2R5BA

Structure of the gp41 n-trimer in complex with the hiv entry inhibitor pie7
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
molecule tags Viral protein/inhibitor
molecule keywords gp41 N-peptide
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r5bA00
2N9BA 4GKGA 2E42A 4XE5B 2P67A 3VMXA 5AVZB 4JYCA 5AW2B 2WWWA 1DH3A 3L37A 5AW0B 3T97A 4AYCA 2WTYA 5APSA 5APYA 1H88A 2Q7CA 1OXZA 1T2KD 5CMZA 5AVXB 3M9HA 3O8ZA 3TNUA 2WT7B 1MFZA 2W27A 1GZLA 5APXA 4C7NA 3L36A 5AW7B 2Q5UA 4M3LA 4RESB 1H8AA 3SWFA 1MV8A 4GT1A 1HUCA 5AVWB 1X8YA 2Q3IA 2WPRA 2WPQA 1HBWA 2H7HA 1J2JB 3A7OA 3TNUB 1T2KC 5AW9B 3L35A 3P8MC 3I5CA 2BASA 3LIDA 1GK6A 3TK1A 3P32A 1JUNA 4AUWA 1YYCA 3NTNA 3VN0A 2QM7A 5APVA 1CZQA 3HE4A 3NFQA 3A2AA 3IR9A 5AVYB 1GK4A 3M9BA 5AVUB 5AVRB 4DZOA 1A02F 2C9LY 3P7KA 5AVQB 2YO2A 5AVTB 3V4QA 3NXSA 1A02J 2KP8A 3VMZA 4AQRD 1H89A 5AVVB 4JYBA 3LIEA 2XU6A 3M91A 1IO4A 5APQA 2JJLA 1NAFA 2WPSA 3HE5B 4HYTB 1S9KD 2P7JA 3A3YB 3NMDA 3V4WA 1KQLA 2XV5A 5AW8B 1CI6B 3VTPC 2Z5IA 3B8EB 3M0AA 2R5DA 2W6AA 3KQGA 2E43A 3KDPB 3UIAA 3V5BA 3M0DA 2R32A 2WT7A 5AVSB 3A5TA 1S9KE 1GU5A 1FAVA 3MGNA 5AW5B 5APWA 1HJBA 2YNYA 2P2UA 1GU4A 3OAKA 1GD2E 2YO3A 3HTKA 1FOSE 1OWAA 2QM8A 5AW6B 4C46A 2ZFCA 2IPPA 3HE4B 3TYYA 1HWTC 4C7NB 3VMYA 2ZXEB 4EOTA 2XZRA 1JNMA 3HE5A 2R5BA 1SP4A 5APUA 1GTWA 1G2CB 1MUUA 1CI6A 2R3CA 5AW3B 1CSBA 4I6MC 2Z5HA 5APTA 3M06A 1NWQA 1SLQA 4I2LC 5AW1B 4LC1A 5AW4B 3VYIA 1FOSF 2C9NY 3MD0A 4KHXA 4B86A 2VRSA
chains in the Genus database with same CATH superfamily
3BCCG 3H6PA 1NKNA 1ZRTE 2QJPC 3AE8C 3VMXA 1QLED 5B5EH 5B5EE 3S1KA 5AW2B 2WPVB 2E76D 1LT9A 2K88A 4JF7A 3RBXA 1VQOP 3TSIA 3L74J 1K9MQ 4YXDC 3OA7A 5APYA 1SQVG 1OIPA 3E7KA 2H89C 2IDBA 3RK3B 5C39A 5AVXB 1VQMP 4U3FG 4EIJA 1T2KD 1Q7YQ 2V7QH 1MFZA 2WMMA 3L71J 4R4LA 2E76C 5CJ0A 1K05A 1NHLA 3L74D 3PHLA 1L0NG 2OARA 1L4AD 3L36A 2J5UA 3H1JG 1DIPA 1G1IA 1J1DB 2WSEH 2WVRA 2WZ7A 3PLNA 4RESB 3C1LA 5GTHH 1FBMA 1NTKE 1SQQJ 1DH3A 1L0LE 5AVWB 1NTMK 1Q2NA 5CBOA 1NTMD 1OVVA 2Q3IA 4H13B 1ZR2A 1TU3F 2KSJA 2J58A 2KIKA 1H0TA 4U3FD 1LTJC 1CW5A 1RE3C 1LT9C 2OTLP 4EYYQ 2YMKA 3EFGA 2E75B 3H1LJ 1FS0E 5AW9B 2V4HA 3TNUB 1N73A 1FZAA 1JEKA 1N7SA 4H44D 1LNQA 2KYVA 3VN0A 2QM7A 1M57D 3GLMA 1JMBA 3A0HE 1SFCC 4K35A 2QJPB 3L70J 1VQ8P 2IX7C 3Q5PA 3A2AA 1SQQK 5AVYB 2FFDC 3H1HE 1S5LH 1N86A 3M9BA 3JC22 1FZCC 5AVQB 3QH9A 2YO2A 4IOIH 1A02J 1PGPA 1Z56A 2IBZG 2YIUC 5KAIE 3SWYA 1EZVD 1HVVA 3AE5C 3L72G 3KPEA 3AEGC 2AEMA 2YKQA 1H89A 3CCRP 3MIWA 3KYQA 2QIWA 1K04A 3LIEA 1VDFA 3M91A 4W80A 3LW5J 2LR2A 5M1BA 3L74G 3O6QB 4WBAA 5KJ7C 1PP9E 1GL2B 3B5ND 1DEEG 1S9KD 1NTZD 1IFDA 2ZVOB 3A3YB 3AE1C 3CL3D 3NMDA 3GW6A 3N4XA 1EZVI 1NTKD 2IBZD 3B4SA 2KLVA 2FBWC 2E5TA 1M1JA 4H13D 3RL0D 1P84E 2HG5D 1YJNP 1BE3E 3H1HJ 3VTPC 1Y47A 1LTTC 1L4AA 1HGZA 1NTZJ 2BEQD 3BASA 4OGQD 3KXDA 1YJWP 2SPZA 1SQQG 1N8RQ 3FWNA 3M0DC 3H1IJ 1FZCA 1YHQP 1NU1J 1URQB 3AE9C 3L73D 4PD4D 5AVSB 3S9OA 3CWBE 2HPCB 3H1KE 1AFOA 2IZ0A 3B5NB 3L75G 4IFMA 4W7ZA 3CXHE 2LXBA 1OMIA 3H1LD 3LW5H 3SSUA 3VP8A 2AXTH 1PGJA 4Y99C 1OW8A 4OWFA 1M8OB 1GU4A 1BDDA 2FXMA 1N7SB 1BSNA 2KK7A 2Q3EA 4N6JA 1NTZK 1N73C 1G1JA 4GOEA 2QM8A 2RH0A 3HUSB 3L70G 2D2CB 2E75D 4K3AA 4GDOA 1VF5C 1G2CA 1JTHA 1RE3A 1JY2P 1LTJA 1SQXE 2AEJA 3BCCJ 3E1IA 3HUSC 3GMAA 2OTJP 2YXRB 1NTMG 3VMYA 1K8AQ 3H1IE 3RL0g 3HE5A 3AE2C 3MP7B 2RMZA 1NH4A 1SP4A 3CWBJ 1VQKP 1KYOH 1VF5D 2KUBA 1G2CB 1JTHB 2P58A 2IYPA 3V6IA 1IFIA 5AW3B 3FWLA 3VP9A 2A45G 2O3JA 2PAJA 1FDIA 2ZAEB 4C7RA 4A7PA 1JY3O 2IBZI 1S3JA 4HH2A 3AEFC 1NWQA 1P84D 1ZXGA 5AW1B 1OX3A 1LT1A 4D6TJ 1L0NJ 1WMKA 3GHGA 3I55P 3D6ZA 2I1JA 1BCCG 3H1JJ 5KJ7D 2WITA 1OZHA 2Q7CA 1X0TA 3FXDA 4B86A 2VRSA 1RY3A 2E42A 3BCCE 2QJKC 3H1HD 3I56P 2OYHC 2BCCD 5AVZB 4JYCA 1SQXK 2OTKE 3CXHD 5H2FH 3T97A 4AYCA 1S5LX 1PIXA 3CPWO 2RKLA 2FYUG 1NU1D 1RF1A 1SQVE 4W7YA 5CMZA 3AE3C 1JCDA 3CX5D 1LWUA 3L75J 3VMAA 2M0BA 4PJ0E 2Y9ZA 4RJTA 1J1EB 4C7NA 2B87B 3HD7C 1KFNA 4ZKPA 2CPSA 1GL2D 3O6QA 1MV8A 1ZP0C 2CPBA 3SFEC 3H25A 2PGDA 1Q86Q 3CC2P 1HUCA 4MN4C 1QEXA 2FYNB 5KAIH 4BWNA 3TGUD 1EQ7A 2W83C 1J2JB 3A7OA 1NVOA 1HBWA 1NTMJ 2UWJE 1HJ0A 1GW4A 3L73G 3P8MC 2CK3H 1K73Q 1GK6A 4Z1MH 1EZVE 3L71G 4AUWA 1FC2C 1YYCA 4ZMDA 3PJSK 2E75C 1EDJA 2KLUA 3RBZA 1EXJA 3HE4A 4H0LB 3ITKA 4IFFA 5CCGC 1VQ6P 1LP1B 3BRVB 5KLVJ 3D6YA 4D6TG 1YITP 1VQ4P 1L0NK 3RL0C 1R8EA 4H13C 3CMEP 2BCCE 2QRXA 5AVRB 2W6BA 1NTZG 2D2CC 1FZFA 5CCHD 3V4QA 3NXSA 4PV1C 2MJZA 2KP8A 5KLVD 3AE7C 2ZYAA 4GOFA 3TDKA 4AQRD 2OYIC 1SQVD 3AE6C 1FDMA 3HRNA 1NU1G 2QSIA 3HD7D 5AVVB 5K5GB 4ASVA 3PRJA 2YMYA 4IFDK 5CCHC 5CHXA 1X9VA 3RK2B 2QJKB 5APQA 3PP5A 2OYHB 1WT6A 1NAFA 2JJLA 2HODB 2QJYB 2WPSA 3T97B 1SQBE 1PP9G 2FKWB 2P7JA 3GF3A 1BGYD 1SQPE 3H32A 1YTZT 3A0HH 1NOHA 3L75D 1L0LD 1PGOA 1ZN5A 1L0LK 2OGUA 3KZIH 4OGQC 4IL6E 5KTBA 1CI6B 3Q5SA 1AJYA 1RQUA 1BE3G 2HLOA 5TJHA 3B5NA 1M90Q 4EDFA 4U7JA 5L8RJ 5KKZC 2FFDA 3M0AA 1NAYA 2R5DA 2W6AA 3AEBC 1M56D 2R32A 1LWUB 3A5TA 4U3FJ 1GU5A 4BRYA 1SQPD 1USEA 5B66H 2K37A 3MGNA 1BDCA 2P10A 3RK2C 3H1ID 5AW5B 4WY4D 3E1RA 5GTHE 4PV1B 1NU1K 3L73J 2A45I 1LJ2A 5CBNA 1PL5A 2OYIB 3EQ2A 3CX5H 5KKZB 1W2BO 1KB9H 1BCCJ 1KB9E 1KILA 2NPSA 1EDIA 1KILE 2YKPA 1QVGO 3K5BA 3S4RA 1AV1A 4N78D 4C46A 2IPPA 3D70A 4UB6H 2L91A 1HWTC 2O1KA 1KYOI 1U57A 3FXEA 1NTME 2XDJA 1JNMA 1BCCD 1VPCA 3WUUA 2W90A 3TGUG 1W5CE 2N1TA 2R5BA 1HGVA 1JY2N 2W8ZA 4OVNF 1GTWA 1SQBD 3MUDC 1EDKA 1MUUA 2E5YA 3V2PA 3V2NA 1KFMA 4EI2A 1HF9A 3IAOA 3WU2H 5GTIE 3HTKB 5E79E 2H88C 3F5HA 1IJDB 2BEZF 1SS1A 2Z5HA 3QWOC 4NPFX 2N9YB 4I2LC 1RF0A 1YQ3C 2K9JA 2C0WA 2D2CD 2FYUK 2LKMA 2QVAA 4NPEA 1LTJB 2JR8A 2I8DA 2O01N 2WSFH 3JSVC 4L76A 4RO0A 3FX0A 1BCCE 2FYNC 1NTKJ 4WB4A 3RK3E 2AXCA 1L0LJ 2Y0CA 2N9BA 1OW7A 4KT0J 4D6TD 1Y9BA 1ZLLA 2A06G 1L0ND 4GKGA 4XE5B 2KI7B 1S2EA 3W68A 1J1DC 1AVOA 4I7ZB 2KXPB 1GL2A 2WWWA 1LTBC 2G8YA 3L37A 1PV3A 5AW0B 1KZUB 5CCGD 3H1LE 2WTYA 1VQ5P 1NJIQ 2Q9IA 4IL6X 1KILB 1OXZA 2FYUE 1FJPA 3H1KJ 1RE4A 2KNCB 2KZJA 3M9HA 3SWKA 3W67A 2WT7B 1Q81Q 1SQPJ 2JWDA 2W27A 2KOGA 1LGHB 1URQA 2XNXA 4WY4A 1GZLA 1EDLA 2KSEA 4ASWA 3H1HG 2QA4P 3RK2D 5AW7B 2Z4EA 5BU5A 4Y28J 3EWKA 1URQC 2O01H 1FE6A 4M3LA 3SWFA 3CCMP 1Q82Q 1M7LA 4H0LD 2M3EA 4GT1A 1X8YA 2PFXA 1QX8A 1T3JA 2W6JH 2WPRA 3CC7P 1VQLP 1J1EC 1KC8Q 1IFJA 2WPQA 4PV1D 4PD4H 1IZNB 3KHUA 3L74E 4YTPC 4DCKA 2N1TD 3L35A 4R4MA 4DT0A 3FGAD 2H43A 3L73E 3TK1A 3LIDA 4DJGA 4L73A 1NTKK 2N1TB 3CLQA 3U59A 3NTNA 4DOJA 1EZVG 3JCUH 2ZT9B 3L71E 5APVA 1CZQA 1JMMA 3Q5RA 4PJ0H 1KN7A 1VF5B 3NFQA 1N2DC 1RF0C 3CC4P 4N3YB 1SVFA 1L0NE 3WU2E 2L5GB 1SQQE 5AVUB 1VQ9P 2E76B 3H1JE 1BGYE 2BCCG 3MUDA 2G3AA 4Y99B 1QVFO 1T6AA 2YXQB 5AVTB 1KB9D 1FZCB 3CWBG 1L0LG 2N1TC 1LTSC 4HKZH 3V2QA 4HJGH 3PH0A 4JYBA 1OVUA 2XU6A 4UB8E 2B89A 3CD6P 4UB8H 1IFNA 2QG4A 3C9IA 2FXPA 2PP6A 1PPJE 1JM0A 1KILC 1LP1A 1SQBK 2NPSC 1KYOD 3G9RA 3HE5B 3L4FA 4WWIA 1KV4A 4YXWH 3Q2YA 2FFDB 1UIXA 3WUVA 1H0TB 2KS1B 2XV5A 5AW8B 5KLVG 4NPDA 1JY3N 2I1KA 2FYZA 4WVZA 3U1CA 2HPCA 3II6A 3G3ZA 1P84H 3CCUP 2JO1A 3A0BE 4BRYB 1X79B 1SQXJ 3F89A 3IFMA 1S4XA 2KS1A 1JO5A 1FU1A 1YIJP 3U1AA 2WT7A 2H8PD 2ZXXA 1S9KE 3TGUJ 1FZBA 1SQXD 5KAFE 5GTIH 1IK9A 2A45H 3L71D 1LTAC 3L72E 3MZWB 5EFWB 3B5NC 1KD1Q 2Y0EA 3CXHH 3V2RA 1NGMB 2AXTE 1BE3D 1PP9J 4GODA 1DD4A 2E74C 2IFMA 2YNYA 2GUSA 2P2UA 4OH8B 1HJBA 2POHA 1GD2E 1SQQD 1DD3A 1FOSE 1LTIC 2JKVA 3AEAC 1KTMA 2WSCJ 3MTUE 4JQ0D 1XTGB 1SFCB 3KZIE 1JOCA 2YKOA 4IL6H 5CCHA 2ZFCA 3HE4B 1KQFB 4C7NB 3CCJP 4EOTA 3BVHA 4YPCA 2OYIA 1PZQA 3ABVC 3TGUE 1KQGB 5APUA 5BVZA 1KYOE 3L72J 3AE4C 1SQVJ 1JY2O 1YQ4C 2R3CA 4LLHA 1OW6A 1CSBA 1MFTA 5B66E 3L70D 5CJ4A 1N7SD 2Y0DA 3L75E 4WY4C 4I6MC 2OQQA 4I7ZC 3M06A 2B87A 2P1JA 1SLQA 5APTA 4OGQB 3WUTA 1RE4C 1SQBJ 3B71A 3VYIA 3CI9A 1VQPP 2NRGA 1PFIA 1BGYJ 1FOSF 2C9NY 2IFNA 3AEEC 4KHXA 1Y8AA 2WSCH 1URQD 3G6EP 1GL2C 1W2EA 2MKVA 1FZEA 4TLFA 1JY3P 3USSA 3CCSP 1H88A 3G71P 1NO4A 4PD4E 4ZNCA 2P67A 2M8RA 2B88A 3P8CD 4H0LC 1SQPK 2ZVNB 3RK3C 4WY4B 1AA0A 2Q1KA 2RN0A 4UB6E 3A0BH 1YBKA 3H1LG 5APSA 4RKUJ 1KORA 3SFDC 4U3FE 1AQ5A 3O8ZA 3TNUA 1N7LA 1M1KQ 2QE7H 3RK3D 1LT9B 1NYHA 3HD7A 4D6TE 2M5AA 5APXA 1VL2A 1LTGC 3Q1MA 1PGQA 1BE3J 1PP9D 2LXCB 2JP3A 1FJKA 2Q5UA 4O9BA 1NTZE 1S5LE 1NTKG 1H8AA 4L74A 1ZW0A 2GA1A 2R3SA 5KLVK 1UIIA 1RF1B 1RH5B 2WSEJ 4QMAA 1AQTA 1SQVK 2K1AA 3GF7A 3H32B 4JPZB 1OFCX 4PD4I 1NU1E 3RGUA 1RQVA 4LGDE 2QJYC 1T8ZA 2K9JB 2ZYGA 5TISH 2H7HA 1X22A 3TF5A 1T2KC 2E74D 4TT3H 3ZDMA 5KLIB 1ZR4A 2OYHA 1DEBA 3IN6A 1XTCC 4GIFA 3I5CA 1VQNP 2BASA 2Q6QA 1SQPG 1JUNA 2WSFJ 3P32A 3PTZA 4JBZA 1GDTA 2YIUB 1IO4A 2QEXP 3L72D 3AEDC 4L75A 3GHGC 2NPSD 1E79H 3CCQP 2JDIH 1DX7A 3IR9A 4ZKUA 1GK4A 2XKMA 3BCCD 1E5WA 3R4YA 1ZRTD 1A02F 1HH0A 1T3UA 4DZOA 3P7KA 2C9LY 1M1JB 1BGYG 2IBZE 2O1JA 1D7MA 1KILD 1QGKB 1R5SA 2B9BA 3HD7B 1MKMA 2WSSH 4XA4A 2M5AB 2Y9YA 2NZ2A 3VMZA 1EC5A 3G4SP 4CPGA 2WQYC 1IFMA 3HUSA 1MZ9A 3N7NA 1NKZB 1L4AB 2J59M 5DJUB 2ZT9C 3MHVA 4BXLA 2HYNA 2IZ1A 2O01J 4I1LA 1EXIA 2FYUJ 2IYOA 1PPJG 4HYTB 2V7QJ 4KJMA 2HFED 1RHZB 3H1KD 3H1JD 1KB9I 1R5LA 3V4WA 1KQLA 2XNDH 5KLIC 1S1CX 3JCUE 1FZGA 1JB0J 1Q90D 5KLVE 3M9QA 3EFFK 2Z5IA 1WRGA 1USDA 2PRRA 3RL0B 3C8VA 1GMJA 2JEEA 1KQSO 1ZMEC 1QL1A 1FDOA 2JWAA 3B8EB 1YI2P 2FXOA 1JCCA 2A06D 1YJ9P 4HB1A 2E43A 1PPJD 1SFCD 3KQGA 2HR3A 3KDPB 4H44B 3M0DA 3H1KG 3P8CE 3UIAA 3V5BA 2HODA 2ZT9D 2KZIA 3VOPA 4N78E 1BSHA 1FAVA 5KJ7A 2NPSB 5CCGA 3CCEP 1L4AC 5TISE 5APWA 1U7MA 1M1JC 2R44A 1YTZI 3CX5E 3IF4A 3OAKA 1GW3A 3BRTB 2YO3A 1SQBG 2K3RA 3HTKA 2A06E 3L70E 1IFPA 1OWAA 5AW6B 2E74B 1SQXG 2KB7P 3GHGB 3CWBD 3Q3DA 4XFJA 1VQ7P 2GM4A 3TYYA 1P84I 1QL2A 3GG2A 3OJAB 3R2PA 1ZV8A 3D71A 3H1IG 1N73B 2ZXEB 2ITAA 2XZRA 5E79H 5H2FE 1AVYA 1HTLC 2GUVA 1IC2A 2ZYDA 4H44C 3CMAP 5DJTB 2KNCA 5BU8B 5KAFH 2OYOA 3OW2O 1ZOYC 1CI6A 1L2PA 2FY8A 3CCVP 2ZJSE 1U7JA 1IK7A 2DW3A 2C0XA 1LWUC 2K9YA 3CXHI 3CCLP 2M3BA 1OVRA 3BATA 1SFCA 2FYUD 3AECC 4LC1A 5AW4B 1RF1C 2BCCJ 1S72P 3WMM0 3MD0A 3CX5I 1KMIZ 1N7SC 2AEFA
chains in the Genus database with same CATH topology
3H6PA 1NKNA 3VMXA 5AW2B 1LT9A 4JF7A 3TSIA 3OA7A 5APYA 3RK3B 1T2KD 5AVXB 4EIJA 2HPCA 1MFZA 5CJ0A 1NHLA 2OARA 1L4AD 3L36A 1G1IA 1J1DB 2WSEH 2WZ7A 4RESB 1FBMA 5AVWB 1NTMK 2Q3IA 1ZR2A 2KSJA 2J58A 1LTJC 1CW5A 1RE3C 1LT9C 3EFGA 3TNUB 5AW9B 1N73A 1FZAA 1N7SA 2KYVA 3VN0A 2QM7A 1SFCC 2IX7C 3A2AA 1SQQK 5AVYB 1N86A 3M9BA 1FZCC 5AVQB 2YO2A 1A02J 1Z56A 3SWYA 1HVVA 3KPEA 1H89A 2YKQA 3MIWA 3KYQA 3LIEA 1VDFA 3M91A 4W80A 4WBAA 5KJ7C 3B5ND 1GL2B 1S9KD 3A3YB 1IFDA 3CL3D 5KJ7A 3NMDA 3N4XA 2KLVA 3RL0D 1M1JA 2HG5D 3VTPC 1LTTC 1L4AA 1HGZA 3BASA 3M0DC 1FZCA 1URQB 5AVSB 2HPCB 1AFOA 3B5NB 4IFMA 4W7ZA 3LW5H 3VP8A 4Y99C 1GU4A 2FXMA 1N7SB 4N6JA 1NTZK 1N73C 1G1JA 2QM8A 3HUSB 1G2CA 1JTHA 1RE3A 1JY2P 1LTJA 3HUSC 3E1IA 3VMYA 3HE5A 1NH4A 1SP4A 1G2CB 1JTHB 1IFIA 5AW3B 3VP9A 2A45G 2PAJA 4C7RA 1JY3O 4HH2A 1NWQA 5AW1B 3GHGA 2I1JA 5KJ7D 2WITA 2Q7CA 4B86A 2VRSA 1RY3A 2E42A 2OYHC 5AVZB 4JYCA 1SQXK 3T97A 4AYCA 1RF1A 4W7YA 5CMZA 1JCDA 1LWUA 1J1EB 4C7NA 3HD7C 1KFNA 2CPSA 1GL2D 1MV8A 2CPBA 1HUCA 1EQ7A 1HBWA 1J2JB 3A7OA 1GW4A 3P8MC 1GK6A 4AUWA 1YYCA 3HE4A 4IFFA 5CCGC 3BRVB 1L0NK 3RL0C 5AVRB 2W6BA 1FZFA 5CCHD 3V4QA 3NXSA 2MJZA 2KP8A 4AQRD 2OYIC 1FDMA 3HRNA 3HD7D 5AVVB 2YMYA 4IFDK 5CCHC 5CHXA 1X9VA 3RK2B 2OYHB 5APQA 3PP5A 1WT6A 1NAFA 2JJLA 2HODB 2WPSA 2FKWB 2P7JA 3H32A 1YTZT 1NOHA 5KTBA 1ZN5A 1L0LK 1CI6B 2HLOA 3B5NA 2FFDA 3M0AA 2R5DA 2W6AA 2R32A 3A5TA 1LWUB 1GU5A 3MGNA 3RK2C 5AW5B 4WY4D 1NU1K 2A45I 2OYIB 3EQ2A 1KILA 2NPSA 2YKPA 4N78D 4C46A 2IPPA 1HWTC 2O1KA 2XDJA 1JNMA 1VPCA 2N1TA 2R5BA 1HGVA 1JY2N 1GTWA 3V2PA 1MUUA 3V2NA 1KFMA 3HTKB 1IJDB 2Z5HA 4I2LC 1RF0A 2C0WA 2FYUK 2LKMA 1LTJB 2WSFH 4WB4A 4DZOA 4ZKPA 2N9BA 1ZLLA 4GKGA 4XE5B 1J1DC 1GL2A 2WWWA 1LTBC 3L37A 5AW0B 5CCGD 1DH3A 1KZUB 2WTYA 2Q9IA 1KILB 1OXZA 1FJPA 1RE4A 2WT7B 3M9HA 2W27A 2KOGA 1LGHB 1URQA 2XNXA 4WY4A 1GZLA 3RK2D 5AW7B 2Z4EA 5BU5A 1URQC 2O01H 4M3LA 3SWFA 1M7LA 4GT1A 1X8YA 1T3JA 2WPRA 1J1EC 1IFJA 2WPQA 2N1TD 3L35A 2H43A 3TK1A 3LIDA 1NTKK 2N1TB 3CLQA 3U59A 3NTNA 4DOJA 5APVA 1CZQA 1JMMA 3NFQA 1N2DC 1RF0C 4N3YB 1SVFA 2L5GB 5AVUB 3MUDA 4Y99B 5AVTB 1FZCB 2N1TC 1LTSC 3V2QA 4JYBA 2XU6A 1IFNA 3C9IA 2PP6A 5BVZA 2NPSC 1KILC 3L4FA 1SQBK 3HE5B 2FFDB 2XV5A 5AW8B 1JY3N 2I1KA 2FYZA 3U1CA 3II6A 3G3ZA 1X79B 3IFMA 1JO5A 1FU1A 3U1AA 2WT7A 2H8PD 1S9KE 1FZBA 1IK9A 2A45H 1LTAC 3B5NC 3V2RA 4OH8B 1HJBA 2IFMA 2YNYA 2GUSA 2P2UA 2POHA 1GD2E 1FOSE 1LTIC 3MTUE 1XTGB 1SFCB 1JOCA 2YKOA 5CCHA 2ZFCA 3HE4B 4C7NB 4EOTA 3BVHA 2OYIA 5APUA 4LLHA 1JY2O 2R3CA 1CSBA 5CJ4A 1N7SD 4WY4C 4I6MC 5APTA 3M06A 2P1JA 1SLQA 1RE4C 3VYIA 3CI9A 1PFIA 1FOSF 2C9NY 2IFNA 4KHXA 2WSCH 1URQD 1H88A 1GL2C 1W2EA 1FZEA 1JY3P 1NO4A 2P67A 2M8RA 3P8CD 1SQPK 3RK3C 4WY4B 5APSA 1AQ5A 3O8ZA 3TNUA 1N7LA 3RK3D 1LT9B 3HD7A 5APXA 1LTGC 1FJKA 2Q5UA 4O9BA 1H8AA 1RF1B 5KLVK 1SQVK 3H32B 4LGDE 1T8ZA 2H7HA 1T2KC 1ZR4A 2OYHA 1DEBA 1XTCC 4GIFA 3I5CA 2BASA 1JUNA 3P32A 1GDTA 3GHGC 2NPSD 1DX7A 3IR9A 4ZKUA 1GK4A 2XKMA 1E5WA 1A02F 1HH0A 1T3UA 2C9LY 3P7KA 1M1JB 2O1JA 1KILD 2FFDC 4XA4A 3HD7B 3VMZA 1IFMA 3HUSA 1MZ9A 3N7NA 1NKZB 1L4AB 2J59M 1IO4A 2HYNA 4I1LA 4HYTB 2HFED 3V4WA 1KQLA 1FZGA 3M9QA 2Z5IA 1WRGA 3RL0B 2JEEA 1QL1A 3B8EB 1JCCA 2E43A 1SFCD 3KQGA 3KDPB 3UIAA 3V5BA 3M0DA 3P8CE 2HODA 3VOPA 4N78E 1FAVA 2NPSB 5CCGA 1L4AC 5APWA 1M1JC 1YTZI 3OAKA 1GW3A 3BRTB 2YO3A 3HTKA 1OWAA 5AW6B 2KB7P 3GHGB 2GM4A 3TYYA 1QL2A 3OJAB 3R2PA 1N73B 1ZV8A 2ZXEB 2XZRA 2GUVA 1HTLC 1IC2A 5BU8B 1CI6A 2C0XA 1LWUC 2M3BA 3BATA 1SFCA 4LC1A 1RF1C 5AW4B 3WMM0 3MD0A 1N7SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9B A;  4GKG A;  2E42 A;  4XE5 B;  2P67 A;  3VMX A;  5AVZ B;  4JYC A;  5AW2 B;  2WWW A;  1DH3 A;  3L37 A;  5AW0 B;  3T97 A;  4AYC A;  2WTY A;  5APS A;  5APY A;  1H88 A;  2Q7C A;  1OXZ A;  1T2K D;  5CMZ A;  5AVX B;  3M9H A;  3O8Z A;  3TNU A;  2WT7 B;  1MFZ A;  2W27 A;  1GZL A;  5APX A;  4C7N A;  3L36 A;  5AW7 B;  2Q5U A;  4M3L A;  4RES B;  1H8A A;  3SWF A;  1MV8 A;  4GT1 A;  1HUC A;  5AVW B;  1X8Y A;  2Q3I A;  2WPR A;  2WPQ A;  1HBW A;  2H7H A;  1J2J B;  3A7O A;  3TNU B;  1T2K C;  5AW9 B;  3L35 A;  3P8M C;  3I5C A;  2BAS A;  3LID A;  1GK6 A;  3TK1 A;  3P32 A;  1JUN A;  4AUW A;  1YYC A;  3NTN A;  3VN0 A;  2QM7 A;  5APV A;  1CZQ A;  3HE4 A;  3NFQ A;  3A2A A;  3IR9 A;  5AVY B;  1GK4 A;  3M9B A;  5AVU B;  5AVR B;  4DZO A;  1A02 F;  2C9L Y;  3P7K A;  5AVQ B;  2YO2 A;  5AVT B;  3V4Q A;  3NXS A;  1A02 J;  2KP8 A;  3VMZ A;  4AQR D;  1H89 A;  5AVV B;  4JYB A;  3LIE A;  2XU6 A;  3M91 A;  1IO4 A;  5APQ A;  2JJL A;  1NAF A;  2WPS A;  3HE5 B;  4HYT B;  1S9K D;  2P7J A;  3A3Y B;  3NMD A;  3V4W A;  1KQL A;  2XV5 A;  5AW8 B;  1CI6 B;  3VTP C;  2Z5I A;  3B8E B;  3M0A A;  2R5D A;  2W6A A;  3KQG A;  2E43 A;  3KDP B;  3UIA A;  3V5B A;  3M0D A;  2R32 A;  2WT7 A;  5AVS B;  3A5T A;  1S9K E;  1GU5 A;  1FAV A;  3MGN A;  5AW5 B;  5APW A;  1HJB A;  2YNY A;  2P2U A;  1GU4 A;  3OAK A;  1GD2 E;  2YO3 A;  3HTK A;  1FOS E;  1OWA A;  2QM8 A;  5AW6 B;  4C46 A;  2ZFC A;  2IPP A;  3HE4 B;  3TYY A;  1HWT C;  4C7N B;  3VMY A;  2ZXE B;  4EOT A;  2XZR A;  1JNM A;  3HE5 A;  2R5B A;  1SP4 A;  5APU A;  1GTW A;  1G2C B;  1MUU A;  1CI6 A;  2R3C A;  5AW3 B;  1CSB A;  4I6M C;  2Z5H A;  5APT A;  3M06 A;  1NWQ A;  1SLQ A;  4I2L C;  5AW1 B;  4LC1 A;  5AW4 B;  3VYI A;  1FOS F;  2C9N Y;  3MD0 A;  4KHX A;  4B86 A;  2VRS A; 
#chains in the Genus database with same CATH topology
 3BCC G;  3H6P A;  1NKN A;  1ZRT E;  2QJP C;  3AE8 C;  3VMX A;  1QLE D;  5B5E H;  5B5E E;  3S1K A;  5AW2 B;  2WPV B;  2E76 D;  1LT9 A;  2K88 A;  4JF7 A;  3RBX A;  1VQO P;  3TSI A;  3L74 J;  1K9M Q;  4YXD C;  3OA7 A;  5APY A;  1SQV G;  1OIP A;  3E7K A;  2H89 C;  2IDB A;  3RK3 B;  5C39 A;  5AVX B;  1VQM P;  4U3F G;  4EIJ A;  1T2K D;  1Q7Y Q;  2V7Q H;  1MFZ A;  2WMM A;  3L71 J;  4R4L A;  2E76 C;  5CJ0 A;  1K05 A;  1NHL A;  3L74 D;  3PHL A;  1L0N G;  2OAR A;  1L4A D;  3L36 A;  2J5U A;  3H1J G;  1DIP A;  1G1I A;  1J1D B;  2WSE H;  2WVR A;  2WZ7 A;  3PLN A;  4RES B;  3C1L A;  5GTH H;  1FBM A;  1NTK E;  1SQQ J;  1DH3 A;  1L0L E;  5AVW B;  1NTM K;  1Q2N A;  5CBO A;  1NTM D;  1OVV A;  2Q3I A;  4H13 B;  1ZR2 A;  1TU3 F;  2KSJ A;  2J58 A;  2KIK A;  1H0T A;  4U3F D;  1LTJ C;  1CW5 A;  1RE3 C;  1LT9 C;  2OTL P;  4EYY Q;  2YMK A;  3EFG A;  2E75 B;  3H1L J;  1FS0 E;  5AW9 B;  2V4H A;  3TNU B;  1N73 A;  1FZA A;  1JEK A;  1N7S A;  4H44 D;  1LNQ A;  2KYV A;  3VN0 A;  2QM7 A;  1M57 D;  3GLM A;  1JMB A;  3A0H E;  1SFC C;  4K35 A;  2QJP B;  3L70 J;  1VQ8 P;  2IX7 C;  3Q5P A;  3A2A A;  1SQQ K;  5AVY B;  2FFD C;  3H1H E;  1S5L H;  1N86 A;  3M9B A;  3JC2 2;  1FZC C;  5AVQ B;  3QH9 A;  2YO2 A;  4IOI H;  1A02 J;  1PGP A;  1Z56 A;  2IBZ G;  2YIU C;  5KAI E;  3SWY A;  1EZV D;  1HVV A;  3AE5 C;  3L72 G;  3KPE A;  3AEG C;  2AEM A;  2YKQ A;  1H89 A;  3CCR P;  3MIW A;  3KYQ A;  2QIW A;  1K04 A;  3LIE A;  1VDF A;  3M91 A;  4W80 A;  3LW5 J;  2LR2 A;  5M1B A;  3L74 G;  3O6Q B;  4WBA A;  5KJ7 C;  1PP9 E;  1GL2 B;  3B5N D;  1DEE G;  1S9K D;  1NTZ D;  1IFD A;  2ZVO B;  3A3Y B;  3AE1 C;  3CL3 D;  3NMD A;  3GW6 A;  3N4X A;  1EZV I;  1NTK D;  2IBZ D;  3B4S A;  2KLV A;  2FBW C;  2E5T A;  1M1J A;  4H13 D;  3RL0 D;  1P84 E;  2HG5 D;  1YJN P;  1BE3 E;  3H1H J;  3VTP C;  1Y47 A;  1LTT C;  1L4A A;  1HGZ A;  1NTZ J;  2BEQ D;  3BAS A;  4OGQ D;  3KXD A;  1YJW P;  2SPZ A;  1SQQ G;  1N8R Q;  3FWN A;  3M0D C;  3H1I J;  1FZC A;  1YHQ P;  1NU1 J;  1URQ B;  3AE9 C;  3L73 D;  4PD4 D;  5AVS B;  3S9O A;  3CWB E;  2HPC B;  3H1K E;  1AFO A;  2IZ0 A;  3B5N B;  3L75 G;  4IFM A;  4W7Z A;  3CXH E;  2LXB A;  1OMI A;  3H1L D;  3LW5 H;  3SSU A;  3VP8 A;  2AXT H;  1PGJ A;  4Y99 C;  1OW8 A;  4OWF A;  1M8O B;  1GU4 A;  1BDD A;  2FXM A;  1N7S B;  1BSN A;  2KK7 A;  2Q3E A;  4N6J A;  1NTZ K;  1N73 C;  1G1J A;  4GOE A;  2QM8 A;  2RH0 A;  3HUS B;  3L70 G;  2D2C B;  2E75 D;  4K3A A;  4GDO A;  1VF5 C;  1G2C A;  1JTH A;  1RE3 A;  1JY2 P;  1LTJ A;  1SQX E;  2AEJ A;  3BCC J;  3E1I A;  3HUS C;  3GMA A;  2OTJ P;  2YXR B;  1NTM G;  3VMY A;  1K8A Q;  3H1I E;  3RL0 g;  3HE5 A;  3AE2 C;  3MP7 B;  2RMZ A;  1NH4 A;  1SP4 A;  3CWB J;  1VQK P;  1KYO H;  1VF5 D;  2KUB A;  1G2C B;  1JTH B;  2P58 A;  2IYP A;  3V6I A;  1IFI A;  5AW3 B;  3FWL A;  3VP9 A;  2A45 G;  2O3J A;  2PAJ A;  1FDI A;  2ZAE B;  4C7R A;  4A7P A;  1JY3 O;  2IBZ I;  1S3J A;  4HH2 A;  3AEF C;  1NWQ A;  1P84 D;  1ZXG A;  5AW1 B;  1OX3 A;  1LT1 A;  4D6T J;  1L0N J;  1WMK A;  3GHG A;  3I55 P;  3D6Z A;  2I1J A;  1BCC G;  3H1J J;  5KJ7 D;  2WIT A;  1OZH A;  2Q7C A;  1X0T A;  3FXD A;  4B86 A;  2VRS A;  1RY3 A;  2E42 A;  3BCC E;  2QJK C;  3H1H D;  3I56 P;  2OYH C;  2BCC D;  5AVZ B;  4JYC A;  1SQX K;  2OTK E;  3CXH D;  5H2F H;  3T97 A;  4AYC A;  1S5L X;  1PIX A;  3CPW O;  2RKL A;  2FYU G;  1NU1 D;  1RF1 A;  1SQV E;  4W7Y A;  5CMZ A;  3AE3 C;  1JCD A;  3CX5 D;  1LWU A;  3L75 J;  3VMA A;  2M0B A;  4PJ0 E;  2Y9Z A;  4RJT A;  1J1E B;  4C7N A;  2B87 B;  3HD7 C;  1KFN A;  4ZKP A;  2CPS A;  1GL2 D;  3O6Q A;  1MV8 A;  1ZP0 C;  2CPB A;  3SFE C;  3H25 A;  2PGD A;  1Q86 Q;  3CC2 P;  1HUC A;  4MN4 C;  1QEX A;  2FYN B;  5KAI H;  4BWN A;  3TGU D;  1EQ7 A;  2W83 C;  1J2J B;  3A7O A;  1NVO A;  1HBW A;  1NTM J;  2UWJ E;  1HJ0 A;  1GW4 A;  3L73 G;  3P8M C;  2CK3 H;  1K73 Q;  1GK6 A;  4Z1M H;  1EZV E;  3L71 G;  4AUW A;  1FC2 C;  1YYC A;  4ZMD A;  3PJS K;  2E75 C;  1EDJ A;  2KLU A;  3RBZ A;  1EXJ A;  3HE4 A;  4H0L B;  3ITK A;  4IFF A;  5CCG C;  1VQ6 P;  1LP1 B;  3BRV B;  5KLV J;  3D6Y A;  4D6T G;  1YIT P;  1VQ4 P;  1L0N K;  3RL0 C;  1R8E A;  4H13 C;  3CME P;  2BCC E;  2QRX A;  5AVR B;  2W6B A;  1NTZ G;  2D2C C;  1FZF A;  5CCH D;  3V4Q A;  3NXS A;  4PV1 C;  2MJZ A;  2KP8 A;  5KLV D;  3AE7 C;  2ZYA A;  4GOF A;  3TDK A;  4AQR D;  2OYI C;  1SQV D;  3AE6 C;  1FDM A;  3HRN A;  1NU1 G;  2QSI A;  3HD7 D;  5AVV B;  5K5G B;  4ASV A;  3PRJ A;  2YMY A;  4IFD K;  5CCH C;  5CHX A;  1X9V A;  3RK2 B;  2QJK B;  5APQ A;  3PP5 A;  2OYH B;  1WT6 A;  1NAF A;  2JJL A;  2HOD B;  2QJY B;  2WPS A;  3T97 B;  1SQB E;  1PP9 G;  2FKW B;  2P7J A;  3GF3 A;  1BGY D;  1SQP E;  3H32 A;  1YTZ T;  3A0H H;  1NOH A;  3L75 D;  1L0L D;  1PGO A;  1ZN5 A;  1L0L K;  2OGU A;  3KZI H;  4OGQ C;  4IL6 E;  5KTB A;  1CI6 B;  3Q5S A;  1AJY A;  1RQU A;  1BE3 G;  2HLO A;  5TJH A;  3B5N A;  1M90 Q;  4EDF A;  4U7J A;  5L8R J;  5KKZ C;  2FFD A;  3M0A A;  1NAY A;  2R5D A;  2W6A A;  3AEB C;  1M56 D;  2R32 A;  1LWU B;  3A5T A;  4U3F J;  1GU5 A;  4BRY A;  1SQP D;  1USE A;  5B66 H;  2K37 A;  3MGN A;  1BDC A;  2P10 A;  3RK2 C;  3H1I D;  5AW5 B;  4WY4 D;  3E1R A;  5GTH E;  4PV1 B;  1NU1 K;  3L73 J;  2A45 I;  1LJ2 A;  5CBN A;  1PL5 A;  2OYI B;  3EQ2 A;  3CX5 H;  5KKZ B;  1W2B O;  1KB9 H;  1BCC J;  1KB9 E;  1KIL A;  2NPS A;  1EDI A;  1KIL E;  2YKP A;  1QVG O;  3K5B A;  3S4R A;  1AV1 A;  4N78 D;  4C46 A;  2IPP A;  3D70 A;  4UB6 H;  2L91 A;  1HWT C;  2O1K A;  1KYO I;  1U57 A;  3FXE A;  1NTM E;  2XDJ A;  1JNM A;  1BCC D;  1VPC A;  3WUU A;  2W90 A;  3TGU G;  1W5C E;  2N1T A;  2R5B A;  1HGV A;  1JY2 N;  2W8Z A;  4OVN F;  1GTW A;  1SQB D;  3MUD C;  1EDK A;  1MUU A;  2E5Y A;  3V2P A;  3V2N A;  1KFM A;  4EI2 A;  1HF9 A;  3IAO A;  3WU2 H;  5GTI E;  3HTK B;  5E79 E;  2H88 C;  3F5H A;  1IJD B;  2BEZ F;  1SS1 A;  2Z5H A;  3QWO C;  4NPF X;  2N9Y B;  4I2L C;  1RF0 A;  1YQ3 C;  2K9J A;  2C0W A;  2D2C D;  2FYU K;  2LKM A;  2QVA A;  4NPE A;  1LTJ B;  2JR8 A;  2I8D A;  2O01 N;  2WSF H;  3JSV C;  4L76 A;  4RO0 A;  3FX0 A;  1BCC E;  2FYN C;  1NTK J;  4WB4 A;  3RK3 E;  2AXC A;  1L0L J;  2Y0C A;  2N9B A;  1OW7 A;  4KT0 J;  4D6T D;  1Y9B A;  1ZLL A;  2A06 G;  1L0N D;  4GKG A;  4XE5 B;  2KI7 B;  1S2E A;  3W68 A;  1J1D C;  1AVO A;  4I7Z B;  2KXP B;  1GL2 A;  2WWW A;  1LTB C;  2G8Y A;  3L37 A;  1PV3 A;  5AW0 B;  1KZU B;  5CCG D;  3H1L E;  2WTY A;  1VQ5 P;  1NJI Q;  2Q9I A;  4IL6 X;  1KIL B;  1OXZ A;  2FYU E;  1FJP A;  3H1K J;  1RE4 A;  2KNC B;  2KZJ A;  3M9H A;  3SWK A;  3W67 A;  2WT7 B;  1Q81 Q;  1SQP J;  2JWD A;  2W27 A;  2KOG A;  1LGH B;  1URQ A;  2XNX A;  4WY4 A;  1GZL A;  1EDL A;  2KSE A;  4ASW A;  3H1H G;  2QA4 P;  3RK2 D;  5AW7 B;  2Z4E A;  5BU5 A;  4Y28 J;  3EWK A;  1URQ C;  2O01 H;  1FE6 A;  4M3L A;  3SWF A;  3CCM P;  1Q82 Q;  1M7L A;  4H0L D;  2M3E A;  4GT1 A;  1X8Y A;  2PFX A;  1QX8 A;  1T3J A;  2W6J H;  2WPR A;  3CC7 P;  1VQL P;  1J1E C;  1KC8 Q;  1IFJ A;  2WPQ A;  4PV1 D;  4PD4 H;  1IZN B;  3KHU A;  3L74 E;  4YTP C;  4DCK A;  2N1T D;  3L35 A;  4R4M A;  4DT0 A;  3FGA D;  2H43 A;  3L73 E;  3TK1 A;  3LID A;  4DJG A;  4L73 A;  1NTK K;  2N1T B;  3CLQ A;  3U59 A;  3NTN A;  4DOJ A;  1EZV G;  3JCU H;  2ZT9 B;  3L71 E;  5APV A;  1CZQ A;  1JMM A;  3Q5R A;  4PJ0 H;  1KN7 A;  1VF5 B;  3NFQ A;  1N2D C;  1RF0 C;  3CC4 P;  4N3Y B;  1SVF A;  1L0N E;  3WU2 E;  2L5G B;  1SQQ E;  5AVU B;  1VQ9 P;  2E76 B;  3H1J E;  1BGY E;  2BCC G;  3MUD A;  2G3A A;  4Y99 B;  1QVF O;  1T6A A;  2YXQ B;  5AVT B;  1KB9 D;  1FZC B;  3CWB G;  1L0L G;  2N1T C;  1LTS C;  4HKZ H;  3V2Q A;  4HJG H;  3PH0 A;  4JYB A;  1OVU A;  2XU6 A;  4UB8 E;  2B89 A;  3CD6 P;  4UB8 H;  1IFN A;  2QG4 A;  3C9I A;  2FXP A;  2PP6 A;  1PPJ E;  1JM0 A;  1KIL C;  1LP1 A;  1SQB K;  2NPS C;  1KYO D;  3G9R A;  3HE5 B;  3L4F A;  4WWI A;  1KV4 A;  4YXW H;  3Q2Y A;  2FFD B;  1UIX A;  3WUV A;  1H0T B;  2KS1 B;  2XV5 A;  5AW8 B;  5KLV G;  4NPD A;  1JY3 N;  2I1K A;  2FYZ A;  4WVZ A;  3U1C A;  2HPC A;  3II6 A;  3G3Z A;  1P84 H;  3CCU P;  2JO1 A;  3A0B E;  4BRY B;  1X79 B;  1SQX J;  3F89 A;  3IFM A;  1S4X A;  2KS1 A;  1JO5 A;  1FU1 A;  1YIJ P;  3U1A A;  2WT7 A;  2H8P D;  2ZXX A;  1S9K E;  3TGU J;  1FZB A;  1SQX D;  5KAF E;  5GTI H;  1IK9 A;  2A45 H;  3L71 D;  1LTA C;  3L72 E;  3MZW B;  5EFW B;  3B5N C;  1KD1 Q;  2Y0E A;  3CXH H;  3V2R A;  1NGM B;  2AXT E;  1BE3 D;  1PP9 J;  4GOD A;  1DD4 A;  2E74 C;  2IFM A;  2YNY A;  2GUS A;  2P2U A;  4OH8 B;  1HJB A;  2POH A;  1GD2 E;  1SQQ D;  1DD3 A;  1FOS E;  1LTI C;  2JKV A;  3AEA C;  1KTM A;  2WSC J;  3MTU E;  4JQ0 D;  1XTG B;  1SFC B;  3KZI E;  1JOC A;  2YKO A;  4IL6 H;  5CCH A;  2ZFC A;  3HE4 B;  1KQF B;  4C7N B;  3CCJ P;  4EOT A;  3BVH A;  4YPC A;  2OYI A;  1PZQ A;  3ABV C;  3TGU E;  1KQG B;  5APU A;  5BVZ A;  1KYO E;  3L72 J;  3AE4 C;  1SQV J;  1JY2 O;  1YQ4 C;  2R3C A;  4LLH A;  1OW6 A;  1CSB A;  1MFT A;  5B66 E;  3L70 D;  5CJ4 A;  1N7S D;  2Y0D A;  3L75 E;  4WY4 C;  4I6M C;  2OQQ A;  4I7Z C;  3M06 A;  2B87 A;  2P1J A;  1SLQ A;  5APT A;  4OGQ B;  3WUT A;  1RE4 C;  1SQB J;  3B71 A;  3VYI A;  3CI9 A;  1VQP P;  2NRG A;  1PFI A;  1BGY J;  1FOS F;  2C9N Y;  2IFN A;  3AEE C;  4KHX A;  1Y8A A;  2WSC H;  1URQ D;  3G6E P;  1GL2 C;  1W2E A;  2MKV A;  1FZE A;  4TLF A;  1JY3 P;  3USS A;  3CCS P;  1H88 A;  3G71 P;  1NO4 A;  4PD4 E;  4ZNC A;  2P67 A;  2M8R A;  2B88 A;  3P8C D;  4H0L C;  1SQP K;  2ZVN B;  3RK3 C;  4WY4 B;  1AA0 A;  2Q1K A;  2RN0 A;  4UB6 E;  3A0B H;  1YBK A;  3H1L G;  5APS A;  4RKU J;  1KOR A;  3SFD C;  4U3F E;  1AQ5 A;  3O8Z A;  3TNU A;  1N7L A;  1M1K Q;  2QE7 H;  3RK3 D;  1LT9 B;  1NYH A;  3HD7 A;  4D6T E;  2M5A A;  5APX A;  1VL2 A;  1LTG C;  3Q1M A;  1PGQ A;  1BE3 J;  1PP9 D;  2LXC B;  2JP3 A;  1FJK A;  2Q5U A;  4O9B A;  1NTZ E;  1S5L E;  1NTK G;  1H8A A;  4L74 A;  1ZW0 A;  2GA1 A;  2R3S A;  5KLV K;  1UII A;  1RF1 B;  1RH5 B;  2WSE J;  4QMA A;  1AQT A;  1SQV K;  2K1A A;  3GF7 A;  3H32 B;  4JPZ B;  1OFC X;  4PD4 I;  1NU1 E;  3RGU A;  1RQV A;  4LGD E;  2QJY C;  1T8Z A;  2K9J B;  2ZYG A;  5TIS H;  2H7H A;  1X22 A;  3TF5 A;  1T2K C;  2E74 D;  4TT3 H;  3ZDM A;  5KLI B;  1ZR4 A;  2OYH A;  1DEB A;  3IN6 A;  1XTC C;  4GIF A;  3I5C A;  1VQN P;  2BAS A;  2Q6Q A;  1SQP G;  1JUN A;  2WSF J;  3P32 A;  3PTZ A;  4JBZ A;  1GDT A;  2YIU B;  1IO4 A;  2QEX P;  3L72 D;  3AED C;  4L75 A;  3GHG C;  2NPS D;  1E79 H;  3CCQ P;  2JDI H;  1DX7 A;  3IR9 A;  4ZKU A;  1GK4 A;  2XKM A;  3BCC D;  1E5W A;  3R4Y A;  1ZRT D;  1A02 F;  1HH0 A;  1T3U A;  4DZO A;  3P7K A;  2C9L Y;  1M1J B;  1BGY G;  2IBZ E;  2O1J A;  1D7M A;  1KIL D;  1QGK B;  1R5S A;  2B9B A;  3HD7 B;  1MKM A;  2WSS H;  4XA4 A;  2M5A B;  2Y9Y A;  2NZ2 A;  3VMZ A;  1EC5 A;  3G4S P;  4CPG A;  2WQY C;  1IFM A;  3HUS A;  1MZ9 A;  3N7N A;  1NKZ B;  1L4A B;  2J59 M;  5DJU B;  2ZT9 C;  3MHV A;  4BXL A;  2HYN A;  2IZ1 A;  2O01 J;  4I1L A;  1EXI A;  2FYU J;  2IYO A;  1PPJ G;  4HYT B;  2V7Q J;  4KJM A;  2HFE D;  1RHZ B;  3H1K D;  3H1J D;  1KB9 I;  1R5L A;  3V4W A;  1KQL A;  2XND H;  5KLI C;  1S1C X;  3JCU E;  1FZG A;  1JB0 J;  1Q90 D;  5KLV E;  3M9Q A;  3EFF K;  2Z5I A;  1WRG A;  1USD A;  2PRR A;  3RL0 B;  3C8V A;  1GMJ A;  2JEE A;  1KQS O;  1ZME C;  1QL1 A;  1FDO A;  2JWA A;  3B8E B;  1YI2 P;  2FXO A;  1JCC A;  2A06 D;  1YJ9 P;  4HB1 A;  2E43 A;  1PPJ D;  1SFC D;  3KQG A;  2HR3 A;  3KDP B;  4H44 B;  3M0D A;  3H1K G;  3P8C E;  3UIA A;  3V5B A;  2HOD A;  2ZT9 D;  2KZI A;  3VOP A;  4N78 E;  1BSH A;  1FAV A;  5KJ7 A;  2NPS B;  5CCG A;  3CCE P;  1L4A C;  5TIS E;  5APW A;  1U7M A;  1M1J C;  2R44 A;  1YTZ I;  3CX5 E;  3IF4 A;  3OAK A;  1GW3 A;  3BRT B;  2YO3 A;  1SQB G;  2K3R A;  3HTK A;  2A06 E;  3L70 E;  1IFP A;  1OWA A;  5AW6 B;  2E74 B;  1SQX G;  2KB7 P;  3GHG B;  3CWB D;  3Q3D A;  4XFJ A;  1VQ7 P;  2GM4 A;  3TYY A;  1P84 I;  1QL2 A;  3GG2 A;  3OJA B;  3R2P A;  1ZV8 A;  3D71 A;  3H1I G;  1N73 B;  2ZXE B;  2ITA A;  2XZR A;  5E79 H;  5H2F E;  1AVY A;  1HTL C;  2GUV A;  1IC2 A;  2ZYD A;  4H44 C;  3CMA P;  5DJT B;  2KNC A;  5BU8 B;  5KAF H;  2OYO A;  3OW2 O;  1ZOY C;  1CI6 A;  1L2P A;  2FY8 A;  3CCV P;  2ZJS E;  1U7J A;  1IK7 A;  2DW3 A;  2C0X A;  1LWU C;  2K9Y A;  3CXH I;  3CCL P;  2M3B A;  1OVR A;  3BAT A;  1SFC A;  2FYU D;  3AEC C;  4LC1 A;  5AW4 B;  1RF1 C;  2BCC J;  1S72 P;  3WMM 0;  3MD0 A;  3CX5 I;  1KMI Z;  1N7S C;  2AEF A; 
#chains in the Genus database with same CATH homology
 3H6P A;  1NKN A;  3VMX A;  5AW2 B;  1LT9 A;  4JF7 A;  3TSI A;  3OA7 A;  5APY A;  3RK3 B;  1T2K D;  5AVX B;  4EIJ A;  2HPC A;  1MFZ A;  5CJ0 A;  1NHL A;  2OAR A;  1L4A D;  3L36 A;  1G1I A;  1J1D B;  2WSE H;  2WZ7 A;  4RES B;  1FBM A;  5AVW B;  1NTM K;  2Q3I A;  1ZR2 A;  2KSJ A;  2J58 A;  1LTJ C;  1CW5 A;  1RE3 C;  1LT9 C;  3EFG A;  3TNU B;  5AW9 B;  1N73 A;  1FZA A;  1N7S A;  2KYV A;  3VN0 A;  2QM7 A;  1SFC C;  2IX7 C;  3A2A A;  1SQQ K;  5AVY B;  1N86 A;  3M9B A;  1FZC C;  5AVQ B;  2YO2 A;  1A02 J;  1Z56 A;  3SWY A;  1HVV A;  3KPE A;  1H89 A;  2YKQ A;  3MIW A;  3KYQ A;  3LIE A;  1VDF A;  3M91 A;  4W80 A;  4WBA A;  5KJ7 C;  3B5N D;  1GL2 B;  1S9K D;  3A3Y B;  1IFD A;  3CL3 D;  5KJ7 A;  3NMD A;  3N4X A;  2KLV A;  3RL0 D;  1M1J A;  2HG5 D;  3VTP C;  1LTT C;  1L4A A;  1HGZ A;  3BAS A;  3M0D C;  1FZC A;  1URQ B;  5AVS B;  2HPC B;  1AFO A;  3B5N B;  4IFM A;  4W7Z A;  3LW5 H;  3VP8 A;  4Y99 C;  1GU4 A;  2FXM A;  1N7S B;  4N6J A;  1NTZ K;  1N73 C;  1G1J A;  2QM8 A;  3HUS B;  1G2C A;  1JTH A;  1RE3 A;  1JY2 P;  1LTJ A;  3HUS C;  3E1I A;  3VMY A;  3HE5 A;  1NH4 A;  1SP4 A;  1G2C B;  1JTH B;  1IFI A;  5AW3 B;  3VP9 A;  2A45 G;  2PAJ A;  4C7R A;  1JY3 O;  4HH2 A;  1NWQ A;  5AW1 B;  3GHG A;  2I1J A;  5KJ7 D;  2WIT A;  2Q7C A;  4B86 A;  2VRS A;  1RY3 A;  2E42 A;  2OYH C;  5AVZ B;  4JYC A;  1SQX K;  3T97 A;  4AYC A;  1RF1 A;  4W7Y A;  5CMZ A;  1JCD A;  1LWU A;  1J1E B;  4C7N A;  3HD7 C;  1KFN A;  2CPS A;  1GL2 D;  1MV8 A;  2CPB A;  1HUC A;  1EQ7 A;  1HBW A;  1J2J B;  3A7O A;  1GW4 A;  3P8M C;  1GK6 A;  4AUW A;  1YYC A;  3HE4 A;  4IFF A;  5CCG C;  3BRV B;  1L0N K;  3RL0 C;  5AVR B;  2W6B A;  1FZF A;  5CCH D;  3V4Q A;  3NXS A;  2MJZ A;  2KP8 A;  4AQR D;  2OYI C;  1FDM A;  3HRN A;  3HD7 D;  5AVV B;  2YMY A;  4IFD K;  5CCH C;  5CHX A;  1X9V A;  3RK2 B;  2OYH B;  5APQ A;  3PP5 A;  1WT6 A;  1NAF A;  2JJL A;  2HOD B;  2WPS A;  2FKW B;  2P7J A;  3H32 A;  1YTZ T;  1NOH A;  5KTB A;  1ZN5 A;  1L0L K;  1CI6 B;  2HLO A;  3B5N A;  2FFD A;  3M0A A;  2R5D A;  2W6A A;  2R32 A;  3A5T A;  1LWU B;  1GU5 A;  3MGN A;  3RK2 C;  5AW5 B;  4WY4 D;  1NU1 K;  2A45 I;  2OYI B;  3EQ2 A;  1KIL A;  2NPS A;  2YKP A;  4N78 D;  4C46 A;  2IPP A;  1HWT C;  2O1K A;  2XDJ A;  1JNM A;  1VPC A;  2N1T A;  2R5B A;  1HGV A;  1JY2 N;  1GTW A;  3V2P A;  1MUU A;  3V2N A;  1KFM A;  3HTK B;  1IJD B;  2Z5H A;  4I2L C;  1RF0 A;  2C0W A;  2FYU K;  2LKM A;  1LTJ B;  2WSF H;  4WB4 A;  4DZO A;  4ZKP A;  2N9B A;  1ZLL A;  4GKG A;  4XE5 B;  1J1D C;  1GL2 A;  2WWW A;  1LTB C;  3L37 A;  5AW0 B;  5CCG D;  1DH3 A;  1KZU B;  2WTY A;  2Q9I A;  1KIL B;  1OXZ A;  1FJP A;  1RE4 A;  2WT7 B;  3M9H A;  2W27 A;  2KOG A;  1LGH B;  1URQ A;  2XNX A;  4WY4 A;  1GZL A;  3RK2 D;  5AW7 B;  2Z4E A;  5BU5 A;  1URQ C;  2O01 H;  4M3L A;  3SWF A;  1M7L A;  4GT1 A;  1X8Y A;  1T3J A;  2WPR A;  1J1E C;  1IFJ A;  2WPQ A;  2N1T D;  3L35 A;  2H43 A;  3TK1 A;  3LID A;  1NTK K;  2N1T B;  3CLQ A;  3U59 A;  3NTN A;  4DOJ A;  5APV A;  1CZQ A;  1JMM A;  3NFQ A;  1N2D C;  1RF0 C;  4N3Y B;  1SVF A;  2L5G B;  5AVU B;  3MUD A;  4Y99 B;  5AVT B;  1FZC B;  2N1T C;  1LTS C;  3V2Q A;  4JYB A;  2XU6 A;  1IFN A;  3C9I A;  2PP6 A;  5BVZ A;  2NPS C;  1KIL C;  3L4F A;  1SQB K;  3HE5 B;  2FFD B;  2XV5 A;  5AW8 B;  1JY3 N;  2I1K A;  2FYZ A;  3U1C A;  3II6 A;  3G3Z A;  1X79 B;  3IFM A;  1JO5 A;  1FU1 A;  3U1A A;  2WT7 A;  2H8P D;  1S9K E;  1FZB A;  1IK9 A;  2A45 H;  1LTA C;  3B5N C;  3V2R A;  4OH8 B;  1HJB A;  2IFM A;  2YNY A;  2GUS A;  2P2U A;  2POH A;  1GD2 E;  1FOS E;  1LTI C;  3MTU E;  1XTG B;  1SFC B;  1JOC A;  2YKO A;  5CCH A;  2ZFC A;  3HE4 B;  4C7N B;  4EOT A;  3BVH A;  2OYI A;  5APU A;  4LLH A;  1JY2 O;  2R3C A;  1CSB A;  5CJ4 A;  1N7S D;  4WY4 C;  4I6M C;  5APT A;  3M06 A;  2P1J A;  1SLQ A;  1RE4 C;  3VYI A;  3CI9 A;  1PFI A;  1FOS F;  2C9N Y;  2IFN A;  4KHX A;  2WSC H;  1URQ D;  1H88 A;  1GL2 C;  1W2E A;  1FZE A;  1JY3 P;  1NO4 A;  2P67 A;  2M8R A;  3P8C D;  1SQP K;  3RK3 C;  4WY4 B;  5APS A;  1AQ5 A;  3O8Z A;  3TNU A;  1N7L A;  3RK3 D;  1LT9 B;  3HD7 A;  5APX A;  1LTG C;  1FJK A;  2Q5U A;  4O9B A;  1H8A A;  1RF1 B;  5KLV K;  1SQV K;  3H32 B;  4LGD E;  1T8Z A;  2H7H A;  1T2K C;  1ZR4 A;  2OYH A;  1DEB A;  1XTC C;  4GIF A;  3I5C A;  2BAS A;  1JUN A;  3P32 A;  1GDT A;  3GHG C;  2NPS D;  1DX7 A;  3IR9 A;  4ZKU A;  1GK4 A;  2XKM A;  1E5W A;  1A02 F;  1HH0 A;  1T3U A;  2C9L Y;  3P7K A;  1M1J B;  2O1J A;  1KIL D;  2FFD C;  4XA4 A;  3HD7 B;  3VMZ A;  1IFM A;  3HUS A;  1MZ9 A;  3N7N A;  1NKZ B;  1L4A B;  2J59 M;  1IO4 A;  2HYN A;  4I1L A;  4HYT B;  2HFE D;  3V4W A;  1KQL A;  1FZG A;  3M9Q A;  2Z5I A;  1WRG A;  3RL0 B;  2JEE A;  1QL1 A;  3B8E B;  1JCC A;  2E43 A;  1SFC D;  3KQG A;  3KDP B;  3UIA A;  3V5B A;  3M0D A;  3P8C E;  2HOD A;  3VOP A;  4N78 E;  1FAV A;  2NPS B;  5CCG A;  1L4A C;  5APW A;  1M1J C;  1YTZ I;  3OAK A;  1GW3 A;  3BRT B;  2YO3 A;  3HTK A;  1OWA A;  5AW6 B;  2KB7 P;  3GHG B;  2GM4 A;  3TYY A;  1QL2 A;  3OJA B;  3R2P A;  1N73 B;  1ZV8 A;  2ZXE B;  2XZR A;  2GUV A;  1HTL C;  1IC2 A;  5BU8 B;  1CI6 A;  2C0X A;  1LWU C;  2M3B A;  3BAT A;  1SFC A;  4LC1 A;  1RF1 C;  5AW4 B;  3WMM 0;  3MD0 A;  1N7S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...