;  5AW5 B;  3VP8 A;  1BCC E;  1QLE D;  1IFD A;  2YO2 A;  5AVV B;  4QMA A;  5AVY B;  1PV3 A;  3MP7 B;  4RJT A;  1NTM K;  2B87 B;  4C7N B;  2R5D A;  3H32 A;  4DJG A;  4O9B A;  1LT9 C;  1GW3 A;  1MUU A;  2FYZ A;  1S4X A;  1L4A A;  2BEQ D;  3AE9 C;  5BVZ A;  1NTK J;  2WSE J;  2YXR B;  1J1D B;  1LTJ C;  2KP8 A;  1LJ2 A;  3FWN A;  1SQP G;  1PP9 G;  1P84 H;  1LTI C;  3L73 D;  4RES B;  1FU1 A;  1EZV G;  5BU5 A;  1J1E B;  3D71 A;  2MKV A;  2IBZ G;  4BRY A;  1NTZ J;  1NTK K;  4GDO A;  3CXH D;  2ZFC A;  2KLU A;  1A02 F;  4JBZ A;  2K9J A;  3CCM P;  5KAI H;  2E75 D;  1K8A Q;  1YIJ P;  1KZU B;  5TIS H;  1JB0 J;  3D6Y A;  4H44 D;  3N4X A;  3VMA A;  2CPS A;  1JCD A;  4CPG A;  2IZ0 A;  3SWK A;  1KIL E;  1VPC A;  4RKU J;  1JO5 A;  3K5B A;  2WSS H;  4I7Z B;  1H0T B;  3HUS B;  1GU4 A;  3L72 D;  2P10 A;  5M1B A;  1M1J C;  1D7M A;  2WT7 A;  1IK9 A;  3MZW B;  3C9I A;  1N7S A;  3Q5R A;  3CCE P;  4W7Y A;  1RQU A;  3L73 E;  2A45 G;  1J2J B;  3EWK A;  1TU3 F;  3TF5 A;  5AW4 B;  1BDC A;  1VQ5 P;  2E5Y A;  2IFN A;  5AW1 B;  1LWU C;  5TJH A;  1AFO A;  1E5W A;  3L72 E;  3WMM 0;  3MIW A;  3L35 A;  3KZI E;  3MTU E;  1NVO A;  1FBM A;  3RGU A;  1GMJ A;  3RK3 C;  2K1A A;  5CHX A;  3O6Q A;  3CMA P;  2PP6 A;  1PL5 A;  3L72 J;  2FY8 A;  3JSV C;  4D6T G;  2XNX A;  3Q5P A;  1HJB A;  1P84 I;  1SFC A;  2ZVO B;  2AXT H;  3I5C A;  4U7J A;  1VQ8 P;  1HGV A;  2JWA A;  3H1K G;  4ZKU A;  1RE3 C;  2YKO A;  1M8O B;  3HRN A;  3O8Z A;  1NGM B;  4TT3 H;  1NOH A;  3CX5 E;  2E76 D;  3BRT B;  2Z4E A;  1RF0 C;  3AEB C;  3HD7 D;  1ZR2 A;  1ZN5 A;  1EDJ A;  1SFC D;  3P8C D;  1IFI A;  1W2B O;  1NU1 G;  1AVO A;  2WSC J;  4MN4 C;  1HTL C;  2XZR A;  3H1I D;  2FYN B;  2HLO A;  5CCH C;  3A7O A;  4IL6 E;  5B66 H;  2OYI B;  3RK2 B;  1NYH A;  2WMM A;  2C9N Y;  4DT0 A;  1KD1 Q;  1BSH A;  2BEZ F;  3SWY A;  3MUD C;  4JYC A;  2WWW A;  3P32 A;  4GT1 A;  4H13 B;  2YXQ B;  2WPR A;  1K9M Q;  1SQX J;  2NZ2 A;  1LTA C;  2A45 H;  2KZI A;  2FKW B;  2BCC J;  4H0L C;  5KLV E;  3I55 P;  3P8C E;  1SQQ J;  1AVY A;  1T8Z A;  1X22 A;  2IFM A;  3A0B E;  1RQV A;  1R5S A;  1GL2 C;  1BDD A;  2B89 A;  4ASW A;  3BVH A;  3VMZ A;  1NHL A;  3G71 P;  1U57 A;  2OYO A;  3H1I E;  2QJK B;  4HH2 A;  1BE3 D;  1JTH A;  1VF5 B;  2YKP A;  1SQV G;  1KMI Z;  3GG2 A;  1Y9B A;  5KLV K;  1HH0 A;  4EIJ A;  1VQ4 P;  1FDO A;  1OMI A;  3AE3 C;  3RL0 B;  5H2F E;  2OTJ P;  3CCV P;  4Z1M H;  1BGY D;  3WU2 E;  2C9L Y;  4Y28 J;  4DOJ A;  1NWQ A;  3VP9 A;  2KNC A;  2OYH B;  1VF5 C;  3CCL P;  2R44 A;  2Y9Z A;  3CLQ A;  1SLQ A;  1EZV I;  1T2K D;  1HJ0 A;  2IBZ I;  1FZC A;  2KSJ A;  1CI6 A;  3F89 A;  1AA0 A;  1BE3 E;  1MFZ A;  2KXP B;  1H88 A;  3IN6 A;  1H89 A;  5KTB A;  1ZME C;  2N1T A;  1FAV A;  2FBW C;  4UB6 H;  3V5B A;  3GHG C;  5KJ7 A;  1BE3 J;  4ZNC A;  1U7J A;  5GTH E;  1ZW0 A;  3L74 J;  2L91 A;  2O1K A;  2ZXE B;  1FZB A;  3GLM A;  3FXE A;  3L4F A;  3MHV A;  1OW8 A;  1YYC A;  5AVQ B;  1FZF A;  3H1J D;  1KQL A;  3GMA A;  3OA7 A;  2A45 I;  2QJP B;  2J58 A;  1BGY J;  5E79 H;  4BXL A;  2XKM A;  3PJS K;  2O1J A;  3C8V A;  1KN7 A;  3HE4 A;  1HWT C;  4K3A A;  2NPS A;  1P84 D;  3CWB G;  4OGQ D;  1N7L A;  4LLH A;  4PJ0 E;  2Q6Q A;  3L71 D;  5AVX B;  2KK7 A;  1KYO H;  3L70 G;  3RK2 D;  2QE7 H;  2WPV B;  2WPS A;  1JM0 A;  1S2E A;  1PPJ G;  2JWD A;  1URQ B;  1KIL C;  3B8E B;  3TGU D;  3G4S P;  3OW2 O;  1GZL A;  2W6A A;  3Q3D A;  1WMK A;  2JJL A;  4IFF A;  3EFG A;  1QVF O;  4C46 A;  1VQL P;  3M9Q A;  2C0W A;  2AEJ A;  1GTW A;  4I2L C;  3H1J J;  2HPC B;  2A06 G;  2L5G B;  5APY A;  3HE5 B;  1URQ C;  2ZT9 D;  3MGN A;  3L36 A;  3WUV A;  4BRY B;  1Y47 A;  2Y0D A;  1QL2 A;  2R3C A;  3ZDM A;  3B5N D;  3U59 A;  3FXD A;  1T6A A;  1S1C X;  1MFT A;  1L4A C;  2GUV A;  3L71 J;  3CCU P;  3RL0 D;  3CD6 P;  2J59 M;  3JCU E;  1X8Y A;  1IK7 A;  4NPD A;  4WY4 A;  1X0T A;  2M5A A;  2D2C B;  1FE6 A;  4JPZ B;  1L0L G;  3TGU J;  1N7S B;  2KS1 B;  1OIP A;  4L73 A;  2V4H A;  4I1L A;  3A0H E;  2W8Z A;  1Q82 Q;  1SS1 A;  4ASV A;  2B9B A;  1S5L H;  3CC2 P;  1K73 Q;  5KLI C;  1ZV8 A;  1EDL A;  4WY4 D;  1KOR A;  1LNQ A;  3GF3 A;  1KYO I;  3H1H G;  5APU A;  1Q86 Q;  1N7S C;  2V7Q H;  1LP1 B;  1RHZ B;  1GDT A;  2QVA A;  3BCC D;  1LT9 B;  3ITK A;  1FDM A;  1ZRT D;  3TSI A;  1BSN A;  1USD A;  3G3Z A;  1SQP D;  1PP9 D;  1LTJ B;  1DD3 A;  4EOT A;  2QJY C;  1JY2 O;  2IBZ D;  1A02 J;  5L8R J;  2R32 A;  1NTK G;  1BCC G;  3G9R A;  2O01 H;  3V2R A;  2ZAE B;  2M3B A;  3AE6 C;  1NTZ E;  2OQQ A;  5APX A;  2FFD A;  1KB9 H;  5B5E E;  3W67 A;  1FJK A;  3LID A;  2Z5I A;  3BCC E;  1M1J B;  1Z56 A;  3BAS A;  3E1R A;  1IJD B;  5AVT B;  1NTZ K;  4OH8 B;  3KXD A;  4TLF A;  1SFC C;  4OVN F;  4U3F G;  1N73 A;  3BCC J;  1ZXG A;  4K35 A;  1MZ9 A;  5KAF H;  1YJ9 P;  1SQP J;  5GTI H;  1PP9 J;  5AW6 B;  1MKM A;  2WIT A;  3EFF K;  4N78 D;  3T97 B;  2Q3I A;  1LWU B;  1SQP K;  4PD4 H;  3L73 G;  1RF1 A;  1L0N G;  3L75 D;  4AQR D;  3CXH E;  1SP4 A;  1CZQ A;  4EYY Q;  1OWA A;  5EFW B;  1KV4 A;  3RK3 B;  2I8D A;  3HTK B;  3TNU B;  3VOP A;  3AE7 C;  2WTY A;  2FYU D;  1YJN P;  4D6T D;  1YHQ P;  1LT1 A;  1IFM A;  1SQB D;  4KHX A;  3L72 G;  2D2C D;  4JQ0 D;  2RN0 A;  2AEF A;  2N9Y B;  5BU8 B;  1ZLL A;  1JTH B;  1KQS O;  4PV1 C;  1DEE G;  3L75 E;  4IFM A;  3HD7 A;  4I6M C;  3TDK A;  3CCR P;  3CCS P;  1K04 A;  2FYU E;  2B87 A;  1SQX D;  2AEM A;  1NU1 D;  3L75 J;  2JO1 A;  1W5C E;  2BCC D;  5CCG A;  3AEE C;  2M3E A;  1SQB E;  2Z5H A;  1SQQ D;  4XE5 B;  2H88 C;  1SVF A;  1YQ3 C;  3H1L D;  2FYU J;  4D6T J;  4HKZ H;  3AEG C;  1PGP A;  1VQK P;  1FZA A;  1QEX A;  1SQB J;  1VQO P;  1VQ7 P;  2FYU K;  1OFC X;  3M91 A;  1MV8 A;  1N2D C;  3WUT A;  2JDI H;  3CPW O;  5CCG D;  4W7Z A;  4PD4 I;  1SQB K;  3PHL A;  1FZC C;  1KYO D;  4H0L B;  1H0T A;  3HUS A;  1SQX E;  3P8M C;  2MJZ A;  3F5H A;  2BCC E;  2ZXX A;  1XTG B;  1Q81 Q;  1EDK A;  1GL2 B;  1SQQ E;  5CBO A;  2N1T C;  1FC2 C;  3H1L E;  2WQY C;  3CC4 P;  5KJ7 C;  3CCQ P;  2RH0 A;  1NU1 J;  2JEE A;  2E74 C;  1SQV D;  2W27 A;  2DW3 A;  1IFJ A;  1YTZ T;  5KLV G;  1KQG B;  3H1L J;  1SQX K;  1CW5 A;  4OGQ C;  3M0D A;  3H1I G;  1JUN A;  1SQQ K;  4C7R A;  2R5B A;  3L74 D;  1JY2 N;  3R4Y A;  1JY3 O;  2K3R A;  3QH9 A;  2IPP A;  2RKL A;  1K05 A;  3AEA C;  4HYT B;  4L76 A;  3N7N A;  2J5U A;  3KZI H;  1VQM P;  2GUS A;  2NRG A;  2NPS C;  4L75 A;  2FXP A;  2CK3 H;  3GHG B;  2I1J A;  1YJW P;  1R5L A;  3CCJ P;  4LGD E;  2HOD B;  2ZT9 C;  2XDJ A;  3V4Q A;  1SQV J;  3L74 E;  3M9B A;  3SWF A;  1QL1 A;  3CX5 H;  2O01 N;  2Q9I A;  3NMD A;  2PAJ A;  3IFM A;  4B86 A;  4UB8 E;  1GD2 E;  1USE A;  2OGU A;  2H43 A;  1BGY E;  1S5L X;  1EDI A;  3CWB D;  3V6I A;  1G1J A;  2QSI A; 
#chains in the Genus database with same CATH homology
 2HFE D;  2OYI A;  2WZ7 A;  1DX7 A;  2YKQ A;  1N7S B;  1LWU A;  3OAK A;  4I1L A;  4W7Y A;  2VRS A;  2IX7 C;  2A45 G;  4JF7 A;  1J2J B;  3KDP B;  3BRV B;  3VYI A;  3HE4 B;  1ZV8 A;  4WY4 C;  3HTK A;  3TNU A;  4WY4 D;  1NU1 K;  5AW4 B;  1KIL B;  1T3U A;  1JCC A;  2NPS B;  2IFN A;  5APU A;  1N7S C;  5AW1 B;  2QM8 A;  2OYI C;  3RK2 C;  1GDT A;  2E42 A;  2M8R A;  1LWU C;  2QM7 A;  1LT9 B;  1FOS F;  1AFO A;  2H7H A;  3CI9 A;  1FDM A;  1E5W A;  3TSI A;  3TYY A;  4DZO A;  3WMM 0;  3G3Z A;  1JY2 P;  3MIW A;  3L35 A;  1NKN A;  2P67 A;  1LTJ B;  5AW0 B;  3MTU E;  4EOT A;  5APV A;  1FBM A;  1JY2 O;  1A02 J;  1RE3 A;  3RK3 C;  2R32 A;  5CHX A;  3RK3 D;  1G2C A;  2O01 H;  2P2U A;  3V2R A;  2PP6 A;  1G2C B;  5AW3 B;  5CMZ A;  3B5N A;  2M3B A;  1EQ7 A;  1LTS C;  3B5N B;  1LTB C;  2KYV A;  2GM4 A;  2P1J A;  3H32 B;  5APX A;  1XTC C;  1RF0 A;  2XNX A;  1HJB A;  2FFD A;  1L4A B;  1SFC A;  3V4W A;  1GW4 A;  2FFD B;  1FJK A;  3KQG A;  3VN0 A;  3I5C A;  1NH4 A;  1HGV A;  3LID A;  2OYH A;  2Z5I A;  1LTG C;  4ZKU A;  1RE3 C;  2YKO A;  3HRN A;  3O8Z A;  3A3Y B;  3VMY A;  2YMY A;  1M1J B;  2C0X A;  5CJ0 A;  1Z56 A;  3M9H A;  3B5N C;  5CCH A;  1NOH A;  2YNY A;  3BAS A;  1WRG A;  1SQV K;  1IO4 A;  2WSC H;  3BRT B;  2XV5 A;  3L37 A;  2Z4E A;  3RL0 C;  1FOS E;  1IJD B;  1GK6 A;  1RF0 C;  5AVT B;  5APT A;  1NTZ K;  4OH8 B;  1IC2 A;  2FFD C;  3HD7 D;  5APS A;  1SFC C;  1ZR2 A;  1ZN5 A;  3VTP C;  1SFC D;  3MUD A;  1N73 A;  1NO4 A;  3P8C D;  1X9V A;  1MZ9 A;  1JMM A;  1IFI A;  2OYH C;  5AVS B;  4WY4 B;  1VDF A;  1HTL C;  5AW6 B;  2XZR A;  2HLO A;  2WT7 B;  2WIT A;  4N78 D;  5CCH C;  3A7O A;  2OYI B;  5CCH D;  5AW8 B;  2Q3I A;  3RK2 B;  1LWU B;  1SQP K;  3U1C A;  2C9N Y;  1RF1 A;  1GL2 A;  1ZR4 A;  2CPB A;  3SWY A;  1LGH B;  1RE4 A;  4AQR D;  1N73 C;  4JYC A;  1SP4 A;  2HYN A;  1CZQ A;  1OWA A;  2WWW A;  2N1T D;  3P32 A;  3MD0 A;  5APQ A;  3RK3 B;  4GT1 A;  3HTK B;  3TNU B;  2WPR A;  3VOP A;  2WTY A;  5KJ7 D;  1LTA C;  2A45 H;  2FKW B;  2KOG A;  3II6 A;  3CL3 D;  3P8C E;  1T3J A;  4JYB A;  1GU5 A;  1IFN A;  2P7J A;  3NFQ A;  1T8Z A;  1IFM A;  4GKG A;  2IFM A;  4KHX A;  1RF1 C;  1GL2 C;  1JY3 N;  3BVH A;  3VMZ A;  1NHL A;  1RE4 C;  5AVR B;  1GL2 D;  1M7L A;  5AW2 B;  4HH2 A;  5AVU B;  5BU8 B;  1JTH A;  1ZLL A;  3NXS A;  1JTH B;  1HGZ A;  3KYQ A;  2KB7 P;  4WB4 A;  2YKP A;  3VMX A;  2N9B A;  4N6J A;  1HBW A;  3V2Q A;  1JNM A;  4IFM A;  3HD7 A;  5KLV K;  1HH0 A;  4I6M C;  4EIJ A;  3RL0 B;  2LKM A;  1SFC B;  1KIL D;  2NPS D;  2C9L Y;  4DOJ A;  3BAT A;  1NWQ A;  3VP9 A;  1LTT C;  5AW9 B;  2OYH B;  3GHG A;  5CCG A;  2HPC A;  1GK4 A;  3IR9 A;  2Z5H A;  4XE5 B;  3CLQ A;  3KPE A;  1SLQ A;  1N86 A;  1SVF A;  2HOD A;  1T2K D;  3HE5 A;  3M06 A;  1FZC A;  1PFI A;  2KSJ A;  1CI6 A;  2WPQ A;  3HD7 C;  1MFZ A;  1URQ D;  1H88 A;  1W2E A;  4N3Y B;  5KTB A;  1H89 A;  1FZA A;  2N1T A;  2W6B A;  1N73 B;  1FAV A;  2FYU K;  1DH3 A;  3EQ2 A;  3H6P A;  3M91 A;  3V5B A;  1MV8 A;  3GHG C;  5KJ7 A;  1HVV A;  1N2D C;  5CCG C;  5APW A;  1YTZ I;  5CCG D;  1X79 B;  4W7Z A;  1J1D C;  1L4A D;  1SQB K;  1KFN A;  1S9K D;  1H8A A;  1FZC C;  4M3L A;  2O1K A;  3HUS A;  2ZXE B;  1FZB A;  1J1E C;  3V2P A;  3P8M C;  2MJZ A;  3OJA B;  3L4F A;  1YYC A;  1RF1 B;  1XTG B;  5AVQ B;  1FZF A;  1GL2 B;  4IFD K;  4AUW A;  2N1T C;  3UIA A;  1DEB A;  3NTN A;  2I1K A;  1KQL A;  3OA7 A;  2A45 I;  2WSF H;  5CJ4 A;  1RY3 A;  5KJ7 C;  3LW5 H;  2J58 A;  2XU6 A;  2Q5U A;  2XKM A;  2JEE A;  4LC1 A;  2W27 A;  2O1J A;  3P7K A;  1IFJ A;  1YTZ T;  1NAF A;  3HE4 A;  4WBA A;  3HUS C;  3M0A A;  1HWT C;  1FJP A;  3V2N A;  1KIL A;  1SQX K;  2Q7C A;  4XA4 A;  4Y99 B;  1CW5 A;  1HUC A;  2NPS A;  2FXM A;  3E1I A;  1N7L A;  3M0D A;  4LLH A;  1KFM A;  3TK1 A;  4N78 E;  1JUN A;  1SQQ K;  4C7R A;  1JY3 P;  1S9K E;  5AVX B;  1N7S D;  1L0L K;  1LT9 A;  2R5B A;  1JOC A;  1JY2 N;  2BAS A;  3RK2 D;  1JY3 O;  2IPP A;  1FZE A;  1CSB A;  3A2A A;  2OAR A;  2POH A;  1LTJ A;  1L0N K;  4HYT B;  2WPS A;  1WT6 A;  3N7N A;  5AW7 B;  1URQ A;  1OXZ A;  4Y99 C;  1AQ5 A;  3HD7 B;  2GUS A;  1URQ B;  5AW5 B;  3VP8 A;  1KIL C;  3B8E B;  1IFD A;  2YO2 A;  5AVV B;  4GIF A;  2WSE H;  5AVY B;  2NPS C;  5AVZ B;  1GZL A;  2W6A A;  4C7N A;  3M0D C;  1NTM K;  2JJL A;  4IFF A;  4C7N B;  3EFG A;  2R5D A;  3H32 A;  4C46 A;  3M9Q A;  4O9B A;  2C0W A;  1LT9 C;  1GW3 A;  2KLV A;  1MUU A;  2FYZ A;  1L4A A;  3GHG B;  1GTW A;  4I2L C;  1T2K C;  5BVZ A;  2HPC B;  2I1J A;  3A5T A;  4LGD E;  1J1D B;  1LTJ C;  2L5G B;  2HOD B;  2KP8 A;  5APY A;  1NKZ B;  3HE5 B;  2XDJ A;  1LTI C;  1FZC B;  3V4Q A;  4RES B;  1URQ C;  1FU1 A;  1CI6 B;  3MGN A;  5BU5 A;  1J1E B;  3L36 A;  1M1J A;  1NTK K;  2ZFC A;  4AYC A;  3M9B A;  2HG5 D;  3SWF A;  1A02 F;  2H8P D;  2N1T B;  1QL2 A;  2R3C A;  1QL1 A;  3B5N D;  5AVW B;  1KZU B;  3U59 A;  2Q9I A;  3NMD A;  2PAJ A;  1L4A C;  3N4X A;  2GUV A;  3IFM A;  3RL0 D;  4B86 A;  2CPS A;  1JCD A;  2YO3 A;  1GD2 E;  2J59 M;  1X8Y A;  1VPC A;  3R2P A;  3PP5 A;  2H43 A;  2E43 A;  1JO5 A;  4WY4 A;  3HUS B;  1GU4 A;  1M1J C;  1G1I A;  4W80 A;  3U1A A;  4ZKP A;  2WT7 A;  1IK9 A;  3C9I A;  1G1J A;  3LIE A;  3T97 A;  1FZG A;  1N7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...