2R5GA

Structure of human clic2, crystal form b
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
237
structure length
237
Chain Sequence
DPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 2
publication title Structure of the Janus Protein Human CLIC2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 82
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2r5gA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2r5gA01
2N5BA 3H79A 1A2JA 3DVWA 3I6AA 2FWHA 3I69A 2AJQB 3MNGA 2O87A 1EOGA 5JCUA 4K1FA 3QOUA 4V2NA 3M0FA 5EY6A 4GF0A 2RLIA 2KP2A 2V41A 2ZCTA 4FYBA 2GSTA 1S3DA 4RQXA 1PX6A 4ZBBA 2NPBA 2L6CA 3ZL5A 4MJBA 4KX4A 5DVBA 4G0IA 2DLXA 3TB2A 1OYJA 8GSSA 1V58A 4Q5FA 3ERGA 1GSEA 1JLVA 6GSUA 2N5AA 2V6KA 17GSA 1V9WA 3TRQA 1W4VA 4EO3A 1QUWA 1THOA 2PPTA 2MZCA 4KSOA 2C0DA 4HU7A 1PA3A 3PH9A 3UEMA 4PQHA 3ZVJA 5A5KA 1QGVA 3ZFBA 3LSZA 2LJKA 2LRNA 3ERWA 3FZAA 4OMVA 1M9AA 2HRKA 3QDNA 4F82A 2KUCA 4K6XA 3TJKA 2J23A 5HFIA 2BTOT 2IL3A 1JZWA 4ZXGA 5DJLA 2OACA 3IA1A 3MAKA 4F03A 3L4NA 5CP1A 5B7CA 2QKEA 1YEXA 4ECBA 3FHKA 1OAZA 2PBJA 4N11A 3H1NA 2E0QA 3GMFA 5ECLB 1F3AA 4G2EA 4OFMA 1H75A 5AN1A 1EOHA 1B48A 2OA7A 1XWAA 4HOJA 3R2QA 2H8LA 2TIRA 2B5YA 2DJJA 4MJEA 2VCTA 4ML6A 4ZL8A 4ILFA 2A2RA 1XCCA 4GQCA 4BWQA 1M9BA 6GSSA 2JSZA 2XBIA 4QL7A 4K8MA 5D9TA 2DJ3A 4PTSA 4AF2A 4PQIA 1TRSA 1XOAA 3CYNA 4POKA 4RI6A 3SWLA 2HRNA 1PD21 2VIMA 2V32A 2IMIA 3LEFA 2XPDA 3KTLA 4XS4B 3HZ4A 3TGZA 1GUHA 4BVYA 1G6YA 2DBCA 2VCVA 1TU8A 5J4UA 3VWWA 4IJIA 5ELAA 1K0BA 2JSYA 2YANA 1K0DA 1GTUA 2WFCA 1SJIA 1J0FA 2RIIA 3FEUA 4JZQA 1AIUA 3HHVA 2DJ2A 1XIYA 20GSA 1FW1A 4NXIA 2VOCA 1XPVA 2CAIA 5LNKe 3HCZA 1U88A 4HDEA 2PMTA 1RK4A 3UIWA 3VPQA 4IHUA 3H8QA 2LKUA 2FA8A 3FR3A 4NHZA 4V1Ag 4AJ6A 5JWRB 1GTBA 1G7EA 2JADA 2DIZA 2DMMA 5JCWA 3WT2A 3ZIVA 2H6YA 5ID2B 4J2FA 2AV4A 1TK0B 1ST9A 5F07A 1V40A 1TRWA 4CDOA 3HVSA 2ZUPA 2O7KA 1CQHA 1XOBA 2IFQB 2K8VA 3WGEA 1S3CA 2F3MA 2V2GA 1XW5A 2OE1A 1AAZA 5AISA 3ZYWA 4XHMA 4EDZA 1Q4JA 3UBKA 2FGXA 1OC9B 1A0RP 1YY7A 3PGTA 2ES7A 4MH3A 2NVLA 5A4VA 3C7MA 1TU7A 2ON5A 3F4SA 3MDKA 2IMEA 1F6MC 1F37A 3FZ4A 1KNGA 1Z5YE 3O3TA 2HT9A 4YQUA 4MF5A 5IQYA 2LQQA 3GH6A 1A23A 5B8AA 3D21A 3HDCA 2OE3A 2C8UA 2YP6A 1F3BA 4TR1A 2CQ9A 5HQPA 2OJLA 2D2ZA 2ZNMA 3APQA 3QCPA 2GQLA 4JE1A 2ALBA 1Z7RA 4YAVA 2IIYA 2CVBA 2P5RA 4MZBA 5JWQB 3KJYA 3L78A 5IPGA 5J3RA 3F6DA 3HJOA 1R5AA 2OE0A 3OR5A 3FR6A 4WF4A 4ID0A 5ECRB 3M9JA 3FRCA 3RHBA 1HQOA 2PVQA 1LBKA 5G5EA 1X5EA 2M80A 3LYPA 2IJYA 4MABA 3F4TA 3QAWA 1BX9A 2H0HA 3P8WA 1OE7A 4PURA 1Y25A 2VUPA 1E2YA 3DD3A 1Z7PA 1MDIA 4XRDA 1X9MB 1OC8A 3BCKA 3DXBA 3GX0A 4IQAA 1QMVA 1SK0A 3EC3A 1PGTA 4YQVA 2LRTA 3ZVJD 3DIEA 1X9SB 1OKTA 4IKHA 3RAZA 4KF9A 2R5GA 1O81A 3GKXA 3D4TA 3VPTA 2EIOA 3LXZA 1A2LA 5DAKB 1URMA 2H19A 1B4QA 1AXDA 5HR3A 1UVZA 3BJ5A 2MBTA 3F8UA 4IBPA 1V57A 1ERVA 3KCMA 1O6JA 4K7NA 4ML1A 3I43A 2XPEA 5ECPB 1B8XA 5HR1A 2H1AA 1T3BA 3UOMA 4GRFA 3FY7A 2X8CA 3PPUA 4E8EA 5KN0A 4WEYA 4J57E 4ZB8A 5ECIB 4FYCA 1X5CA 1GRXA 2L4QA 5L71A 1XVQA 1LU4A 3C73A 2MMOA 1GSUA 1RW1A 5DCGA 2TRCP 1K3LA 4DVCA 4IGJA 2JZRA 1NHOA 2HSHA 4PNFA 3UMAA 3PINA 2H72A 2GSSA 2MMZA 2YWNA 3RPPA 1GH2A 3M1GA 1NM3A 3HJMA 3PR8A 4MF6A 2LTKA 4ULXA 4J56E 1BJXA 2I3YA 2IPAA 4KNDA 3E3EA 2L57A 2H71A 11GSA 4P3YB 4WETA 3O6TA 5HFGA 19GSA 4MJCA 3TOUA 10GSA 2FUG2 1R4WA 3GFKA 2NBSA 1ERTA 3LYKA 1U6TA 3RBTA 2X99A 4L0WA 3ED3A 4ZB6A 4HS1A 2LUSA 3CSHA 2VD0A 3Q18A 4FQUA 5HR0A 4ZL9A 2JZTA 2GQMA 1SU9A 5J9CA 1HYUA 2CAQA 4HZ2A 1MEKA 12GSA 4ECIA 5AGYA 2HZEB 1FOVA 3GIXA 1Z6MA 2WGRA 4TXOB 2E2MA 1OVNA 1AUCA 3W6GA 4Z7XA 1PKWA 3GX8A 2C0GA 3FR9A 1A2MA 1QK8A 3G9BA 5LCZA 4PUAA 4NHWA 2AYTA 4HJ2A 5COHA 1K0CA 1AC1A 2FLSA 4HEA2 4NV2A 4GSNA 3HY2A 3EYTA 3P7XA 2YJ7A 2HRAA 18GSA 5HR2A 1PKZA 3D5JA 3LJRA 2I81A 1E6BA 4MF7A 1XWKA 5D8IA 2OBKA 5D9XA 1AW9A 6GSTA 4HI7A 4BA7A 5GSSA 3GKMA 5G31A 1GSFA 3R3EA 2B3SA 1JZRA 3QMXA 2XC2A 2F9SA 2GVPA 2GT5A 1GWCA 3TJJA 5ID2A 3UVTA 2P5QA 1SK2A 3G7IA 4IP1A 2HE3A 1EV4A 4HUAA 5CYYA 2VM2A 1T4YA 3DKSA 2G0FA 3VWUA 9GSSA 4I2UA 2X64A 2PN8A 1SL1B 6GSWA 2EC4A 1TXXA 3CRTA 1OC9A 2YOIA 2V1MA 4MPFA 2H74A 1GUKA 4JR4A 5IIZA 4YH2A 4YAPA 1UA5A 4TRXA 1O8WA 4I8BA 5DQSA 2PU9C 2X8GA 1SKSB 4X0XA 3TKRA 3D0ZA 3NIVA 3HA9A 1ZOFA 4X1UA 5EVOA 4DSQA 1JLWA 1EWXA 4KSMA 3ZMKA 2CV4A 3GSTA 1IYIA 3F0IA 5CAXA 1X0RA 3ME7A 1K3YA 3SBCA 3F4RA 5CNWA 3DVXA 3HZ8A 3CTFA 3ME8A 2KP1A 5IOWA 4ZL7A 3L9VA 4KB3A 4ZB9A 4KDUA 1M7TA 2MMNA 1U87A 3I9V2 2CA8A 5FT3A 2H76A 1TK8B 1SYXA 5DALB 2HSMB 5A4UA 2YWMA 2L59A 4G0KA 1T8EB 4KUNA 3GYKA 1A0FA 3VI5A 5G2ZA 1T4ZA 3TOTA 4KCEA 4BL7B 2F51A 3UJ1A 1V98A 1Y6EA 2CVKA 3ZREA 3GN3A 2I4AA 4CW9A 2P31A 1SENA 3AY8A 5DCHA 1Z3EA 5GAPD 1GNEA 4K0NA 3Q6OA 3KMNA 5DAKA 3HYPA 1U3IA 4MZWA 5H5RA 1O8XA 3LG6A 1EEMA 4ECJA 1XWGA 7GSSA 3IOSA 3KGKA 5IMCA 2R2JA 1BQ7A 1FB6A 2J9HA 1ACVA 3EMPA 4LMWA 5CRGA 2R3XA 2L4CA 3BBYA 4GXZA 3Q19A 2IMDA 1Z9HA 1F9MA 2IN3A 3BOAA 4LA1A 4TR4A 2LRCA 5CRHA 2H1GA 2R6KA 3GRXA 4POBA 4XTSA 5ELGA 5B6NA 2C0FA 1X9WB 1U3AA 1K0MA 1XXUA 2I9HA 3O76A 1YJ6A 2H01A 3VWXA 4EKZA 3F6FA 5GZZB 1FG4A 2EIRA 2L5OA 4TN8A 3VWVA 3IK7A 3VLNA 4QL9A 1FB0A 4XIHA 5KEJA 4HJMA 2CZ3A 1HD2A 4G19A 1GSSA 3UBLA 16GSA 3ZIJA 1IYHA 3KXOA 3GV1A 4TKYA 1GUMA 2GSQA 1GSYA 4OO5A 3F9UA 5G5FA 2MMAA 2M72A 1B4PA 2DJKA 1T7PB 4KDYA 3KM6A 1M2BA 4EL1A 4BPYA 2MBSA 3FK8A 3HXSA 1CQGA 5DQYA 2OBIA 1XZOA 3L0HA 2VCQA 3E9JB 4O32A 4PGTA 2K9FA 1K3OA 1M2AA 4IS0A 2VO4A 2IWTA 1I5GA 2HZEA 2IMFA 5F8BA 4TXOA 4EF0A 4F2IA 1WOUA 3US3A 2GT6A 3DEXA 1WRYA 2Z9SA 1PN9A 1YF0A 1K0AA 1YKAA 1N8JA 4IW9A 3H93A 4WR4A 4WR5A 4USSA 1G7OA 1BEDA 1SYRA 3C1SA 2WDUA 2FWFA 2CX4A 3CXGA 4XS6A 2E7PA 5E4WA 5IMDA 1XFLA 1ZYEA 4K2DA 1OC3A 2G2QA 2H73A 4GQFA 5ECKB 1GSDA 2HZFA 3V1WA 3A3TA 1DUGA 1LJRA 3QD9A 2DIYA 5ECNB 3KMOA 2VCXA 1FAAA 4HQSA 2C3QA 2WCIA 1FHEA 3TRPA 3KIJA 2X8HA 1O73A 3J7Yb 1XWCA 4RUVA 3CRUA 4XRAA 2QGVA 1ML6A 4PQ1A 5H5SA 1ZMAA 1BG5A 4MCUA 3APSA 1C72A 3GURA 4KAEA 4K0GA 1TDIA 1SK1A 3GA4A 4DSSB 3LXTA 2CT6A 4JR6A 4G10A 4GSTA 2O85A 4BVYB 4Q5RA 1ERUA 1VF3A 2H0GA 1DE2A 3FZ9A 3VI7A 3VK9A 4KDXA 3CSJA 2H66A 3D6IA 3FW2A 3EE2A 1OKDA 4LLRA 3KH7A 1GLPA 3KEBA 4PUFC 4I5QA 5G1KA 3QFBC 4CHSA 2AUVA 3MSZA 1AQWA 1SJZA 3GUSA 2LSTA 2VL2C 1WE0A 3DWVA 3WD6A 2L6DA 1GP1A 3ZRDA 2H75A 4HZ4A 4K9ZA 1XBSA 4D73B 4RI7A 1FVKA 5DDLA 4KA0A 5C00A 2DJ0A 1GNWA 4YQMA 3ZFLA 3Q74A 3APOA 3QPMA 5ECHB 4EDYA 5IPHA 4XS1A 3F3RA 1KBNA 1R5PA 5G1LA 2UZ8A 1UN2A 4NPBA 1O85A 3KP8A 1GSQA 3DYRA 2IMKA 2HSMA 5DALA 1EP7A 5B6MA 4JU5A 2BJXA 5IO2A 2A4VA 1KTEA 3EWLA 4I6XA 3GH9A 2OADA 1VRSD 2MYGA 4N10A 5DJMA 1PSQA 5ABRA 2A2SA 1HNAA 4MH2A 3ISOA 3TJBA 2FY6A 2KOKA 2VL2A 3ZMLA 3WT1A 3A2WA 4XS4A 3CBUA 4H86A 3NZNA 1PRXA 4TR3A 3LWAA 4N0VA 2VCZA 3H4KA 1TK5B 3D22A 5IO0A 2VAFA 4TR1B 2JL4A 4O5RA 2FCHA 2M46A 2KHPA 1WMJA 2LEGA 4ZBDA 2L5LA 1M2DA 2WB9A 4TXVA 2HXKA 2YV9A 3LORA 4TVEA 4FYUA 2GZYA 22GSA 2YZHA 1A8LA 2GDRA 1WPIA 2VL9A 3N5OA 4GSSA 2AB6A 1PL2A 2DC5A 2EIQA 1YQ1A 3HVVA 2VLUA 1JZDA 4ZILA 2WULA 2FD3A 3FZ5A 2C3TA 2LNTA 2HFDA 1PQNA 2B5XA 4OO4A 1B9YC 1ABAA 3L9SA 3TKSC 3EINA 5IMVA 3L9UA 2N5FA 3RDWA 3TUEA 5LD0A 3W8JA 4L0UA 5CRWA 3HKRA 1UC7A 3HJPA 2IFQA 4HQZA 2HSYA 2BMXA 2C3NA 5A4WA 4E8HA 3GL3A 4OCEA 3TKSE 2R37A 1WWJA 3EMXA 4ECCA 4DEJA 2LQOA 3GSSA 4GCIA 5AIXA 4GLTA 1QXHA 3KZQA 4MJAA 5J41A 4KCAA 1T1VA 4IELA 5AIVA 1R7HA 3EURA 3IV4A 3IRAA 2B5EA 3P2AA 3GTUB 5EPFA 2H6XA 5ECOB 2NTOA 3C71A 2H6ZA 3D4MA 3P90A 3IDVA 5IMFA 4PXOA 1XWBA 2FWGA 2DMLA 3MWHA 3WYWA 1MDJA 1O7UA 1J9BA 3TKSA 4XCSA 4MMMA 2LJAA 3TJFA 5INYA 2F8FA 4F9ZA 5GSTA 1A8YA 4BWSA 1GL8A 3ZITA 1G6WA 4MDCA 1VF2A 1NSWA 5FHIA 4BVXB 3U6VA 3IC4A 2DSAA 4WXTA 3EU3A 4EUYA 1ZGNA 2ON7A 1QQ2A 1I9DA 5IMAA 4V2MA 2KLXA 3EVIA 3QFAC 1VGLA 1SKRB 5DBQA 4EC0A 3C1RA 2WRTA 4ISDA 2C0EA 3LQ7A 1SJ6A 3A2XA 1AQVA 1G0TA 4AJ7A 5KN2A 2AHEA 5ECQB 4G9HA 2NDOA 2CX3A 1W89A 3E0UA 2YCDA 4EXJA 3IPZA 1EEJA 1TW9A 3ZLPA 1TI3A 3GKNA 3S9FA 2GQKA 2HQTA 3HVXA 2K8SA 2H30A 2CVDA 1MDKA 4L8EA 2C1YA 3GNJA 5D9VA 2HI7A 4MLYA 4POMA 1ILOA 5KN3A 1SL0B 3WGXA 3KH9A 3EU4A 3TDGA 1J08A 2VCWA 1XVWA 1PX7A 4IVFA 2C4JA 3UARA 4K7IA 4KW6A 2FNOA 4DSSA 2LNSA 4AGSA 2RM6A 3KD0A 2YPMA 13GSA 3IC8A 4KGIA 1XW9A 3TKPA 2AAWA 1WIKA 3IAM2 4ZBAA 4EE0A 4KH7A 4LL4B 2GLRA 2GTUA 2JU5A 4X43A 2O89A 4WBRD 3QAGA 4RQRA 5G30A 1JHBA 2GZZA 1SD9A 4NWYA 3BD2A 4MZCA 4WF5A 4OCFA 5D73A 1TRVA 4NAXA 6GSYA 3DMLA 2OKAA 4O7HA 1THXA 4MP4A 1DBYA 4TW5A 4I2TA 2V6OA 1GULA 2E2GA 1PMTA 1YF1A 2YWOA 1VF1A 3GHAA 3KTBA 1ZL9A 2FA4A 2O8VB 4MA9A 4ZIJA 3N9JA 1M0UA 1M99A 1RQMA 4ACSA 1Q98A 2PERA 5ECMB 4D73A 1S3AA 5KN1A 4AJ8A 3CSIA 3IXRA 4MPGA 1QFNA 2WZ9A 2B1KA 3QR6A 5E59A 5CRDA 4JRRA 4FO5A 4DSRA 5IM9A 2PWJA 4NV5A 5ECSA 3QAVA 2FWEA 4TOPA 3TRXA 3LFLA 1GTAA 1XW6A 5HFKA 3A5WA 2XHFA 3CTGA 3LGCA 2C80A 3VFIA 1NW2A 4K7OA 1ZZYA 1Z6NA 3M8NA 2H1BA 2JZSA 1AQXA 3VURA 1FO5A 1WJKA 3UVHA 3FYGA 2VM1A 1H4OA 1TTZA 3F63A 2HRKB 4FH8A 4IQ1A 1JZOA 4G0LA 4WKWA 1MD3A 1ZYQB 2HNLA 3GKKA 4FIWA 3F3QA 2WS2A 1X5DA 1VF4A 3K8NA 4GWRA 1TI1A 3M3MA 1GTIA 5F0GA 3JCML 3U5RE 1TRUA 4LMVA 1DE1A 3TJGA 5CREA 2QC7A 4F0CA 3IBHA 3UAPA 1B9XC 3DRNA 1WP0A 4O92A 1YZXA 3UL3A 4IN0A 3RPNA 2YN1A 5ENUA 2K6VA 1EV9A 3IR4A 1SKWB 4N30A 1YKCA 3IAS2 1A24A 2RUFA 1TP9A 4V2LA 2VL3A 5B8BA 2R4VA 5JWOB 5F06A 5D93A 1BYEA 3BCIA 1OE8A 4KE3A 1TOFA 2DJ1A 1HNCA 2XBQA 3FKFA 5IOXA 1N2AA 3IK9A 2H1DA 1SD8A 2VLTA 3GL5A 4N0ZA 1F2EA 2I1UA 3ZZXA 2RM5A 1KEBA 3M9KA 3KP9A 5FWGA 4LL1B 2VD1A 2F8AA 5D96A 6GSXA 3TKQA 2H0IA 1YDKA 4IJ3A 3GTUA 3CMIA 4EVMA 4WBJA 3ZTLA 4PNGA 4OFNA 4Q5NA 1GLQA 2LS5A 3G7YA 4I97A 1EGOA 1ERWA 2K18A 5CO3A 5BMUA 1PL1A 1TKDB 3IE3A 4GTUA 1DSBA 2YZUA 2YV7A 14GSA 2GZPA 4TR0A 2B6MA 1FVJA 4BVXA 2PUKC 3A2VA 4JBBA 5JCGA 4QQ7A 1EGRA 4IP6A 4NMUA 2HRFA 2JACA 2GS3A 4Q5QA 1BAYA 1EP8A 5H5QA 1NHYA 5F05A 1TJDA 1K0OA 3W8SA 1V2AA 1SL2B 1ZCPA 3TCOA 2HSNB 1MTCA 2YJHA 2QSIA 3RHCA 5GAND 2B7KA 2PGTA 1ON4A 2REMA 5J9BA 2HYXA 4V1Ap 3J7Yk 2VLVA 4PX1A 2GSRA 4BL7A 3HD5A 1T00A 4MK3A 3ERFA 2GGTA 1EZKA 3DGQA 4L5OA 1JFUA 4F0BA 1USBA 2HLSA 3G7JA 3WGDA 1MD4A 1HNBA 2YNXA 2CZ2A 2B1LA 2B7JA 5D9WA 4OWYA 2WJUA 3C8EA 1K0NA 2H70A 5IMZA 4POLA 3IHQA 4OD7A 1YEPA 1R26A 4OFTA 2LJRA 2P0GA 6GSVA 4JEDA 2YWIA 3NOFA 2LV3A 2PVOC 2FHEA 2RUEA 5C04A 4HU9A 5J5NA 4L5LA 2TRXA 5EL8A
chains in the Genus database with same CATH superfamily
2N5BA 3H79A 1A2JA 3DVWA 3I6AA 2FWHA 3I69A 2AJQB 3MNGA 2O87A 2O3EA 1EOGA 5JCUA 4K1FA 3QOUA 4V2NA 3M0FA 5EY6A 4GF0A 2RLIA 2KP2A 2V41A 2ZCTA 4FYBA 2GSTA 1S3DA 4RQXA 1PX6A 4ZBBA 2NPBA 2L6CA 4PI0C 3ZL5A 4MJBA 4KX4A 5DVBA 4G0IA 2DLXA 3TB2A 4HSCX 1OYJA 8GSSA 1V58A 3MIXA 4Q5FA 3ERGA 1GSEA 1JLVA 6GSUA 2N5AA 2V6KA 17GSA 1V9WA 3TRQA 1W4VA 4EO3A 1QUWA 1THOA 2PPTA 2MZCA 4KSOA 2C0DA 4HU7A 1PA3A 3PH9A 2H1LA 3UEMA 4PQHA 3ZVJA 5A5KA 1QGVA 3ZFBA 2A4HA 3LSZA 2LJKA 2LRNA 3ERWA 3FZAA 4OMVA 1M9AA 2HRKA 3QDNA 4F82A 2KUCA 4K6XA 3TJKA 2J23A 5HFIA 2BTOT 2IL3A 1JZWA 4ZXGA 5DJLA 1YEWC 2OACA 3IA1A 3MAKA 4F03A 3L4NA 4EIPA 5CP1A 5B7CA 2QKEA 1YEXA 4ECBA 3FHKA 1OAZA 2PBJA 4ICYA 4N11A 2X4AA 3H1NA 2E0QA 3GMFA 2EFEA 5ECLB 1F3AA 4G2EA 4OFMA 1H75A 5AN1A 1EOHA 1B48A 2OA7A 1XWAA 4HOJA 3R2QA 2H8LA 2TIRA 2B5YA 2DJJA 4MJEA 2VCTA 4ML6A 4ZL8A 2UV8G 4ILFA 2A2RA 4O5QA 1XCCA 4GQCA 4BWQA 1M9BA 6GSSA 2JSZA 2XBIA 4QL7A 4K8MA 5D9TA 2DJ3A 4PTSA 4AF2A 4PQIA 1TRSA 1XOAA 3CYNA 4POKA 4RI6A 3SWLA 2HRNA 1PD21 2VIMA 5J4VA 2V32A 2IMIA 3LEFA 2XPDA 3KTLA 4XS4B 3HZ4A 3TGZA 1GUHA 4BVYA 1G6YA 2DBCA 2VCVA 1TU8A 5J4UA 3VWWA 4IJIA 5ELAA 1K0BA 2JSYA 2YANA 1K0DA 1GTUA 2WFCA 1PN0A 1SJIA 1J0FA 2RIIA 3FEUA 4JZQA 3EPTA 1AIUA 3HHVA 2DJ2A 1XIYA 20GSA 1FW1A 4NXIA 2VOCA 1XPVA 2CAIA 5LNKe 3HCZA 4PI2C 1U88A 4HDEA 2PMTA 1RK4A 3UIWA 3VPQA 4IHUA 3H8QA 2LKUA 2FA8A 3FR3A 4NHZA 4V1Ag 4AJ6A 5JWRB 1GTBA 1G7EA 2JADA 2DIZA 2DMMA 5A1NB 5JCWA 3WT2A 3ZIVA 2H6YA 5ID2B 4J2FA 2AV4A 1TK0B 1ST9A 5F07A 1V40A 1TRWA 4CDOA 3HVSA 2ZUPA 2O7KA 1CQHA 1XOBA 2IFQB 3MYDA 2K8VA 3WGEA 2HSNA 1S3CA 2F3MA 2V2GA 1XW5A 2OE1A 1AAZA 5AISA 3ZYWA 4XHMA 4EDZA 1Q4JA 3UBKA 2FGXA 1OC9B 1A0RP 1YY7A 3PGTA 2ES7A 4MH3A 2NVLA 5A4VA 3C7MA 1TU7A 2ON5A 3F4SA 3MDKA 2IMEA 1F6MC 1F37A 3FZ4A 1KNGA 1Z5YE 3O3TA 2HT9A 4YQUA 4MF5A 5IQYA 2LQQA 3GH6A 1A23A 5B8AA 3D21A 3HDCA 2OE3A 2C8UA 2YP6A 1F3BA 4TR1A 2CQ9A 5HQPA 2OJLA 2D2ZA 2ZNMA 3APQA 3QCPA 2GQLA 4JE1A 2ALBA 1Z7RA 4Z2UA 4YAVA 2IIYA 2CVBA 2P5RA 4MZBA 5JWQB 4AKIA 3KJYA 3L78A 4K5RA 5IPGA 5J3RA 3F6DA 3HJOA 1R5AA 2OE0A 3OR5A 3FR6A 4WF4A 3A5IA 3FMWA 4ID0A 5ECRB 3M9JA 3FRCA 3RHBA 1HQOA 2PVQA 1LBKA 5G5EA 1X5EA 2M80A 3LYPA 2IJYA 1M3JA 4MABA 3F4TA 3QAWA 3HMJG 1BX9A 2H0HA 3P8WA 1OE7A 4PURA 1Y25A 2VUPA 1E2YA 3DD3A 2O5VA 1Z7PA 2WW1A 1MDIA 4XRDA 1X9MB 1OC8A 3BCKA 4YKGA 3DXBA 3GX0A 4IQAA 1QMVA 1SK0A 3EC3A 1PGTA 4YQVA 2LRTA 3ZVJD 3DIEA 1X9SB 1OKTA 4IKHA 3RAZA 4KF9A 2R5GA 1O81A 3GKXA 3D4TA 3VPTA 2EIOA 3LXZA 1A2LA 5DAKB 1URMA 2H19A 1B4QA 1AXDA 5HR3A 1UVZA 3BJ5A 4N3ZA 2MBTA 1SVLA 3F8UA 4IBPA 1V57A 1ERVA 3KCMA 1S4BP 1O6JA 4K7NA 4ML1A 3I43A 2XPEA 5ECPB 1B8XA 5HR1A 2H1AA 1T3BA 3UOMA 4GRFA 3FY7A 2X8CA 3PPUA 4E8EA 5KN0A 4WEYA 4J57E 4ZB8A 5ECIB 4FYCA 1X5CA 1GRXA 2L4QA 5L71A 1XVQA 1LU4A 3C73A 2MMOA 1GSUA 1RW1A 5DCGA 2TRCP 1K3LA 4DVCA 4IGJA 2JZRA 1NHOA 2HSHA 4PNFA 3UMAA 3PINA 2H72A 2GSSA 2MMZA 2YWNA 3RPPA 1GH2A 3M1GA 5J47A 1NM3A 1XG8A 3HJMA 3PR8A 4MF6A 2QA1A 2LTKA 4ULXA 4J56E 1BJXA 2I3YA 2IPAA 4KNDA 3E3EA 2L57A 2H71A 11GSA 4P3YB 4WETA 3O6TA 5HFGA 5A5HB 19GSA 4MJCA 3TOUA 10GSA 4QMKA 2FUG2 1R4WA 3GFKA 2NBSA 1ERTA 3LYKA 1U6TA 3RBTA 2X99A 4L0WA 3ED3A 4ZB6A 2R0CA 4HS1A 2LUSA 3CSHA 2EFCA 2VD0A 3Q18A 4FQUA 5HR0A 4K2XA 2A2PA 4ZL9A 2JZTA 2GQMA 1SU9A 5J9CA 1HYUA 2CAQA 4HZ2A 1MEKA 12GSA 4ECIA 5AGYA 2HZEB 1FOVA 3GIXA 1Z6MA 2WGRA 4TXOB 2E2MA 1OVNA 1AUCA 3W6GA 4Z7XA 1PKWA 3GX8A 2C0GA 3FR9A 1A2MA 1QK8A 3G9BA 5LCZA 4PUAA 4NHWA 2AYTA 4HJ2A 4YKFA 5COHA 1K0CA 1AC1A 5BRTA 2FLSA 4HEA2 4NV2A 4GSNA 3HY2A 3EYTA 3P7XA 2YJ7A 2HRAA 18GSA 5HR2A 1PKZA 3D5JA 3LJRA 2I81A 1E6BA 4MF7A 1XWKA 5D8IA 2OBKA 5D9XA 1AW9A 6GSTA 4HI7A 4BA7A 5GSSA 3GKMA 5G31A 1GSFA 3R3EA 2B3SA 1JZRA 3QMXA 2XC2A 2F9SA 2GVPA 2GT5A 1GWCA 5A1NA 3TJJA 5ID2A 3UVTA 2P5QA 1SK2A 3G7IA 4IP1A 2HE3A 1EV4A 4HUAA 5CYYA 2VM2A 1T4YA 3DKSA 2G0FA 3VWUA 9GSSA 4I2UA 2X64A 2PN8A 1SL1B 6GSWA 2EC4A 2EFDA 1TXXA 3CRTA 3RGBC 1OC9A 1S3RA 2YOIA 2V1MA 4MPFA 2H74A 1GUKA 4E68A 4JR4A 5IIZA 4YH2A 4YAPA 1I1IP 1UA5A 4TRXA 1O8WA 4I8BA 5DQSA 2PU9C 2X8GA 1SKSB 4X0XA 3TKRA 3D0ZA 3NIVA 3HA9A 1ZOFA 4X1UA 5EVOA 4DSQA 1JLWA 1EWXA 4KSMA 1PFOA 3ZMKA 2CV4A 3GSTA 1IYIA 3F0IA 5CAXA 1X0RA 3ME7A 1K3YA 3SBCA 3F4RA 5CNWA 3DVXA 3HZ8A 3CTFA 3ME8A 2KP1A 5IOWA 4ZL7A 3L9VA 4KB3A 4ZB9A 4KDUA 4BIKA 1M7TA 2MMNA 2EFHA 1U87A 3I9V2 2CA8A 4AKGA 5FT3A 3CHXC 2H76A 1TK8B 1SYXA 5DALB 2HSMB 5A4UA 2YWMA 2L59A 2OT3A 5KOXA 4G0KA 1T8EB 4KUNA 3GYKA 1A0FA 3VI5A 5G2ZA 1T4ZA 3TOTA 4KCEA 4BL7B 2VKZG 2F51A 3UJ1A 1V98A 1Y6EA 2CVKA 3ZREA 3GN3A 2I4AA 4CW9A 2P31A 1SENA 3AY8A 5DCHA 1Z3EA 5GAPD 1GNEA 4K0NA 3Q6OA 3KMNA 5DAKA 3HYPA 1U3IA 4MZWA 5H5RA 1O8XA 3LG6A 1EEMA 4ECJA 1XWGA 7GSSA 3IOSA 3KGKA 5IMCA 2R2JA 1BQ7A 1FB6A 2J9HA 4AI6A 1ACVA 3EMPA 4LMWA 5CRGA 2R3XA 2L4CA 3BBYA 4O5UA 4GXZA 3Q19A 2IMDA 1Z9HA 1F9MA 2IN3A 3BOAA 4LA1A 4TR4A 2LRCA 5CRHA 3HVNA 2H1GA 2R6KA 3GRXA 4POBA 4XTSA 5ELGA 5B6NA 2C0FA 1X9WB 1U3AA 1K0MA 1XXUA 2I9HA 3O76A 1YJ6A 2H01A 2DKIA 3VWXA 4EKZA 3F6FA 5GZZB 1FG4A 2EIRA 2L5OA 4TN8A 3VWVA 3IK7A 3VLNA 4QL9A 1FB0A 4XIHA 5KEJA 4HJMA 2CZ3A 1HD2A 4G19A 1GSSA 3UBLA 16GSA 3ZIJA 1IYHA 3KXOA 3CQFA 3GV1A 4TKYA 5J4YA 1GUMA 2GSQA 1GSYA 4OO5A 3F9UA 5G5FA 4AKXB 2MMAA 2M72A 1B4PA 2DJKA 1T7PB 4KDYA 3KM6A 1M2BA 4EL1A 4BPYA 2MBSA 3FK8A 3HXSA 1CQGA 5DQYA 2OBIA 1XZOA 3L0HA 2VCQA 3E9JB 4O32A 4AKHA 4PGTA 2K9FA 1K3OA 1M2AA 4IS0A 2VO4A 2IWTA 1I5GA 2HZEA 2IMFA 5F8BA 4TXOA 4EF0A 4F2IA 1WOUA 3US3A 2WVZA 2GT6A 3DEXA 1WRYA 2Z9SA 1PN9A 1YF0A 1K0AA 1YKAA 1N8JA 4IW9A 3H93A 4WR4A 4WR5A 2R0GA 4USSA 1G7OA 1BEDA 1SYRA 3C1SA 2WDUA 2FWFA 2CX4A 3CXGA 4XS6A 1ZYNA 2E7PA 5E4WA 5IMDA 1XFLA 1ZYEA 4K2DA 1OC3A 2G2QA 2H73A 4GQFA 5ECKB 1GSDA 2WW0A 2HZFA 3V1WA 3A3TA 1DUGA 1LJRA 3QD9A 2DIYA 5ECNB 3KMOA 2VCXA 5KOWA 1FAAA 4HQSA 2C3QA 2WCIA 1FHEA 3TRPA 3KIJA 2X8HA 1O73A 3J7Yb 1XWCA 4RUVA 3CRUA 4XRAA 2QGVA 1ML6A 4PQ1A 5H5SA 1ZMAA 1BG5A 4MCUA 3APSA 1C72A 3GURA 4KAEA 4Z2TA 4K0GA 1TDIA 1SK1A 3GA4A 4DSSB 3LXTA 2CT6A 4JR6A 4G10A 2R0PA 1FOHA 4GSTA 2O85A 4BVYB 4Q5RA 1ERUA 1VF3A 2H0GA 1DE2A 3FZ9A 3VI7A 3VK9A 4KDXA 3CSJA 2H66A 3D6IA 3FW2A 3EE2A 1OKDA 4LLRA 2WVYA 3KH7A 1GLPA 3KEBA 4PUFC 4I5QA 5G1KA 3QFBC 4CHSA 2AUVA 3MSZA 4FXYP 1AQWA 1SJZA 3GUSA 2LSTA 4X4JA 2VL2C 1WE0A 3DWVA 3WD6A 2L6DA 1GP1A 3ZRDA 2H75A 4HZ4A 4K9ZA 1XBSA 4D73B 4RI7A 2WVXB 1FVKA 5DDLA 4KA0A 5C00A 2DJ0A 1GNWA 4YQMA 3ZFLA 3Q74A 3APOA 3QPMA 5ECHB 4EDYA 5IPHA 4XS1A 3F3RA 1KBNA 1R5PA 5G1LA 2UZ8A 1UN2A 4NPBA 1O85A 3KP8A 1GSQA 3DYRA 2IMKA 2HSMA 5DALA 1EP7A 5B6MA 4JU5A 2BJXA 5IO2A 2A4VA 1KTEA 3EWLA 4I6XA 3GH9A 2OADA 1VRSD 2MYGA 4N10A 5DJMA 1PSQA 5ABRA 2A2SA 1HNAA 4MH2A 3ISOA 3TJBA 2FY6A 2KOKA 2VL2A 3ZMLA 3WT1A 3A2WA 4XS4A 3CBUA 4H86A 3NZNA 1PRXA 4TR3A 3LWAA 4N0VA 2VCZA 3H4KA 1TK5B 3D22A 5IO0A 2VAFA 4TR1B 2JL4A 4O5RA 2FCHA 2M46A 2KHPA 1WMJA 2LEGA 4ZBDA 2L5LA 1M2DA 2WB9A 4TXVA 2HXKA 2YV9A 3LORA 4TVEA 4FYUA 2GZYA 22GSA 2YZHA 1A8LA 2GDRA 1WPIA 2VL9A 3N5OA 1ZYPA 4GSSA 2AB6A 1PL2A 2DC5A 2EIQA 1YQ1A 3HVVA 2VLUA 1JZDA 4ZILA 4CY8A 2WW2A 2WULA 2FD3A 3FZ5A 2C3TA 2LNTA 2HFDA 1PQNA 2B5XA 4OO4A 1B9YC 1ABAA 3L9SA 3TKSC 3EINA 4A5PA 5IMVA 3L9UA 2N5FA 3RDWA 3TUEA 5LD0A 3W8JA 4L0UA 5CRWA 3HKRA 2WW3A 1UC7A 3HJPA 2IFQA 4HQZA 2HSYA 2BMXA 2C3NA 5A4WA 4E8HA 3GL3A 4PHZC 4OCEA 3TKSE 2R37A 1WWJA 3EMXA 4ECCA 4DEJA 2LQOA 3GSSA 4GCIA 5AIXA 4GLTA 1QXHA 3KZQA 4MJAA 5J41A 4KCAA 1T1VA 4IELA 5AIVA 1R7HA 3EURA 3IV4A 3IRAA 2B5EA 3P2AA 3GTUB 5EPFA 2H6XA 5ECOB 2NTOA 3C71A 2H6ZA 3LW9A 3D4MA 3P90A 4K5SA 3IDVA 1TXUA 5IMFA 4PXOA 1XWBA 2FWGA 2DMLA 3MWHA 3WYWA 1MDJA 1O7UA 5BMUB 1J9BA 3TKSA 4XCSA 4MMMA 5A34B 2LJAA 3TJFA 5INYA 2F8FA 4F9ZA 5GSTA 1A8YA 4BWSA 1GL8A 3ZITA 1G6WA 4MDCA 1VF2A 1NSWA 5FHIA 4BVXB 3U6VA 3IC4A 2DSAA 4WXTA 3EU3A 4EUYA 1ZGNA 2ON7A 1QQ2A 1I9DA 5IMAA 4V2MA 2KLXA 3EVIA 3QFAC 1VGLA 1SKRB 5DBQA 4EC0A 3C1RA 2WRTA 4ISDA 2C0EA 3LQ7A 1SJ6A 3A2XA 1AQVA 1G0TA 4AJ7A 5KN2A 2AHEA 5ECQB 4G9HA 2NDOA 2CX3A 1W89A 3E0UA 1Y1UA 2YCDA 4EXJA 3IPZA 1EEJA 1TW9A 3ZLPA 1TI3A 3GKNA 3S9FA 2GQKA 2HQTA 3HVXA 2K8SA 2H30A 2CVDA 1MDKA 4L8EA 2C1YA 3GNJA 5D9VA 2HI7A 4MLYA 4POMA 1ILOA 5KN3A 1SL0B 3WGXA 3KH9A 3EU4A 3TDGA 1J08A 1BG1A 2VCWA 1XVWA 1PX7A 4IVFA 2C4JA 3UARA 4K7IA 4KW6A 2FNOA 4DSSA 2LNSA 4AGSA 2RM6A 3KD0A 2YPMA 13GSA 3IC8A 4KGIA 2O36A 1XW9A 3TKPA 2AAWA 1WIKA 3IAM2 4ZBAA 4EE0A 4KH7A 4LL4B 2GLRA 2GTUA 2JU5A 4X43A 2O89A 4WBRD 3QAGA 4RQRA 5G30A 1JHBA 2GZZA 1SD9A 4NWYA 3BD2A 4MZCA 4WF5A 4OCFA 5D73A 1TRVA 4NAXA 6GSYA 3DMLA 2OKAA 4O7HA 1THXA 4MP4A 1DBYA 4TW5A 4I2TA 2V6OA 1GULA 2E2GA 1PMTA 1YF1A 2YWOA 1VF1A 3GHAA 3KTBA 1ZL9A 2FA4A 2O8VB 4MA9A 4ZIJA 3N9JA 1M0UA 1M99A 1RQMA 4ACSA 1Q98A 2PERA 2QA2A 5ECMB 4D73A 2WVXA 1S3AA 5KN1A 1SVMA 4AJ8A 1M3IA 3CSIA 3IXRA 4MPGA 1QFNA 2WZ9A 5A5HA 2B1KA 3QR6A 5E59A 5CRDA 4JRRA 4FO5A 4DSRA 5IM9A 2PWJA 4NV5A 5ECSA 3QAVA 2FWEA 4TOPA 3TRXA 3LFLA 1GTAA 1XW6A 5HFKA 3A5WA 2XHFA 3CTGA 3LGCA 2C80A 2X49A 3VFIA 1NW2A 1SVOA 4K7OA 1ZZYA 1Z6NA 3M8NA 2H1BA 2JZSA 1AQXA 3VURA 1FO5A 1WJKA 3UVHA 3FYGA 2VM1A 1H4OA 1TTZA 3F63A 2HRKB 4FH8A 4IQ1A 1JZOA 4G0LA 4WKWA 1BF5A 1MD3A 3CWGA 1ZYQB 2HNLA 3GKKA 4FIWA 3F3QA 2WS2A 1X5DA 1VF4A 3K8NA 4GWRA 1TI1A 3M3MA 1GTIA 5F0GA 3JCML 3U5RE 1TRUA 4LMVA 1DE1A 1YVLA 3TJGA 5CREA 2QC7A 4F0CA 3IBHA 3UAPA 1B9XC 3DRNA 1WP0A 4O92A 1YZXA 5J40A 3UL3A 4IN0A 3RPNA 4ZB7A 2YN1A 5ENUA 2K6VA 1EV9A 3IR4A 4G01A 1SKWB 4N30A 1YKCA 3IAS2 1A24A 2RUFA 1TP9A 4V2LA 2VL3A 5B8BA 2R4VA 5JWOB 5F06A 5D93A 1BYEA 3BCIA 1OE8A 4KE3A 1TOFA 2DJ1A 1HNCA 2XBQA 3FKFA 5IOXA 1N2AA 3IK9A 2H1DA 1SD8A 2VLTA 3GL5A 4N0ZA 1F2EA 2WZSA 2I1UA 3ZZXA 2RM5A 1KEBA 3M9KA 3KP9A 5FWGA 4LL1B 2VD1A 2F8AA 5D96A 6GSXA 3TKQA 2H0IA 1YDKA 4IJ3A 3GTUA 4CY6A 3CMIA 4EVMA 4WBJA 3ZTLA 4PNGA 4OFNA 4Q5NA 1GLQA 2LS5A 3G7YA 4I97A 3IHGA 1EGOA 1ERWA 2K18A 5CO3A 5BMUA 1PL1A 1TKDB 5A34A 3IE3A 4GTUA 1DSBA 4Z2RA 2YZUA 2YV7A 14GSA 2GZPA 4TR0A 2B6MA 1FVJA 4BVXA 2PUKC 3A2VA 4JBBA 5JCGA 4QQ7A 1EGRA 4IP6A 4NMUA 2HRFA 2JACA 2GS3A 4Q5QA 1BAYA 1EP8A 5H5QA 1NHYA 5F05A 1TJDA 1K0OA 4W66A 3W8SA 4EIQA 1V2AA 1SL2B 1ZCPA 3TCOA 4MNNA 2HSNB 1MTCA 3RFRC 2YJHA 2QSIA 3TU3B 3RHCA 5GAND 2B7KA 2PGTA 1ON4A 2REMA 5J9BA 2HYXA 4V1Ap 3J7Yk 2VLVA 4PX1A 2GSRA 4BL7A 3HD5A 1T00A 4MK3A 3ERFA 2GGTA 1EZKA 3DGQA 4L5OA 4GDFA 1JFUA 4F0BA 1USBA 2HLSA 3G7JA 2DKHA 3WGDA 1MD4A 1HNBA 2YNXA 2CZ2A 2B1LA 2B7JA 5D9WA 4OWYA 2WJUA 3C8EA 1K0NA 2H70A 5IMZA 4POLA 3IHQA 4OD7A 1YEPA 1R26A 4OFTA 2LJRA 2P0GA 6GSVA 4JEDA 2YWIA 3NOFA 2LV3A 2PVOC 2FHEA 1N25A 2RUEA 5C04A 4HU9A 5J5NA 4L5LA 2TRXA 5EL8A
chains in the Genus database with same CATH topology
2N5BA 3H79A 1A2JA 3DVWA 3I6AA 2FWHA 3I69A 2AJQB 3MNGA 2O87A 1EOGA 5JCUA 4K1FA 3QOUA 4V2NA 3M0FA 5EY6A 4GF0A 2RLIA 2KP2A 2V41A 2ZCTA 4FYBA 2GSTA 1S3DA 4RQXA 1PX6A 4ZBBA 2NPBA 2L6CA 3ZL5A 4MJBA 4KX4A 5DVBA 4G0IA 2DLXA 3TB2A 1OYJA 8GSSA 1V58A 3MIXA 4Q5FA 3ERGA 1GSEA 1JLVA 6GSUA 2N5AA 2V6KA 17GSA 1V9WA 3TRQA 1W4VA 4EO3A 1QUWA 1THOA 2PPTA 2MZCA 4KSOA 2C0DA 4HU7A 1PA3A 3PH9A 2H1LA 3UEMA 4PQHA 3ZVJA 5A5KA 1QGVA 3ZFBA 2A4HA 3LSZA 2LJKA 2LRNA 3ERWA 3FZAA 4OMVA 1M9AA 2HRKA 3QDNA 4F82A 2KUCA 4K6XA 3TJKA 2J23A 5HFIA 2BTOT 2IL3A 1JZWA 4ZXGA 5DJLA 2OACA 3IA1A 3MAKA 4F03A 3L4NA 4EIPA 5CP1A 5B7CA 2QKEA 1YEXA 4ECBA 3FHKA 1OAZA 2PBJA 4ICYA 4N11A 2X4AA 3H1NA 2E0QA 3GMFA 2EFEA 5ECLB 1F3AA 4G2EA 4OFMA 1H75A 5AN1A 1EOHA 1B48A 2OA7A 1XWAA 4HOJA 3R2QA 2H8LA 2TIRA 2B5YA 2DJJA 4MJEA 2VCTA 4ML6A 4ZL8A 2UV8G 4ILFA 2A2RA 4O5QA 1XCCA 4GQCA 4BWQA 1M9BA 6GSSA 2JSZA 2XBIA 4QL7A 4K8MA 5D9TA 2DJ3A 4PTSA 4AF2A 4PQIA 1TRSA 1XOAA 3CYNA 4POKA 4RI6A 3SWLA 2HRNA 1PD21 2VIMA 5J4VA 2V32A 2IMIA 3LEFA 2XPDA 3KTLA 4XS4B 3HZ4A 3TGZA 1GUHA 4BVYA 1G6YA 2DBCA 2VCVA 1TU8A 5J4UA 3VWWA 4IJIA 5ELAA 1K0BA 2JSYA 2YANA 1K0DA 1GTUA 2WFCA 1PN0A 1SJIA 1J0FA 2RIIA 3FEUA 4JZQA 3EPTA 1AIUA 3HHVA 2DJ2A 1XIYA 20GSA 1FW1A 4NXIA 2VOCA 1XPVA 2CAIA 5LNKe 3HCZA 1U88A 4HDEA 2PMTA 1RK4A 3UIWA 3VPQA 4IHUA 3H8QA 2LKUA 2FA8A 3FR3A 4NHZA 4V1Ag 4AJ6A 5JWRB 1GTBA 1G7EA 2JADA 2DIZA 2DMMA 5A1NB 5JCWA 3WT2A 3ZIVA 2H6YA 5ID2B 4J2FA 2AV4A 1TK0B 1ST9A 5F07A 1V40A 1TRWA 4CDOA 3HVSA 2ZUPA 2O7KA 1CQHA 1XOBA 2IFQB 3MYDA 2K8VA 3WGEA 2HSNA 1S3CA 2F3MA 2V2GA 1XW5A 2OE1A 1AAZA 5AISA 3ZYWA 4XHMA 4EDZA 1Q4JA 3UBKA 2FGXA 1OC9B 1A0RP 1YY7A 3PGTA 2ES7A 4MH3A 2NVLA 5A4VA 3C7MA 1TU7A 2ON5A 3F4SA 3MDKA 2IMEA 1F6MC 1F37A 3FZ4A 1KNGA 1Z5YE 3O3TA 2HT9A 4YQUA 4MF5A 5IQYA 2LQQA 3GH6A 1A23A 5B8AA 3D21A 3HDCA 2OE3A 2C8UA 2YP6A 1F3BA 4TR1A 2CQ9A 5HQPA 2OJLA 2D2ZA 2ZNMA 3APQA 3QCPA 2GQLA 4JE1A 2ALBA 1Z7RA 4Z2UA 4YAVA 2IIYA 2CVBA 2P5RA 4MZBA 5JWQB 4AKIA 3KJYA 3L78A 4K5RA 5IPGA 5J3RA 3F6DA 3HJOA 1R5AA 2OE0A 3OR5A 3FR6A 4WF4A 3A5IA 3FMWA 4ID0A 5ECRB 3M9JA 3FRCA 3RHBA 1HQOA 2PVQA 1LBKA 5G5EA 1X5EA 2M80A 3LYPA 2IJYA 4MABA 3F4TA 3QAWA 3HMJG 1BX9A 2H0HA 3P8WA 1OE7A 4PURA 1Y25A 2VUPA 1E2YA 3DD3A 2O5VA 1Z7PA 1MDIA 4XRDA 1X9MB 1OC8A 3BCKA 4YKGA 3DXBA 3GX0A 4IQAA 1QMVA 1SK0A 3EC3A 1PGTA 4YQVA 2LRTA 3ZVJD 3DIEA 1X9SB 1OKTA 4IKHA 3RAZA 4KF9A 2R5GA 1O81A 3GKXA 3D4TA 3VPTA 2EIOA 3LXZA 1A2LA 5DAKB 1URMA 2H19A 1B4QA 1AXDA 5HR3A 1UVZA 3BJ5A 4N3ZA 2MBTA 1SVLA 3F8UA 4IBPA 1V57A 1ERVA 3KCMA 1O6JA 4K7NA 4ML1A 3I43A 2XPEA 5ECPB 1B8XA 5HR1A 2H1AA 1T3BA 3UOMA 4GRFA 3FY7A 2X8CA 3PPUA 4E8EA 5KN0A 4WEYA 4J57E 4ZB8A 5ECIB 4FYCA 1X5CA 1GRXA 2L4QA 5L71A 1XVQA 1LU4A 3C73A 2MMOA 1GSUA 1RW1A 5DCGA 2TRCP 1K3LA 4DVCA 4IGJA 2JZRA 1NHOA 2HSHA 4PNFA 3UMAA 3PINA 2H72A 2GSSA 2MMZA 2YWNA 3RPPA 1GH2A 3M1GA 5J47A 1NM3A 3HJMA 3PR8A 4MF6A 2QA1A 2LTKA 4ULXA 4J56E 1BJXA 2I3YA 2IPAA 4KNDA 3E3EA 2L57A 2H71A 11GSA 4P3YB 4WETA 3O6TA 5HFGA 5A5HB 19GSA 4MJCA 3TOUA 10GSA 4QMKA 2FUG2 1R4WA 3GFKA 2NBSA 1ERTA 3LYKA 1U6TA 3RBTA 2X99A 4L0WA 3ED3A 4ZB6A 2R0CA 4HS1A 2LUSA 3CSHA 2EFCA 2VD0A 3Q18A 4FQUA 5HR0A 4K2XA 2A2PA 4ZL9A 2JZTA 2GQMA 1SU9A 5J9CA 1HYUA 2CAQA 4HZ2A 1MEKA 12GSA 4ECIA 5AGYA 2HZEB 1FOVA 3GIXA 1Z6MA 2WGRA 4TXOB 2E2MA 1OVNA 1AUCA 3W6GA 4Z7XA 1PKWA 3GX8A 2C0GA 3FR9A 1A2MA 1QK8A 3G9BA 5LCZA 4PUAA 4NHWA 2AYTA 4HJ2A 4YKFA 5COHA 1K0CA 1AC1A 5BRTA 2FLSA 4HEA2 4NV2A 4GSNA 3HY2A 3EYTA 3P7XA 2YJ7A 2HRAA 18GSA 5HR2A 1PKZA 3D5JA 3LJRA 2I81A 1E6BA 4MF7A 1XWKA 5D8IA 2OBKA 5D9XA 1AW9A 6GSTA 4HI7A 4BA7A 5GSSA 3GKMA 5G31A 1GSFA 3R3EA 2B3SA 1JZRA 3QMXA 2XC2A 2F9SA 2GVPA 2GT5A 1GWCA 5A1NA 3TJJA 5ID2A 3UVTA 2P5QA 1SK2A 3G7IA 4IP1A 2HE3A 1EV4A 4HUAA 5CYYA 2VM2A 1T4YA 3DKSA 2G0FA 3VWUA 9GSSA 4I2UA 2X64A 2PN8A 1SL1B 6GSWA 2EC4A 2EFDA 1TXXA 3CRTA 1OC9A 2YOIA 2V1MA 4MPFA 2H74A 1GUKA 4E68A 4JR4A 5IIZA 4YH2A 4YAPA 1UA5A 4TRXA 1O8WA 4I8BA 5DQSA 2PU9C 2X8GA 1SKSB 4X0XA 3TKRA 3D0ZA 3NIVA 3HA9A 1ZOFA 4X1UA 5EVOA 4DSQA 1JLWA 1EWXA 4KSMA 3ZMKA 2CV4A 3GSTA 1IYIA 3F0IA 5CAXA 1X0RA 3ME7A 1K3YA 3SBCA 3F4RA 5CNWA 3DVXA 3HZ8A 3CTFA 3ME8A 2KP1A 5IOWA 4ZL7A 3L9VA 4KB3A 4ZB9A 4KDUA 1M7TA 2MMNA 2EFHA 1U87A 3I9V2 2CA8A 4AKGA 5FT3A 2H76A 1TK8B 1SYXA 5DALB 2HSMB 5A4UA 2YWMA 2L59A 2OT3A 5KOXA 4G0KA 1T8EB 4KUNA 3GYKA 1A0FA 3VI5A 5G2ZA 1T4ZA 3TOTA 4KCEA 4BL7B 2VKZG 2F51A 3UJ1A 1V98A 1Y6EA 2CVKA 3ZREA 3GN3A 2I4AA 4CW9A 2P31A 1SENA 3AY8A 5DCHA 1Z3EA 5GAPD 1GNEA 4K0NA 3Q6OA 3KMNA 5DAKA 3HYPA 1U3IA 4MZWA 5H5RA 1O8XA 3LG6A 1EEMA 4ECJA 1XWGA 7GSSA 3IOSA 3KGKA 5IMCA 2R2JA 1BQ7A 1FB6A 2J9HA 4AI6A 1ACVA 3EMPA 4LMWA 5CRGA 2R3XA 2L4CA 3BBYA 4O5UA 4GXZA 3Q19A 2IMDA 1Z9HA 1F9MA 2IN3A 3BOAA 4LA1A 4TR4A 2LRCA 5CRHA 2H1GA 2R6KA 3GRXA 4POBA 4XTSA 5ELGA 5B6NA 2C0FA 1X9WB 1U3AA 1K0MA 1XXUA 2I9HA 3O76A 1YJ6A 2H01A 2DKIA 3VWXA 4EKZA 3F6FA 5GZZB 1FG4A 2EIRA 2L5OA 4TN8A 3VWVA 3IK7A 3VLNA 4QL9A 1FB0A 4XIHA 5KEJA 4HJMA 2CZ3A 1HD2A 4G19A 1GSSA 3UBLA 16GSA 3ZIJA 1IYHA 3KXOA 3GV1A 4TKYA 5J4YA 1GUMA 2GSQA 1GSYA 4OO5A 3F9UA 5G5FA 4AKXB 2MMAA 2M72A 1B4PA 2DJKA 1T7PB 4KDYA 3KM6A 1M2BA 4EL1A 4BPYA 2MBSA 3FK8A 3HXSA 1CQGA 5DQYA 2OBIA 1XZOA 3L0HA 2VCQA 3E9JB 4O32A 4AKHA 4PGTA 2K9FA 1K3OA 1M2AA 4IS0A 2VO4A 2IWTA 1I5GA 2HZEA 2IMFA 5F8BA 4TXOA 4EF0A 4F2IA 1WOUA 3US3A 2GT6A 3DEXA 1WRYA 2Z9SA 1PN9A 1YF0A 1K0AA 1YKAA 1N8JA 4IW9A 3H93A 4WR4A 4WR5A 2R0GA 4USSA 1G7OA 1BEDA 1SYRA 3C1SA 2WDUA 2FWFA 2CX4A 3CXGA 4XS6A 1ZYNA 2E7PA 5E4WA 5IMDA 1XFLA 1ZYEA 4K2DA 1OC3A 2G2QA 2H73A 4GQFA 5ECKB 1GSDA 2HZFA 3V1WA 3A3TA 1DUGA 1LJRA 3QD9A 2DIYA 5ECNB 3KMOA 2VCXA 5KOWA 1FAAA 4HQSA 2C3QA 2WCIA 1FHEA 3TRPA 3KIJA 2X8HA 1O73A 3J7Yb 1XWCA 4RUVA 3CRUA 4XRAA 2QGVA 1ML6A 4PQ1A 5H5SA 1ZMAA 1BG5A 4MCUA 3APSA 1C72A 3GURA 4KAEA 4Z2TA 4K0GA 1TDIA 1SK1A 3GA4A 4DSSB 3LXTA 2CT6A 4JR6A 4G10A 2R0PA 1FOHA 4GSTA 2O85A 4BVYB 4Q5RA 1ERUA 1VF3A 2H0GA 1DE2A 3FZ9A 3VI7A 3VK9A 4KDXA 3CSJA 2H66A 3D6IA 3FW2A 3EE2A 1OKDA 4LLRA 3KH7A 1GLPA 3KEBA 4PUFC 4I5QA 5G1KA 3QFBC 4CHSA 2AUVA 3MSZA 1AQWA 1SJZA 3GUSA 2LSTA 4X4JA 2VL2C 1WE0A 3DWVA 3WD6A 2L6DA 1GP1A 3ZRDA 2H75A 4HZ4A 4K9ZA 1XBSA 4D73B 4RI7A 1FVKA 5DDLA 4KA0A 5C00A 2DJ0A 1GNWA 4YQMA 3ZFLA 3Q74A 3APOA 3QPMA 5ECHB 4EDYA 5IPHA 4XS1A 3F3RA 1KBNA 1R5PA 5G1LA 2UZ8A 1UN2A 4NPBA 1O85A 3KP8A 1GSQA 3DYRA 2IMKA 2HSMA 5DALA 1EP7A 5B6MA 4JU5A 2BJXA 5IO2A 2A4VA 1KTEA 3EWLA 4I6XA 3GH9A 2OADA 1VRSD 2MYGA 4N10A 5DJMA 1PSQA 5ABRA 2A2SA 1HNAA 4MH2A 3ISOA 3TJBA 2FY6A 2KOKA 2VL2A 3ZMLA 3WT1A 3A2WA 4XS4A 3CBUA 4H86A 3NZNA 1PRXA 4TR3A 3LWAA 4N0VA 2VCZA 3H4KA 1TK5B 3D22A 5IO0A 2VAFA 4TR1B 2JL4A 4O5RA 2FCHA 2M46A 2KHPA 1WMJA 2LEGA 4ZBDA 2L5LA 1M2DA 2WB9A 4TXVA 2HXKA 2YV9A 3LORA 4TVEA 4FYUA 2GZYA 22GSA 2YZHA 1A8LA 2GDRA 1WPIA 2VL9A 3N5OA 1ZYPA 4GSSA 2AB6A 1PL2A 2DC5A 2EIQA 1YQ1A 3HVVA 2VLUA 1JZDA 4ZILA 4CY8A 2WULA 2FD3A 3FZ5A 2C3TA 2LNTA 2HFDA 1PQNA 2B5XA 4OO4A 1B9YC 1ABAA 3L9SA 3TKSC 3EINA 4A5PA 5IMVA 3L9UA 2N5FA 3RDWA 3TUEA 5LD0A 3W8JA 4L0UA 5CRWA 3HKRA 1UC7A 3HJPA 2IFQA 4HQZA 2HSYA 2BMXA 2C3NA 5A4WA 4E8HA 3GL3A 4OCEA 3TKSE 2R37A 1WWJA 3EMXA 4ECCA 4DEJA 2LQOA 3GSSA 4GCIA 5AIXA 4GLTA 1QXHA 3KZQA 4MJAA 5J41A 4KCAA 1T1VA 4IELA 5AIVA 1R7HA 3EURA 3IV4A 3IRAA 2B5EA 3P2AA 3GTUB 5EPFA 2H6XA 5ECOB 2NTOA 3C71A 2H6ZA 3LW9A 3D4MA 3P90A 4K5SA 3IDVA 1TXUA 5IMFA 4PXOA 1XWBA 2FWGA 2DMLA 3MWHA 3WYWA 1MDJA 1O7UA 5BMUB 1J9BA 3TKSA 4XCSA 4MMMA 5A34B 2LJAA 3TJFA 5INYA 2F8FA 4F9ZA 5GSTA 1A8YA 4BWSA 1GL8A 3ZITA 1G6WA 4MDCA 1VF2A 1NSWA 5FHIA 4BVXB 3U6VA 3IC4A 2DSAA 4WXTA 3EU3A 4EUYA 1ZGNA 2ON7A 1QQ2A 1I9DA 5IMAA 4V2MA 2KLXA 3EVIA 3QFAC 1VGLA 1SKRB 5DBQA 4EC0A 3C1RA 2WRTA 4ISDA 2C0EA 3LQ7A 1SJ6A 3A2XA 1AQVA 1G0TA 4AJ7A 5KN2A 2AHEA 5ECQB 4G9HA 2NDOA 2CX3A 1W89A 3E0UA 1Y1UA 2YCDA 4EXJA 3IPZA 1EEJA 1TW9A 3ZLPA 1TI3A 3GKNA 3S9FA 2GQKA 2HQTA 3HVXA 2K8SA 2H30A 2CVDA 1MDKA 4L8EA 2C1YA 3GNJA 5D9VA 2HI7A 4MLYA 4POMA 1ILOA 5KN3A 1SL0B 3WGXA 3KH9A 3EU4A 3TDGA 1J08A 1BG1A 2VCWA 1XVWA 1PX7A 4IVFA 2C4JA 3UARA 4K7IA 4KW6A 2FNOA 4DSSA 2LNSA 4AGSA 2RM6A 3KD0A 2YPMA 13GSA 3IC8A 4KGIA 1XW9A 3TKPA 2AAWA 1WIKA 3IAM2 4ZBAA 4EE0A 4KH7A 4LL4B 2GLRA 2GTUA 2JU5A 4X43A 2O89A 4WBRD 3QAGA 4RQRA 5G30A 1JHBA 2GZZA 1SD9A 4NWYA 3BD2A 4MZCA 4WF5A 4OCFA 5D73A 1TRVA 4NAXA 6GSYA 3DMLA 2OKAA 4O7HA 1THXA 4MP4A 1DBYA 4TW5A 4I2TA 2V6OA 1GULA 2E2GA 1PMTA 1YF1A 2YWOA 1VF1A 3GHAA 3KTBA 1ZL9A 2FA4A 2O8VB 4MA9A 4ZIJA 3N9JA 1M0UA 1M99A 1RQMA 4ACSA 1Q98A 2PERA 2QA2A 5ECMB 4D73A 1S3AA 5KN1A 1SVMA 4AJ8A 3CSIA 3IXRA 4MPGA 1QFNA 2WZ9A 5A5HA 2B1KA 3QR6A 5E59A 5CRDA 4JRRA 4FO5A 4DSRA 5IM9A 2PWJA 4NV5A 5ECSA 3QAVA 2FWEA 4TOPA 3TRXA 3LFLA 1GTAA 1XW6A 5HFKA 3A5WA 2XHFA 3CTGA 3LGCA 2C80A 2X49A 3VFIA 1NW2A 1SVOA 4K7OA 1ZZYA 1Z6NA 3M8NA 2H1BA 2JZSA 1AQXA 3VURA 1FO5A 1WJKA 3UVHA 3FYGA 2VM1A 1H4OA 1TTZA 3F63A 2HRKB 4FH8A 4IQ1A 1JZOA 4G0LA 4WKWA 1BF5A 1MD3A 3CWGA 1ZYQB 2HNLA 3GKKA 4FIWA 3F3QA 2WS2A 1X5DA 1VF4A 3K8NA 4GWRA 1TI1A 3M3MA 1GTIA 5F0GA 3JCML 3U5RE 1TRUA 4LMVA 1DE1A 1YVLA 3TJGA 5CREA 2QC7A 4F0CA 3IBHA 3UAPA 1B9XC 3DRNA 1WP0A 4O92A 1YZXA 5J40A 3UL3A 4IN0A 3RPNA 4ZB7A 2YN1A 5ENUA 2K6VA 1EV9A 3IR4A 4G01A 1SKWB 4N30A 1YKCA 3IAS2 1A24A 2RUFA 1TP9A 4V2LA 2VL3A 5B8BA 2R4VA 5JWOB 5F06A 5D93A 1BYEA 3BCIA 1OE8A 4KE3A 1TOFA 2DJ1A 1HNCA 2XBQA 3FKFA 5IOXA 1N2AA 3IK9A 2H1DA 1SD8A 2VLTA 3GL5A 4N0ZA 1F2EA 2I1UA 3ZZXA 2RM5A 1KEBA 3M9KA 3KP9A 5FWGA 4LL1B 2VD1A 2F8AA 5D96A 6GSXA 3TKQA 2H0IA 1YDKA 4IJ3A 3GTUA 4CY6A 3CMIA 4EVMA 4WBJA 3ZTLA 4PNGA 4OFNA 4Q5NA 1GLQA 2LS5A 3G7YA 4I97A 3IHGA 1EGOA 1ERWA 2K18A 5CO3A 5BMUA 1PL1A 1TKDB 5A34A 3IE3A 4GTUA 1DSBA 4Z2RA 2YZUA 2YV7A 14GSA 2GZPA 4TR0A 2B6MA 1FVJA 4BVXA 2PUKC 3A2VA 4JBBA 5JCGA 4QQ7A 1EGRA 4IP6A 4NMUA 2HRFA 2JACA 2GS3A 4Q5QA 1BAYA 1EP8A 5H5QA 1NHYA 5F05A 1TJDA 1K0OA 4W66A 3W8SA 4EIQA 1V2AA 1SL2B 1ZCPA 3TCOA 4MNNA 2HSNB 1MTCA 2YJHA 2QSIA 3TU3B 3RHCA 5GAND 2B7KA 2PGTA 1ON4A 2REMA 5J9BA 2HYXA 4V1Ap 3J7Yk 2VLVA 4PX1A 2GSRA 4BL7A 3HD5A 1T00A 4MK3A 3ERFA 2GGTA 1EZKA 3DGQA 4L5OA 4GDFA 1JFUA 4F0BA 1USBA 2HLSA 3G7JA 2DKHA 3WGDA 1MD4A 1HNBA 2YNXA 2CZ2A 2B1LA 2B7JA 5D9WA 4OWYA 2WJUA 3C8EA 1K0NA 2H70A 5IMZA 4POLA 3IHQA 4OD7A 1YEPA 1R26A 4OFTA 2LJRA 2P0GA 6GSVA 4JEDA 2YWIA 3NOFA 2LV3A 2PVOC 2FHEA 1N25A 2RUEA 5C04A 4HU9A 5J5NA 4L5LA 2TRXA 5EL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N5B A;  3H79 A;  1A2J A;  3DVW A;  3I6A A;  2FWH A;  3I69 A;  2AJQ B;  3MNG A;  2O87 A;  1EOG A;  5JCU A;  4K1F A;  3QOU A;  4V2N A;  3M0F A;  5EY6 A;  4GF0 A;  2RLI A;  2KP2 A;  2V41 A;  2ZCT A;  4FYB A;  2GST A;  1S3D A;  4RQX A;  1PX6 A;  4ZBB A;  2NPB A;  2L6C A;  3ZL5 A;  4MJB A;  4KX4 A;  5DVB A;  4G0I A;  2DLX A;  3TB2 A;  1OYJ A;  8GSS A;  1V58 A;  4Q5F A;  3ERG A;  1GSE A;  1JLV A;  6GSU A;  2N5A A;  2V6K A;  17GS A;  1V9W A;  3TRQ A;  1W4V A;  4EO3 A;  1QUW A;  1THO A;  2PPT A;  2MZC A;  4KSO A;  2C0D A;  4HU7 A;  1PA3 A;  3PH9 A;  3UEM A;  4PQH A;  3ZVJ A;  5A5K A;  1QGV A;  3ZFB A;  3LSZ A;  2LJK A;  2LRN A;  3ERW A;  3FZA A;  4OMV A;  1M9A A;  2HRK A;  3QDN A;  4F82 A;  2KUC A;  4K6X A;  3TJK A;  2J23 A;  5HFI A;  2BTO T;  2IL3 A;  1JZW A;  4ZXG A;  5DJL A;  2OAC A;  3IA1 A;  3MAK A;  4F03 A;  3L4N A;  5CP1 A;  5B7C A;  2QKE A;  1YEX A;  4ECB A;  3FHK A;  1OAZ A;  2PBJ A;  4N11 A;  3H1N A;  2E0Q A;  3GMF A;  5ECL B;  1F3A A;  4G2E A;  4OFM A;  1H75 A;  5AN1 A;  1EOH A;  1B48 A;  2OA7 A;  1XWA A;  4HOJ A;  3R2Q A;  2H8L A;  2TIR A;  2B5Y A;  2DJJ A;  4MJE A;  2VCT A;  4ML6 A;  4ZL8 A;  4ILF A;  2A2R A;  1XCC A;  4GQC A;  4BWQ A;  1M9B A;  6GSS A;  2JSZ A;  2XBI A;  4QL7 A;  4K8M A;  5D9T A;  2DJ3 A;  4PTS A;  4AF2 A;  4PQI A;  1TRS A;  1XOA A;  3CYN A;  4POK A;  4RI6 A;  3SWL A;  2HRN A;  1PD2 1;  2VIM A;  2V32 A;  2IMI A;  3LEF A;  2XPD A;  3KTL A;  4XS4 B;  3HZ4 A;  3TGZ A;  1GUH A;  4BVY A;  1G6Y A;  2DBC A;  2VCV A;  1TU8 A;  5J4U A;  3VWW A;  4IJI A;  5ELA A;  1K0B A;  2JSY A;  2YAN A;  1K0D A;  1GTU A;  2WFC A;  1SJI A;  1J0F A;  2RII A;  3FEU A;  4JZQ A;  1AIU A;  3HHV A;  2DJ2 A;  1XIY A;  20GS A;  1FW1 A;  4NXI A;  2VOC A;  1XPV A;  2CAI A;  5LNK e;  3HCZ A;  1U88 A;  4HDE A;  2PMT A;  1RK4 A;  3UIW A;  3VPQ A;  4IHU A;  3H8Q A;  2LKU A;  2FA8 A;  3FR3 A;  4NHZ A;  4V1A g;  4AJ6 A;  5JWR B;  1GTB A;  1G7E A;  2JAD A;  2DIZ A;  2DMM A;  5JCW A;  3WT2 A;  3ZIV A;  2H6Y A;  5ID2 B;  4J2F A;  2AV4 A;  1TK0 B;  1ST9 A;  5F07 A;  1V40 A;  1TRW A;  4CDO A;  3HVS A;  2ZUP A;  2O7K A;  1CQH A;  1XOB A;  2IFQ B;  2K8V A;  3WGE A;  1S3C A;  2F3M A;  2V2G A;  1XW5 A;  2OE1 A;  1AAZ A;  5AIS A;  3ZYW A;  4XHM A;  4EDZ A;  1Q4J A;  3UBK A;  2FGX A;  1OC9 B;  1A0R P;  1YY7 A;  3PGT A;  2ES7 A;  4MH3 A;  2NVL A;  5A4V A;  3C7M A;  1TU7 A;  2ON5 A;  3F4S A;  3MDK A;  2IME A;  1F6M C;  1F37 A;  3FZ4 A;  1KNG A;  1Z5Y E;  3O3T A;  2HT9 A;  4YQU A;  4MF5 A;  5IQY A;  2LQQ A;  3GH6 A;  1A23 A;  5B8A A;  3D21 A;  3HDC A;  2OE3 A;  2C8U A;  2YP6 A;  1F3B A;  4TR1 A;  2CQ9 A;  5HQP A;  2OJL A;  2D2Z A;  2ZNM A;  3APQ A;  3QCP A;  2GQL A;  4JE1 A;  2ALB A;  1Z7R A;  4YAV A;  2IIY A;  2CVB A;  2P5R A;  4MZB A;  5JWQ B;  3KJY A;  3L78 A;  5IPG A;  5J3R A;  3F6D A;  3HJO A;  1R5A A;  2OE0 A;  3OR5 A;  3FR6 A;  4WF4 A;  4ID0 A;  5ECR B;  3M9J A;  3FRC A;  3RHB A;  1HQO A;  2PVQ A;  1LBK A;  5G5E A;  1X5E A;  2M80 A;  3LYP A;  2IJY A;  4MAB A;  3F4T A;  3QAW A;  1BX9 A;  2H0H A;  3P8W A;  1OE7 A;  4PUR A;  1Y25 A;  2VUP A;  1E2Y A;  3DD3 A;  1Z7P A;  1MDI A;  4XRD A;  1X9M B;  1OC8 A;  3BCK A;  3DXB A;  3GX0 A;  4IQA A;  1QMV A;  1SK0 A;  3EC3 A;  1PGT A;  4YQV A;  2LRT A;  3ZVJ D;  3DIE A;  1X9S B;  1OKT A;  4IKH A;  3RAZ A;  4KF9 A;  2R5G A;  1O81 A;  3GKX A;  3D4T A;  3VPT A;  2EIO A;  3LXZ A;  1A2L A;  5DAK B;  1URM A;  2H19 A;  1B4Q A;  1AXD A;  5HR3 A;  1UVZ A;  3BJ5 A;  2MBT A;  3F8U A;  4IBP A;  1V57 A;  1ERV A;  3KCM A;  1O6J A;  4K7N A;  4ML1 A;  3I43 A;  2XPE A;  5ECP B;  1B8X A;  5HR1 A;  2H1A A;  1T3B A;  3UOM A;  4GRF A;  3FY7 A;  2X8C A;  3PPU A;  4E8E A;  5KN0 A;  4WEY A;  4J57 E;  4ZB8 A;  5ECI B;  4FYC A;  1X5C A;  1GRX A;  2L4Q A;  5L71 A;  1XVQ A;  1LU4 A;  3C73 A;  2MMO A;  1GSU A;  1RW1 A;  5DCG A;  2TRC P;  1K3L A;  4DVC A;  4IGJ A;  2JZR A;  1NHO A;  2HSH A;  4PNF A;  3UMA A;  3PIN A;  2H72 A;  2GSS A;  2MMZ A;  2YWN A;  3RPP A;  1GH2 A;  3M1G A;  1NM3 A;  3HJM A;  3PR8 A;  4MF6 A;  2LTK A;  4ULX A;  4J56 E;  1BJX A;  2I3Y A;  2IPA A;  4KND A;  3E3E A;  2L57 A;  2H71 A;  11GS A;  4P3Y B;  4WET A;  3O6T A;  5HFG A;  19GS A;  4MJC A;  3TOU A;  10GS A;  2FUG 2;  1R4W A;  3GFK A;  2NBS A;  1ERT A;  3LYK A;  1U6T A;  3RBT A;  2X99 A;  4L0W A;  3ED3 A;  4ZB6 A;  4HS1 A;  2LUS A;  3CSH A;  2VD0 A;  3Q18 A;  4FQU A;  5HR0 A;  4ZL9 A;  2JZT A;  2GQM A;  1SU9 A;  5J9C A;  1HYU A;  2CAQ A;  4HZ2 A;  1MEK A;  12GS A;  4ECI A;  5AGY A;  2HZE B;  1FOV A;  3GIX A;  1Z6M A;  2WGR A;  4TXO B;  2E2M A;  1OVN A;  1AUC A;  3W6G A;  4Z7X A;  1PKW A;  3GX8 A;  2C0G A;  3FR9 A;  1A2M A;  1QK8 A;  3G9B A;  5LCZ A;  4PUA A;  4NHW A;  2AYT A;  4HJ2 A;  5COH A;  1K0C A;  1AC1 A;  2FLS A;  4HEA 2;  4NV2 A;  4GSN A;  3HY2 A;  3EYT A;  3P7X A;  2YJ7 A;  2HRA A;  18GS A;  5HR2 A;  1PKZ A;  3D5J A;  3LJR A;  2I81 A;  1E6B A;  4MF7 A;  1XWK A;  5D8I A;  2OBK A;  5D9X A;  1AW9 A;  6GST A;  4HI7 A;  4BA7 A;  5GSS A;  3GKM A;  5G31 A;  1GSF A;  3R3E A;  2B3S A;  1JZR A;  3QMX A;  2XC2 A;  2F9S A;  2GVP A;  2GT5 A;  1GWC A;  3TJJ A;  5ID2 A;  3UVT A;  2P5Q A;  1SK2 A;  3G7I A;  4IP1 A;  2HE3 A;  1EV4 A;  4HUA A;  5CYY A;  2VM2 A;  1T4Y A;  3DKS A;  2G0F A;  3VWU A;  9GSS A;  4I2U A;  2X64 A;  2PN8 A;  1SL1 B;  6GSW A;  2EC4 A;  1TXX A;  3CRT A;  1OC9 A;  2YOI A;  2V1M A;  4MPF A;  2H74 A;  1GUK A;  4JR4 A;  5IIZ A;  4YH2 A;  4YAP A;  1UA5 A;  4TRX A;  1O8W A;  4I8B A;  5DQS A;  2PU9 C;  2X8G A;  1SKS B;  4X0X A;  3TKR A;  3D0Z A;  3NIV A;  3HA9 A;  1ZOF A;  4X1U A;  5EVO A;  4DSQ A;  1JLW A;  1EWX A;  4KSM A;  3ZMK A;  2CV4 A;  3GST A;  1IYI A;  3F0I A;  5CAX A;  1X0R A;  3ME7 A;  1K3Y A;  3SBC A;  3F4R A;  5CNW A;  3DVX A;  3HZ8 A;  3CTF A;  3ME8 A;  2KP1 A;  5IOW A;  4ZL7 A;  3L9V A;  4KB3 A;  4ZB9 A;  4KDU A;  1M7T A;  2MMN A;  1U87 A;  3I9V 2;  2CA8 A;  5FT3 A;  2H76 A;  1TK8 B;  1SYX A;  5DAL B;  2HSM B;  5A4U A;  2YWM A;  2L59 A;  4G0K A;  1T8E B;  4KUN A;  3GYK A;  1A0F A;  3VI5 A;  5G2Z A;  1T4Z A;  3TOT A;  4KCE A;  4BL7 B;  2F51 A;  3UJ1 A;  1V98 A;  1Y6E A;  2CVK A;  3ZRE A;  3GN3 A;  2I4A A;  4CW9 A;  2P31 A;  1SEN A;  3AY8 A;  5DCH A;  1Z3E A;  5GAP D;  1GNE A;  4K0N A;  3Q6O A;  3KMN A;  5DAK A;  3HYP A;  1U3I A;  4MZW A;  5H5R A;  1O8X A;  3LG6 A;  1EEM A;  4ECJ A;  1XWG A;  7GSS A;  3IOS A;  3KGK A;  5IMC A;  2R2J A;  1BQ7 A;  1FB6 A;  2J9H A;  1ACV A;  3EMP A;  4LMW A;  5CRG A;  2R3X A;  2L4C A;  3BBY A;  4GXZ A;  3Q19 A;  2IMD A;  1Z9H A;  1F9M A;  2IN3 A;  3BOA A;  4LA1 A;  4TR4 A;  2LRC A;  5CRH A;  2H1G A;  2R6K A;  3GRX A;  4POB A;  4XTS A;  5ELG A;  5B6N A;  2C0F A;  1X9W B;  1U3A A;  1K0M A;  1XXU A;  2I9H A;  3O76 A;  1YJ6 A;  2H01 A;  3VWX A;  4EKZ A;  3F6F A;  5GZZ B;  1FG4 A;  2EIR A;  2L5O A;  4TN8 A;  3VWV A;  3IK7 A;  3VLN A;  4QL9 A;  1FB0 A;  4XIH A;  5KEJ A;  4HJM A;  2CZ3 A;  1HD2 A;  4G19 A;  1GSS A;  3UBL A;  16GS A;  3ZIJ A;  1IYH A;  3KXO A;  3GV1 A;  4TKY A;  1GUM A;  2GSQ A;  1GSY A;  4OO5 A;  3F9U A;  5G5F A;  2MMA A;  2M72 A;  1B4P A;  2DJK A;  1T7P B;  4KDY A;  3KM6 A;  1M2B A;  4EL1 A;  4BPY A;  2MBS A;  3FK8 A;  3HXS A;  1CQG A;  5DQY A;  2OBI A;  1XZO A;  3L0H A;  2VCQ A;  3E9J B;  4O32 A;  4PGT A;  2K9F A;  1K3O A;  1M2A A;  4IS0 A;  2VO4 A;  2IWT A;  1I5G A;  2HZE A;  2IMF A;  5F8B A;  4TXO A;  4EF0 A;  4F2I A;  1WOU A;  3US3 A;  2GT6 A;  3DEX A;  1WRY A;  2Z9S A;  1PN9 A;  1YF0 A;  1K0A A;  1YKA A;  1N8J A;  4IW9 A;  3H93 A;  4WR4 A;  4WR5 A;  4USS A;  1G7O A;  1BED A;  1SYR A;  3C1S A;  2WDU A;  2FWF A;  2CX4 A;  3CXG A;  4XS6 A;  2E7P A;  5E4W A;  5IMD A;  1XFL A;  1ZYE A;  4K2D A;  1OC3 A;  2G2Q A;  2H73 A;  4GQF A;  5ECK B;  1GSD A;  2HZF A;  3V1W A;  3A3T A;  1DUG A;  1LJR A;  3QD9 A;  2DIY A;  5ECN B;  3KMO A;  2VCX A;  1FAA A;  4HQS A;  2C3Q A;  2WCI A;  1FHE A;  3TRP A;  3KIJ A;  2X8H A;  1O73 A;  3J7Y b;  1XWC A;  4RUV A;  3CRU A;  4XRA A;  2QGV A;  1ML6 A;  4PQ1 A;  5H5S A;  1ZMA A;  1BG5 A;  4MCU A;  3APS A;  1C72 A;  3GUR A;  4KAE A;  4K0G A;  1TDI A;  1SK1 A;  3GA4 A;  4DSS B;  3LXT A;  2CT6 A;  4JR6 A;  4G10 A;  4GST A;  2O85 A;  4BVY B;  4Q5R A;  1ERU A;  1VF3 A;  2H0G A;  1DE2 A;  3FZ9 A;  3VI7 A;  3VK9 A;  4KDX A;  3CSJ A;  2H66 A;  3D6I A;  3FW2 A;  3EE2 A;  1OKD A;  4LLR A;  3KH7 A;  1GLP A;  3KEB A;  4PUF C;  4I5Q A;  5G1K A;  3QFB C;  4CHS A;  2AUV A;  3MSZ A;  1AQW A;  1SJZ A;  3GUS A;  2LST A;  2VL2 C;  1WE0 A;  3DWV A;  3WD6 A;  2L6D A;  1GP1 A;  3ZRD A;  2H75 A;  4HZ4 A;  4K9Z A;  1XBS A;  4D73 B;  4RI7 A;  1FVK A;  5DDL A;  4KA0 A;  5C00 A;  2DJ0 A;  1GNW A;  4YQM A;  3ZFL A;  3Q74 A;  3APO A;  3QPM A;  5ECH B;  4EDY A;  5IPH A;  4XS1 A;  3F3R A;  1KBN A;  1R5P A;  5G1L A;  2UZ8 A;  1UN2 A;  4NPB A;  1O85 A;  3KP8 A;  1GSQ A;  3DYR A;  2IMK A;  2HSM A;  5DAL A;  1EP7 A;  5B6M A;  4JU5 A;  2BJX A;  5IO2 A;  2A4V A;  1KTE A;  3EWL A;  4I6X A;  3GH9 A;  2OAD A;  1VRS D;  2MYG A;  4N10 A;  5DJM A;  1PSQ A;  5ABR A;  2A2S A;  1HNA A;  4MH2 A;  3ISO A;  3TJB A;  2FY6 A;  2KOK A;  2VL2 A;  3ZML A;  3WT1 A;  3A2W A;  4XS4 A;  3CBU A;  4H86 A;  3NZN A;  1PRX A;  4TR3 A;  3LWA A;  4N0V A;  2VCZ A;  3H4K A;  1TK5 B;  3D22 A;  5IO0 A;  2VAF A;  4TR1 B;  2JL4 A;  4O5R A;  2FCH A;  2M46 A;  2KHP A;  1WMJ A;  2LEG A;  4ZBD A;  2L5L A;  1M2D A;  2WB9 A;  4TXV A;  2HXK A;  2YV9 A;  3LOR A;  4TVE A;  4FYU A;  2GZY A;  22GS A;  2YZH A;  1A8L A;  2GDR A;  1WPI A;  2VL9 A;  3N5O A;  4GSS A;  2AB6 A;  1PL2 A;  2DC5 A;  2EIQ A;  1YQ1 A;  3HVV A;  2VLU A;  1JZD A;  4ZIL A;  2WUL A;  2FD3 A;  3FZ5 A;  2C3T A;  2LNT A;  2HFD A;  1PQN A;  2B5X A;  4OO4 A;  1B9Y C;  1ABA A;  3L9S A;  3TKS C;  3EIN A;  5IMV A;  3L9U A;  2N5F A;  3RDW A;  3TUE A;  5LD0 A;  3W8J A;  4L0U A;  5CRW A;  3HKR A;  1UC7 A;  3HJP A;  2IFQ A;  4HQZ A;  2HSY A;  2BMX A;  2C3N A;  5A4W A;  4E8H A;  3GL3 A;  4OCE A;  3TKS E;  2R37 A;  1WWJ A;  3EMX A;  4ECC A;  4DEJ A;  2LQO A;  3GSS A;  4GCI A;  5AIX A;  4GLT A;  1QXH A;  3KZQ A;  4MJA A;  5J41 A;  4KCA A;  1T1V A;  4IEL A;  5AIV A;  1R7H A;  3EUR A;  3IV4 A;  3IRA A;  2B5E A;  3P2A A;  3GTU B;  5EPF A;  2H6X A;  5ECO B;  2NTO A;  3C71 A;  2H6Z A;  3D4M A;  3P90 A;  3IDV A;  5IMF A;  4PXO A;  1XWB A;  2FWG A;  2DML A;  3MWH A;  3WYW A;  1MDJ A;  1O7U A;  1J9B A;  3TKS A;  4XCS A;  4MMM A;  2LJA A;  3TJF A;  5INY A;  2F8F A;  4F9Z A;  5GST A;  1A8Y A;  4BWS A;  1GL8 A;  3ZIT A;  1G6W A;  4MDC A;  1VF2 A;  1NSW A;  5FHI A;  4BVX B;  3U6V A;  3IC4 A;  2DSA A;  4WXT A;  3EU3 A;  4EUY A;  1ZGN A;  2ON7 A;  1QQ2 A;  1I9D A;  5IMA A;  4V2M A;  2KLX A;  3EVI A;  3QFA C;  1VGL A;  1SKR B;  5DBQ A;  4EC0 A;  3C1R A;  2WRT A;  4ISD A;  2C0E A;  3LQ7 A;  1SJ6 A;  3A2X A;  1AQV A;  1G0T A;  4AJ7 A;  5KN2 A;  2AHE A;  5ECQ B;  4G9H A;  2NDO A;  2CX3 A;  1W89 A;  3E0U A;  2YCD A;  4EXJ A;  3IPZ A;  1EEJ A;  1TW9 A;  3ZLP A;  1TI3 A;  3GKN A;  3S9F A;  2GQK A;  2HQT A;  3HVX A;  2K8S A;  2H30 A;  2CVD A;  1MDK A;  4L8E A;  2C1Y A;  3GNJ A;  5D9V A;  2HI7 A;  4MLY A;  4POM A;  1ILO A;  5KN3 A;  1SL0 B;  3WGX A;  3KH9 A;  3EU4 A;  3TDG A;  1J08 A;  2VCW A;  1XVW A;  1PX7 A;  4IVF A;  2C4J A;  3UAR A;  4K7I A;  4KW6 A;  2FNO A;  4DSS A;  2LNS A;  4AGS A;  2RM6 A;  3KD0 A;  2YPM A;  13GS A;  3IC8 A;  4KGI A;  1XW9 A;  3TKP A;  2AAW A;  1WIK A;  3IAM 2;  4ZBA A;  4EE0 A;  4KH7 A;  4LL4 B;  2GLR A;  2GTU A;  2JU5 A;  4X43 A;  2O89 A;  4WBR D;  3QAG A;  4RQR A;  5G30 A;  1JHB A;  2GZZ A;  1SD9 A;  4NWY A;  3BD2 A;  4MZC A;  4WF5 A;  4OCF A;  5D73 A;  1TRV A;  4NAX A;  6GSY A;  3DML A;  2OKA A;  4O7H A;  1THX A;  4MP4 A;  1DBY A;  4TW5 A;  4I2T A;  2V6O A;  1GUL A;  2E2G A;  1PMT A;  1YF1 A;  2YWO A;  1VF1 A;  3GHA A;  3KTB A;  1ZL9 A;  2FA4 A;  2O8V B;  4MA9 A;  4ZIJ A;  3N9J A;  1M0U A;  1M99 A;  1RQM A;  4ACS A;  1Q98 A;  2PER A;  5ECM B;  4D73 A;  1S3A A;  5KN1 A;  4AJ8 A;  3CSI A;  3IXR A;  4MPG A;  1QFN A;  2WZ9 A;  2B1K A;  3QR6 A;  5E59 A;  5CRD A;  4JRR A;  4FO5 A;  4DSR A;  5IM9 A;  2PWJ A;  4NV5 A;  5ECS A;  3QAV A;  2FWE A;  4TOP A;  3TRX A;  3LFL A;  1GTA A;  1XW6 A;  5HFK A;  3A5W A;  2XHF A;  3CTG A;  3LGC A;  2C80 A;  3VFI A;  1NW2 A;  4K7O A;  1ZZY A;  1Z6N A;  3M8N A;  2H1B A;  2JZS A;  1AQX A;  3VUR A;  1FO5 A;  1WJK A;  3UVH A;  3FYG A;  2VM1 A;  1H4O A;  1TTZ A;  3F63 A;  2HRK B;  4FH8 A;  4IQ1 A;  1JZO A;  4G0L A;  4WKW A;  1MD3 A;  1ZYQ B;  2HNL A;  3GKK A;  4FIW A;  3F3Q A;  2WS2 A;  1X5D A;  1VF4 A;  3K8N A;  4GWR A;  1TI1 A;  3M3M A;  1GTI A;  5F0G A;  3JCM L;  3U5R E;  1TRU A;  4LMV A;  1DE1 A;  3TJG A;  5CRE A;  2QC7 A;  4F0C A;  3IBH A;  3UAP A;  1B9X C;  3DRN A;  1WP0 A;  4O92 A;  1YZX A;  3UL3 A;  4IN0 A;  3RPN A;  2YN1 A;  5ENU A;  2K6V A;  1EV9 A;  3IR4 A;  1SKW B;  4N30 A;  1YKC A;  3IAS 2;  1A24 A;  2RUF A;  1TP9 A;  4V2L A;  2VL3 A;  5B8B A;  2R4V A;  5JWO B;  5F06 A;  5D93 A;  1BYE A;  3BCI A;  1OE8 A;  4KE3 A;  1TOF A;  2DJ1 A;  1HNC A;  2XBQ A;  3FKF A;  5IOX A;  1N2A A;  3IK9 A;  2H1D A;  1SD8 A;  2VLT A;  3GL5 A;  4N0Z A;  1F2E A;  2I1U A;  3ZZX A;  2RM5 A;  1KEB A;  3M9K A;  3KP9 A;  5FWG A;  4LL1 B;  2VD1 A;  2F8A A;  5D96 A;  6GSX A;  3TKQ A;  2H0I A;  1YDK A;  4IJ3 A;  3GTU A;  3CMI A;  4EVM A;  4WBJ A;  3ZTL A;  4PNG A;  4OFN A;  4Q5N A;  1GLQ A;  2LS5 A;  3G7Y A;  4I97 A;  1EGO A;  1ERW A;  2K18 A;  5CO3 A;  5BMU A;  1PL1 A;  1TKD B;  3IE3 A;  4GTU A;  1DSB A;  2YZU A;  2YV7 A;  14GS A;  2GZP A;  4TR0 A;  2B6M A;  1FVJ A;  4BVX A;  2PUK C;  3A2V A;  4JBB A;  5JCG A;  4QQ7 A;  1EGR A;  4IP6 A;  4NMU A;  2HRF A;  2JAC A;  2GS3 A;  4Q5Q A;  1BAY A;  1EP8 A;  5H5Q A;  1NHY A;  5F05 A;  1TJD A;  1K0O A;  3W8S A;  1V2A A;  1SL2 B;  1ZCP A;  3TCO A;  2HSN B;  1MTC A;  2YJH A;  2QSI A;  3RHC A;  5GAN D;  2B7K A;  2PGT A;  1ON4 A;  2REM A;  5J9B A;  2HYX A;  4V1A p;  3J7Y k;  2VLV A;  4PX1 A;  2GSR A;  4BL7 A;  3HD5 A;  1T00 A;  4MK3 A;  3ERF A;  2GGT A;  1EZK A;  3DGQ A;  4L5O A;  1JFU A;  4F0B A;  1USB A;  2HLS A;  3G7J A;  3WGD A;  1MD4 A;  1HNB A;  2YNX A;  2CZ2 A;  2B1L A;  2B7J A;  5D9W A;  4OWY A;  2WJU A;  3C8E A;  1K0N A;  2H70 A;  5IMZ A;  4POL A;  3IHQ A;  4OD7 A;  1YEP A;  1R26 A;  4OFT A;  2LJR A;  2P0G A;  6GSV A;  4JED A;  2YWI A;  3NOF A;  2LV3 A;  2PVO C;  2FHE A;  2RUE A;  5C04 A;  4HU9 A;  5J5N A;  4L5L A;  2TRX A;  5EL8 A; 
#chains in the Genus database with same CATH topology
 2N5B A;  3H79 A;  1A2J A;  3DVW A;  3I6A A;  2FWH A;  3I69 A;  2AJQ B;  3MNG A;  2O87 A;  2O3E A;  1EOG A;  5JCU A;  4K1F A;  3QOU A;  4V2N A;  3M0F A;  5EY6 A;  4GF0 A;  2RLI A;  2KP2 A;  2V41 A;  2ZCT A;  4FYB A;  2GST A;  1S3D A;  4RQX A;  1PX6 A;  4ZBB A;  2NPB A;  2L6C A;  4PI0 C;  3ZL5 A;  4MJB A;  4KX4 A;  5DVB A;  4G0I A;  2DLX A;  3TB2 A;  4HSC X;  1OYJ A;  8GSS A;  1V58 A;  3MIX A;  4Q5F A;  3ERG A;  1GSE A;  1JLV A;  6GSU A;  2N5A A;  2V6K A;  17GS A;  1V9W A;  3TRQ A;  1W4V A;  4EO3 A;  1QUW A;  1THO A;  2PPT A;  2MZC A;  4KSO A;  2C0D A;  4HU7 A;  1PA3 A;  3PH9 A;  2H1L A;  3UEM A;  4PQH A;  3ZVJ A;  5A5K A;  1QGV A;  3ZFB A;  2A4H A;  3LSZ A;  2LJK A;  2LRN A;  3ERW A;  3FZA A;  4OMV A;  1M9A A;  2HRK A;  3QDN A;  4F82 A;  2KUC A;  4K6X A;  3TJK A;  2J23 A;  5HFI A;  2BTO T;  2IL3 A;  1JZW A;  4ZXG A;  5DJL A;  1YEW C;  2OAC A;  3IA1 A;  3MAK A;  4F03 A;  3L4N A;  4EIP A;  5CP1 A;  5B7C A;  2QKE A;  1YEX A;  4ECB A;  3FHK A;  1OAZ A;  2PBJ A;  4ICY A;  4N11 A;  2X4A A;  3H1N A;  2E0Q A;  3GMF A;  2EFE A;  5ECL B;  1F3A A;  4G2E A;  4OFM A;  1H75 A;  5AN1 A;  1EOH A;  1B48 A;  2OA7 A;  1XWA A;  4HOJ A;  3R2Q A;  2H8L A;  2TIR A;  2B5Y A;  2DJJ A;  4MJE A;  2VCT A;  4ML6 A;  4ZL8 A;  2UV8 G;  4ILF A;  2A2R A;  4O5Q A;  1XCC A;  4GQC A;  4BWQ A;  1M9B A;  6GSS A;  2JSZ A;  2XBI A;  4QL7 A;  4K8M A;  5D9T A;  2DJ3 A;  4PTS A;  4AF2 A;  4PQI A;  1TRS A;  1XOA A;  3CYN A;  4POK A;  4RI6 A;  3SWL A;  2HRN A;  1PD2 1;  2VIM A;  5J4V A;  2V32 A;  2IMI A;  3LEF A;  2XPD A;  3KTL A;  4XS4 B;  3HZ4 A;  3TGZ A;  1GUH A;  4BVY A;  1G6Y A;  2DBC A;  2VCV A;  1TU8 A;  5J4U A;  3VWW A;  4IJI A;  5ELA A;  1K0B A;  2JSY A;  2YAN A;  1K0D A;  1GTU A;  2WFC A;  1PN0 A;  1SJI A;  1J0F A;  2RII A;  3FEU A;  4JZQ A;  3EPT A;  1AIU A;  3HHV A;  2DJ2 A;  1XIY A;  20GS A;  1FW1 A;  4NXI A;  2VOC A;  1XPV A;  2CAI A;  5LNK e;  3HCZ A;  4PI2 C;  1U88 A;  4HDE A;  2PMT A;  1RK4 A;  3UIW A;  3VPQ A;  4IHU A;  3H8Q A;  2LKU A;  2FA8 A;  3FR3 A;  4NHZ A;  4V1A g;  4AJ6 A;  5JWR B;  1GTB A;  1G7E A;  2JAD A;  2DIZ A;  2DMM A;  5A1N B;  5JCW A;  3WT2 A;  3ZIV A;  2H6Y A;  5ID2 B;  4J2F A;  2AV4 A;  1TK0 B;  1ST9 A;  5F07 A;  1V40 A;  1TRW A;  4CDO A;  3HVS A;  2ZUP A;  2O7K A;  1CQH A;  1XOB A;  2IFQ B;  3MYD A;  2K8V A;  3WGE A;  2HSN A;  1S3C A;  2F3M A;  2V2G A;  1XW5 A;  2OE1 A;  1AAZ A;  5AIS A;  3ZYW A;  4XHM A;  4EDZ A;  1Q4J A;  3UBK A;  2FGX A;  1OC9 B;  1A0R P;  1YY7 A;  3PGT A;  2ES7 A;  4MH3 A;  2NVL A;  5A4V A;  3C7M A;  1TU7 A;  2ON5 A;  3F4S A;  3MDK A;  2IME A;  1F6M C;  1F37 A;  3FZ4 A;  1KNG A;  1Z5Y E;  3O3T A;  2HT9 A;  4YQU A;  4MF5 A;  5IQY A;  2LQQ A;  3GH6 A;  1A23 A;  5B8A A;  3D21 A;  3HDC A;  2OE3 A;  2C8U A;  2YP6 A;  1F3B A;  4TR1 A;  2CQ9 A;  5HQP A;  2OJL A;  2D2Z A;  2ZNM A;  3APQ A;  3QCP A;  2GQL A;  4JE1 A;  2ALB A;  1Z7R A;  4Z2U A;  4YAV A;  2IIY A;  2CVB A;  2P5R A;  4MZB A;  5JWQ B;  4AKI A;  3KJY A;  3L78 A;  4K5R A;  5IPG A;  5J3R A;  3F6D A;  3HJO A;  1R5A A;  2OE0 A;  3OR5 A;  3FR6 A;  4WF4 A;  3A5I A;  3FMW A;  4ID0 A;  5ECR B;  3M9J A;  3FRC A;  3RHB A;  1HQO A;  2PVQ A;  1LBK A;  5G5E A;  1X5E A;  2M80 A;  3LYP A;  2IJY A;  1M3J A;  4MAB A;  3F4T A;  3QAW A;  3HMJ G;  1BX9 A;  2H0H A;  3P8W A;  1OE7 A;  4PUR A;  1Y25 A;  2VUP A;  1E2Y A;  3DD3 A;  2O5V A;  1Z7P A;  2WW1 A;  1MDI A;  4XRD A;  1X9M B;  1OC8 A;  3BCK A;  4YKG A;  3DXB A;  3GX0 A;  4IQA A;  1QMV A;  1SK0 A;  3EC3 A;  1PGT A;  4YQV A;  2LRT A;  3ZVJ D;  3DIE A;  1X9S B;  1OKT A;  4IKH A;  3RAZ A;  4KF9 A;  2R5G A;  1O81 A;  3GKX A;  3D4T A;  3VPT A;  2EIO A;  3LXZ A;  1A2L A;  5DAK B;  1URM A;  2H19 A;  1B4Q A;  1AXD A;  5HR3 A;  1UVZ A;  3BJ5 A;  4N3Z A;  2MBT A;  1SVL A;  3F8U A;  4IBP A;  1V57 A;  1ERV A;  3KCM A;  1S4B P;  1O6J A;  4K7N A;  4ML1 A;  3I43 A;  2XPE A;  5ECP B;  1B8X A;  5HR1 A;  2H1A A;  1T3B A;  3UOM A;  4GRF A;  3FY7 A;  2X8C A;  3PPU A;  4E8E A;  5KN0 A;  4WEY A;  4J57 E;  4ZB8 A;  5ECI B;  4FYC A;  1X5C A;  1GRX A;  2L4Q A;  5L71 A;  1XVQ A;  1LU4 A;  3C73 A;  2MMO A;  1GSU A;  1RW1 A;  5DCG A;  2TRC P;  1K3L A;  4DVC A;  4IGJ A;  2JZR A;  1NHO A;  2HSH A;  4PNF A;  3UMA A;  3PIN A;  2H72 A;  2GSS A;  2MMZ A;  2YWN A;  3RPP A;  1GH2 A;  3M1G A;  5J47 A;  1NM3 A;  1XG8 A;  3HJM A;  3PR8 A;  4MF6 A;  2QA1 A;  2LTK A;  4ULX A;  4J56 E;  1BJX A;  2I3Y A;  2IPA A;  4KND A;  3E3E A;  2L57 A;  2H71 A;  11GS A;  4P3Y B;  4WET A;  3O6T A;  5HFG A;  5A5H B;  19GS A;  4MJC A;  3TOU A;  10GS A;  4QMK A;  2FUG 2;  1R4W A;  3GFK A;  2NBS A;  1ERT A;  3LYK A;  1U6T A;  3RBT A;  2X99 A;  4L0W A;  3ED3 A;  4ZB6 A;  2R0C A;  4HS1 A;  2LUS A;  3CSH A;  2EFC A;  2VD0 A;  3Q18 A;  4FQU A;  5HR0 A;  4K2X A;  2A2P A;  4ZL9 A;  2JZT A;  2GQM A;  1SU9 A;  5J9C A;  1HYU A;  2CAQ A;  4HZ2 A;  1MEK A;  12GS A;  4ECI A;  5AGY A;  2HZE B;  1FOV A;  3GIX A;  1Z6M A;  2WGR A;  4TXO B;  2E2M A;  1OVN A;  1AUC A;  3W6G A;  4Z7X A;  1PKW A;  3GX8 A;  2C0G A;  3FR9 A;  1A2M A;  1QK8 A;  3G9B A;  5LCZ A;  4PUA A;  4NHW A;  2AYT A;  4HJ2 A;  4YKF A;  5COH A;  1K0C A;  1AC1 A;  5BRT A;  2FLS A;  4HEA 2;  4NV2 A;  4GSN A;  3HY2 A;  3EYT A;  3P7X A;  2YJ7 A;  2HRA A;  18GS A;  5HR2 A;  1PKZ A;  3D5J A;  3LJR A;  2I81 A;  1E6B A;  4MF7 A;  1XWK A;  5D8I A;  2OBK A;  5D9X A;  1AW9 A;  6GST A;  4HI7 A;  4BA7 A;  5GSS A;  3GKM A;  5G31 A;  1GSF A;  3R3E A;  2B3S A;  1JZR A;  3QMX A;  2XC2 A;  2F9S A;  2GVP A;  2GT5 A;  1GWC A;  5A1N A;  3TJJ A;  5ID2 A;  3UVT A;  2P5Q A;  1SK2 A;  3G7I A;  4IP1 A;  2HE3 A;  1EV4 A;  4HUA A;  5CYY A;  2VM2 A;  1T4Y A;  3DKS A;  2G0F A;  3VWU A;  9GSS A;  4I2U A;  2X64 A;  2PN8 A;  1SL1 B;  6GSW A;  2EC4 A;  2EFD A;  1TXX A;  3CRT A;  3RGB C;  1OC9 A;  1S3R A;  2YOI A;  2V1M A;  4MPF A;  2H74 A;  1GUK A;  4E68 A;  4JR4 A;  5IIZ A;  4YH2 A;  4YAP A;  1I1I P;  1UA5 A;  4TRX A;  1O8W A;  4I8B A;  5DQS A;  2PU9 C;  2X8G A;  1SKS B;  4X0X A;  3TKR A;  3D0Z A;  3NIV A;  3HA9 A;  1ZOF A;  4X1U A;  5EVO A;  4DSQ A;  1JLW A;  1EWX A;  4KSM A;  1PFO A;  3ZMK A;  2CV4 A;  3GST A;  1IYI A;  3F0I A;  5CAX A;  1X0R A;  3ME7 A;  1K3Y A;  3SBC A;  3F4R A;  5CNW A;  3DVX A;  3HZ8 A;  3CTF A;  3ME8 A;  2KP1 A;  5IOW A;  4ZL7 A;  3L9V A;  4KB3 A;  4ZB9 A;  4KDU A;  4BIK A;  1M7T A;  2MMN A;  2EFH A;  1U87 A;  3I9V 2;  2CA8 A;  4AKG A;  5FT3 A;  3CHX C;  2H76 A;  1TK8 B;  1SYX A;  5DAL B;  2HSM B;  5A4U A;  2YWM A;  2L59 A;  2OT3 A;  5KOX A;  4G0K A;  1T8E B;  4KUN A;  3GYK A;  1A0F A;  3VI5 A;  5G2Z A;  1T4Z A;  3TOT A;  4KCE A;  4BL7 B;  2VKZ G;  2F51 A;  3UJ1 A;  1V98 A;  1Y6E A;  2CVK A;  3ZRE A;  3GN3 A;  2I4A A;  4CW9 A;  2P31 A;  1SEN A;  3AY8 A;  5DCH A;  1Z3E A;  5GAP D;  1GNE A;  4K0N A;  3Q6O A;  3KMN A;  5DAK A;  3HYP A;  1U3I A;  4MZW A;  5H5R A;  1O8X A;  3LG6 A;  1EEM A;  4ECJ A;  1XWG A;  7GSS A;  3IOS A;  3KGK A;  5IMC A;  2R2J A;  1BQ7 A;  1FB6 A;  2J9H A;  4AI6 A;  1ACV A;  3EMP A;  4LMW A;  5CRG A;  2R3X A;  2L4C A;  3BBY A;  4O5U A;  4GXZ A;  3Q19 A;  2IMD A;  1Z9H A;  1F9M A;  2IN3 A;  3BOA A;  4LA1 A;  4TR4 A;  2LRC A;  5CRH A;  3HVN A;  2H1G A;  2R6K A;  3GRX A;  4POB A;  4XTS A;  5ELG A;  5B6N A;  2C0F A;  1X9W B;  1U3A A;  1K0M A;  1XXU A;  2I9H A;  3O76 A;  1YJ6 A;  2H01 A;  2DKI A;  3VWX A;  4EKZ A;  3F6F A;  5GZZ B;  1FG4 A;  2EIR A;  2L5O A;  4TN8 A;  3VWV A;  3IK7 A;  3VLN A;  4QL9 A;  1FB0 A;  4XIH A;  5KEJ A;  4HJM A;  2CZ3 A;  1HD2 A;  4G19 A;  1GSS A;  3UBL A;  16GS A;  3ZIJ A;  1IYH A;  3KXO A;  3CQF A;  3GV1 A;  4TKY A;  5J4Y A;  1GUM A;  2GSQ A;  1GSY A;  4OO5 A;  3F9U A;  5G5F A;  4AKX B;  2MMA A;  2M72 A;  1B4P A;  2DJK A;  1T7P B;  4KDY A;  3KM6 A;  1M2B A;  4EL1 A;  4BPY A;  2MBS A;  3FK8 A;  3HXS A;  1CQG A;  5DQY A;  2OBI A;  1XZO A;  3L0H A;  2VCQ A;  3E9J B;  4O32 A;  4AKH A;  4PGT A;  2K9F A;  1K3O A;  1M2A A;  4IS0 A;  2VO4 A;  2IWT A;  1I5G A;  2HZE A;  2IMF A;  5F8B A;  4TXO A;  4EF0 A;  4F2I A;  1WOU A;  3US3 A;  2WVZ A;  2GT6 A;  3DEX A;  1WRY A;  2Z9S A;  1PN9 A;  1YF0 A;  1K0A A;  1YKA A;  1N8J A;  4IW9 A;  3H93 A;  4WR4 A;  4WR5 A;  2R0G A;  4USS A;  1G7O A;  1BED A;  1SYR A;  3C1S A;  2WDU A;  2FWF A;  2CX4 A;  3CXG A;  4XS6 A;  1ZYN A;  2E7P A;  5E4W A;  5IMD A;  1XFL A;  1ZYE A;  4K2D A;  1OC3 A;  2G2Q A;  2H73 A;  4GQF A;  5ECK B;  1GSD A;  2WW0 A;  2HZF A;  3V1W A;  3A3T A;  1DUG A;  1LJR A;  3QD9 A;  2DIY A;  5ECN B;  3KMO A;  2VCX A;  5KOW A;  1FAA A;  4HQS A;  2C3Q A;  2WCI A;  1FHE A;  3TRP A;  3KIJ A;  2X8H A;  1O73 A;  3J7Y b;  1XWC A;  4RUV A;  3CRU A;  4XRA A;  2QGV A;  1ML6 A;  4PQ1 A;  5H5S A;  1ZMA A;  1BG5 A;  4MCU A;  3APS A;  1C72 A;  3GUR A;  4KAE A;  4Z2T A;  4K0G A;  1TDI A;  1SK1 A;  3GA4 A;  4DSS B;  3LXT A;  2CT6 A;  4JR6 A;  4G10 A;  2R0P A;  1FOH A;  4GST A;  2O85 A;  4BVY B;  4Q5R A;  1ERU A;  1VF3 A;  2H0G A;  1DE2 A;  3FZ9 A;  3VI7 A;  3VK9 A;  4KDX A;  3CSJ A;  2H66 A;  3D6I A;  3FW2 A;  3EE2 A;  1OKD A;  4LLR A;  2WVY A;  3KH7 A;  1GLP A;  3KEB A;  4PUF C;  4I5Q A;  5G1K A;  3QFB C;  4CHS A;  2AUV A;  3MSZ A;  4FXY P;  1AQW A;  1SJZ A;  3GUS A;  2LST A;  4X4J A;  2VL2 C;  1WE0 A;  3DWV A;  3WD6 A;  2L6D A;  1GP1 A;  3ZRD A;  2H75 A;  4HZ4 A;  4K9Z A;  1XBS A;  4D73 B;  4RI7 A;  2WVX B;  1FVK A;  5DDL A;  4KA0 A;  5C00 A;  2DJ0 A;  1GNW A;  4YQM A;  3ZFL A;  3Q74 A;  3APO A;  3QPM A;  5ECH B;  4EDY A;  5IPH A;  4XS1 A;  3F3R A;  1KBN A;  1R5P A;  5G1L A;  2UZ8 A;  1UN2 A;  4NPB A;  1O85 A;  3KP8 A;  1GSQ A;  3DYR A;  2IMK A;  2HSM A;  5DAL A;  1EP7 A;  5B6M A;  4JU5 A;  2BJX A;  5IO2 A;  2A4V A;  1KTE A;  3EWL A;  4I6X A;  3GH9 A;  2OAD A;  1VRS D;  2MYG A;  4N10 A;  5DJM A;  1PSQ A;  5ABR A;  2A2S A;  1HNA A;  4MH2 A;  3ISO A;  3TJB A;  2FY6 A;  2KOK A;  2VL2 A;  3ZML A;  3WT1 A;  3A2W A;  4XS4 A;  3CBU A;  4H86 A;  3NZN A;  1PRX A;  4TR3 A;  3LWA A;  4N0V A;  2VCZ A;  3H4K A;  1TK5 B;  3D22 A;  5IO0 A;  2VAF A;  4TR1 B;  2JL4 A;  4O5R A;  2FCH A;  2M46 A;  2KHP A;  1WMJ A;  2LEG A;  4ZBD A;  2L5L A;  1M2D A;  2WB9 A;  4TXV A;  2HXK A;  2YV9 A;  3LOR A;  4TVE A;  4FYU A;  2GZY A;  22GS A;  2YZH A;  1A8L A;  2GDR A;  1WPI A;  2VL9 A;  3N5O A;  1ZYP A;  4GSS A;  2AB6 A;  1PL2 A;  2DC5 A;  2EIQ A;  1YQ1 A;  3HVV A;  2VLU A;  1JZD A;  4ZIL A;  4CY8 A;  2WW2 A;  2WUL A;  2FD3 A;  3FZ5 A;  2C3T A;  2LNT A;  2HFD A;  1PQN A;  2B5X A;  4OO4 A;  1B9Y C;  1ABA A;  3L9S A;  3TKS C;  3EIN A;  4A5P A;  5IMV A;  3L9U A;  2N5F A;  3RDW A;  3TUE A;  5LD0 A;  3W8J A;  4L0U A;  5CRW A;  3HKR A;  2WW3 A;  1UC7 A;  3HJP A;  2IFQ A;  4HQZ A;  2HSY A;  2BMX A;  2C3N A;  5A4W A;  4E8H A;  3GL3 A;  4PHZ C;  4OCE A;  3TKS E;  2R37 A;  1WWJ A;  3EMX A;  4ECC A;  4DEJ A;  2LQO A;  3GSS A;  4GCI A;  5AIX A;  4GLT A;  1QXH A;  3KZQ A;  4MJA A;  5J41 A;  4KCA A;  1T1V A;  4IEL A;  5AIV A;  1R7H A;  3EUR A;  3IV4 A;  3IRA A;  2B5E A;  3P2A A;  3GTU B;  5EPF A;  2H6X A;  5ECO B;  2NTO A;  3C71 A;  2H6Z A;  3LW9 A;  3D4M A;  3P90 A;  4K5S A;  3IDV A;  1TXU A;  5IMF A;  4PXO A;  1XWB A;  2FWG A;  2DML A;  3MWH A;  3WYW A;  1MDJ A;  1O7U A;  5BMU B;  1J9B A;  3TKS A;  4XCS A;  4MMM A;  5A34 B;  2LJA A;  3TJF A;  5INY A;  2F8F A;  4F9Z A;  5GST A;  1A8Y A;  4BWS A;  1GL8 A;  3ZIT A;  1G6W A;  4MDC A;  1VF2 A;  1NSW A;  5FHI A;  4BVX B;  3U6V A;  3IC4 A;  2DSA A;  4WXT A;  3EU3 A;  4EUY A;  1ZGN A;  2ON7 A;  1QQ2 A;  1I9D A;  5IMA A;  4V2M A;  2KLX A;  3EVI A;  3QFA C;  1VGL A;  1SKR B;  5DBQ A;  4EC0 A;  3C1R A;  2WRT A;  4ISD A;  2C0E A;  3LQ7 A;  1SJ6 A;  3A2X A;  1AQV A;  1G0T A;  4AJ7 A;  5KN2 A;  2AHE A;  5ECQ B;  4G9H A;  2NDO A;  2CX3 A;  1W89 A;  3E0U A;  1Y1U A;  2YCD A;  4EXJ A;  3IPZ A;  1EEJ A;  1TW9 A;  3ZLP A;  1TI3 A;  3GKN A;  3S9F A;  2GQK A;  2HQT A;  3HVX A;  2K8S A;  2H30 A;  2CVD A;  1MDK A;  4L8E A;  2C1Y A;  3GNJ A;  5D9V A;  2HI7 A;  4MLY A;  4POM A;  1ILO A;  5KN3 A;  1SL0 B;  3WGX A;  3KH9 A;  3EU4 A;  3TDG A;  1J08 A;  1BG1 A;  2VCW A;  1XVW A;  1PX7 A;  4IVF A;  2C4J A;  3UAR A;  4K7I A;  4KW6 A;  2FNO A;  4DSS A;  2LNS A;  4AGS A;  2RM6 A;  3KD0 A;  2YPM A;  13GS A;  3IC8 A;  4KGI A;  2O36 A;  1XW9 A;  3TKP A;  2AAW A;  1WIK A;  3IAM 2;  4ZBA A;  4EE0 A;  4KH7 A;  4LL4 B;  2GLR A;  2GTU A;  2JU5 A;  4X43 A;  2O89 A;  4WBR D;  3QAG A;  4RQR A;  5G30 A;  1JHB A;  2GZZ A;  1SD9 A;  4NWY A;  3BD2 A;  4MZC A;  4WF5 A;  4OCF A;  5D73 A;  1TRV A;  4NAX A;  6GSY A;  3DML A;  2OKA A;  4O7H A;  1THX A;  4MP4 A;  1DBY A;  4TW5 A;  4I2T A;  2V6O A;  1GUL A;  2E2G A;  1PMT A;  1YF1 A;  2YWO A;  1VF1 A;  3GHA A;  3KTB A;  1ZL9 A;  2FA4 A;  2O8V B;  4MA9 A;  4ZIJ A;  3N9J A;  1M0U A;  1M99 A;  1RQM A;  4ACS A;  1Q98 A;  2PER A;  2QA2 A;  5ECM B;  4D73 A;  2WVX A;  1S3A A;  5KN1 A;  1SVM A;  4AJ8 A;  1M3I A;  3CSI A;  3IXR A;  4MPG A;  1QFN A;  2WZ9 A;  5A5H A;  2B1K A;  3QR6 A;  5E59 A;  5CRD A;  4JRR A;  4FO5 A;  4DSR A;  5IM9 A;  2PWJ A;  4NV5 A;  5ECS A;  3QAV A;  2FWE A;  4TOP A;  3TRX A;  3LFL A;  1GTA A;  1XW6 A;  5HFK A;  3A5W A;  2XHF A;  3CTG A;  3LGC A;  2C80 A;  2X49 A;  3VFI A;  1NW2 A;  1SVO A;  4K7O A;  1ZZY A;  1Z6N A;  3M8N A;  2H1B A;  2JZS A;  1AQX A;  3VUR A;  1FO5 A;  1WJK A;  3UVH A;  3FYG A;  2VM1 A;  1H4O A;  1TTZ A;  3F63 A;  2HRK B;  4FH8 A;  4IQ1 A;  1JZO A;  4G0L A;  4WKW A;  1BF5 A;  1MD3 A;  3CWG A;  1ZYQ B;  2HNL A;  3GKK A;  4FIW A;  3F3Q A;  2WS2 A;  1X5D A;  1VF4 A;  3K8N A;  4GWR A;  1TI1 A;  3M3M A;  1GTI A;  5F0G A;  3JCM L;  3U5R E;  1TRU A;  4LMV A;  1DE1 A;  1YVL A;  3TJG A;  5CRE A;  2QC7 A;  4F0C A;  3IBH A;  3UAP A;  1B9X C;  3DRN A;  1WP0 A;  4O92 A;  1YZX A;  5J40 A;  3UL3 A;  4IN0 A;  3RPN A;  4ZB7 A;  2YN1 A;  5ENU A;  2K6V A;  1EV9 A;  3IR4 A;  4G01 A;  1SKW B;  4N30 A;  1YKC A;  3IAS 2;  1A24 A;  2RUF A;  1TP9 A;  4V2L A;  2VL3 A;  5B8B A;  2R4V A;  5JWO B;  5F06 A;  5D93 A;  1BYE A;  3BCI A;  1OE8 A;  4KE3 A;  1TOF A;  2DJ1 A;  1HNC A;  2XBQ A;  3FKF A;  5IOX A;  1N2A A;  3IK9 A;  2H1D A;  1SD8 A;  2VLT A;  3GL5 A;  4N0Z A;  1F2E A;  2WZS A;  2I1U A;  3ZZX A;  2RM5 A;  1KEB A;  3M9K A;  3KP9 A;  5FWG A;  4LL1 B;  2VD1 A;  2F8A A;  5D96 A;  6GSX A;  3TKQ A;  2H0I A;  1YDK A;  4IJ3 A;  3GTU A;  4CY6 A;  3CMI A;  4EVM A;  4WBJ A;  3ZTL A;  4PNG A;  4OFN A;  4Q5N A;  1GLQ A;  2LS5 A;  3G7Y A;  4I97 A;  3IHG A;  1EGO A;  1ERW A;  2K18 A;  5CO3 A;  5BMU A;  1PL1 A;  1TKD B;  5A34 A;  3IE3 A;  4GTU A;  1DSB A;  4Z2R A;  2YZU A;  2YV7 A;  14GS A;  2GZP A;  4TR0 A;  2B6M A;  1FVJ A;  4BVX A;  2PUK C;  3A2V A;  4JBB A;  5JCG A;  4QQ7 A;  1EGR A;  4IP6 A;  4NMU A;  2HRF A;  2JAC A;  2GS3 A;  4Q5Q A;  1BAY A;  1EP8 A;  5H5Q A;  1NHY A;  5F05 A;  1TJD A;  1K0O A;  4W66 A;  3W8S A;  4EIQ A;  1V2A A;  1SL2 B;  1ZCP A;  3TCO A;  4MNN A;  2HSN B;  1MTC A;  3RFR C;  2YJH A;  2QSI A;  3TU3 B;  3RHC A;  5GAN D;  2B7K A;  2PGT A;  1ON4 A;  2REM A;  5J9B A;  2HYX A;  4V1A p;  3J7Y k;  2VLV A;  4PX1 A;  2GSR A;  4BL7 A;  3HD5 A;  1T00 A;  4MK3 A;  3ERF A;  2GGT A;  1EZK A;  3DGQ A;  4L5O A;  4GDF A;  1JFU A;  4F0B A;  1USB A;  2HLS A;  3G7J A;  2DKH A;  3WGD A;  1MD4 A;  1HNB A;  2YNX A;  2CZ2 A;  2B1L A;  2B7J A;  5D9W A;  4OWY A;  2WJU A;  3C8E A;  1K0N A;  2H70 A;  5IMZ A;  4POL A;  3IHQ A;  4OD7 A;  1YEP A;  1R26 A;  4OFT A;  2LJR A;  2P0G A;  6GSV A;  4JED A;  2YWI A;  3NOF A;  2LV3 A;  2PVO C;  2FHE A;  1N25 A;  2RUE A;  5C04 A;  4HU9 A;  5J5N A;  4L5L A;  2TRX A;  5EL8 A; 
#chains in the Genus database with same CATH homology
 2N5B A;  3H79 A;  1A2J A;  3DVW A;  3I6A A;  2FWH A;  3I69 A;  2AJQ B;  3MNG A;  2O87 A;  1EOG A;  5JCU A;  4K1F A;  3QOU A;  4V2N A;  3M0F A;  5EY6 A;  4GF0 A;  2RLI A;  2KP2 A;  2V41 A;  2ZCT A;  4FYB A;  2GST A;  1S3D A;  4RQX A;  1PX6 A;  4ZBB A;  2NPB A;  2L6C A;  3ZL5 A;  4MJB A;  4KX4 A;  5DVB A;  4G0I A;  2DLX A;  3TB2 A;  1OYJ A;  8GSS A;  1V58 A;  3MIX A;  4Q5F A;  3ERG A;  1GSE A;  1JLV A;  6GSU A;  2N5A A;  2V6K A;  17GS A;  1V9W A;  3TRQ A;  1W4V A;  4EO3 A;  1QUW A;  1THO A;  2PPT A;  2MZC A;  4KSO A;  2C0D A;  4HU7 A;  1PA3 A;  3PH9 A;  2H1L A;  3UEM A;  4PQH A;  3ZVJ A;  5A5K A;  1QGV A;  3ZFB A;  2A4H A;  3LSZ A;  2LJK A;  2LRN A;  3ERW A;  3FZA A;  4OMV A;  1M9A A;  2HRK A;  3QDN A;  4F82 A;  2KUC A;  4K6X A;  3TJK A;  2J23 A;  5HFI A;  2BTO T;  2IL3 A;  1JZW A;  4ZXG A;  5DJL A;  2OAC A;  3IA1 A;  3MAK A;  4F03 A;  3L4N A;  4EIP A;  5CP1 A;  5B7C A;  2QKE A;  1YEX A;  4ECB A;  3FHK A;  1OAZ A;  2PBJ A;  4ICY A;  4N11 A;  2X4A A;  3H1N A;  2E0Q A;  3GMF A;  2EFE A;  5ECL B;  1F3A A;  4G2E A;  4OFM A;  1H75 A;  5AN1 A;  1EOH A;  1B48 A;  2OA7 A;  1XWA A;  4HOJ A;  3R2Q A;  2H8L A;  2TIR A;  2B5Y A;  2DJJ A;  4MJE A;  2VCT A;  4ML6 A;  4ZL8 A;  2UV8 G;  4ILF A;  2A2R A;  4O5Q A;  1XCC A;  4GQC A;  4BWQ A;  1M9B A;  6GSS A;  2JSZ A;  2XBI A;  4QL7 A;  4K8M A;  5D9T A;  2DJ3 A;  4PTS A;  4AF2 A;  4PQI A;  1TRS A;  1XOA A;  3CYN A;  4POK A;  4RI6 A;  3SWL A;  2HRN A;  1PD2 1;  2VIM A;  5J4V A;  2V32 A;  2IMI A;  3LEF A;  2XPD A;  3KTL A;  4XS4 B;  3HZ4 A;  3TGZ A;  1GUH A;  4BVY A;  1G6Y A;  2DBC A;  2VCV A;  1TU8 A;  5J4U A;  3VWW A;  4IJI A;  5ELA A;  1K0B A;  2JSY A;  2YAN A;  1K0D A;  1GTU A;  2WFC A;  1PN0 A;  1SJI A;  1J0F A;  2RII A;  3FEU A;  4JZQ A;  3EPT A;  1AIU A;  3HHV A;  2DJ2 A;  1XIY A;  20GS A;  1FW1 A;  4NXI A;  2VOC A;  1XPV A;  2CAI A;  5LNK e;  3HCZ A;  1U88 A;  4HDE A;  2PMT A;  1RK4 A;  3UIW A;  3VPQ A;  4IHU A;  3H8Q A;  2LKU A;  2FA8 A;  3FR3 A;  4NHZ A;  4V1A g;  4AJ6 A;  5JWR B;  1GTB A;  1G7E A;  2JAD A;  2DIZ A;  2DMM A;  5A1N B;  5JCW A;  3WT2 A;  3ZIV A;  2H6Y A;  5ID2 B;  4J2F A;  2AV4 A;  1TK0 B;  1ST9 A;  5F07 A;  1V40 A;  1TRW A;  4CDO A;  3HVS A;  2ZUP A;  2O7K A;  1CQH A;  1XOB A;  2IFQ B;  3MYD A;  2K8V A;  3WGE A;  2HSN A;  1S3C A;  2F3M A;  2V2G A;  1XW5 A;  2OE1 A;  1AAZ A;  5AIS A;  3ZYW A;  4XHM A;  4EDZ A;  1Q4J A;  3UBK A;  2FGX A;  1OC9 B;  1A0R P;  1YY7 A;  3PGT A;  2ES7 A;  4MH3 A;  2NVL A;  5A4V A;  3C7M A;  1TU7 A;  2ON5 A;  3F4S A;  3MDK A;  2IME A;  1F6M C;  1F37 A;  3FZ4 A;  1KNG A;  1Z5Y E;  3O3T A;  2HT9 A;  4YQU A;  4MF5 A;  5IQY A;  2LQQ A;  3GH6 A;  1A23 A;  5B8A A;  3D21 A;  3HDC A;  2OE3 A;  2C8U A;  2YP6 A;  1F3B A;  4TR1 A;  2CQ9 A;  5HQP A;  2OJL A;  2D2Z A;  2ZNM A;  3APQ A;  3QCP A;  2GQL A;  4JE1 A;  2ALB A;  1Z7R A;  4Z2U A;  4YAV A;  2IIY A;  2CVB A;  2P5R A;  4MZB A;  5JWQ B;  4AKI A;  3KJY A;  3L78 A;  4K5R A;  5IPG A;  5J3R A;  3F6D A;  3HJO A;  1R5A A;  2OE0 A;  3OR5 A;  3FR6 A;  4WF4 A;  3A5I A;  3FMW A;  4ID0 A;  5ECR B;  3M9J A;  3FRC A;  3RHB A;  1HQO A;  2PVQ A;  1LBK A;  5G5E A;  1X5E A;  2M80 A;  3LYP A;  2IJY A;  4MAB A;  3F4T A;  3QAW A;  3HMJ G;  1BX9 A;  2H0H A;  3P8W A;  1OE7 A;  4PUR A;  1Y25 A;  2VUP A;  1E2Y A;  3DD3 A;  2O5V A;  1Z7P A;  1MDI A;  4XRD A;  1X9M B;  1OC8 A;  3BCK A;  4YKG A;  3DXB A;  3GX0 A;  4IQA A;  1QMV A;  1SK0 A;  3EC3 A;  1PGT A;  4YQV A;  2LRT A;  3ZVJ D;  3DIE A;  1X9S B;  1OKT A;  4IKH A;  3RAZ A;  4KF9 A;  2R5G A;  1O81 A;  3GKX A;  3D4T A;  3VPT A;  2EIO A;  3LXZ A;  1A2L A;  5DAK B;  1URM A;  2H19 A;  1B4Q A;  1AXD A;  5HR3 A;  1UVZ A;  3BJ5 A;  4N3Z A;  2MBT A;  1SVL A;  3F8U A;  4IBP A;  1V57 A;  1ERV A;  3KCM A;  1O6J A;  4K7N A;  4ML1 A;  3I43 A;  2XPE A;  5ECP B;  1B8X A;  5HR1 A;  2H1A A;  1T3B A;  3UOM A;  4GRF A;  3FY7 A;  2X8C A;  3PPU A;  4E8E A;  5KN0 A;  4WEY A;  4J57 E;  4ZB8 A;  5ECI B;  4FYC A;  1X5C A;  1GRX A;  2L4Q A;  5L71 A;  1XVQ A;  1LU4 A;  3C73 A;  2MMO A;  1GSU A;  1RW1 A;  5DCG A;  2TRC P;  1K3L A;  4DVC A;  4IGJ A;  2JZR A;  1NHO A;  2HSH A;  4PNF A;  3UMA A;  3PIN A;  2H72 A;  2GSS A;  2MMZ A;  2YWN A;  3RPP A;  1GH2 A;  3M1G A;  5J47 A;  1NM3 A;  3HJM A;  3PR8 A;  4MF6 A;  2QA1 A;  2LTK A;  4ULX A;  4J56 E;  1BJX A;  2I3Y A;  2IPA A;  4KND A;  3E3E A;  2L57 A;  2H71 A;  11GS A;  4P3Y B;  4WET A;  3O6T A;  5HFG A;  5A5H B;  19GS A;  4MJC A;  3TOU A;  10GS A;  4QMK A;  2FUG 2;  1R4W A;  3GFK A;  2NBS A;  1ERT A;  3LYK A;  1U6T A;  3RBT A;  2X99 A;  4L0W A;  3ED3 A;  4ZB6 A;  2R0C A;  4HS1 A;  2LUS A;  3CSH A;  2EFC A;  2VD0 A;  3Q18 A;  4FQU A;  5HR0 A;  4K2X A;  2A2P A;  4ZL9 A;  2JZT A;  2GQM A;  1SU9 A;  5J9C A;  1HYU A;  2CAQ A;  4HZ2 A;  1MEK A;  12GS A;  4ECI A;  5AGY A;  2HZE B;  1FOV A;  3GIX A;  1Z6M A;  2WGR A;  4TXO B;  2E2M A;  1OVN A;  1AUC A;  3W6G A;  4Z7X A;  1PKW A;  3GX8 A;  2C0G A;  3FR9 A;  1A2M A;  1QK8 A;  3G9B A;  5LCZ A;  4PUA A;  4NHW A;  2AYT A;  4HJ2 A;  4YKF A;  5COH A;  1K0C A;  1AC1 A;  5BRT A;  2FLS A;  4HEA 2;  4NV2 A;  4GSN A;  3HY2 A;  3EYT A;  3P7X A;  2YJ7 A;  2HRA A;  18GS A;  5HR2 A;  1PKZ A;  3D5J A;  3LJR A;  2I81 A;  1E6B A;  4MF7 A;  1XWK A;  5D8I A;  2OBK A;  5D9X A;  1AW9 A;  6GST A;  4HI7 A;  4BA7 A;  5GSS A;  3GKM A;  5G31 A;  1GSF A;  3R3E A;  2B3S A;  1JZR A;  3QMX A;  2XC2 A;  2F9S A;  2GVP A;  2GT5 A;  1GWC A;  5A1N A;  3TJJ A;  5ID2 A;  3UVT A;  2P5Q A;  1SK2 A;  3G7I A;  4IP1 A;  2HE3 A;  1EV4 A;  4HUA A;  5CYY A;  2VM2 A;  1T4Y A;  3DKS A;  2G0F A;  3VWU A;  9GSS A;  4I2U A;  2X64 A;  2PN8 A;  1SL1 B;  6GSW A;  2EC4 A;  2EFD A;  1TXX A;  3CRT A;  1OC9 A;  2YOI A;  2V1M A;  4MPF A;  2H74 A;  1GUK A;  4E68 A;  4JR4 A;  5IIZ A;  4YH2 A;  4YAP A;  1UA5 A;  4TRX A;  1O8W A;  4I8B A;  5DQS A;  2PU9 C;  2X8G A;  1SKS B;  4X0X A;  3TKR A;  3D0Z A;  3NIV A;  3HA9 A;  1ZOF A;  4X1U A;  5EVO A;  4DSQ A;  1JLW A;  1EWX A;  4KSM A;  3ZMK A;  2CV4 A;  3GST A;  1IYI A;  3F0I A;  5CAX A;  1X0R A;  3ME7 A;  1K3Y A;  3SBC A;  3F4R A;  5CNW A;  3DVX A;  3HZ8 A;  3CTF A;  3ME8 A;  2KP1 A;  5IOW A;  4ZL7 A;  3L9V A;  4KB3 A;  4ZB9 A;  4KDU A;  1M7T A;  2MMN A;  2EFH A;  1U87 A;  3I9V 2;  2CA8 A;  4AKG A;  5FT3 A;  2H76 A;  1TK8 B;  1SYX A;  5DAL B;  2HSM B;  5A4U A;  2YWM A;  2L59 A;  2OT3 A;  5KOX A;  4G0K A;  1T8E B;  4KUN A;  3GYK A;  1A0F A;  3VI5 A;  5G2Z A;  1T4Z A;  3TOT A;  4KCE A;  4BL7 B;  2VKZ G;  2F51 A;  3UJ1 A;  1V98 A;  1Y6E A;  2CVK A;  3ZRE A;  3GN3 A;  2I4A A;  4CW9 A;  2P31 A;  1SEN A;  3AY8 A;  5DCH A;  1Z3E A;  5GAP D;  1GNE A;  4K0N A;  3Q6O A;  3KMN A;  5DAK A;  3HYP A;  1U3I A;  4MZW A;  5H5R A;  1O8X A;  3LG6 A;  1EEM A;  4ECJ A;  1XWG A;  7GSS A;  3IOS A;  3KGK A;  5IMC A;  2R2J A;  1BQ7 A;  1FB6 A;  2J9H A;  4AI6 A;  1ACV A;  3EMP A;  4LMW A;  5CRG A;  2R3X A;  2L4C A;  3BBY A;  4O5U A;  4GXZ A;  3Q19 A;  2IMD A;  1Z9H A;  1F9M A;  2IN3 A;  3BOA A;  4LA1 A;  4TR4 A;  2LRC A;  5CRH A;  2H1G A;  2R6K A;  3GRX A;  4POB A;  4XTS A;  5ELG A;  5B6N A;  2C0F A;  1X9W B;  1U3A A;  1K0M A;  1XXU A;  2I9H A;  3O76 A;  1YJ6 A;  2H01 A;  2DKI A;  3VWX A;  4EKZ A;  3F6F A;  5GZZ B;  1FG4 A;  2EIR A;  2L5O A;  4TN8 A;  3VWV A;  3IK7 A;  3VLN A;  4QL9 A;  1FB0 A;  4XIH A;  5KEJ A;  4HJM A;  2CZ3 A;  1HD2 A;  4G19 A;  1GSS A;  3UBL A;  16GS A;  3ZIJ A;  1IYH A;  3KXO A;  3GV1 A;  4TKY A;  5J4Y A;  1GUM A;  2GSQ A;  1GSY A;  4OO5 A;  3F9U A;  5G5F A;  4AKX B;  2MMA A;  2M72 A;  1B4P A;  2DJK A;  1T7P B;  4KDY A;  3KM6 A;  1M2B A;  4EL1 A;  4BPY A;  2MBS A;  3FK8 A;  3HXS A;  1CQG A;  5DQY A;  2OBI A;  1XZO A;  3L0H A;  2VCQ A;  3E9J B;  4O32 A;  4AKH A;  4PGT A;  2K9F A;  1K3O A;  1M2A A;  4IS0 A;  2VO4 A;  2IWT A;  1I5G A;  2HZE A;  2IMF A;  5F8B A;  4TXO A;  4EF0 A;  4F2I A;  1WOU A;  3US3 A;  2GT6 A;  3DEX A;  1WRY A;  2Z9S A;  1PN9 A;  1YF0 A;  1K0A A;  1YKA A;  1N8J A;  4IW9 A;  3H93 A;  4WR4 A;  4WR5 A;  2R0G A;  4USS A;  1G7O A;  1BED A;  1SYR A;  3C1S A;  2WDU A;  2FWF A;  2CX4 A;  3CXG A;  4XS6 A;  1ZYN A;  2E7P A;  5E4W A;  5IMD A;  1XFL A;  1ZYE A;  4K2D A;  1OC3 A;  2G2Q A;  2H73 A;  4GQF A;  5ECK B;  1GSD A;  2HZF A;  3V1W A;  3A3T A;  1DUG A;  1LJR A;  3QD9 A;  2DIY A;  5ECN B;  3KMO A;  2VCX A;  5KOW A;  1FAA A;  4HQS A;  2C3Q A;  2WCI A;  1FHE A;  3TRP A;  3KIJ A;  2X8H A;  1O73 A;  3J7Y b;  1XWC A;  4RUV A;  3CRU A;  4XRA A;  2QGV A;  1ML6 A;  4PQ1 A;  5H5S A;  1ZMA A;  1BG5 A;  4MCU A;  3APS A;  1C72 A;  3GUR A;  4KAE A;  4Z2T A;  4K0G A;  1TDI A;  1SK1 A;  3GA4 A;  4DSS B;  3LXT A;  2CT6 A;  4JR6 A;  4G10 A;  2R0P A;  1FOH A;  4GST A;  2O85 A;  4BVY B;  4Q5R A;  1ERU A;  1VF3 A;  2H0G A;  1DE2 A;  3FZ9 A;  3VI7 A;  3VK9 A;  4KDX A;  3CSJ A;  2H66 A;  3D6I A;  3FW2 A;  3EE2 A;  1OKD A;  4LLR A;  3KH7 A;  1GLP A;  3KEB A;  4PUF C;  4I5Q A;  5G1K A;  3QFB C;  4CHS A;  2AUV A;  3MSZ A;  1AQW A;  1SJZ A;  3GUS A;  2LST A;  4X4J A;  2VL2 C;  1WE0 A;  3DWV A;  3WD6 A;  2L6D A;  1GP1 A;  3ZRD A;  2H75 A;  4HZ4 A;  4K9Z A;  1XBS A;  4D73 B;  4RI7 A;  1FVK A;  5DDL A;  4KA0 A;  5C00 A;  2DJ0 A;  1GNW A;  4YQM A;  3ZFL A;  3Q74 A;  3APO A;  3QPM A;  5ECH B;  4EDY A;  5IPH A;  4XS1 A;  3F3R A;  1KBN A;  1R5P A;  5G1L A;  2UZ8 A;  1UN2 A;  4NPB A;  1O85 A;  3KP8 A;  1GSQ A;  3DYR A;  2IMK A;  2HSM A;  5DAL A;  1EP7 A;  5B6M A;  4JU5 A;  2BJX A;  5IO2 A;  2A4V A;  1KTE A;  3EWL A;  4I6X A;  3GH9 A;  2OAD A;  1VRS D;  2MYG A;  4N10 A;  5DJM A;  1PSQ A;  5ABR A;  2A2S A;  1HNA A;  4MH2 A;  3ISO A;  3TJB A;  2FY6 A;  2KOK A;  2VL2 A;  3ZML A;  3WT1 A;  3A2W A;  4XS4 A;  3CBU A;  4H86 A;  3NZN A;  1PRX A;  4TR3 A;  3LWA A;  4N0V A;  2VCZ A;  3H4K A;  1TK5 B;  3D22 A;  5IO0 A;  2VAF A;  4TR1 B;  2JL4 A;  4O5R A;  2FCH A;  2M46 A;  2KHP A;  1WMJ A;  2LEG A;  4ZBD A;  2L5L A;  1M2D A;  2WB9 A;  4TXV A;  2HXK A;  2YV9 A;  3LOR A;  4TVE A;  4FYU A;  2GZY A;  22GS A;  2YZH A;  1A8L A;  2GDR A;  1WPI A;  2VL9 A;  3N5O A;  1ZYP A;  4GSS A;  2AB6 A;  1PL2 A;  2DC5 A;  2EIQ A;  1YQ1 A;  3HVV A;  2VLU A;  1JZD A;  4ZIL A;  4CY8 A;  2WUL A;  2FD3 A;  3FZ5 A;  2C3T A;  2LNT A;  2HFD A;  1PQN A;  2B5X A;  4OO4 A;  1B9Y C;  1ABA A;  3L9S A;  3TKS C;  3EIN A;  4A5P A;  5IMV A;  3L9U A;  2N5F A;  3RDW A;  3TUE A;  5LD0 A;  3W8J A;  4L0U A;  5CRW A;  3HKR A;  1UC7 A;  3HJP A;  2IFQ A;  4HQZ A;  2HSY A;  2BMX A;  2C3N A;  5A4W A;  4E8H A;  3GL3 A;  4OCE A;  3TKS E;  2R37 A;  1WWJ A;  3EMX A;  4ECC A;  4DEJ A;  2LQO A;  3GSS A;  4GCI A;  5AIX A;  4GLT A;  1QXH A;  3KZQ A;  4MJA A;  5J41 A;  4KCA A;  1T1V A;  4IEL A;  5AIV A;  1R7H A;  3EUR A;  3IV4 A;  3IRA A;  2B5E A;  3P2A A;  3GTU B;  5EPF A;  2H6X A;  5ECO B;  2NTO A;  3C71 A;  2H6Z A;  3LW9 A;  3D4M A;  3P90 A;  4K5S A;  3IDV A;  1TXU A;  5IMF A;  4PXO A;  1XWB A;  2FWG A;  2DML A;  3MWH A;  3WYW A;  1MDJ A;  1O7U A;  5BMU B;  1J9B A;  3TKS A;  4XCS A;  4MMM A;  5A34 B;  2LJA A;  3TJF A;  5INY A;  2F8F A;  4F9Z A;  5GST A;  1A8Y A;  4BWS A;  1GL8 A;  3ZIT A;  1G6W A;  4MDC A;  1VF2 A;  1NSW A;  5FHI A;  4BVX B;  3U6V A;  3IC4 A;  2DSA A;  4WXT A;  3EU3 A;  4EUY A;  1ZGN A;  2ON7 A;  1QQ2 A;  1I9D A;  5IMA A;  4V2M A;  2KLX A;  3EVI A;  3QFA C;  1VGL A;  1SKR B;  5DBQ A;  4EC0 A;  3C1R A;  2WRT A;  4ISD A;  2C0E A;  3LQ7 A;  1SJ6 A;  3A2X A;  1AQV A;  1G0T A;  4AJ7 A;  5KN2 A;  2AHE A;  5ECQ B;  4G9H A;  2NDO A;  2CX3 A;  1W89 A;  3E0U A;  1Y1U A;  2YCD A;  4EXJ A;  3IPZ A;  1EEJ A;  1TW9 A;  3ZLP A;  1TI3 A;  3GKN A;  3S9F A;  2GQK A;  2HQT A;  3HVX A;  2K8S A;  2H30 A;  2CVD A;  1MDK A;  4L8E A;  2C1Y A;  3GNJ A;  5D9V A;  2HI7 A;  4MLY A;  4POM A;  1ILO A;  5KN3 A;  1SL0 B;  3WGX A;  3KH9 A;  3EU4 A;  3TDG A;  1J08 A;  1BG1 A;  2VCW A;  1XVW A;  1PX7 A;  4IVF A;  2C4J A;  3UAR A;  4K7I A;  4KW6 A;  2FNO A;  4DSS A;  2LNS A;  4AGS A;  2RM6 A;  3KD0 A;  2YPM A;  13GS A;  3IC8 A;  4KGI A;  1XW9 A;  3TKP A;  2AAW A;  1WIK A;  3IAM 2;  4ZBA A;  4EE0 A;  4KH7 A;  4LL4 B;  2GLR A;  2GTU A;  2JU5 A;  4X43 A;  2O89 A;  4WBR D;  3QAG A;  4RQR A;  5G30 A;  1JHB A;  2GZZ A;  1SD9 A;  4NWY A;  3BD2 A;  4MZC A;  4WF5 A;  4OCF A;  5D73 A;  1TRV A;  4NAX A;  6GSY A;  3DML A;  2OKA A;  4O7H A;  1THX A;  4MP4 A;  1DBY A;  4TW5 A;  4I2T A;  2V6O A;  1GUL A;  2E2G A;  1PMT A;  1YF1 A;  2YWO A;  1VF1 A;  3GHA A;  3KTB A;  1ZL9 A;  2FA4 A;  2O8V B;  4MA9 A;  4ZIJ A;  3N9J A;  1M0U A;  1M99 A;  1RQM A;  4ACS A;  1Q98 A;  2PER A;  2QA2 A;  5ECM B;  4D73 A;  1S3A A;  5KN1 A;  1SVM A;  4AJ8 A;  3CSI A;  3IXR A;  4MPG A;  1QFN A;  2WZ9 A;  5A5H A;  2B1K A;  3QR6 A;  5E59 A;  5CRD A;  4JRR A;  4FO5 A;  4DSR A;  5IM9 A;  2PWJ A;  4NV5 A;  5ECS A;  3QAV A;  2FWE A;  4TOP A;  3TRX A;  3LFL A;  1GTA A;  1XW6 A;  5HFK A;  3A5W A;  2XHF A;  3CTG A;  3LGC A;  2C80 A;  2X49 A;  3VFI A;  1NW2 A;  1SVO A;  4K7O A;  1ZZY A;  1Z6N A;  3M8N A;  2H1B A;  2JZS A;  1AQX A;  3VUR A;  1FO5 A;  1WJK A;  3UVH A;  3FYG A;  2VM1 A;  1H4O A;  1TTZ A;  3F63 A;  2HRK B;  4FH8 A;  4IQ1 A;  1JZO A;  4G0L A;  4WKW A;  1BF5 A;  1MD3 A;  3CWG A;  1ZYQ B;  2HNL A;  3GKK A;  4FIW A;  3F3Q A;  2WS2 A;  1X5D A;  1VF4 A;  3K8N A;  4GWR A;  1TI1 A;  3M3M A;  1GTI A;  5F0G A;  3JCM L;  3U5R E;  1TRU A;  4LMV A;  1DE1 A;  1YVL A;  3TJG A;  5CRE A;  2QC7 A;  4F0C A;  3IBH A;  3UAP A;  1B9X C;  3DRN A;  1WP0 A;  4O92 A;  1YZX A;  5J40 A;  3UL3 A;  4IN0 A;  3RPN A;  4ZB7 A;  2YN1 A;  5ENU A;  2K6V A;  1EV9 A;  3IR4 A;  4G01 A;  1SKW B;  4N30 A;  1YKC A;  3IAS 2;  1A24 A;  2RUF A;  1TP9 A;  4V2L A;  2VL3 A;  5B8B A;  2R4V A;  5JWO B;  5F06 A;  5D93 A;  1BYE A;  3BCI A;  1OE8 A;  4KE3 A;  1TOF A;  2DJ1 A;  1HNC A;  2XBQ A;  3FKF A;  5IOX A;  1N2A A;  3IK9 A;  2H1D A;  1SD8 A;  2VLT A;  3GL5 A;  4N0Z A;  1F2E A;  2I1U A;  3ZZX A;  2RM5 A;  1KEB A;  3M9K A;  3KP9 A;  5FWG A;  4LL1 B;  2VD1 A;  2F8A A;  5D96 A;  6GSX A;  3TKQ A;  2H0I A;  1YDK A;  4IJ3 A;  3GTU A;  4CY6 A;  3CMI A;  4EVM A;  4WBJ A;  3ZTL A;  4PNG A;  4OFN A;  4Q5N A;  1GLQ A;  2LS5 A;  3G7Y A;  4I97 A;  3IHG A;  1EGO A;  1ERW A;  2K18 A;  5CO3 A;  5BMU A;  1PL1 A;  1TKD B;  5A34 A;  3IE3 A;  4GTU A;  1DSB A;  4Z2R A;  2YZU A;  2YV7 A;  14GS A;  2GZP A;  4TR0 A;  2B6M A;  1FVJ A;  4BVX A;  2PUK C;  3A2V A;  4JBB A;  5JCG A;  4QQ7 A;  1EGR A;  4IP6 A;  4NMU A;  2HRF A;  2JAC A;  2GS3 A;  4Q5Q A;  1BAY A;  1EP8 A;  5H5Q A;  1NHY A;  5F05 A;  1TJD A;  1K0O A;  4W66 A;  3W8S A;  4EIQ A;  1V2A A;  1SL2 B;  1ZCP A;  3TCO A;  4MNN A;  2HSN B;  1MTC A;  2YJH A;  2QSI A;  3TU3 B;  3RHC A;  5GAN D;  2B7K A;  2PGT A;  1ON4 A;  2REM A;  5J9B A;  2HYX A;  4V1A p;  3J7Y k;  2VLV A;  4PX1 A;  2GSR A;  4BL7 A;  3HD5 A;  1T00 A;  4MK3 A;  3ERF A;  2GGT A;  1EZK A;  3DGQ A;  4L5O A;  4GDF A;  1JFU A;  4F0B A;  1USB A;  2HLS A;  3G7J A;  2DKH A;  3WGD A;  1MD4 A;  1HNB A;  2YNX A;  2CZ2 A;  2B1L A;  2B7J A;  5D9W A;  4OWY A;  2WJU A;  3C8E A;  1K0N A;  2H70 A;  5IMZ A;  4POL A;  3IHQ A;  4OD7 A;  1YEP A;  1R26 A;  4OFT A;  2LJR A;  2P0G A;  6GSV A;  4JED A;  2YWI A;  3NOF A;  2LV3 A;  2PVO C;  2FHE A;  1N25 A;  2RUE A;  5C04 A;  4HU9 A;  5J5N A;  4L5L A;  2TRX A;  5EL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...