2R5MA

Crystal structure of the two mbt repeats from sex-comb on midleg (scm) in complex with peptide r-(me)k-s
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
b'AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPGHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycomb protein Scm
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5mA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5mA01
2RHYA 4A4EA 3OS0A 3LGFA 3C4SA 3L42A 3EAEA 4PLIA 3OYBA 5CIUA 1WJSA 4QQ6A 5FRMA 2LVMA 3PMIA 2O4XA 4A4HA 3OYCA 4BDZA 1H3ZA 2LTOA 4BACA 2EFIA 4Z02A 4II1A 2CKKA 2R57A 4E7HA 3ASKA 5KE2A 4E7LA 2L8DA 4FU6A 4UC4A 1G5VA 2DIQA 3LX7A 3E9GA 1MHNA 2K3XA 4N4HA 3OYDA 4BDYA 2B8AA 2RJDA 5IAYA 3OA6A 3GOXA 3S3OA 3E9FA 4C5HA 3NTKA 3OS2A 2JTFA 4IKFA 3S6WA 3DB3A 2QQSA 1WJRA 3UWNA 4QW2A 3OYNA 3PFSA 3FLGA 3PMTA 3OS1A 3LYIA 4GY5A 2WACA 1SSFA 4Q5WA 3L2UA 4IURA 4C5EA 3NTHA 3OYFA 3FEOA 2R5MA 3QBYA 5D6YA 4L59A 2BKDN 3OYMA 5KE3A 2YRVA 3OMGA 2DAQA 2M16A 3NTIA 4N4IA 5D6XA 1OI1A 3QIIA 4X34A 2RHUA 3L2VA 2MWPA 3MEVA 3OMCA 2E6NA 3KUFA 3SD4A 2E5QA 4FL6A 5FROA 2GFUA 4A4GA 2RHIA 4BE1A 4BE0A 1OZ2A 3OYHA 3FC3A 4BE2A 4IUTA 1RI0A 4C5IA 5J39A 1XNIA 3PNWC 4B9WA 2P0KA 3LH0A 3L2QA 2M0OA 3UT1A 3ME9A 3H6ZA 5D6WA 4B9XA 4EDUA 4RG2A 4N4GA 3MEUA 4E7IA 4E7JA 2X4WA 2RHXA 2XK0A 2RI3A 2EQMA 2X35A 2JZ2A 3OYJA 3L2RA 2RO0A 4IUVA 3MEWA 3Q1JA 3DB4A 2R58A 4QQGA 4ZTJA 2PQWA 1WGSA 4E7KA 1N27A 2D9TA 3F70A 4IUPA 2DIGA 2IG0A 2F5KA 5J26A 3P8HA 4PLLA 2GFAA 2RI2A 2FHDA 2HQXA 2LRQA 3MP6A 3LLRA 2HQEA 2BIVA 4IUQA 3S3NA 2X4XA 1OYXA 2BUDA 3CEYA 4IUUA 3META 4NS5A 2K3YA 2RHZA 3LGLA 3MO8A 4A4FA 2LCCA 5M9OA 3OYIA 3DLMA 2RJEA 2LDMA 3M9QA 2EKOA 5C6SA 4C5GA 3OYGA 5FRNA 3BDLA 2G3RA 4PL6A 5IN1A 1KHCA 2RJFA 4LD6A 2EQUA 3OYKA 3OB9A 3H8ZA 5KH6A 2QQRA 3QKJA 2M1HA 3OYLA 2NLUA 2X4YA 4OVAA 4BD3A 4QVZA 2R5AA 3MP1A 2L89A 2O4XB 5KCOA 3ZEHA 3MP8A 3OY9A 2XDPA 5KCHA 2L3RA 2RI5A 4QQDA 5C0MA 3L2WA 4CRIA 3OQ5A 2EQJA 2MWOA 3FDRA 3MEAA 3O8VA 2EQKA 3OYEA 3S3MA 1WJQA 1OZ3A 2RJCA 2VYTA 3OYAA 2GF7A 4HCZA 4ZTFA 3QJ6A 3P8DA
chains in the Genus database with same CATH superfamily
2JTEA 1RAGB 3OYYA 1G3YA 1QKWA 2EGCA 1G3WA 1OX9A 4HA8A 1GBQA 3CCJT 1QVGA 1QVFP 2DERA 2QAZA 3E9GA 3OYDA 4XU1A 2X3WD 2X4JA 4BDYA 2BZ8A 1NJIU 3CCLT 2VXFA 1VQ7Q 2QQSA 4M77E 2QA4T 4Q5WA 2R5MA 1IXDA 5KE3A 1WA7A 2CREA 1GCQA 4M7AA 3CMAA 5HKCA 3SD4A 2DX1A 3R6NA 1UE9A 2HDAA 3M53A 3CCUT 2DJZA 1N6AA 3HHTB 1YJWA 4AMCA 3ZL7C 2BTTA 5GAMe 1K73R 3CCRA 1S72A 4C92B 3MEUA 1ZUYA 1R8OB 3M4YA 1YITQ 1E6HA 2DF6A 1Q7YU 1NG2A 3TCJA 2D8JA 3A1PA 5IHIA 3F70A 4IUPA 3ZFJA 5J26A 2P4TA 1ABQA 3OW2A 3J81E 2CP0A 1AD5A 2Z0WA 4O6JA 2E65A 4PFPA 4XU0A 2MYSA 2DXBA 1QVFA 2EYYA 3THKA 4DBHA 2FZGB 1TG0A 4HVUA 3CCQQ 2KK4A 1O9SA 1PRLC 4LDYA 1KJWA 1Y71A 1UGVA 4M75B 5IXBA 2PNIA 4OMMA 4F7UF 2HQHA 2H8HA 3OQ5A 2MWOA 4PJNA 1H3HA 1NPPA 4O5VA 3RKYA 3OS0A 1V76A 3EAEA 4ZGEB 3X20B 3JV3A 3OYCA 2AHJB 1Q81C 4E7HA 1FYNA 5KE2A 4OB2B 2DTIA 2VVKA 4C8QA 1Q82U 3D7SB 5LL6S 1VIFA 5D7UA 3M56A 1YJ9Q 4GY5A 2A3LA 1SSFA 3NPFA 1VQNQ 2K6DA 3VRYA 3MCAB 1YHQA 1M1FA 2ECZA 2P0QA 4J7FA 1M5Q1 3SWNB 5GAOp 4PFZA 1M1KC 3A98A 2GNCA 4XQ3A 1RLQC 1SHGA 4C0DC 1GCPA 4M78G 2P0KA 4E7SA 3L2QA 4FYXB 2COWA 2GCXA 2X4WA 3EHRA 1KD1C 4CC7A 3JB9J 2JZ2A 4OGCA 3H0FA 3X24B 4ZNXA 4FYWB 2R58A 4MZTA 2V8IA 4QQGA 5CR2A 4JRIA 2CP2A 2ZGWA 2KRSA 4LDVA 2PU9B 1JXOA 3V7CA 1ZBJA 4M7AE 5GAOq 2LNHB 3META 1VQ4T 1VQOT 2RHZA 4M4ZA 3OYIA 2JW4A 2RJEA 4C8QB 4C5GA 3BDLA 1D0YA 4PL6A 1AZEA 2VKNA 1XJWB 2EKHA 2EQUA 3X25B 1VQLT 4OVAA 4RTXA 3HKSA 2DD4A 2K7AA 4PJOF 3JCMP 2OTLA 2CS7A 4NL2A 5GANd 2QEXT 2LQNA 1WQWA 2GF7A 1GFDA 4A4KA 1C0MA 4DA4A 3I55A 2C0IA 3RMQA 1WJSA 3OSSC 4E6RA 3JCMW 1K4US 2HMAA 1YBYA 2A08A 2EBPA 2D6FA 2OAWA 2OI3A 1AWWA 5IAYA 1ZBXA 1TU0B 4Z8AA 1KHIA 4IURA 4C5EA 1HJDA 2DTHA 2JT4A 5GJVB 1SF9A 1BB9A 3GPLA 1VYUA 5FU7C 4F14A 3PTAA 2LCLA 2RHUA 3KUFA 1WHJA 2E70A 2AZVA 3CC7Q 2VV5A 4Y91A 5CAIA 1QLYA 1XTDA 1RI9A 4DEXA 1Y96B 4N4GA 1T0JA 4JS4A 2KMTA 4E7IA 2XK0A 4QVDA 3L2RA 1Q81U 1K8AR 1UFFA 3RMSA 3CCSA 2PQWA 4E7KA 4J7IA 4WF2A 2DIGA 2C0OA 3QSUA 1OU8A 2RI2A 2LRQA 3I5SA 2X4XA 2BUDA 2QQAA 3CEYA 3CCRT 1UDLA 2QDLA 2J6KA 3OBWA 3E19A 1YIJQ 5I11A 1KFZA 2EKOA 1VQ5A 2EYWA 2NUPB 5KYWA 3CC4Q 4J6WA 4KBMB 2RJFA 3EH2A 1M1KU 2KY9A 2FPDA 1QW1A 4C0DB 3QDFA 4MZPA 4KGZB 2K5LA 5KYXA 2XDPA 3GP8A 3EGUA 4QQDA 1I1JA 1ZA2B 4F7UG 1KD1U 8ATCB 3LW5E 3P8DA 4PJJA 1YN8A 2CP7A 5DY9A 6AT1B 3SEMA 3MPUB 1CKBA 2JMCA 2IPOB 5A2QE 2B86A 4BDZA 2PVGB 3HRUA 2E64A 4XTWA 4Z89A 5LJ5h 1M3CA 5GMKm 4N4HA 2DO3A 4AFQC 3S3OA 2QGGA 3VUZA 1QVFS 3VV0A 2EJFA 4IKFA 4C0FA 4R0KA 2KXDA 1C6VX 2KYBA 1KC8C 3X28B 2LJ3A 5GMKl 1RLPC 1PWTA 3A8HB 1EFNA 1M90R 3BY7A 1I4K1 4M77C 5KYWB 2E6NA 4FL6A 1N9RA 2GFUA 2PTKA 3CPFA 3ER0A 1QKXA 2KNBB 2WSEE 3JB9H 3A8LB 4B9WA 2CH4W 3TREA 3G7ZA 1X6OA 4EDUA 1BI3A 2FEIA 1VQ7A 3VS3A 1CKAA 2CDTA 4ZGDB 3DB4A 2D1XA 2D9TA 4C92D 1IGUA 1N9SA 4J9DA 1AVZC 3RIRA 1M27C 1VQ8T 2WSFE 1RACB 3AT1B 1TXQA 3P8BB 2DL7A 2FL7A 1QCFA 1VQ6T 5CKFA 2KGTA 2QDYB 2K5IA 2DM1A 1QWFA 4C92F 2KE9A 1H92A 1U06A 3REBB 4ZGJB 1YITA 4ZN1A 5GAMf 1RAFB 5DM7R 4F7UE 1MV3A 1UUEA 1JXMA 2L89A 4PJOG 1WLPB 5KCHA 2M02A 3M5AA 4E7ZA 4F16A 4M75D 1YWPA 2CH4A 3REAB 2HSPA 1MMDA 4FM4B 3SFMA 1WHHA 5CKHA 1NE8A 3I56Q 2DEQA 4A4HA 3JRZA 2HD0A 4RMOA 4M7DA 3RDVA 3CCQA 1VQ9A 1QP3A 2K3XA 1YJNQ 2EAYA 2HL5C 2F2XA 4M75F 3JCMf 2OTLT 2JTFA 1I8FA 3A8GB 3M54A 4D8KA 3OS1A 5GAN2 3CXCP 3CBOA 2HCKA 3I55T 2ZPHB 3I5RA 2EYQA 3EH1A 4RTTA 5HK3A 3CCMQ 3V7SA 1AWJA 2NUZA 3EFOB 4LXCA 2GTJA 1WX6A 3VYGA 3UA7A 5DLQE 4J9CA 1WXUA 5KYUB 2KDSA 3V8JA 1GL5A 2RQVA 4ME7A 4J9FA 1I5LA 1OPKA 1YJ9A 1VYTA 1VQNA 3CMEQ 2Y4YA 2VXEA 4A54A 3WXMB 1KC8U 3CD6Q 2AKKA 2OAUA 3MJXA 4JPBW 2KI7A 2H3JA 2ZPFB 2CP3A 4F04B 4M77B 1GCQC 2EVRA 3G4SA 4M7AC 1JBMA 2LJ1A 5GAOm 2QG9B 3EG9B 4AFUC 3C0CA 4C8QD 1HK9A 3M0QA 4PJOE 3M59A 3BFMA 2NLUA 2QTXA 5GAOl 3H0IA 1W6XA 5HK0A 1UGQB 1ZUKA 2DZCA 1RL2A 2X51A 3V8LA 2EQKA 4QT7A 1D3BA 2JM8A 1UHCA 1YI2T 2GTOA 1VQ5T 1GFCA 2OTJA 2KYMA 4KUIA 2XICA 3QDRB 3OYBA 4HVWA 2VGNA 5FRMA 2ENMA 1FWZA 4C8QF 1MUZA 1BK2A 3PE0A 4HVVA 1WHMA 5IHKA 3GBQA 1BBZA 2DPPB 2E5KA 1KK7A 3FLGA 2GGRA 2WACA 2DYIA 3QWYA 3JB9D 4XU3A 1K8AC 4J6YA 4D6WA 1ZQ1A 1OI1A 3RKWA 5LJ3h 2DTOA 2DBMA 4R56A 4M7DE 2MAMA 1YCYA 1TH7A 2QA4Q 3E2UA 2HAXA 3UT1A 2PUOB 2XDBA 3SB2A 1RABB 3H41A 4BI8B 5GANh 2KROA 2RQRA 3G1JA 4IUVA 3JCMb 5IXFA 3GLXA 2K57A 2IG0A 2Y4XA 1OEBA 3BDUA 4C8QC 5KYNA 4ESRA 1MMGA 1OYXA 2KR3A 2CZ1B 2DRKA 4FYVB 2LCCA 2DKGA 2V1QA 1FMKA 1VQ7T 2MMPA 5I2MA 3OYGA 1B34A 4C92G 1SKUB 3GNFB 2MOXA 4FW1A 5CCAA 2A36A 4N0AA 4ORZA 2R5AA 3UATA 1M4ZA 4JJCA 2KBTA 2LX9A 2DNUA 2ED0A 5I2SA 2XKOC 2L3RA 5HCKA 3G6EQ 3GNGA 3FJ5A 2DA9A 1AT1B 2XG8D 3M0RA 1UB4A 3EHQA 2CZ6B 3M0TA 4AT1B 4PLIA 4XTXA 3JCMe 1YIJA 4QQ6A 1YITT 2EW3A 4Z02A 1TUDA 3PT9A 4E7LA 1RAHB 2YLCA 2O01E 5GAN6 3VKIA 4M7AB 4M75G 2VB6A 3GOXA 2V8JA 3NTKA 3QZ5B 1WHGA 1OX8A 1V1CA 2FRWA 5GAMd 4M78A 1T0HA 2K79A 2L3PA 2YRVA 4NL3A 2OJ2A 4X34A 4EMKA 4PK4A 1VQ9T 2E5QA 2KRNA 4FSXA 4EPCA 2L0AA 3E1SA 3ME9A 2FRYA 3HSBA 4XU2A 4Y28E 2FG0A 1JQQA 4ZN3A 4JZ3A 2KRMA 2F5KA 1M2OA 1MMAA 3LWHA 2NYSA 1BI2A 1X01A 4IUUA 1PCXA 1CSKA 5LJ3e 3VYHB 2DL5A 1K8AU 1M8MA 1NJIR 1M8VA 3C94A 3QPHA 2YHTA 4OB3B 2LP5A 2DL8A 1EX4A 2ZZDA 1YJ9T 4J6XA 4RUGA 1VQNT 1ZUUA 1PKTA 1Z9ZA 1SG5A 4X9DA 1QVPA 2M1HA 2MF2A 4OMFB 1I5OB 2E6ZA 2HZYA 1WYXA 1VQOQ 1MMNA 4EMKB 3NFCA 2EGEA 2PVDB 1X43A 2F69A 1KQSP 3CCET 3EGDA 3R6OA 2DLPA 3EFRA 1PC0A 2ED1A 3G4ST 4JLGA 1YWOA 1JJ2P 2Y90A 5CQYA 4OP0A 2CZ7B 2QXFA 1Q7YR 1Y0MA 3TSZA 2LQKA 1FXXA 1QWEA 1H8KA 2JVVA 1VQPA 2BZXA 2RQWA 2H3EB 3PMTA 1VUBA 2LNVA 4BI4A 2HSEB 2OTJT 4J8OA 2DMOA 2KSSA 3CXCS 1NPRA 3DKMA 4DBQA 1PRMC 4D8DA 3EFSA 2ZCFB 2P84A 3I56A 1N8RC 1S1NA 2MIOA 5GMKj 1XNIA 1YJNA 2DETA 4PJMA 4B9XA 4RG2A 3EGDB 4CC3A 3BW1A 3MEWA 1KQSA 4XAXB 2WSCE 1EZZB 5CK9A 2QI2A 3H0HA 1SRMA 4V2SA 3CCMA 3J7AF 4HT9A 4M78E 2FHDA 4MMLA 2HQXA 1NLOC 4OMQA 1MV0B 4JJDA 1IZ6A 4PFOA 3JCMJ 2D8HA 2JXBA 1Q82R 3A8MB 1X2QA 1KHCA 4F7UA 5LJ5f 4LE9A 4M77D 2LX7A 3CMAT 4J9GA 5GAMj 2F1LA 3QWXX 5GAN4 3CMEA 3CC2Q 3EG0A 3VS6A 2ZPIB 3QO3A 1YJWT 1JO8A 4WTOB 3UPUA 1QMCA 2J6OA 1S72T 2RJCA 4E2FB 3OSVA 1UEBA 4AFSC 2LJ0A 1KG1A 4X9CA 5AYFA 4J9BA 4M77F 2JNGA 1LOJA 1FMVA 5EG2A 2V1RA 1H3ZA 4BACA 3ASKA 1UJ0A 1VA7A 4FU6A 1G5VA 1LCKA 2VASA 1UHFA 1U5SA 2QTVA 2BE7D 1BCOA 5ECAA 1PNJA 3VS7A 2CSIA 1MNEA 4DEYA 3MKDA 1K9AA 3EG3A 2L3QA 2MWPA 1NEBA 3ZBDA 4BE1A 2FPFA 3RESA 3RERA 5A0LA 3QZ9B 1SEMA 1OU9A 4MZMA 4C5IA 1WHKA 4PJLA 1K73C 3H6ZA 1M3BA 4HCBA 2NUTA 1ACMB 4M7DC 2SRCA 1ZSGA 1MNDA 2LC4A 4DBFA 1WHLA 4LDWA 4IIMA 1RAEB 3VUBA 4FT2A 4PLLA 3M58A 3WVDB 1Y07A 2C06A 1WI7A 5AT1B 2BIVA 3PIPA 5KYXB 4KGVB 3CCVQ 4J5YA 2QA4A 2LDMA 1FMWA 1D0XA 1G3TA 1N8RU 1YHQT 2JOYA 4PJOA 2CGHA 4LD6A 5GMKi 4OB0B 3L1AA 1VQ8Q 1K0XA 4GLKA 2KVQG 3ULRB 1TTHB 3ZEHA 5GAMg 1T3LA 1VQ6Q 4QKUA 1TOVA 2K2MA 5IHNA 4GBQA 2EYXA 2EWNA 2YRDA 3PVLA 4XTYA 1X2KA 2RHYA 1KSWA 4LUDA 2NUTB 1Q81R 1XOVA 3HFNA 4DOVA 2CKKA 1M3AA 5FU6C 1LPLA 2YUPA 3CBPA 2PUKB 3GIBA 2EIFA 2AIRB 3G6EA 4QW2A 3DLLA 1ZX6A 4M7AD 2OX7A 3JCMg 4J83A 2JS0A 2DAQA 4JZ4A 3L2WA 3M55A 2DL3A 1G2BA 1M1KR 2OTLQ 2RHIA 5IT9E 1M9SA 1AWOA 1RI0A 1VQPT 1A0NB 3PNWC 2ABLA 1UJYA 2HKNA 4HT8A 2M0OA 1JB0E 4M7AF 1IO6A 1WXTA 1VQKQ 4QVCA 2MI6A 1RADB 2RHXA 3OYJA 2XHCA 3NGPA 2KQWA 1M30A 2RQUA 4ANJA 3G71Q 3I56T 1YFNA 3HRSA 1PM3A 2VGMA 1ZSZA 1HSQA 2VWFA 2CYZB 1YJNT 3X26B 1UGRB 4DOWA 5LJ5e 1KIKA 2E4HA 3QYGB 4PKCC 1HD3A 3DLMA 2QQ9A 2YWWA 2ZPEB 2XD0A 1LNXA 2P0PA 1Y7XA 3U23A 3CCMT 2I0NA 2O9VA 3VS0A 1HYOA 3HPWA 4RTUA 1K73U 3M57A 4L6V5 3OY9A 5J3BA 2L2PA 4M7DB 4RTZA 2E3HA 5KYYA 2AZSA 3S3MA 1LJOA 1X27A 3KXTA 1KQSS 2LZ6B 1K9MR 3EGXA 4A4EA 3C4SA 4HXJA 4M77G 3CCST 2LVMA 3A5ZB 1I07A 2O4XA 1W1FA 5LJ3f 1JJ2S 4II1A 2DK3A 2DBKA 3CBMA 2LCSA 2DIQA 3CXCA 5L8RE 1VQMQ 2JTMA 4C5HA 1YI2Q 3S6WA 5GANf 1VQOA 1ZA1B 3DB3A 1VQ5Q 2A37A 3RUXA 3UWNA 1QVGP 5HY6A 3C95A 1O75A 3UDCA 4R55A 3NTHA 5GAOr 1X75C 4FW2A 2G6FX 4N0AC 5D6YA 4L59A 4XK8E 5CO7A 4JJBA 1PSEA 2QYZA 3QXEB 1T3SA 1G8XA 2HNIA 4KH0B 1P92A 3OYHA 1M1GA 2J05A 1WFWA 2LQ8A 3SDZA 1SSHA 2CZ0B 4KT0E 4C0ZA 4JDSA 5KYYB 4RTYA 5EC7A 4P5NA 5FU6B 4CI0C 4ZTJA 3FRNA 1N27A 1PHTA 3CCJQ 5FLXE 2CSQA 3QG1A 5IH2A 1AHJB 1ZHIA 2X3XD 3CCLQ 1YP5A 4C92A 1QCOA 2V26A 1B3QA 1NBEB 2PZ1A 4M78C 4A4FA 4A53A 2L5QA 3GF5A 4J9EA 3JB9F 4EMKC 2O2OA 5FRNA 1WIEA 2YSQA 1PD1A 2F2VA 3I35A 1Q86R 1D3BB 1R77A 5IN1A 3VS4A 3NHNA 2VUBA 2QQRA 5FWBA 2HKQB 1PG5B 3CCUQ 1NM7A 4BD3A 1UGSB 4VUBA 5GAOn 4LNPA 2HEQA 2VC8A 5C0MA 4RG8A 1WQ7A 3BE3A 3LWIA 2EQJA 3CC7A 1TUCA 4J9IA 4JUVA 4C0GA 1U1SA 2JJ9A 1Z9QA 4M75A 1AEYA 2FZKB 1JEGA 4KUDK 5I22A 2CP6A 5CQXA 3FJPA 2E3IA 1D09B 2L8DA 2YXYA 2ZPGB 3OA6A 3CC2A 1G3SA 2DD5A 1KC8R 4MDXA 2RM4A 3PFSA 1AOJA 2AKLA 2EYZA 2I2LA 4RTWA 3OYFA 3QBYA 4BB7A 1NLPC 2DFUA 1U1TA 2LT1A 3OMGA 2GQVA 1VIEA 4XTVA 2CUBA 9ATCB 1M90C 3CC4A 4Y92A 1U3OA 4BE0A 3VS2A 3RR6A 2DXCA 3I9QA 3M0SA 1KQ2A 2D0QB 3RNJA 3LH0A 1GXIE 5L23A 3G6ET 4AG1C 3TVTA 4M7AG 1E7OA 1BU1A 2DE0X 3SWNA 3HRTA 1OQKA 3Q1JA 2YUOA 2JMAA 2K4YA 1VQ9Q 1W4SA 3AHUA 1B34B 3CCQT 2XIDA 4OF1A 1K1ZA 4PNOA 2P4RA 2HQEA 4MDWA 3S3NA 1R0CB 1EIFA 4BI3A 1TWBA 5C6SA 1R0BG 1BCMA 2FB7A 2JN0A 1MGQA 4BY6C 1U8RA 5KH6A 4EMHA 5LJ5j 3OYLA 4WCIA 2X4YA 4RCCA 3JCMd 2RI5A 2ESWA 4LD9K 2QGFB 3OYEA 4C92E 2PVOB 2L3SA 1GRIA 4Z88A 3CCVA 2DILA 3L42A 4CC4B 3JAME 1NZ9A 1PSFA 4FIBA 3TU4K 1K76A 3PMIA 3PIOA 5GANe 2RD1A 1FX7A 1W2BS 3CCEQ 2DVEA 4UC4A 4M78B 4FCYA 1VQ8A 2MPXC 1VQ4Q 4OMLA 2AK5A 2YDLA 1W70A 3G4SQ 1RUWA 4F17A 4IIOA 1WJRA 1TSFA 3UA6A 1UECA 1VQ6A 1G83A 2FYKA 2EGAA 3FEOA 1SHFA 1VQLQ 4JJNK 4C8QG 3NTIA 3L2VA 5CVIA 2EJGA 4M75E 4BE2A 4IUTA 2QEXQ 5J39A 3CPWS 4PJOD 3V7RA 2LQWA 2LT4A 2ROLA 2OTJQ 3URGA 3KBGA 3RBBB 2E10A 2COZA 3JCMV 2RI3A 2EQMA 4CC2A 3IQLA 2CP5A 2CT3A 2IVWA 2RN8A 2QK0A 5LJ3d 4LDXA 2YUNA 1D0ZA 3JSCA 1Y96A 3LLRA 4JRPA 2DRMA 3LGLA 2HBWA 1PKSA 2AT1B 2BE9B 3JB9G 2RMOA 1K9MC 1M90U 4EMGA 4MMKA 1BIBA 1VQKA 4DQ2A 3OB9A 3G71A 1QCNA 3MP8A 2ROTA 5LJ5g 3M4GA 2JUFA 2RB6A 4JS5A 1JJ2A 1DJ7B 1D1AA 2NUPA 3HL8A 2J7IA 2O88A 5GAN8 3FDRA 3O8VA 3VRZA 2VYTA 1I81A 3OYAA 4M7DD 1OULA 5GAN5 3VU3C 5A0DA 5A0GA 2EQIA 1UGPB 3CMAQ 1QP2A 4A63B 2YUQA 1YJWQ 3VJPA 1WNLA 3CCRQ 2HL3A 1S72Q 2EPDA 4PJOC 3CC7T 1IREB 2RK1A 3CD6A 2O31A 3OYNA 4M7DF 3LYIA 3INZA 4BY6B 4C8QE 3PVQA 1N5ZA 1F1BB 4KGXB 1ARKA 2DJQA 1QVGS 2BKDN 4HCCA 1OPLA 5I21A 2M16A 1VYVA 4FSSA 1NYFA 3NMZC 4OGEA 3KFVA 1OZ2A 1C1AA 3CC2T 1B07A 3HTRA 4DBRA 4JRKA 1X69A 1H641 2COYA 1VQMA 1UG1A 5D6WA 5GJWB 1YI2A 4E7JA 3OS5A 2RQTA 3RKXA 1YCSB 1YIJT 1Q86C 3CC4T 1XQHA 1X6GA 2GFAA 4BUGA 2RPNA 3L2ZA 4F7UB 3QYHB 3MP6A 5GAN3 3EG1A 2X9HA 1Q95G 1JRIA 2A7YA 3FB9A 2K3YA 1RAIB 1QQJA 1WDXA 3M9QA 3OW2S 2G3RA 2J6FA 1ZLMA 2K3BA 3OYKA 2DXUA 1D1CA 1WPYA 4RKUE 3CCJA 3MP1A 5KCOA 2KXCA 1JU5C 4CRIA 2V8KA 3VS1A 3CCLA 3MEAA 1LVKA 1WJQA 1OZ3A 2RNAA 1YHQQ 2KT1A 2A0FB 3LGFA 1PD0A 4XTUA 2EJ9A 4OMNA 4TVRA 1ZSZC 2E41A 4J9HA 2LTOA 2EFIA 2CT4A 3M0PA 2RK2A 2R57A 5CKDA 5LJ3j 1X6BA 3UF4A 5FWCA 2RJDA 1K9MU 3CCUA 2DVJA 3O5ZA 4ATOA 2XDDA 2RH2A 5GANj 2GQIA 3L2UA 2O9SA 3CCVT 3TEEA 1K0SA 1NYGA 2D0NA 2LMJA 1D1BA 1W2BP 4ELZC 3MEVA 1SRLA 2YT6A 3QUIA 5FROA 2FPEA 4A4GA 2FVUA 2E1HA 2FO0A 3FC3A 1IHWA 4KRTA 3J80E 1BKBA 2YRCA 5FU7B 2BZYA 2FZCB 3HP9A 2KEAA 3FIFA 2X35A 5CKEA 2RO0A 1KQ1A 3EFOA 2W0ZA 1BYMA 1IB8A 1HXDA 2ATCB 3M0UA 2QASA 3P8HA 2K2VA 4OMPA 4PJOB 1VQPQ 3CPWP 5KYUA 5CKBA 4OMOA 5GMKh 2YLBA 3MHXA 1M2VA 1WZOA 4NS5A 4NOYA 5GAN7 3WVEB 2MCNA 3MO8A 4L5GA 3T9NA 3I55Q 4E47A 4GLMA 3JCMX 1KD1R 1NJIC 4HKEA 4RTVA 1V29B 4K11A 3QHSA 2JM9A 2SEMA 3JCMc 1OOTA 2XU8A 1OV3A 3VS5A 1BI0A 3LH5A 4QVZA 2M51A 4M77A 4KH1B 4AFZC 2DZ9A 3EG9A 1W2BA 2K9GA 8AT1B 1Q86U 1YNZA 2KAFA 4AG2C 3TSWA 3V8KA 3QJ6A 4XTZA 4EIKA 1VQKT 5CIUA 1J3TA 2QQBA 4C92C 3QJYA 2KT8A 1Q7YC 1IHVA 3G71T 5GAMh 3LX7A 1MHNA 1RAAB 2B8AA 2DYBA 3E9FA 1SPKA 5LJ3g 3OS2A 3JB9I 4M78D 3TQ7P 4M7DG 2DL4A 2IIMA 4YTLA 1M2VB 3CCSQ 3JCMQ 2W10A 3CPWA 1BIAA 4LUEA 1NEGA 1IRXA 4RCBA 5GANg 1B7TA 4FT4A 3OYMA 3C12A 1N8RR 5D6XA 4N4IA 3QIIA 3OMCA 3CMET 1ABOA 2A28A 3CCEA 1UTIA 4OB1B 4M78F 2CUDA 2DXTA 3CD6T 3EG2A 1VQ4A 2MK5A 4M75C 1ZSZB 3JCMh 3CQTA 3OBYA 4FYYB 1TUGB 4ELYC 3HFOA 1I0CA 5LJ5d 1WGSA 2XMFA 4X1VA 2GBQA 4KULA 1AZGB 2F5TX 1IGQA 1VQLA 2HBPA 2E12A 1AWXA 2J06A 2RA2A 4LN2A 2RF0A 4JRQA 4IUQA 1VQMT 4JLIA 5FW9A 7AT1B 2QEXA 2ZAEA 5M9OA 4B6MA 4LDUA 2DEUA 1Q82C 3PGGA 1Y57A 2ZPBB 2JS2A 3EGXB 3H8ZA 1E6GA 5DLOA 3QKJA 1VOMA 3N5BB 1WXBA 1GBRA 4HCKA 3SHWA 2O4XB 2XI9A 3SWNC 2C0TA 3A8OB 1BI1A 2NWMA 2K5FA 5GMKe 3OW2P 1TS9A 2F2WA 2M0YA 4HCZA 4ZTFA 2M9UA 3H9NA
chains in the Genus database with same CATH topology
3CCVA 3L42A 3OYYA 4X9CA 1KG1A 5CKHA 1NZ9A 1NE8A 1PSFA 4FIBA 4M77F 2JNGA 1LOJA 1G3YA 5AYFA 3PMIA 3PIOA 5EG2A 3TU4K 1G3WA 5GANe 2DEQA 4A4HA 1H3ZA 3JRZA 2HD0A 2RD1A 4BACA 4RMOA 4M7DA 1FX7A 4HA8A 3CCQA 1W2BS 3ASKA 1QVGA 3CCJT 1VQ9A 1QP3A 2DVEA 4FU6A 4M78B 4UC4A 1G5VA 3E9GA 2K3XA 4XU1A 3OYDA 2EAYA 2X4JA 1VQ8A 4BDYA 1NJIU 3JCMf 2OTLT 4M75F 3CCLT 2JTFA 2VXFA 1I8FA 2QQSA 1WJRA 3A8GB 3M54A 4V2SA 4M77E 3OS1A 2QA4T 1VQ6A 4Q5WA 2FYKA 5GAN2 3CBOA 3I55T 3FEOA 2ZPHB 2R5MA 2EYQA 5HK3A 5KE3A 3V7SA 4JJNK 4C8QG 3NTIA 3L2VA 4M7AA 2MWPA 3CMAA 5HKCA 5CVIA 2EJGA 4M75E 3SD4A 3ZBDA 4BE1A 3RESA 3RERA 5A0LA 3M53A 3CCUT 4IUTA 2DJZA 1N6AA 3HHTB 3QZ9B 4MZMA 3VYGA 4C5IA 3V7RA 5J39A 5DLQE 3CPWS 4PJOD 5GAMe 2LT4A 3URGA 3CCRA 1S72A 1K73C 3KBGA 3H6ZA 2E10A 4HCBA 2KDSA 3V8JA 3MEUA 4C92B 3JCMV 2RI3A 1R8OB 2EQMA 3M4YA 4M7DC 4ME7A 1Q7YU 1I5LA 3TCJA 1YJ9A 2LC4A 2IVWA 5LJ3d 1VQNA 4LDWA 3F70A 4IUPA 3ZFJA 2Y4YA 5J26A 4LDXA 3VUBA 4FT2A 4PLLA 2P4TA 3M58A 3OW2A 2VXEA 4A54A 3WVDB 3WXMB 3JSCA 1Y07A 1KC8U 1Y96A 3J81E 2C06A 3LLRA 2BIVA 3PIPA 2OAUA 4O6JA 4JRPA 2E65A 4XU0A 3LGLA 2H3JA 2ZPFB 4J5YA 2QA4A 2LDMA 2DXBA 4M77B 3JB9G 1M90U 1K9MC 4EMGA 3G4SA 1QVFA 1JBMA 4MMKA 4M7AC 1G3TA 1N8RU 5GAOm 1YHQT 1BIBA 2JOYA 4PJOA 1VQKA 2CGHA 4LD6A 4DQ2A 5GMKi 2KK4A 1O9SA 4OB0B 3OB9A 4LDYA 4C8QD 1HK9A 3L1AA 4PJOE 1Y71A 3M59A 3BFMA 4GLKA 2NLUA 2QTXA 2KVQG 4M75B 5GAOl 5HK0A 3G71A 3ZEHA 1UGQB 3MP8A 5LJ5g 3M4GA 2JUFA 2DZCA 1RL2A 2RB6A 5GAMg 3V8LA 4F7UF 4JS5A 1DJ7B 1JJ2A 3HL8A 3OQ5A 2MWOA 5GAN8 3FDRA 3O8VA 2EQKA 1D3BA 1NPPA 2EWNA 1I81A 2VYTA 3OYAA 4O5VA 1YI2T 4XTYA 4M7DD 5GAN5 1VQ5T 2OTJA 3RKYA 2RHYA 3VU3C 5A0DA 3OS0A 5A0GA 4KUIA 3EAEA 1UGPB 4ZGEB 2XICA 3QDRB 3OYBA 1QP2A 2VGNA 5FRMA 4C8QF 1FWZA 3X20B 1XOVA 3OYCA 3HFNA 2AHJB 4DOVA 2CKKA 1Q81C 4E7HA 5KE2A 4OB2B 5FU6C 3VJPA 3CBPA 1WNLA 2PUKB 3GIBA 2EIFA 2DTIA 3HSBA 4C8QA 1Q82U 4PJOC 5LL6S 3CC7T 2DPPB 1IREB 2RK1A 4QW2A 3G6EA 1VIFA 3OYNA 3DLLA 3CD6A 3FLGA 3M56A 4M7DF 3LYIA 3INZA 4GY5A 2A3LA 1SSFA 2WACA 4BY6B 4C8QE 4HT9A 4M7AD 3JB9D 3MCAB 3JCMg 1QVGS 1YHQA 4XU3A 1K8AC 4J6YA 2BKDN 4HCCA 4J83A 5I21A 1M1FA 2P0QA 2DAQA 4D6WA 2M16A 1ZQ1A 4J7FA 1M5Q1 3SWNB 3L2WA 1OI1A 3M55A 5GAOp 3RKWA 4BE2A 2RHIA 4OGEA 5IT9E 5LJ3h 1M1KC 1OZ2A 1M9SA 2DTOA 4R56A 4XQ3A 4M7DE 1RI0A 3CC2T 1VQPT 2MAMA 1YCYA 1TH7A 3PNWC 2P0KA 4M78G 4C0DC 4HT8A 3L2QA 4JRKA 2HAXA 1H641 2M0OA 1VQMA 3UT1A 2PUOB 1JB0E 4M7AF 5D6WA 2XDBA 3SB2A 4QVCA 2MI6A 1YI2A 4BI8B 4E7JA 3OS5A 2GCXA 2RHXA 2X4WA 5GANh 3OYJA 3JB9J 2JZ2A 2XHCA 4OGCA 1KD1C 4IUVA 3RKXA 3X24B 3JCMb 2KQWA 2R58A 2V8IA 4MZTA 4QQGA 4JRIA 5CR2A 2ZGWA 1YIJT 1Q86C 3GLXA 2K57A 2IG0A 3CC4T 1XQHA 4LDVA 2PU9B 2Y4XA 3I56T 2GFAA 3BDUA 4BUGA 4C8QC 3HRSA 2VGMA 3L2ZA 4F7UB 3QYHB 3MP6A 3V7CA 5GAN3 4M7AE 2CYZB 1OYXA 5GAOq 3X26B 1UGRB 4DOWA 5LJ5e 1YJNT 2CZ1B 3META 1VQ4T 1JRIA 2A7YA 3FB9A 3QYGB 4PKCC 1VQOT 2K3YA 2RHZA 2LCCA 2DKGA 3OYIA 3DLMA 2RJEA 1VQ7T 2MMPA 3M9QA 2QQ9A 3OW2S 4C8QB 5I2MA 2ZPEB 4C5GA 1B34A 3BDLA 3OYGA 2XD0A 2G3RA 4C92G 4PL6A 1LNXA 3GNFB 2EQUA 3X25B 2DXUA 3OYKA 2P0PA 5CCAA 1Y7XA 3CCMT 1VQLT 3HPWA 4N0AA 4OVAA 1K73U 1WPYA 2R5AA 4RKUE 3HKSA 3M57A 3MP1A 1M4ZA 2DD4A 4L6V5 5KCOA 2LX9A 3OY9A 5J3BA 4PJOF 5I2SA 2XKOC 2L3RA 3JCMP 4M7DB 3GNGA 2V8KA 4CRIA 2CS7A 4NL2A 5GANd 2QEXT 2OTLA 3CCLA 3MEAA 3S3MA 1LJOA 1WJQA 1OZ3A 1WQWA 3KXTA 2XG8D 1KQSS 2GF7A 1UB4A 4A4KA 2CZ6B 4A4EA 4DA4A 3LGFA 3C4SA 3I55A 1YJWA 4PLIA 4XTXA 4XTUA 2EJ9A 4M77G 3RMQA 1WJSA 4QQ6A 3OSSC 4TVRA 2LVMA 3JCMe 3CCST 3A5ZB 1YITT 3JCMW 2E41A 2O4XA 5LJ3f 1JJ2S 2LTOA 1YBYA 2EFIA 4Z02A 4II1A 2DK3A 2RK2A 2R57A 5CKDA 3CBMA 5LJ3j 3PT9A 2D6FA 4E7LA 2DIQA 2YLCA 3CXCA 2O01E 5L8RE 5GAN6 2RJDA 5IAYA 2JTMA 3VKIA 4M7AB 4M75G 3GOXA 3CCUA 1K9MU 1ZBXA 4C5HA 2V8JA 3NTKA 3S6WA 3QZ5B 5GANf 3DB3A 1VQOA 4ATOA 3RUXA 2XDDA 3UWNA 2RH2A 5HY6A 5GANj 3C95A 3L2UA 1O75A 1KHIA 4IURA 3UDCA 4C5EA 3NTHA 2DTHA 4R55A 3TEEA 3CCVT 1X75C 5GAOr 4N0AC 5D6YA 4L59A 3GPLA 4XK8E 5GAMd 4M78A 5CO7A 4NL3A 2YRVA 5FU7C 1PSEA 3PTAA 4ELZC 2LCLA 4X34A 2RHUA 4EMKA 3MEVA 3QXEB 3KUFA 1VQ9T 2E5QA 3QUIA 5FROA 2E70A 2HNIA 4FSXA 4A4GA 1P92A 2FVUA 2E1HA 3OYHA 3FC3A 2VV5A 1M1GA 4Y91A 5CAIA 3J80E 4EPCA 1BKBA 1XTDA 5FU7B 3E1SA 1Y96B 2LQ8A 3ME9A 3SDZA 3HP9A 4N4GA 2CZ0B 4KT0E 2KMTA 4JDSA 3FIFA 4C0ZA 2XK0A 4JS4A 4QVDA 4XU2A 2X35A 3L2RA 1Q81U 4P5NA 2RO0A 5CKEA 1KQ1A 5FU6B 3RMSA 4CI0C 1BYMA 4ZTJA 4Y28E 2PQWA 4ZN3A 3FRNA 3CCSA 4E7KA 1N27A 1HXDA 4J7IA 4WF2A 2DIGA 2F5KA 5FLXE 3QSUA 3P8HA 2K2VA 2RI2A 3QG1A 4PJOB 3LWHA 1AHJB 1ZHIA 2LRQA 1BI2A 5CKBA 4C92A 5GMKh 1X01A 2YLBA 2X4XA 2BUDA 4IUUA 2QQAA 3CEYA 3MHXA 3CCRT 3JB9H 5LJ3e 3VYHB 4NS5A 4NOYA 5GAN7 1K8AU 3WVEB 3MO8A 4L5GA 4M78C 3T9NA 4A4FA 3OBWA 1M8VA 4E47A 4A53A 2L5QA 3GF5A 3JCMX 3C94A 3QPHA 3E19A 2YHTA 4OB3B 4HKEA 1NJIC 3JB9F 4EMKC 1V29B 2EKOA 1VQ5A 5FRNA 2ZZDA 1YJ9T 4J6XA 3QHSA 4J6WA 4KBMB 1D3BB 5IN1A 2RJFA 1VQNT 3JCMc 1M1KU 2KY9A 2VUBA 1QW1A 2QQRA 4X9DA 4C0DB 1QVPA 2M1HA 2MF2A 2XU8A 4OMFB 1BI0A 4MZPA 4BD3A 4QVZA 2K5LA 2E6ZA 1UGSB 4VUBA 4EMKB 5GAOn 2XDPA 3NFCA 3GP8A 2PVDB 2F69A 4M77A 2VC8A 4QQDA 4F7UG 4RG8A 5C0MA 1WQ7A 1KD1U 3CCET 3R6OA 3LWIA 2EQJA 2DZ9A 1W2BA 3LW5E 3CC7A 1Q86U 2KAFA 3EFRA 3V8KA 4JUVA 3QJ6A 3P8DA 4XTZA 4JLGA 3G4ST 4C0GA 1U1SA 1VQKT 2Y90A 5CQYA 5DY9A 5CIUA 4M75A 3JAME 4OP0A 2QQBA 2CZ7B 2QXFA 4C92C 4KUDK 3QJYA 5A2QE 4BDZA 2PVGB 5CQXA 3HRUA 2E64A 4XTWA 3FJPA 1Q7YC 2LQKA 5LJ5h 2ZPGB 2L8DA 3G71T 5GAMh 3LX7A 5GMKm 1MHNA 4N4HA 2DO3A 1FXXA 2B8AA 3OA6A 3S3OA 3VUZA 1QVFS 3E9FA 3CC2A 2JVVA 5LJ3g 1VQPA 3VV0A 3OS2A 2EJFA 1G3SA 2DD5A 4C0FA 3JB9I 4IKFA 4M78D 4MDXA 2RM4A 4M7DG 1KC8C 3PFSA 3PMTA 1VUBA 2LNVA 3X28B 4BI4A 5GMKl 4YTLA 2OTJT 4J8OA 3JCMQ 2I2LA 3OYFA 3CPWA 1BIAA 2KSSA 3QBYA 4RCBA 4BB7A 3A8HB 3CXCS 1NPRA 5GANg 3DKMA 3BY7A 1U1TA 2LT1A 4FT4A 3OYMA 3OMGA 1I4K1 3C12A 2GQVA 1VIEA 4XTVA 5D6XA 4M77C 3EFSA 4N4IA 3QIIA 1M90C 2ZCFB 3CC4A 3OMCA 2E6NA 1N8RC 3I56A 4FL6A 1N9RA 3CMET 2GFUA 4BE0A 3CPFA 5GMKj 3ER0A 2DXCA 1XNIA 2WSEE 3A8LB 4OB1B 2D0QB 4M78F 4B9WA 3LH0A 3CCEA 1YJNA 1KQ2A 2DXTA 1GXIE 3G6ET 3CD6T 1VQ4A 4M75C 3TREA 4M7AG 3G7ZA 4B9XA 1X6OA 4EDUA 4RG2A 3JCMh 1BI3A 3OBYA 1VQ7A 3BW1A 3SWNA 3HRTA 4ZGDB 4ELYC 3HFOA 4E7IA 3MEWA 3Q1JA 3DB4A 2K4YA 4XAXB 5LJ5d 1W4SA 1WGSA 2D9TA 4C92D 1KQSA 2WSCE 4KULA 2F5TX 3AHUA 1N9SA 5CK9A 2QI2A 1B34B 3CCQT 2HBPA 2XIDA 2E12A 3CCMA 1VQLA 3J7AF 4M78E 2FHDA 3RIRA 2RA2A 4MMLA 2HQXA 4OF1A 1VQ8T 4PNOA 4JRQA 2HQEA 4IUQA 4MDWA 3S3NA 2WSFE 1IZ6A 1VQMT 4JLIA 3P8BB 3JCMJ 2QEXA 1EIFA 4BI3A 5M9OA 2FL7A 1VQ6T 5CKFA 2QDYB 2K5IA 4LDUA 5C6SA 3A8MB 1Q82C 3PGGA 4C92F 1KHCA 4F7UA 2FB7A 2JN0A 5LJ5f 1MGQA 2ZPBB 4ZGJB 1YITA 4M77D 4ZN1A 4BY6C 5GAMf 3CCJA 3H8ZA 5KH6A 1U8RA 5DLOA 5DM7R 4EMHA 5LJ5j 3QKJA 4F7UE 3OYLA 3CMAT 5GAMj 3N5BB 5GAN4 2X4YA 3CMEA 2L89A 2O4XB 4RCCA 1YIJA 2XI9A 2ZPIB 4PJOG 3QO3A 1YJWT 5KCHA 3JCMd 3SWNC 2RI5A 4LD9K 3M5AA 3UPUA 4M75D 3A8OB 3OYEA 1BI1A 1S72T 2K5FA 2RJCA 5GMKe 4C92E 4FM4B 2PVOB 4HCZA 3SFMA 4ZTFA 3OSVA 2M9UA 1UEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHY A;  4A4E A;  3OS0 A;  3LGF A;  3C4S A;  3L42 A;  3EAE A;  4PLI A;  3OYB A;  5CIU A;  1WJS A;  4QQ6 A;  5FRM A;  2LVM A;  3PMI A;  2O4X A;  4A4H A;  3OYC A;  4BDZ A;  1H3Z A;  2LTO A;  4BAC A;  2EFI A;  4Z02 A;  4II1 A;  2CKK A;  2R57 A;  4E7H A;  3ASK A;  5KE2 A;  4E7L A;  2L8D A;  4FU6 A;  4UC4 A;  1G5V A;  2DIQ A;  3LX7 A;  3E9G A;  1MHN A;  2K3X A;  4N4H A;  3OYD A;  4BDY A;  2B8A A;  2RJD A;  5IAY A;  3OA6 A;  3GOX A;  3S3O A;  3E9F A;  4C5H A;  3NTK A;  3OS2 A;  2JTF A;  4IKF A;  3S6W A;  3DB3 A;  2QQS A;  1WJR A;  3UWN A;  4QW2 A;  3OYN A;  3PFS A;  3FLG A;  3PMT A;  3OS1 A;  3LYI A;  4GY5 A;  2WAC A;  1SSF A;  4Q5W A;  3L2U A;  4IUR A;  4C5E A;  3NTH A;  3OYF A;  3FEO A;  2R5M A;  3QBY A;  5D6Y A;  4L59 A;  2BKD N;  3OYM A;  5KE3 A;  2YRV A;  3OMG A;  2DAQ A;  2M16 A;  3NTI A;  4N4I A;  5D6X A;  1OI1 A;  3QII A;  4X34 A;  2RHU A;  3L2V A;  2MWP A;  3MEV A;  3OMC A;  2E6N A;  3KUF A;  3SD4 A;  2E5Q A;  4FL6 A;  5FRO A;  2GFU A;  4A4G A;  2RHI A;  4BE1 A;  4BE0 A;  1OZ2 A;  3OYH A;  3FC3 A;  4BE2 A;  4IUT A;  1RI0 A;  4C5I A;  5J39 A;  1XNI A;  3PNW C;  4B9W A;  2P0K A;  3LH0 A;  3L2Q A;  2M0O A;  3UT1 A;  3ME9 A;  3H6Z A;  5D6W A;  4B9X A;  4EDU A;  4RG2 A;  4N4G A;  3MEU A;  4E7I A;  4E7J A;  2X4W A;  2RHX A;  2XK0 A;  2RI3 A;  2EQM A;  2X35 A;  2JZ2 A;  3OYJ A;  3L2R A;  2RO0 A;  4IUV A;  3MEW A;  3Q1J A;  3DB4 A;  2R58 A;  4QQG A;  4ZTJ A;  2PQW A;  1WGS A;  4E7K A;  1N27 A;  2D9T A;  3F70 A;  4IUP A;  2DIG A;  2IG0 A;  2F5K A;  5J26 A;  3P8H A;  4PLL A;  2GFA A;  2RI2 A;  2FHD A;  2HQX A;  2LRQ A;  3MP6 A;  3LLR A;  2HQE A;  2BIV A;  4IUQ A;  3S3N A;  2X4X A;  1OYX A;  2BUD A;  3CEY A;  4IUU A;  3MET A;  4NS5 A;  2K3Y A;  2RHZ A;  3LGL A;  3MO8 A;  4A4F A;  2LCC A;  5M9O A;  3OYI A;  3DLM A;  2RJE A;  2LDM A;  3M9Q A;  2EKO A;  5C6S A;  4C5G A;  3OYG A;  5FRN A;  3BDL A;  2G3R A;  4PL6 A;  5IN1 A;  1KHC A;  2RJF A;  4LD6 A;  2EQU A;  3OYK A;  3OB9 A;  3H8Z A;  5KH6 A;  2QQR A;  3QKJ A;  2M1H A;  3OYL A;  2NLU A;  2X4Y A;  4OVA A;  4BD3 A;  4QVZ A;  2R5A A;  3MP1 A;  2L89 A;  2O4X B;  5KCO A;  3ZEH A;  3MP8 A;  3OY9 A;  2XDP A;  5KCH A;  2L3R A;  2RI5 A;  4QQD A;  5C0M A;  3L2W A;  4CRI A;  3OQ5 A;  2EQJ A;  2MWO A;  3FDR A;  3MEA A;  3O8V A;  2EQK A;  3OYE A;  3S3M A;  1WJQ A;  1OZ3 A;  2RJC A;  2VYT A;  3OYA A;  2GF7 A;  4HCZ A;  4ZTF A;  3QJ6 A;  3P8D A; 
#chains in the Genus database with same CATH topology
 2JTE A;  1RAG B;  3OYY A;  1G3Y A;  1QKW A;  2EGC A;  1G3W A;  1OX9 A;  4HA8 A;  1GBQ A;  3CCJ T;  1QVG A;  1QVF P;  2DER A;  2QAZ A;  3E9G A;  3OYD A;  4XU1 A;  2X3W D;  2X4J A;  4BDY A;  2BZ8 A;  1NJI U;  3CCL T;  2VXF A;  1VQ7 Q;  2QQS A;  4M77 E;  2QA4 T;  4Q5W A;  2R5M A;  1IXD A;  5KE3 A;  1WA7 A;  2CRE A;  1GCQ A;  4M7A A;  3CMA A;  5HKC A;  3SD4 A;  2DX1 A;  3R6N A;  1UE9 A;  2HDA A;  3M53 A;  3CCU T;  2DJZ A;  1N6A A;  3HHT B;  1YJW A;  4AMC A;  3ZL7 C;  2BTT A;  5GAM e;  1K73 R;  3CCR A;  1S72 A;  4C92 B;  3MEU A;  1ZUY A;  1R8O B;  3M4Y A;  1YIT Q;  1E6H A;  2DF6 A;  1Q7Y U;  1NG2 A;  3TCJ A;  2D8J A;  3A1P A;  5IHI A;  3F70 A;  4IUP A;  3ZFJ A;  5J26 A;  2P4T A;  1ABQ A;  3OW2 A;  3J81 E;  2CP0 A;  1AD5 A;  2Z0W A;  4O6J A;  2E65 A;  4PFP A;  4XU0 A;  2MYS A;  2DXB A;  1QVF A;  2EYY A;  3THK A;  4DBH A;  2FZG B;  1TG0 A;  4HVU A;  3CCQ Q;  2KK4 A;  1O9S A;  1PRL C;  4LDY A;  1KJW A;  1Y71 A;  1UGV A;  4M75 B;  5IXB A;  2PNI A;  4OMM A;  4F7U F;  2HQH A;  2H8H A;  3OQ5 A;  2MWO A;  4PJN A;  1H3H A;  1NPP A;  4O5V A;  3RKY A;  3OS0 A;  1V76 A;  3EAE A;  4ZGE B;  3X20 B;  3JV3 A;  3OYC A;  2AHJ B;  1Q81 C;  4E7H A;  1FYN A;  5KE2 A;  4OB2 B;  2DTI A;  2VVK A;  4C8Q A;  1Q82 U;  3D7S B;  5LL6 S;  1VIF A;  5D7U A;  3M56 A;  1YJ9 Q;  4GY5 A;  2A3L A;  1SSF A;  3NPF A;  1VQN Q;  2K6D A;  3VRY A;  3MCA B;  1YHQ A;  1M1F A;  2ECZ A;  2P0Q A;  4J7F A;  1M5Q 1;  3SWN B;  5GAO p;  4PFZ A;  1M1K C;  3A98 A;  2GNC A;  4XQ3 A;  1RLQ C;  1SHG A;  4C0D C;  1GCP A;  4M78 G;  2P0K A;  4E7S A;  3L2Q A;  4FYX B;  2COW A;  2GCX A;  2X4W A;  3EHR A;  1KD1 C;  4CC7 A;  3JB9 J;  2JZ2 A;  4OGC A;  3H0F A;  3X24 B;  4ZNX A;  4FYW B;  2R58 A;  4MZT A;  2V8I A;  4QQG A;  5CR2 A;  4JRI A;  2CP2 A;  2ZGW A;  2KRS A;  4LDV A;  2PU9 B;  1JXO A;  3V7C A;  1ZBJ A;  4M7A E;  5GAO q;  2LNH B;  3MET A;  1VQ4 T;  1VQO T;  2RHZ A;  4M4Z A;  3OYI A;  2JW4 A;  2RJE A;  4C8Q B;  4C5G A;  3BDL A;  1D0Y A;  4PL6 A;  1AZE A;  2VKN A;  1XJW B;  2EKH A;  2EQU A;  3X25 B;  1VQL T;  4OVA A;  4RTX A;  3HKS A;  2DD4 A;  2K7A A;  4PJO F;  3JCM P;  2OTL A;  2CS7 A;  4NL2 A;  5GAN d;  2QEX T;  2LQN A;  1WQW A;  2GF7 A;  1GFD A;  4A4K A;  1C0M A;  4DA4 A;  3I55 A;  2C0I A;  3RMQ A;  1WJS A;  3OSS C;  4E6R A;  3JCM W;  1K4U S;  2HMA A;  1YBY A;  2A08 A;  2EBP A;  2D6F A;  2OAW A;  2OI3 A;  1AWW A;  5IAY A;  1ZBX A;  1TU0 B;  4Z8A A;  1KHI A;  4IUR A;  4C5E A;  1HJD A;  2DTH A;  2JT4 A;  5GJV B;  1SF9 A;  1BB9 A;  3GPL A;  1VYU A;  5FU7 C;  4F14 A;  3PTA A;  2LCL A;  2RHU A;  3KUF A;  1WHJ A;  2E70 A;  2AZV A;  3CC7 Q;  2VV5 A;  4Y91 A;  5CAI A;  1QLY A;  1XTD A;  1RI9 A;  4DEX A;  1Y96 B;  4N4G A;  1T0J A;  4JS4 A;  2KMT A;  4E7I A;  2XK0 A;  4QVD A;  3L2R A;  1Q81 U;  1K8A R;  1UFF A;  3RMS A;  3CCS A;  2PQW A;  4E7K A;  4J7I A;  4WF2 A;  2DIG A;  2C0O A;  3QSU A;  1OU8 A;  2RI2 A;  2LRQ A;  3I5S A;  2X4X A;  2BUD A;  2QQA A;  3CEY A;  3CCR T;  1UDL A;  2QDL A;  2J6K A;  3OBW A;  3E19 A;  1YIJ Q;  5I11 A;  1KFZ A;  2EKO A;  1VQ5 A;  2EYW A;  2NUP B;  5KYW A;  3CC4 Q;  4J6W A;  4KBM B;  2RJF A;  3EH2 A;  1M1K U;  2KY9 A;  2FPD A;  1QW1 A;  4C0D B;  3QDF A;  4MZP A;  4KGZ B;  2K5L A;  5KYX A;  2XDP A;  3GP8 A;  3EGU A;  4QQD A;  1I1J A;  1ZA2 B;  4F7U G;  1KD1 U;  8ATC B;  3LW5 E;  3P8D A;  4PJJ A;  1YN8 A;  2CP7 A;  5DY9 A;  6AT1 B;  3SEM A;  3MPU B;  1CKB A;  2JMC A;  2IPO B;  5A2Q E;  2B86 A;  4BDZ A;  2PVG B;  3HRU A;  2E64 A;  4XTW A;  4Z89 A;  5LJ5 h;  1M3C A;  5GMK m;  4N4H A;  2DO3 A;  4AFQ C;  3S3O A;  2QGG A;  3VUZ A;  1QVF S;  3VV0 A;  2EJF A;  4IKF A;  4C0F A;  4R0K A;  2KXD A;  1C6V X;  2KYB A;  1KC8 C;  3X28 B;  2LJ3 A;  5GMK l;  1RLP C;  1PWT A;  3A8H B;  1EFN A;  1M90 R;  3BY7 A;  1I4K 1;  4M77 C;  5KYW B;  2E6N A;  4FL6 A;  1N9R A;  2GFU A;  2PTK A;  3CPF A;  3ER0 A;  1QKX A;  2KNB B;  2WSE E;  3JB9 H;  3A8L B;  4B9W A;  2CH4 W;  3TRE A;  3G7Z A;  1X6O A;  4EDU A;  1BI3 A;  2FEI A;  1VQ7 A;  3VS3 A;  1CKA A;  2CDT A;  4ZGD B;  3DB4 A;  2D1X A;  2D9T A;  4C92 D;  1IGU A;  1N9S A;  4J9D A;  1AVZ C;  3RIR A;  1M27 C;  1VQ8 T;  2WSF E;  1RAC B;  3AT1 B;  1TXQ A;  3P8B B;  2DL7 A;  2FL7 A;  1QCF A;  1VQ6 T;  5CKF A;  2KGT A;  2QDY B;  2K5I A;  2DM1 A;  1QWF A;  4C92 F;  2KE9 A;  1H92 A;  1U06 A;  3REB B;  4ZGJ B;  1YIT A;  4ZN1 A;  5GAM f;  1RAF B;  5DM7 R;  4F7U E;  1MV3 A;  1UUE A;  1JXM A;  2L89 A;  4PJO G;  1WLP B;  5KCH A;  2M02 A;  3M5A A;  4E7Z A;  4F16 A;  4M75 D;  1YWP A;  2CH4 A;  3REA B;  2HSP A;  1MMD A;  4FM4 B;  3SFM A;  1WHH A;  5CKH A;  1NE8 A;  3I56 Q;  2DEQ A;  4A4H A;  3JRZ A;  2HD0 A;  4RMO A;  4M7D A;  3RDV A;  3CCQ A;  1VQ9 A;  1QP3 A;  2K3X A;  1YJN Q;  2EAY A;  2HL5 C;  2F2X A;  4M75 F;  3JCM f;  2OTL T;  2JTF A;  1I8F A;  3A8G B;  3M54 A;  4D8K A;  3OS1 A;  5GAN 2;  3CXC P;  3CBO A;  2HCK A;  3I55 T;  2ZPH B;  3I5R A;  2EYQ A;  3EH1 A;  4RTT A;  5HK3 A;  3CCM Q;  3V7S A;  1AWJ A;  2NUZ A;  3EFO B;  4LXC A;  2GTJ A;  1WX6 A;  3VYG A;  3UA7 A;  5DLQ E;  4J9C A;  1WXU A;  5KYU B;  2KDS A;  3V8J A;  1GL5 A;  2RQV A;  4ME7 A;  4J9F A;  1I5L A;  1OPK A;  1YJ9 A;  1VYT A;  1VQN A;  3CME Q;  2Y4Y A;  2VXE A;  4A54 A;  3WXM B;  1KC8 U;  3CD6 Q;  2AKK A;  2OAU A;  3MJX A;  4JPB W;  2KI7 A;  2H3J A;  2ZPF B;  2CP3 A;  4F04 B;  4M77 B;  1GCQ C;  2EVR A;  3G4S A;  4M7A C;  1JBM A;  2LJ1 A;  5GAO m;  2QG9 B;  3EG9 B;  4AFU C;  3C0C A;  4C8Q D;  1HK9 A;  3M0Q A;  4PJO E;  3M59 A;  3BFM A;  2NLU A;  2QTX A;  5GAO l;  3H0I A;  1W6X A;  5HK0 A;  1UGQ B;  1ZUK A;  2DZC A;  1RL2 A;  2X51 A;  3V8L A;  2EQK A;  4QT7 A;  1D3B A;  2JM8 A;  1UHC A;  1YI2 T;  2GTO A;  1VQ5 T;  1GFC A;  2OTJ A;  2KYM A;  4KUI A;  2XIC A;  3QDR B;  3OYB A;  4HVW A;  2VGN A;  5FRM A;  2ENM A;  1FWZ A;  4C8Q F;  1MUZ A;  1BK2 A;  3PE0 A;  4HVV A;  1WHM A;  5IHK A;  3GBQ A;  1BBZ A;  2DPP B;  2E5K A;  1KK7 A;  3FLG A;  2GGR A;  2WAC A;  2DYI A;  3QWY A;  3JB9 D;  4XU3 A;  1K8A C;  4J6Y A;  4D6W A;  1ZQ1 A;  1OI1 A;  3RKW A;  5LJ3 h;  2DTO A;  2DBM A;  4R56 A;  4M7D E;  2MAM A;  1YCY A;  1TH7 A;  2QA4 Q;  3E2U A;  2HAX A;  3UT1 A;  2PUO B;  2XDB A;  3SB2 A;  1RAB B;  3H41 A;  4BI8 B;  5GAN h;  2KRO A;  2RQR A;  3G1J A;  4IUV A;  3JCM b;  5IXF A;  3GLX A;  2K57 A;  2IG0 A;  2Y4X A;  1OEB A;  3BDU A;  4C8Q C;  5KYN A;  4ESR A;  1MMG A;  1OYX A;  2KR3 A;  2CZ1 B;  2DRK A;  4FYV B;  2LCC A;  2DKG A;  2V1Q A;  1FMK A;  1VQ7 T;  2MMP A;  5I2M A;  3OYG A;  1B34 A;  4C92 G;  1SKU B;  3GNF B;  2MOX A;  4FW1 A;  5CCA A;  2A36 A;  4N0A A;  4ORZ A;  2R5A A;  3UAT A;  1M4Z A;  4JJC A;  2KBT A;  2LX9 A;  2DNU A;  2ED0 A;  5I2S A;  2XKO C;  2L3R A;  5HCK A;  3G6E Q;  3GNG A;  3FJ5 A;  2DA9 A;  1AT1 B;  2XG8 D;  3M0R A;  1UB4 A;  3EHQ A;  2CZ6 B;  3M0T A;  4AT1 B;  4PLI A;  4XTX A;  3JCM e;  1YIJ A;  4QQ6 A;  1YIT T;  2EW3 A;  4Z02 A;  1TUD A;  3PT9 A;  4E7L A;  1RAH B;  2YLC A;  2O01 E;  5GAN 6;  3VKI A;  4M7A B;  4M75 G;  2VB6 A;  3GOX A;  2V8J A;  3NTK A;  3QZ5 B;  1WHG A;  1OX8 A;  1V1C A;  2FRW A;  5GAM d;  4M78 A;  1T0H A;  2K79 A;  2L3P A;  2YRV A;  4NL3 A;  2OJ2 A;  4X34 A;  4EMK A;  4PK4 A;  1VQ9 T;  2E5Q A;  2KRN A;  4FSX A;  4EPC A;  2L0A A;  3E1S A;  3ME9 A;  2FRY A;  3HSB A;  4XU2 A;  4Y28 E;  2FG0 A;  1JQQ A;  4ZN3 A;  4JZ3 A;  2KRM A;  2F5K A;  1M2O A;  1MMA A;  3LWH A;  2NYS A;  1BI2 A;  1X01 A;  4IUU A;  1PCX A;  1CSK A;  5LJ3 e;  3VYH B;  2DL5 A;  1K8A U;  1M8M A;  1NJI R;  1M8V A;  3C94 A;  3QPH A;  2YHT A;  4OB3 B;  2LP5 A;  2DL8 A;  1EX4 A;  2ZZD A;  1YJ9 T;  4J6X A;  4RUG A;  1VQN T;  1ZUU A;  1PKT A;  1Z9Z A;  1SG5 A;  4X9D A;  1QVP A;  2M1H A;  2MF2 A;  4OMF B;  1I5O B;  2E6Z A;  2HZY A;  1WYX A;  1VQO Q;  1MMN A;  4EMK B;  3NFC A;  2EGE A;  2PVD B;  1X43 A;  2F69 A;  1KQS P;  3CCE T;  3EGD A;  3R6O A;  2DLP A;  3EFR A;  1PC0 A;  2ED1 A;  3G4S T;  4JLG A;  1YWO A;  1JJ2 P;  2Y90 A;  5CQY A;  4OP0 A;  2CZ7 B;  2QXF A;  1Q7Y R;  1Y0M A;  3TSZ A;  2LQK A;  1FXX A;  1QWE A;  1H8K A;  2JVV A;  1VQP A;  2BZX A;  2RQW A;  2H3E B;  3PMT A;  1VUB A;  2LNV A;  4BI4 A;  2HSE B;  2OTJ T;  4J8O A;  2DMO A;  2KSS A;  3CXC S;  1NPR A;  3DKM A;  4DBQ A;  1PRM C;  4D8D A;  3EFS A;  2ZCF B;  2P84 A;  3I56 A;  1N8R C;  1S1N A;  2MIO A;  5GMK j;  1XNI A;  1YJN A;  2DET A;  4PJM A;  4B9X A;  4RG2 A;  3EGD B;  4CC3 A;  3BW1 A;  3MEW A;  1KQS A;  4XAX B;  2WSC E;  1EZZ B;  5CK9 A;  2QI2 A;  3H0H A;  1SRM A;  4V2S A;  3CCM A;  3J7A F;  4HT9 A;  4M78 E;  2FHD A;  4MML A;  2HQX A;  1NLO C;  4OMQ A;  1MV0 B;  4JJD A;  1IZ6 A;  4PFO A;  3JCM J;  2D8H A;  2JXB A;  1Q82 R;  3A8M B;  1X2Q A;  1KHC A;  4F7U A;  5LJ5 f;  4LE9 A;  4M77 D;  2LX7 A;  3CMA T;  4J9G A;  5GAM j;  2F1L A;  3QWX X;  5GAN 4;  3CME A;  3CC2 Q;  3EG0 A;  3VS6 A;  2ZPI B;  3QO3 A;  1YJW T;  1JO8 A;  4WTO B;  3UPU A;  1QMC A;  2J6O A;  1S72 T;  2RJC A;  4E2F B;  3OSV A;  1UEB A;  4AFS C;  2LJ0 A;  1KG1 A;  4X9C A;  5AYF A;  4J9B A;  4M77 F;  2JNG A;  1LOJ A;  1FMV A;  5EG2 A;  2V1R A;  1H3Z A;  4BAC A;  3ASK A;  1UJ0 A;  1VA7 A;  4FU6 A;  1G5V A;  1LCK A;  2VAS A;  1UHF A;  1U5S A;  2QTV A;  2BE7 D;  1BCO A;  5ECA A;  1PNJ A;  3VS7 A;  2CSI A;  1MNE A;  4DEY A;  3MKD A;  1K9A A;  3EG3 A;  2L3Q A;  2MWP A;  1NEB A;  3ZBD A;  4BE1 A;  2FPF A;  3RES A;  3RER A;  5A0L A;  3QZ9 B;  1SEM A;  1OU9 A;  4MZM A;  4C5I A;  1WHK A;  4PJL A;  1K73 C;  3H6Z A;  1M3B A;  4HCB A;  2NUT A;  1ACM B;  4M7D C;  2SRC A;  1ZSG A;  1MND A;  2LC4 A;  4DBF A;  1WHL A;  4LDW A;  4IIM A;  1RAE B;  3VUB A;  4FT2 A;  4PLL A;  3M58 A;  3WVD B;  1Y07 A;  2C06 A;  1WI7 A;  5AT1 B;  2BIV A;  3PIP A;  5KYX B;  4KGV B;  3CCV Q;  4J5Y A;  2QA4 A;  2LDM A;  1FMW A;  1D0X A;  1G3T A;  1N8R U;  1YHQ T;  2JOY A;  4PJO A;  2CGH A;  4LD6 A;  5GMK i;  4OB0 B;  3L1A A;  1VQ8 Q;  1K0X A;  4GLK A;  2KVQ G;  3ULR B;  1TTH B;  3ZEH A;  5GAM g;  1T3L A;  1VQ6 Q;  4QKU A;  1TOV A;  2K2M A;  5IHN A;  4GBQ A;  2EYX A;  2EWN A;  2YRD A;  3PVL A;  4XTY A;  1X2K A;  2RHY A;  1KSW A;  4LUD A;  2NUT B;  1Q81 R;  1XOV A;  3HFN A;  4DOV A;  2CKK A;  1M3A A;  5FU6 C;  1LPL A;  2YUP A;  3CBP A;  2PUK B;  3GIB A;  2EIF A;  2AIR B;  3G6E A;  4QW2 A;  3DLL A;  1ZX6 A;  4M7A D;  2OX7 A;  3JCM g;  4J83 A;  2JS0 A;  2DAQ A;  4JZ4 A;  3L2W A;  3M55 A;  2DL3 A;  1G2B A;  1M1K R;  2OTL Q;  2RHI A;  5IT9 E;  1M9S A;  1AWO A;  1RI0 A;  1VQP T;  1A0N B;  3PNW C;  2ABL A;  1UJY A;  2HKN A;  4HT8 A;  2M0O A;  1JB0 E;  4M7A F;  1IO6 A;  1WXT A;  1VQK Q;  4QVC A;  2MI6 A;  1RAD B;  2RHX A;  3OYJ A;  2XHC A;  3NGP A;  2KQW A;  1M30 A;  2RQU A;  4ANJ A;  3G71 Q;  3I56 T;  1YFN A;  3HRS A;  1PM3 A;  2VGM A;  1ZSZ A;  1HSQ A;  2VWF A;  2CYZ B;  1YJN T;  3X26 B;  1UGR B;  4DOW A;  5LJ5 e;  1KIK A;  2E4H A;  3QYG B;  4PKC C;  1HD3 A;  3DLM A;  2QQ9 A;  2YWW A;  2ZPE B;  2XD0 A;  1LNX A;  2P0P A;  1Y7X A;  3U23 A;  3CCM T;  2I0N A;  2O9V A;  3VS0 A;  1HYO A;  3HPW A;  4RTU A;  1K73 U;  3M57 A;  4L6V 5;  3OY9 A;  5J3B A;  2L2P A;  4M7D B;  4RTZ A;  2E3H A;  5KYY A;  2AZS A;  3S3M A;  1LJO A;  1X27 A;  3KXT A;  1KQS S;  2LZ6 B;  1K9M R;  3EGX A;  4A4E A;  3C4S A;  4HXJ A;  4M77 G;  3CCS T;  2LVM A;  3A5Z B;  1I07 A;  2O4X A;  1W1F A;  5LJ3 f;  1JJ2 S;  4II1 A;  2DK3 A;  2DBK A;  3CBM A;  2LCS A;  2DIQ A;  3CXC A;  5L8R E;  1VQM Q;  2JTM A;  4C5H A;  1YI2 Q;  3S6W A;  5GAN f;  1VQO A;  1ZA1 B;  3DB3 A;  1VQ5 Q;  2A37 A;  3RUX A;  3UWN A;  1QVG P;  5HY6 A;  3C95 A;  1O75 A;  3UDC A;  4R55 A;  3NTH A;  5GAO r;  1X75 C;  4FW2 A;  2G6F X;  4N0A C;  5D6Y A;  4L59 A;  4XK8 E;  5CO7 A;  4JJB A;  1PSE A;  2QYZ A;  3QXE B;  1T3S A;  1G8X A;  2HNI A;  4KH0 B;  1P92 A;  3OYH A;  1M1G A;  2J05 A;  1WFW A;  2LQ8 A;  3SDZ A;  1SSH A;  2CZ0 B;  4KT0 E;  4C0Z A;  4JDS A;  5KYY B;  4RTY A;  5EC7 A;  4P5N A;  5FU6 B;  4CI0 C;  4ZTJ A;  3FRN A;  1N27 A;  1PHT A;  3CCJ Q;  5FLX E;  2CSQ A;  3QG1 A;  5IH2 A;  1AHJ B;  1ZHI A;  2X3X D;  3CCL Q;  1YP5 A;  4C92 A;  1QCO A;  2V26 A;  1B3Q A;  1NBE B;  2PZ1 A;  4M78 C;  4A4F A;  4A53 A;  2L5Q A;  3GF5 A;  4J9E A;  3JB9 F;  4EMK C;  2O2O A;  5FRN A;  1WIE A;  2YSQ A;  1PD1 A;  2F2V A;  3I35 A;  1Q86 R;  1D3B B;  1R77 A;  5IN1 A;  3VS4 A;  3NHN A;  2VUB A;  2QQR A;  5FWB A;  2HKQ B;  1PG5 B;  3CCU Q;  1NM7 A;  4BD3 A;  1UGS B;  4VUB A;  5GAO n;  4LNP A;  2HEQ A;  2VC8 A;  5C0M A;  4RG8 A;  1WQ7 A;  3BE3 A;  3LWI A;  2EQJ A;  3CC7 A;  1TUC A;  4J9I A;  4JUV A;  4C0G A;  1U1S A;  2JJ9 A;  1Z9Q A;  4M75 A;  1AEY A;  2FZK B;  1JEG A;  4KUD K;  5I22 A;  2CP6 A;  5CQX A;  3FJP A;  2E3I A;  1D09 B;  2L8D A;  2YXY A;  2ZPG B;  3OA6 A;  3CC2 A;  1G3S A;  2DD5 A;  1KC8 R;  4MDX A;  2RM4 A;  3PFS A;  1AOJ A;  2AKL A;  2EYZ A;  2I2L A;  4RTW A;  3OYF A;  3QBY A;  4BB7 A;  1NLP C;  2DFU A;  1U1T A;  2LT1 A;  3OMG A;  2GQV A;  1VIE A;  4XTV A;  2CUB A;  9ATC B;  1M90 C;  3CC4 A;  4Y92 A;  1U3O A;  4BE0 A;  3VS2 A;  3RR6 A;  2DXC A;  3I9Q A;  3M0S A;  1KQ2 A;  2D0Q B;  3RNJ A;  3LH0 A;  1GXI E;  5L23 A;  3G6E T;  4AG1 C;  3TVT A;  4M7A G;  1E7O A;  1BU1 A;  2DE0 X;  3SWN A;  3HRT A;  1OQK A;  3Q1J A;  2YUO A;  2JMA A;  2K4Y A;  1VQ9 Q;  1W4S A;  3AHU A;  1B34 B;  3CCQ T;  2XID A;  4OF1 A;  1K1Z A;  4PNO A;  2P4R A;  2HQE A;  4MDW A;  3S3N A;  1R0C B;  1EIF A;  4BI3 A;  1TWB A;  5C6S A;  1R0B G;  1BCM A;  2FB7 A;  2JN0 A;  1MGQ A;  4BY6 C;  1U8R A;  5KH6 A;  4EMH A;  5LJ5 j;  3OYL A;  4WCI A;  2X4Y A;  4RCC A;  3JCM d;  2RI5 A;  2ESW A;  4LD9 K;  2QGF B;  3OYE A;  4C92 E;  2PVO B;  2L3S A;  1GRI A;  4Z88 A;  3CCV A;  2DIL A;  3L42 A;  4CC4 B;  3JAM E;  1NZ9 A;  1PSF A;  4FIB A;  3TU4 K;  1K76 A;  3PMI A;  3PIO A;  5GAN e;  2RD1 A;  1FX7 A;  1W2B S;  3CCE Q;  2DVE A;  4UC4 A;  4M78 B;  4FCY A;  1VQ8 A;  2MPX C;  1VQ4 Q;  4OML A;  2AK5 A;  2YDL A;  1W70 A;  3G4S Q;  1RUW A;  4F17 A;  4IIO A;  1WJR A;  1TSF A;  3UA6 A;  1UEC A;  1VQ6 A;  1G83 A;  2FYK A;  2EGA A;  3FEO A;  1SHF A;  1VQL Q;  4JJN K;  4C8Q G;  3NTI A;  3L2V A;  5CVI A;  2EJG A;  4M75 E;  4BE2 A;  4IUT A;  2QEX Q;  5J39 A;  3CPW S;  4PJO D;  3V7R A;  2LQW A;  2LT4 A;  2ROL A;  2OTJ Q;  3URG A;  3KBG A;  3RBB B;  2E10 A;  2COZ A;  3JCM V;  2RI3 A;  2EQM A;  4CC2 A;  3IQL A;  2CP5 A;  2CT3 A;  2IVW A;  2RN8 A;  2QK0 A;  5LJ3 d;  4LDX A;  2YUN A;  1D0Z A;  3JSC A;  1Y96 A;  3LLR A;  4JRP A;  2DRM A;  3LGL A;  2HBW A;  1PKS A;  2AT1 B;  2BE9 B;  3JB9 G;  2RMO A;  1K9M C;  1M90 U;  4EMG A;  4MMK A;  1BIB A;  1VQK A;  4DQ2 A;  3OB9 A;  3G71 A;  1QCN A;  3MP8 A;  2ROT A;  5LJ5 g;  3M4G A;  2JUF A;  2RB6 A;  4JS5 A;  1JJ2 A;  1DJ7 B;  1D1A A;  2NUP A;  3HL8 A;  2J7I A;  2O88 A;  5GAN 8;  3FDR A;  3O8V A;  3VRZ A;  2VYT A;  1I81 A;  3OYA A;  4M7D D;  1OUL A;  5GAN 5;  3VU3 C;  5A0D A;  5A0G A;  2EQI A;  1UGP B;  3CMA Q;  1QP2 A;  4A63 B;  2YUQ A;  1YJW Q;  3VJP A;  1WNL A;  3CCR Q;  2HL3 A;  1S72 Q;  2EPD A;  4PJO C;  3CC7 T;  1IRE B;  2RK1 A;  3CD6 A;  2O31 A;  3OYN A;  4M7D F;  3LYI A;  3INZ A;  4BY6 B;  4C8Q E;  3PVQ A;  1N5Z A;  1F1B B;  4KGX B;  1ARK A;  2DJQ A;  1QVG S;  2BKD N;  4HCC A;  1OPL A;  5I21 A;  2M16 A;  1VYV A;  4FSS A;  1NYF A;  3NMZ C;  4OGE A;  3KFV A;  1OZ2 A;  1C1A A;  3CC2 T;  1B07 A;  3HTR A;  4DBR A;  4JRK A;  1X69 A;  1H64 1;  2COY A;  1VQM A;  1UG1 A;  5D6W A;  5GJW B;  1YI2 A;  4E7J A;  3OS5 A;  2RQT A;  3RKX A;  1YCS B;  1YIJ T;  1Q86 C;  3CC4 T;  1XQH A;  1X6G A;  2GFA A;  4BUG A;  2RPN A;  3L2Z A;  4F7U B;  3QYH B;  3MP6 A;  5GAN 3;  3EG1 A;  2X9H A;  1Q95 G;  1JRI A;  2A7Y A;  3FB9 A;  2K3Y A;  1RAI B;  1QQJ A;  1WDX A;  3M9Q A;  3OW2 S;  2G3R A;  2J6F A;  1ZLM A;  2K3B A;  3OYK A;  2DXU A;  1D1C A;  1WPY A;  4RKU E;  3CCJ A;  3MP1 A;  5KCO A;  2KXC A;  1JU5 C;  4CRI A;  2V8K A;  3VS1 A;  3CCL A;  3MEA A;  1LVK A;  1WJQ A;  1OZ3 A;  2RNA A;  1YHQ Q;  2KT1 A;  2A0F B;  3LGF A;  1PD0 A;  4XTU A;  2EJ9 A;  4OMN A;  4TVR A;  1ZSZ C;  2E41 A;  4J9H A;  2LTO A;  2EFI A;  2CT4 A;  3M0P A;  2RK2 A;  2R57 A;  5CKD A;  5LJ3 j;  1X6B A;  3UF4 A;  5FWC A;  2RJD A;  1K9M U;  3CCU A;  2DVJ A;  3O5Z A;  4ATO A;  2XDD A;  2RH2 A;  5GAN j;  2GQI A;  3L2U A;  2O9S A;  3CCV T;  3TEE A;  1K0S A;  1NYG A;  2D0N A;  2LMJ A;  1D1B A;  1W2B P;  4ELZ C;  3MEV A;  1SRL A;  2YT6 A;  3QUI A;  5FRO A;  2FPE A;  4A4G A;  2FVU A;  2E1H A;  2FO0 A;  3FC3 A;  1IHW A;  4KRT A;  3J80 E;  1BKB A;  2YRC A;  5FU7 B;  2BZY A;  2FZC B;  3HP9 A;  2KEA A;  3FIF A;  2X35 A;  5CKE A;  2RO0 A;  1KQ1 A;  3EFO A;  2W0Z A;  1BYM A;  1IB8 A;  1HXD A;  2ATC B;  3M0U A;  2QAS A;  3P8H A;  2K2V A;  4OMP A;  4PJO B;  1VQP Q;  3CPW P;  5KYU A;  5CKB A;  4OMO A;  5GMK h;  2YLB A;  3MHX A;  1M2V A;  1WZO A;  4NS5 A;  4NOY A;  5GAN 7;  3WVE B;  2MCN A;  3MO8 A;  4L5G A;  3T9N A;  3I55 Q;  4E47 A;  4GLM A;  3JCM X;  1KD1 R;  1NJI C;  4HKE A;  4RTV A;  1V29 B;  4K11 A;  3QHS A;  2JM9 A;  2SEM A;  3JCM c;  1OOT A;  2XU8 A;  1OV3 A;  3VS5 A;  1BI0 A;  3LH5 A;  4QVZ A;  2M51 A;  4M77 A;  4KH1 B;  4AFZ C;  2DZ9 A;  3EG9 A;  1W2B A;  2K9G A;  8AT1 B;  1Q86 U;  1YNZ A;  2KAF A;  4AG2 C;  3TSW A;  3V8K A;  3QJ6 A;  4XTZ A;  4EIK A;  1VQK T;  5CIU A;  1J3T A;  2QQB A;  4C92 C;  3QJY A;  2KT8 A;  1Q7Y C;  1IHV A;  3G71 T;  5GAM h;  3LX7 A;  1MHN A;  1RAA B;  2B8A A;  2DYB A;  3E9F A;  1SPK A;  5LJ3 g;  3OS2 A;  3JB9 I;  4M78 D;  3TQ7 P;  4M7D G;  2DL4 A;  2IIM A;  4YTL A;  1M2V B;  3CCS Q;  3JCM Q;  2W10 A;  3CPW A;  1BIA A;  4LUE A;  1NEG A;  1IRX A;  4RCB A;  5GAN g;  1B7T A;  4FT4 A;  3OYM A;  3C12 A;  1N8R R;  5D6X A;  4N4I A;  3QII A;  3OMC A;  3CME T;  1ABO A;  2A28 A;  3CCE A;  1UTI A;  4OB1 B;  4M78 F;  2CUD A;  2DXT A;  3CD6 T;  3EG2 A;  1VQ4 A;  2MK5 A;  4M75 C;  1ZSZ B;  3JCM h;  3CQT A;  3OBY A;  4FYY B;  1TUG B;  4ELY C;  3HFO A;  1I0C A;  5LJ5 d;  1WGS A;  2XMF A;  4X1V A;  2GBQ A;  4KUL A;  1AZG B;  2F5T X;  1IGQ A;  1VQL A;  2HBP A;  2E12 A;  1AWX A;  2J06 A;  2RA2 A;  4LN2 A;  2RF0 A;  4JRQ A;  4IUQ A;  1VQM T;  4JLI A;  5FW9 A;  7AT1 B;  2QEX A;  2ZAE A;  5M9O A;  4B6M A;  4LDU A;  2DEU A;  1Q82 C;  3PGG A;  1Y57 A;  2ZPB B;  2JS2 A;  3EGX B;  3H8Z A;  1E6G A;  5DLO A;  3QKJ A;  1VOM A;  3N5B B;  1WXB A;  1GBR A;  4HCK A;  3SHW A;  2O4X B;  2XI9 A;  3SWN C;  2C0T A;  3A8O B;  1BI1 A;  2NWM A;  2K5F A;  5GMK e;  3OW2 P;  1TS9 A;  2F2W A;  2M0Y A;  4HCZ A;  4ZTF A;  2M9U A;  3H9N A; 
#chains in the Genus database with same CATH homology
 3CCV A;  3L42 A;  3OYY A;  4X9C A;  1KG1 A;  5CKH A;  1NZ9 A;  1NE8 A;  1PSF A;  4FIB A;  4M77 F;  2JNG A;  1LOJ A;  1G3Y A;  5AYF A;  3PMI A;  3PIO A;  5EG2 A;  3TU4 K;  1G3W A;  5GAN e;  2DEQ A;  4A4H A;  1H3Z A;  3JRZ A;  2HD0 A;  2RD1 A;  4BAC A;  4RMO A;  4M7D A;  1FX7 A;  4HA8 A;  3CCQ A;  1W2B S;  3ASK A;  1QVG A;  3CCJ T;  1VQ9 A;  1QP3 A;  2DVE A;  4FU6 A;  4M78 B;  4UC4 A;  1G5V A;  3E9G A;  2K3X A;  4XU1 A;  3OYD A;  2EAY A;  2X4J A;  1VQ8 A;  4BDY A;  1NJI U;  3JCM f;  2OTL T;  4M75 F;  3CCL T;  2JTF A;  2VXF A;  1I8F A;  2QQS A;  1WJR A;  3A8G B;  3M54 A;  4V2S A;  4M77 E;  3OS1 A;  2QA4 T;  1VQ6 A;  4Q5W A;  2FYK A;  5GAN 2;  3CBO A;  3I55 T;  3FEO A;  2ZPH B;  2R5M A;  2EYQ A;  5HK3 A;  5KE3 A;  3V7S A;  4JJN K;  4C8Q G;  3NTI A;  3L2V A;  4M7A A;  2MWP A;  3CMA A;  5HKC A;  5CVI A;  2EJG A;  4M75 E;  3SD4 A;  3ZBD A;  4BE1 A;  3RES A;  3RER A;  5A0L A;  3M53 A;  3CCU T;  4IUT A;  2DJZ A;  1N6A A;  3HHT B;  3QZ9 B;  4MZM A;  3VYG A;  4C5I A;  3V7R A;  5J39 A;  5DLQ E;  3CPW S;  4PJO D;  5GAM e;  2LT4 A;  3URG A;  3CCR A;  1S72 A;  1K73 C;  3KBG A;  3H6Z A;  2E10 A;  4HCB A;  2KDS A;  3V8J A;  3MEU A;  4C92 B;  3JCM V;  2RI3 A;  1R8O B;  2EQM A;  3M4Y A;  4M7D C;  4ME7 A;  1Q7Y U;  1I5L A;  3TCJ A;  1YJ9 A;  2LC4 A;  2IVW A;  5LJ3 d;  1VQN A;  4LDW A;  3F70 A;  4IUP A;  3ZFJ A;  2Y4Y A;  5J26 A;  4LDX A;  3VUB A;  4FT2 A;  4PLL A;  2P4T A;  3M58 A;  3OW2 A;  2VXE A;  4A54 A;  3WVD B;  3WXM B;  3JSC A;  1Y07 A;  1KC8 U;  1Y96 A;  3J81 E;  2C06 A;  3LLR A;  2BIV A;  3PIP A;  2OAU A;  4O6J A;  4JRP A;  2E65 A;  4XU0 A;  3LGL A;  2H3J A;  2ZPF B;  4J5Y A;  2QA4 A;  2LDM A;  2DXB A;  4M77 B;  3JB9 G;  1M90 U;  1K9M C;  4EMG A;  3G4S A;  1QVF A;  1JBM A;  4MMK A;  4M7A C;  1G3T A;  1N8R U;  5GAO m;  1YHQ T;  1BIB A;  2JOY A;  4PJO A;  1VQK A;  2CGH A;  4LD6 A;  4DQ2 A;  5GMK i;  2KK4 A;  1O9S A;  4OB0 B;  3OB9 A;  4LDY A;  4C8Q D;  1HK9 A;  3L1A A;  4PJO E;  1Y71 A;  3M59 A;  3BFM A;  4GLK A;  2NLU A;  2QTX A;  2KVQ G;  4M75 B;  5GAO l;  5HK0 A;  3G71 A;  3ZEH A;  1UGQ B;  3MP8 A;  5LJ5 g;  3M4G A;  2JUF A;  2DZC A;  1RL2 A;  2RB6 A;  5GAM g;  3V8L A;  4F7U F;  4JS5 A;  1DJ7 B;  1JJ2 A;  3HL8 A;  3OQ5 A;  2MWO A;  5GAN 8;  3FDR A;  3O8V A;  2EQK A;  1D3B A;  1NPP A;  2EWN A;  1I81 A;  2VYT A;  3OYA A;  4O5V A;  1YI2 T;  4XTY A;  4M7D D;  5GAN 5;  1VQ5 T;  2OTJ A;  3RKY A;  2RHY A;  3VU3 C;  5A0D A;  3OS0 A;  5A0G A;  4KUI A;  3EAE A;  1UGP B;  4ZGE B;  2XIC A;  3QDR B;  3OYB A;  1QP2 A;  2VGN A;  5FRM A;  4C8Q F;  1FWZ A;  3X20 B;  1XOV A;  3OYC A;  3HFN A;  2AHJ B;  4DOV A;  2CKK A;  1Q81 C;  4E7H A;  5KE2 A;  4OB2 B;  5FU6 C;  3VJP A;  3CBP A;  1WNL A;  2PUK B;  3GIB A;  2EIF A;  2DTI A;  3HSB A;  4C8Q A;  1Q82 U;  4PJO C;  5LL6 S;  3CC7 T;  2DPP B;  1IRE B;  2RK1 A;  4QW2 A;  3G6E A;  1VIF A;  3OYN A;  3DLL A;  3CD6 A;  3FLG A;  3M56 A;  4M7D F;  3LYI A;  3INZ A;  4GY5 A;  2A3L A;  1SSF A;  2WAC A;  4BY6 B;  4C8Q E;  4HT9 A;  4M7A D;  3JB9 D;  3MCA B;  3JCM g;  1QVG S;  1YHQ A;  4XU3 A;  1K8A C;  4J6Y A;  2BKD N;  4HCC A;  4J83 A;  5I21 A;  1M1F A;  2P0Q A;  2DAQ A;  4D6W A;  2M16 A;  1ZQ1 A;  4J7F A;  1M5Q 1;  3SWN B;  3L2W A;  1OI1 A;  3M55 A;  5GAO p;  3RKW A;  4BE2 A;  2RHI A;  4OGE A;  5IT9 E;  5LJ3 h;  1M1K C;  1OZ2 A;  1M9S A;  2DTO A;  4R56 A;  4XQ3 A;  4M7D E;  1RI0 A;  3CC2 T;  1VQP T;  2MAM A;  1YCY A;  1TH7 A;  3PNW C;  2P0K A;  4M78 G;  4C0D C;  4HT8 A;  3L2Q A;  4JRK A;  2HAX A;  1H64 1;  2M0O A;  1VQM A;  3UT1 A;  2PUO B;  1JB0 E;  4M7A F;  5D6W A;  2XDB A;  3SB2 A;  4QVC A;  2MI6 A;  1YI2 A;  4BI8 B;  4E7J A;  3OS5 A;  2GCX A;  2RHX A;  2X4W A;  5GAN h;  3OYJ A;  3JB9 J;  2JZ2 A;  2XHC A;  4OGC A;  1KD1 C;  4IUV A;  3RKX A;  3X24 B;  3JCM b;  2KQW A;  2R58 A;  2V8I A;  4MZT A;  4QQG A;  4JRI A;  5CR2 A;  2ZGW A;  1YIJ T;  1Q86 C;  3GLX A;  2K57 A;  2IG0 A;  3CC4 T;  1XQH A;  4LDV A;  2PU9 B;  2Y4X A;  3I56 T;  2GFA A;  3BDU A;  4BUG A;  4C8Q C;  3HRS A;  2VGM A;  3L2Z A;  4F7U B;  3QYH B;  3MP6 A;  3V7C A;  5GAN 3;  4M7A E;  2CYZ B;  1OYX A;  5GAO q;  3X26 B;  1UGR B;  4DOW A;  5LJ5 e;  1YJN T;  2CZ1 B;  3MET A;  1VQ4 T;  1JRI A;  2A7Y A;  3FB9 A;  3QYG B;  4PKC C;  1VQO T;  2K3Y A;  2RHZ A;  2LCC A;  2DKG A;  3OYI A;  3DLM A;  2RJE A;  1VQ7 T;  2MMP A;  3M9Q A;  2QQ9 A;  3OW2 S;  4C8Q B;  5I2M A;  2ZPE B;  4C5G A;  1B34 A;  3BDL A;  3OYG A;  2XD0 A;  2G3R A;  4C92 G;  4PL6 A;  1LNX A;  3GNF B;  2EQU A;  3X25 B;  2DXU A;  3OYK A;  2P0P A;  5CCA A;  1Y7X A;  3CCM T;  1VQL T;  3HPW A;  4N0A A;  4OVA A;  1K73 U;  1WPY A;  2R5A A;  4RKU E;  3HKS A;  3M57 A;  3MP1 A;  1M4Z A;  2DD4 A;  4L6V 5;  5KCO A;  2LX9 A;  3OY9 A;  5J3B A;  4PJO F;  5I2S A;  2XKO C;  2L3R A;  3JCM P;  4M7D B;  3GNG A;  2V8K A;  4CRI A;  2CS7 A;  4NL2 A;  5GAN d;  2QEX T;  2OTL A;  3CCL A;  3MEA A;  3S3M A;  1LJO A;  1WJQ A;  1OZ3 A;  1WQW A;  3KXT A;  2XG8 D;  1KQS S;  2GF7 A;  1UB4 A;  4A4K A;  2CZ6 B;  4A4E A;  4DA4 A;  3LGF A;  3C4S A;  3I55 A;  1YJW A;  4PLI A;  4XTX A;  4XTU A;  2EJ9 A;  4M77 G;  3RMQ A;  1WJS A;  4QQ6 A;  3OSS C;  4TVR A;  2LVM A;  3JCM e;  3CCS T;  3A5Z B;  1YIT T;  3JCM W;  2E41 A;  2O4X A;  5LJ3 f;  1JJ2 S;  2LTO A;  1YBY A;  2EFI A;  4Z02 A;  4II1 A;  2DK3 A;  2RK2 A;  2R57 A;  5CKD A;  3CBM A;  5LJ3 j;  3PT9 A;  2D6F A;  4E7L A;  2DIQ A;  2YLC A;  3CXC A;  2O01 E;  5L8R E;  5GAN 6;  2RJD A;  5IAY A;  2JTM A;  3VKI A;  4M7A B;  4M75 G;  3GOX A;  3CCU A;  1K9M U;  1ZBX A;  4C5H A;  2V8J A;  3NTK A;  3S6W A;  3QZ5 B;  5GAN f;  3DB3 A;  1VQO A;  4ATO A;  3RUX A;  2XDD A;  3UWN A;  2RH2 A;  5HY6 A;  5GAN j;  3C95 A;  3L2U A;  1O75 A;  1KHI A;  4IUR A;  3UDC A;  4C5E A;  3NTH A;  2DTH A;  4R55 A;  3TEE A;  3CCV T;  1X75 C;  5GAO r;  4N0A C;  5D6Y A;  4L59 A;  3GPL A;  4XK8 E;  5GAM d;  4M78 A;  5CO7 A;  4NL3 A;  2YRV A;  5FU7 C;  1PSE A;  3PTA A;  4ELZ C;  2LCL A;  4X34 A;  2RHU A;  4EMK A;  3MEV A;  3QXE B;  3KUF A;  1VQ9 T;  2E5Q A;  3QUI A;  5FRO A;  2E70 A;  2HNI A;  4FSX A;  4A4G A;  1P92 A;  2FVU A;  2E1H A;  3OYH A;  3FC3 A;  2VV5 A;  1M1G A;  4Y91 A;  5CAI A;  3J80 E;  4EPC A;  1BKB A;  1XTD A;  5FU7 B;  3E1S A;  1Y96 B;  2LQ8 A;  3ME9 A;  3SDZ A;  3HP9 A;  4N4G A;  2CZ0 B;  4KT0 E;  2KMT A;  4JDS A;  3FIF A;  4C0Z A;  2XK0 A;  4JS4 A;  4QVD A;  4XU2 A;  2X35 A;  3L2R A;  1Q81 U;  4P5N A;  2RO0 A;  5CKE A;  1KQ1 A;  5FU6 B;  3RMS A;  4CI0 C;  1BYM A;  4ZTJ A;  4Y28 E;  2PQW A;  4ZN3 A;  3FRN A;  3CCS A;  4E7K A;  1N27 A;  1HXD A;  4J7I A;  4WF2 A;  2DIG A;  2F5K A;  5FLX E;  3QSU A;  3P8H A;  2K2V A;  2RI2 A;  3QG1 A;  4PJO B;  3LWH A;  1AHJ B;  1ZHI A;  2LRQ A;  1BI2 A;  5CKB A;  4C92 A;  5GMK h;  1X01 A;  2YLB A;  2X4X A;  2BUD A;  4IUU A;  2QQA A;  3CEY A;  3MHX A;  3CCR T;  3JB9 H;  5LJ3 e;  3VYH B;  4NS5 A;  4NOY A;  5GAN 7;  1K8A U;  3WVE B;  3MO8 A;  4L5G A;  4M78 C;  3T9N A;  4A4F A;  3OBW A;  1M8V A;  4E47 A;  4A53 A;  2L5Q A;  3GF5 A;  3JCM X;  3C94 A;  3QPH A;  3E19 A;  2YHT A;  4OB3 B;  4HKE A;  1NJI C;  3JB9 F;  4EMK C;  1V29 B;  2EKO A;  1VQ5 A;  5FRN A;  2ZZD A;  1YJ9 T;  4J6X A;  3QHS A;  4J6W A;  4KBM B;  1D3B B;  5IN1 A;  2RJF A;  1VQN T;  3JCM c;  1M1K U;  2KY9 A;  2VUB A;  1QW1 A;  2QQR A;  4X9D A;  4C0D B;  1QVP A;  2M1H A;  2MF2 A;  2XU8 A;  4OMF B;  1BI0 A;  4MZP A;  4BD3 A;  4QVZ A;  2K5L A;  2E6Z A;  1UGS B;  4VUB A;  4EMK B;  5GAO n;  2XDP A;  3NFC A;  3GP8 A;  2PVD B;  2F69 A;  4M77 A;  2VC8 A;  4QQD A;  4F7U G;  4RG8 A;  5C0M A;  1WQ7 A;  1KD1 U;  3CCE T;  3R6O A;  3LWI A;  2EQJ A;  2DZ9 A;  1W2B A;  3LW5 E;  3CC7 A;  1Q86 U;  2KAF A;  3EFR A;  3V8K A;  4JUV A;  3QJ6 A;  3P8D A;  4XTZ A;  4JLG A;  3G4S T;  4C0G A;  1U1S A;  1VQK T;  2Y90 A;  5CQY A;  5DY9 A;  5CIU A;  4M75 A;  3JAM E;  4OP0 A;  2QQB A;  2CZ7 B;  2QXF A;  4C92 C;  4KUD K;  3QJY A;  5A2Q E;  4BDZ A;  2PVG B;  5CQX A;  3HRU A;  2E64 A;  4XTW A;  3FJP A;  1Q7Y C;  2LQK A;  5LJ5 h;  2ZPG B;  2L8D A;  3G71 T;  5GAM h;  3LX7 A;  5GMK m;  1MHN A;  4N4H A;  2DO3 A;  1FXX A;  2B8A A;  3OA6 A;  3S3O A;  3VUZ A;  1QVF S;  3E9F A;  3CC2 A;  2JVV A;  5LJ3 g;  1VQP A;  3VV0 A;  3OS2 A;  2EJF A;  1G3S A;  2DD5 A;  4C0F A;  3JB9 I;  4IKF A;  4M78 D;  4MDX A;  2RM4 A;  4M7D G;  1KC8 C;  3PFS A;  3PMT A;  1VUB A;  2LNV A;  3X28 B;  4BI4 A;  5GMK l;  4YTL A;  2OTJ T;  4J8O A;  3JCM Q;  2I2L A;  3OYF A;  3CPW A;  1BIA A;  2KSS A;  3QBY A;  4RCB A;  4BB7 A;  3A8H B;  3CXC S;  1NPR A;  5GAN g;  3DKM A;  3BY7 A;  1U1T A;  2LT1 A;  4FT4 A;  3OYM A;  3OMG A;  1I4K 1;  3C12 A;  2GQV A;  1VIE A;  4XTV A;  5D6X A;  4M77 C;  3EFS A;  4N4I A;  3QII A;  1M90 C;  2ZCF B;  3CC4 A;  3OMC A;  2E6N A;  1N8R C;  3I56 A;  4FL6 A;  1N9R A;  3CME T;  2GFU A;  4BE0 A;  3CPF A;  5GMK j;  3ER0 A;  2DXC A;  1XNI A;  2WSE E;  3A8L B;  4OB1 B;  2D0Q B;  4M78 F;  4B9W A;  3LH0 A;  3CCE A;  1YJN A;  1KQ2 A;  2DXT A;  1GXI E;  3G6E T;  3CD6 T;  1VQ4 A;  4M75 C;  3TRE A;  4M7A G;  3G7Z A;  4B9X A;  1X6O A;  4EDU A;  4RG2 A;  3JCM h;  1BI3 A;  3OBY A;  1VQ7 A;  3BW1 A;  3SWN A;  3HRT A;  4ZGD B;  4ELY C;  3HFO A;  4E7I A;  3MEW A;  3Q1J A;  3DB4 A;  2K4Y A;  4XAX B;  5LJ5 d;  1W4S A;  1WGS A;  2D9T A;  4C92 D;  1KQS A;  2WSC E;  4KUL A;  2F5T X;  3AHU A;  1N9S A;  5CK9 A;  2QI2 A;  1B34 B;  3CCQ T;  2HBP A;  2XID A;  2E12 A;  3CCM A;  1VQL A;  3J7A F;  4M78 E;  2FHD A;  3RIR A;  2RA2 A;  4MML A;  2HQX A;  4OF1 A;  1VQ8 T;  4PNO A;  4JRQ A;  2HQE A;  4IUQ A;  4MDW A;  3S3N A;  2WSF E;  1IZ6 A;  1VQM T;  4JLI A;  3P8B B;  3JCM J;  2QEX A;  1EIF A;  4BI3 A;  5M9O A;  2FL7 A;  1VQ6 T;  5CKF A;  2QDY B;  2K5I A;  4LDU A;  5C6S A;  3A8M B;  1Q82 C;  3PGG A;  4C92 F;  1KHC A;  4F7U A;  2FB7 A;  2JN0 A;  5LJ5 f;  1MGQ A;  2ZPB B;  4ZGJ B;  1YIT A;  4M77 D;  4ZN1 A;  4BY6 C;  5GAM f;  3CCJ A;  3H8Z A;  5KH6 A;  1U8R A;  5DLO A;  5DM7 R;  4EMH A;  5LJ5 j;  3QKJ A;  4F7U E;  3OYL A;  3CMA T;  5GAM j;  3N5B B;  5GAN 4;  2X4Y A;  3CME A;  2L89 A;  2O4X B;  4RCC A;  1YIJ A;  2XI9 A;  2ZPI B;  4PJO G;  3QO3 A;  1YJW T;  5KCH A;  3JCM d;  3SWN C;  2RI5 A;  4LD9 K;  3M5A A;  3UPU A;  4M75 D;  3A8O B;  3OYE A;  1BI1 A;  1S72 T;  2K5F A;  2RJC A;  5GMK e;  4C92 E;  4FM4 B;  2PVO B;  4HCZ A;  3SFM A;  4ZTF A;  3OSV A;  2M9U A;  1UEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...