2R5MA

Crystal structure of the two mbt repeats from sex-comb on midleg (scm) in complex with peptide r-(me)k-s
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPGHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Polycomb protein Scm
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5mA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5mA01
3L42A 2QQSA 4QQDA 2E6NA 2DIQA 2E5QA 2X4WA 2JZ2A 2EQKA 3C4SA 4EDUA 4BDZA 3ME9A 4A4FA 1OYXA 1WJQA 4II1A 3CEYA 4BE1A 5C0MA 2RO0A 3LGFA 4Z02A 4UC4A 3L2VA 4BE2A 3FLGA 4N4IA 3OYHA 3NTIA 4C5GA 3P8HA 4CRIA 5M9OA 3OYDA 5D6YA 5C6SA 4FU6A 2M16A 3S6WA 2RJFA 3OS0A 3M9QA 3PNWC 2D9TA 3FDRA 4A4HA 3MEWA 4QQGA 3PMIA 2BUDA 2RHXA 1OI1A 2BIVA 2F5KA 2K3XA 2X35A 3DB3A 3LH0A 4FL6A 3OY9A 3OYJA 3LGLA 3PFSA 3SD4A 2WACA 4QW2A 4E7LA 3MEVA 2DIGA 2M1HA 5KE3A 2EFIA 2HQEA 4IUQA 4E7HA 1H3ZA 2RI2A 2XK0A 2K3YA 4IUPA 4B9XA 4E7IA 2RHIA 2R57A 4IURA 3QBYA 5D6XA 2EKOA 2B8AA 3NTHA 3OYAA 2O4XB 3DLMA 3FEOA 1WGSA 2R58A 3ZEHA 4E7KA 2MWPA 3OB9A 3OS1A 3MP8A 3S3NA 4PLIA 2MWOA 2RI5A 5J26A 3GOXA 3OA6A 1XNIA 4ZTJA 4BD3A 4QQ6A 3FC3A 2M0OA 3MP1A 3OQ5A 4RG2A 5FROA 3Q1JA 1WJRA 3MEUA 4BACA 2RI3A 5KCHA 2DAQA 4HCZA 3MO8A 1MHNA 3OS2A 3UWNA 2JTFA 5IAYA 2LVMA 3KUFA 4N4HA 1N27A 5KCOA 3L2QA 4E7JA 3P8DA 3O8VA 3OMCA 2YRVA 4PLLA 4QVZA 4IUVA 5FRNA 3LLRA 2P0KA 2EQJA 2CKKA 5J39A 4BE0A 3OYIA 3OYEA 3S3MA 2LRQA 3QIIA 4C5EA 3ASKA 2PQWA 4A4EA 2QQRA 4LD6A 2G3RA 3OYMA 5IN1A 4NS5A 3OYCA 2NLUA 2XDPA 4BDYA 2X4YA 2GFUA 2LCCA 3MEAA 3L2WA 2R5MA 3OYBA 4C5IA 3OYNA 5KE2A 3OMGA 1G5VA 1RI0A 3META 4L59A 2IG0A 1SSFA 4N4GA 4PL6A 2LTOA 3NTKA 4ZTFA 3OYLA 2L3RA 2RJDA 2R5AA 3BDLA 3LYIA 2EQMA 3QKJA 4IKFA 4Q5WA 3PMTA 3OYKA 4X34A 4GY5A 3UT1A 3L2UA 3OYFA 2GF7A 2RJCA 3QJ6A 2HQXA 1OZ3A 2VYTA 2O4XA 3E9FA 2L8DA 2LDMA 2RHYA 2RJEA 5FRMA 3F70A 2RHUA 4A4GA 3L2RA 4IUUA 4C5HA 3S3OA 1WJSA 1OZ2A 3DB4A 3EAEA 5KH6A 2BKDN 2EQUA 3LX7A 2L89A 3E9GA 5CIUA 4B9WA 1KHCA 5D6WA 2X4XA 3MP6A 2FHDA 3OYGA 4OVAA 2GFAA 3H8ZA 3H6ZA 4IUTA 2RHZA
chains in the Genus database with same CATH superfamily
1K9MU 2JTMA 1Y57A 2E6NA 3RKYA 2K3BA 2RO0A 2CGHA 1NEGA 1M1GA 1MUZA 3VJPA 1I0CA 2VASA 5M9OA 2HMAA 4FU6A 8AT1B 4C8QC 1M90R 4FSXA 2BTTA 5GANe 3LH0A 1RAEB 2P0PA 3JCMW 3QWYA 4PJOF 3CCUT 4X9DA 1NBEB 2OJ2A 3CXCS 2EFIA 1VQLT 4L6V5 1WXTA 3V8KA 3EGDA 4RCCA 3SDZA 1PG5B 3Q1JA 3FB9A 2AKKA 1W2BA 3A8LB 4XTZA 2E64A 4LUDA 1PHTA 2J6FA 2JTFA 4AFSC 3X25B 2VXFA 5GAN5 3JCMe 1ZBXA 3O8VA 1BI3A 3EH1A 2MCNA 4RTXA 2J06A 3HTRA 2QXFA 3X26B 2JN0A 3VRYA 3EG3A 2X4YA 4M7AA 3MEAA 3OMGA 1P92A 2KVQG 3A1PA 1B3QA 3REAB 2DJZA 4IKFA 4FSSA 3PMTA 1K73R 2AHJB 1K9MC 3CBOA 2RJCA 1UFFA 2JMAA 2M0YA 2CP3A 1EIFA 5GANj 3QUIA 4M4ZA 3HHTB 2DERA 2QK0A 2F1LA 1NYGA 1NM7A 1TH7A 4QQDA 4XU1A 1S72T 5CQXA 2LNVA 1EX4A 4XU0A 1S72Q 1YNZA 2QDLA 2X51A 2F69A 3CEYA 3G4SA 3TU4K 5CKDA 3FJ5A 4NL2A 3FLGA 3NTIA 2JJ9A 3JCMX 2YRDA 5GAN4 3S6WA 2YWWA 2CH4W 2XICA 3PMIA 2MK5A 3M54A 2PU9B 1OEBA 1TG0A 4QW2A 2L0AA 2W10A 2M1HA 4F16A 1M3BA 3WXMB 4KBMB 4BB7A 5D6XA 2DXTA 2J7IA 2DD4A 5I21A 3MP8A 4PLIA 2RI5A 1BBZA 4Z89A 3EG9A 1MMDA 5KYUB 2K5LA 1ABOA 2DVJA 2C0IA 4HCKA 3ZFJA 1WZOA 3OW2S 4D8DA 1YI2T 5LJ5d 5KCOA 1M5Q1 3V8LA 2NUPA 3VKIA 2QA4Q 1I1JA 2EYWA 4FW1A 1VQ6Q 2DJQA 3JB9H 3CC2Q 1AVZC 1K9MR 1FX7A 4N0AA 2AIRB 2YLCA 3G71T 2FVUA 5LJ3j 1VQ7T 2JM8A 2QQBA 4LDYA 3CCET 1SSFA 2OTLA 3C0CA 3JCMV 3OYLA 3MJXA 1VQKT 2R5AA 1PSEA 4XTVA 4V2SA 1ZHIA 2X3WD 4ATOA 3OS5A 2OTJQ 3VS7A 4J6WA 3OYFA 1B7TA 2F5TX 5CAIA 1KQSA 2Y4XA 4F7UF 3F70A 2HQHA 2KXDA 1N6AA 5ECAA 4J9IA 2PNIA 4CC3A 4ELZC 3CCSQ 1ZA2B 1ZLMA 1X69A 3V7RA 2FRYA 2DIQA 2X4WA 1Q7YR 4OMLA 5CKBA 4M78A 3X28B 3UA7A 2DYBA 5AYFA 1W70A 1QP3A 4JUVA 2JW4A 4E7SA 5L8RE 1TSFA 2XDBA 2QGGA 1TU0B 4QQGA 2RHXA 3M0QA 2F5KA 1R77A 4PFZA 2RMOA 1VQKA 2J6KA 3PFSA 3SD4A 3CCRA 4A54A 3NTHA 1QWEA 2B8AA 3EFOB 1I8FA 2R58A 3QZ5B 4DBFA 3HFNA 1AWJA 3M57A 1WLPB 2KE9A 1VQNT 1YITT 3OS2A 3RDVA 3INZA 3RERA 2BE7D 2RPNA 2K2MA 2IIMA 3OMCA 1NYFA 1PKTA 2ZZDA 4KGZB 4C8QG 1YHQA 4M75A 1M1FA 4QT7A 1XOVA 2LRQA 4LDWA 3LWIA 1OU9A 2AK5A 4QKUA 1UJYA 1YJ9Q 4OGCA 3L2WA 3EGXA 2BE9B 4FIBA 4HVWA 2E70A 2JS2A 1LNXA 5HK0A 1FMKA 2A08A 2C0OA 2A7YA 1Y71A 5L23A 1VQPT 1SF9A 4CC2A 2MIOA 2EJ9A 3G71Q 3CCUA 2RJEA 1Q7YU 1BCOA 5IHIA 2JM9A 1M2VA 2QYZA 3I55A 3GLXA 2GFAA 4E7JA 1AWWA 2JZ2A 3EH2A 5IT9E 1JJ2S 2MMPA 5CKHA 3FIFA 2D8JA 4J83A 1VYTA 3OYDA 3AHUA 4D8KA 1M8MA 4E47A 1U5SA 1TUCA 2DL8A 3C94A 1V29B 1WHLA 2QEXQ 3GF5A 4LNPA 2KQWA 2QEXT 2D6FA 2DIGA 1UGQB 1YJWA 2HQEA 2VC8A 5GANh 3OYAA 1RAFB 4AG2C 1JO8A 1BU1A 4Z8AA 1NE8A 2MWOA 1M3CA 1OV3A 4QQ6A 4C92A 4J6YA 2LQNA 3EHQA 3MEUA 1D0XA 4R56A 1PRLC 1SPKA 1VIFA 1M1KR 1SRMA 1OOTA 2PUOB 2QQ9A 5FRNA 3SWNA 2HL5C 1VQ8T 2AKLA 3DLLA 3JCMP 2ZPBB 3C12A 1YCSB 3I5SA 3CCRQ 3QHSA 1IGUA 1N5ZA 5LJ3f 3UA6A 4JJNK 4M77B 5CKFA 4DEXA 2X3XD 3VS1A 5KYYB 2ZPGB 1PD0A 2K57A 3E9FA 5CVIA 3H0IA 2F2XA 5CR2A 4IUUA 1XQHA 1OU8A 2NUTA 2JTEA 4M7DC 4MMKA 5GJVB 4M7AG 1WDXA 3C95A 4A4FA 2CS7A 5CK9A 2E6ZA 2A3LA 4EMKA 4C92E 3L2VA 3M56A 1UG1A 1H641 2ZCFB 2Z0WA 2VXEA 2C0TA 4KGVB 1AZEA 2FEIA 4JZ4A 1VQMQ 2LJ0A 3LGLA 3NFCA 2EAYA 1TTHB 2K3YA 5LJ3d 1JEGA 4DBRA 2R57A 3L2ZA 2EWNA 4A4KA 2DZ9A 2A37A 3MKDA 2MF2A 3R6OA 2RN8A 2B86A 3TCJA 1K0XA 2JXBA 5I2SA 5HK3A 5GAMh 4C92C 2LQ8A 4ESRA 1IB8A 2PUKB 5FLXE 3JB9I 3UF4A 3VS4A 2LX9A 1HK9A 4M7DB 3LLRA 1Y7XA 1YJNT 1IHVA 3QIIA 2XDDA 2DPPB 2ZPEB 3CMET 1K76A 4M7DA 3OYMA 3I55T 3QZ9B 2CZ1B 2E1HA 5GANd 2DFUA 2MPXC 2LCCA 3VS3A 1YJWQ 2MI6A 2E5KA 1ABQA 4XK8E 1PWTA 2EQMA 1OPKA 2ED0A 2X9HA 1SHGA 3V8JA 4PJOG 1BIAA 1JBMA 2I2LA 4M75E 3L2RA 4A4GA 1W6XA 4ZN3A 2CYZB 1CKBA 1N9SA 5KH6A 3CC4Q 4X9CA 1KHCA 3TQ7P 4EMHA 3EGXB 4PJMA 3ZL7C 1E6HA 2G6FX 4A53A 2CREA 2E5QA 3SWNC 1NPRA 3URGA 2WSFE 3HP9A 3CMEA 5FU7B 4C0FA 3OBYA 3P8HA 1AD5A 3EG1A 2K79A 1DJ7B 3M4YA 3MEWA 4C0GA 4J6XA 2OTLQ 1PNJA 4M77E 1VQPQ 2NWMA 3LH5A 1VUBA 1RAAB 1IHWA 1H3ZA 2DNUA 1Q7YC 1TXQA 2XIDA 2EPDA 2FPEA 1OX8A 3S3NA 4XTYA 2CSIA 2KI7A 1AHJB 1OULA 3REBB 4BD3A 2JOYA 5IXFA 1QLYA 1WJRA 1VQMT 4ZGEB 3JCMh 4KH1B 1Y0MA 3CCSA 1QVPA 4N0AC 5IXBA 1T3SA 2CZ6B 2XHCA 1MMNA 1ZSZA 1T0JA 2JUFA 1MMGA 2M9UA 2EVRA 4J9GA 5GMKh 5GANg 1M3AA 1YI2A 3CCQT 2EYXA 1HJDA 5CKEA 2IVWA 4J9HA 5GAMg 1XJWB 5KE2A 2HNIA 1R8OB 4PL6A 5IHNA 1Q82C 3CXCA 3QJ6A 2DMOA 1OZ3A 3RBBB 1QW1A 2LDMA 4JDSA 1VQ8A 1M1KU 4FYVB 3HRTA 2V26A 3M0SA 3QG1A 1Z9QA 3E9GA 4HCCA 5D6WA 1KSWA 2D9TA 1YIJQ 1LJOA 1QP2A 1VQ8Q 2O31A 4M78D 4L5GA 5C0MA 1S72A 3JCMc 4J9BA 1VQ9T 5D6YA 2HSPA 4M7DG 3OS0A 5CCAA 4DBHA 4DBQA 2C06A 1D0ZA 3CCVQ 1Y96A 2V8JA 4MZTA 1TWBA 3GIBA 3CMAA 3EG9B 1G3YA 1WGSA 1WHJA 1QKWA 1KD1C 3V7SA 1XNIA 2ZPFB 3FC3A 1WHKA 5FROA 3UDCA 4F7UA 2A28A 1RAIB 3OSSC 1ZSZC 5HY6A 3RR6A 1Q82R 4LN2A 2CP2A 4XTUA 1YP5A 3UWNA 2VVKA 1QMCA 2D0QB 5GAOl 1KC8C 3QDRB 1H3HA 2YRVA 3VU3C 1LVKA 2OTJA 1MNDA 2A0FB 3RKWA 3OYEA 1VQOA 1HXDA 1JB0E 2YT6A 3S3MA 4YTLA 2DTIA 2YUQA 1TUDA 3H0FA 1N9RA 1VQPA 4ZGDB 3M0RA 3G1JA 1GCQC 2KEAA 2DZCA 3SB2A 2EJGA 1K8AU 3JSCA 2DBKA 3CPWS 3E2UA 4C92B 4Q5WA 4BI8B 2M02A 4X34A 2DE0X 4J8OA 1GFDA 3THKA 1JJ2P 5FU6C 4F7UE 2KRSA 3VUBA 2FL7A 1QWFA 4F14A 3FRNA 1HSQA 3RUXA 2FZKB 1D1CA 3S3OA 3EAEA 4IIMA 5A0LA 1ZX6A 3VS2A 4GLKA 2FPDA 1Q86U 2YDLA 4IUTA 3OSVA 1YJNQ 4M7AB 2ENMA 4KUDK 1VIEA 1OYXA 2CUBA 1YI2Q 1O9SA 4F17A 1BI0A 2KROA 4PJJA 4UC4A 5GMKm 3QJYA 3G4SQ 2COZA 4HVUA 4C5GA 1AZGB 1QVGA 4PJOD 4RG8A 2X4JA 3GNGA 1QCOA 1VQ6T 3J80E 2P0QA 4OF1A 2E4HA 2K7AA 3RESA 3QO3A 4JZ3A 4F7UB 1RACB 1Q81U 4TVRA 4M7AD 1HYOA 3JV3A 4E7HA 4XTXA 2DXUA 1R0CB 4M78C 4OB3B 2RHIA 5GMKl 4GBQA 4C8QD 1U3OA 2F2VA 3EG2A 2DM1A 2D1XA 4LDXA 2RF0A 3CPWP 5HCKA 2OX7A 1YIJA 1JRIA 2KGTA 1ZA1B 2KYBA 1EFNA 4Z88A 2O9VA 3KUFA 2ED1A 4QVZA 3M4GA 2VGMA 3QYHB 4JJBA 1V76A 1CKAA 4Y92A 3I5RA 2G3RA 2ROLA 3D7SB 3J81E 1VQOT 1KQ2A 1MV0B 4AT1B 2HBWA 3CMAQ 5DM7R 1VQMA 1QVGP 1G5VA 3NTKA 2VKNA 2L2PA 2YUOA 3RNJA 3M53A 1A0NB 2L3QA 3LYIA 2KBTA 2DKGA 1ACMB 2K5IA 1K4US 1M8VA 1M2OA 2JT4A 5CO7A 2EBPA 1SHFA 4PJOE 2XG8D 2QA4A 3H9NA 4C92G 1I5OB 4M75F 3WVEB 5I22A 1MMAA 3PTAA 3CC7A 1JQQA 2LX7A 2QASA 2SRCA 3TSWA 2E3HA 1H92A 1AWXA 3DKMA 4OMQA 2ATCB 4LE9A 3JB9J 4JLGA 2DO3A 2FG0A 1M90U 1UGVA 3LGFA 3SWNB 2RQUA 2VWFA 4BI3A 3JCMJ 1YJNA 1WNLA 1YFNA 1G3SA 1K0SA 4D6WA 1X6OA 1EZZB 2LQWA 4HVVA 4R0KA 2JMCA 2RI2A 2YUNA 2YHTA 3CCLQ 1UE9A 4ME7A 4PFOA 3CCLT 4DOWA 1YJWT 4FW2A 3OB9A 3E19A 3CC2T 1AEYA 4CI0C 4M77A 4DEYA 1OX9A 5KCHA 4P5NA 2KXCA 2IPOB 2KMTA 2A36A 1ZUYA 4HCBA 1MHNA 3RMQA 1ZSGA 3M0TA 3TREA 5IH2A 4C0ZA 3L2QA 1UGRB 2RK1A 4EIKA 1Q86C 3EFRA 2Y4YA 1Q86R 1U1SA 4KULA 2MYSA 1LCKA 3GPLA 4LD6A 4JJDA 5IN1A 1UGSB 4XU3A 4ZGJB 4OMPA 3BE3A 4RUGA 3E1SA 2E3IA 4XQ3A 1RI0A 2O01E 4MZMA 2V8IA 1KQSP 2CP7A 4HA8A 3L2UA 4ELYC 2JS0A 2RQRA 4J7FA 1VQ5Q 2ZAEA 3M0UA 1PCXA 2GNCA 3FJPA 2EGAA 2L89A 2LNHB 1SSHA 2V1QA 3CD6Q 4KUIA 2CP5A 4M7AE 3UPUA 2VB6A 1WQWA 4M77D 1Y96B 2RHZA 3I55Q 3UATA 1YJ9A 3MHXA 1VQ5A 1X01A 2GTOA 2PTKA 4EPCA 2DETA 1Q95G 3HPWA 1D1BA 4J9CA 4M78G 4N4IA 1D3BB 4CRIA 2XD0A 2GCXA 4OP0A 4M7DF 3CCMT 1KG1A 2Y90A 1NEBA 1GRIA 2BUDA 1VOMA 2YXYA 3OYJA 2QEXA 4IUQA 1NG2A 2E41A 1ZBJA 4DOVA 1X2QA 3OS1A 3OBWA 3QWXX 1X6GA 4DA4A 3OQ5A 5I11A 4EMKC 5FW9A 3I9QA 1YJ9T 2DVEA 4B6MA 1OPLA 1PSFA 2QG9B 2LVMA 3G4ST 1BB9A 3NPFA 3PVLA 4C8QB 4ZN1A 1B34B 4MDWA 4M78B 2PZ1A 2QDYB 2QQAA 2VGNA 2ZPIB 4NS5A 1K73U 1VQ7Q 3U23A 1RLPC 2HEQA 3A8HB 2DL3A 1U06A 2IG0A 2F2WA 7AT1B 3I56A 5GAOn 5GMKe 4KH0B 1M27C 2OTJT 1I07A 3OYKA 3SHWA 2DXBA 2CP0A 2GF7A 3VRZA 4R55A 4AFZC 4M7AF 1UB4A 1BYMA 2COYA 5GANf 1QVFA 2AZVA 4BUGA 1NPPA 1QQJA 3CCMA 2LZ6B 3SEMA 3GP8A 3VS6A 1HD3A 1LOJA 1G83A 4L59A 2K2VA 1FMVA 2MAMA 2H8HA 4II1A 3J7AF 1VQOQ 3CQTA 2ABLA 3CMAT 1RLQC 1B34A 4FYWB 2W0ZA 5KYNA 1KK7A 5LJ3e 1KJWA 4IIOA 2WSEE 2RB6A 4A4HA 2LCSA 1OI1A 2K3XA 4FL6A 2COWA 1T0HA 2WACA 4JPBW 2J05A 1X75C 2GQVA 3ZEHA 3M55A 2QGFB 2HCKA 3OA6A 1IREB 3MP1A 4HT9A 1BI2A 2DA9A 4KRTA 4JS5A 1VQ9Q 3PIOA 3HSBA 1QVFS 5GAOp 4PFPA 3P8DA 2CZ0B 1K1ZA 3RMSA 2HSEB 5FU6B 5J3BA 2P0KA 2EQJA 4O6JA 3WVDB 5GMKi 2O2OA 2OAUA 2XI9A 2NUPB 3BFMA 1NJIR 1GCQA 2PQWA 2KNBB 5AT1B 1JXOA 2NLUA 2HDAA 2XDPA 1X27A 4CC7A 4F04B 4JS4A 5KYUA 2KRMA 2LQKA 2LTOA 3PT9A 2RJDA 1YWOA 2H3JA 1SEMA 5KYXA 1M2VB 3QKJA 4OB0B 1VQ7A 5GAMj 2RA2A 1SKUB 2SEMA 2BZYA 1SG5A 2HKNA 1OZ2A 2EQUA 5CIUA 1FXXA 3TSZA 4C8QF 1VQ4Q 4KT0E 1XTDA 1T3LA 2FHDA 1TS9A 2DRKA 2KT1A 5A2QE 1UEBA 1Q81C 2HL3A 4VUBA 4M75B 4EMKB 3MPUB 3JB9F 4JRKA 4Y28E 2ZGWA 3A8GB 5C6SA 3G6EQ 3NHNA 1TOVA 3R6NA 2HBPA 1WXUA 1UJ0A 2YLBA 2BIVA 5A0DA 3M58A 5KE3A 2L5QA 4M77G 3CC4A 2V8KA 3G6EA 1RADB 4JRQA 4E7IA 3ZBDA 4NL3A 1BKBA 4IURA 1VQ5T 1FYNA 1RL2A 1D0YA 2QTVA 3EG0A 3CCJQ 3HFOA 2RH2A 4HT8A 3LW5E 5EG2A 1MV3A 9ATCB 5GAN7 4J9DA 4MMLA 2GQIA 2L3PA 4N4HA 1WIEA 4J9FA 1PKSA 1GL5A 1UTIA 5LJ5g 3M0PA 4JRIA 2PVOB 4RKUE 4PJOC 1IXDA 4EMGA 3M59A 2XMFA 1RI9A 2DTOA 4BDYA 2KDSA 3OYBA 2CP6A 1U1TA 1WQ7A 1ZUUA 5GAMf 3M5AA 2D8HA 3BDUA 4C8QE 2RQWA 5A0GA 1E7OA 1PM3A 1PD1A 2HQXA 5LJ5h 2O4XA 2RNAA 1M30A 1UECA 2YUPA 4RCBA 3JRZA 1IO6A 3QDFA 2DBMA 3OYGA 2EGCA 1M4ZA 1X2KA 3L42A 2OTLT 2DL7A 4EDUA 4OMNA 2LCLA 1E6GA 1R0BG 5DLQE 3VS5A 3MCAB 2EW3A 3VS0A 3O5ZA 4M78E 1IRXA 2LT1A 1G3TA 1VQ4T 1BI1A 1VQKQ 1NJIU 4OMFB 1VA7A 3CCQA 3CCVA 4C92F 1JJ2A 2VV5A 1RAGB 3JCMf 3SFMA 3EFSA 1B07A 1M1KC 3QBYA 5LJ5f 2YRCA 2DTHA 3BY7A 3FEOA 4HKEA 1M9SA 1WHGA 2EGEA 3PGGA 1KHIA 2H3EB 4RTWA 4C0DB 4RG2A 3CCST 2RM4A 1WA7A 2ESWA 1QVFP 2D0NA 2KT8A 4E2FB 4HCZA 5KYWB 4JJCA 4M75C 2P4TA 5IAYA 3X24B 3CCJA 1W4SA 2BZ8A 1K8AC 2ECZA 4RTZA 4BI4A 1C6VX 4JRPA 2P84A 4OMMA 2E12A 4ORZA 3A98A 3CD6T 4C92D 4C5EA 2DYIA 4OMOA 1MNEA 3CCEA 3KFVA 1VQLQ 1MGQA 3QXEB 4FM4B 2DEUA 2GFUA 4MDXA 3P8BB 2JNGA 4A63B 4C0DC 4AG1C 4AFUC 2AT1B 2WSCE 3LWHA 1I4K1 1WI7A 1WPYA 4FYYB 1KD1U 5LJ3g 3VV0A 1VQLA 4M7DD 3JCMQ 2P4RA 4WF2A 3JCMd 4RTUA 5EC7A 4FT2A 1VQNQ 5KYXB 5GAOr 2RHUA 4F7UG 3RIRA 3QYGB 1I5LA 1GXIE 4M7DE 1UUEA 3OW2P 2GGRA 5LJ5e 3CC4T 1S1NA 3AT1B 4OVAA 3H8ZA 4FYXB 3CCVT 3KBGA 4CC4B 2EJFA 4BDZA 5GAN3 1WJQA 1OQKA 5FWCA 1GFCA 2DILA 1CSKA 4J7IA 4M77F 3CBPA 3OYHA 2LJ1A 2NUZA 3RKXA 3BW1A 2RJFA 4FT4A 2KSSA 1N8RC 2X35A 3DB3A 1W1FA 5KYWA 2VUBA 3I56Q 1AOJA 2AZSA 1K73C 5I2MA 3I56T 2RD1A 1LPLA 3PVQA 2E65A 2GTJA 4K11A 3VYGA 3H41A 1YBYA 1D1AA 5D7UA 2LJ3A 2LT4A 2KR3A 1VYVA 4E6RA 4PJNA 1X43A 2FYKA 2K6DA 2LC4A 1G8XA 4BACA 2FO0A 5GAOq 1WYXA 2CT4A 2EKHA 3IQLA 1W2BS 3MO8A 1WHHA 1W2BP 2DL4A 1QCFA 4PJOB 1YHQT 1YHQQ 2DLPA 5DLOA 2KAFA 3G6ET 1ZUKA 5J39A 3CPWA 3HRUA 5GAN8 2KY9A 3ASKA 1IZ6A 3OYCA 3CCQQ 1YITA 4LUEA 3VUZA 3OYNA 2EYZA 4WTOB 5FWBA 4PJOA 1AWOA 2J6OA 4N4GA 2KK4A 1GBRA 1N8RR 4O5VA 1BCMA 4QVDA 5KYYA 3EFOA 4GY5A 3UT1A 5GAMd 3CCUQ 4OGEA 4XAXB 2RQTA 3NGPA 3A5ZB 2FRWA 1M90C 1K8AR 4JLIA 1WXBA 3JB9G 1WHMA 1WJSA 1KFZA 4E7ZA 3DB4A 2DK3A 3JAME 1QCNA 3MP6A 2O9SA 1U8RA 3CC7Q 5GAOm 2EQIA 1UDLA 3H6ZA 2FZGB 3CD6A 2NYSA 2HKQB 3V7CA 1O75A 1K9AA 1YIJT 2O88A 3OYYA 1QKXA 2KYMA 4MZPA 3CCEQ 4BE1A 3G71A 4Z02A 4C8QA 1VQ6A 1D09B 1UGPB 3CC2A 1RUWA 1YWPA 4BE2A 1KC8U 1VYUA 2CUDA 2HD0A 1Y07A 1ZSZB 3CXCP 3PNWC 3FDRA 1JXMA 2FPFA 4PKCC 2PVDB 3OY9A 3I35A 4DQ2A 3KXTA 4E7LA 5LJ5j 3JB9D 3A8OB 1H8KA 1YN8A 2XK0A 1WFWA 2I0NA 3X20B 1YCYA 4B9XA 1VQNA 4J9EA 2E10A 2ROTA 2EKOA 3ULRB 4PK4A 2BZXA 3CPFA 3DLMA 5IHKA 2MWPA 1C0MA 1X6BA 3GOXA 4ZTJA 4QVCA 5GAN2 2M0OA 4RTTA 2MOXA 4BY6B 5DY9A 4M7AC 1UHCA 1JU5C 2CSQA 2DL5A 4J5YA 1KQ1A 3OW2A 2XKOC 1D3BA 3JCMb 3HL8A 2K5FA 4IUVA 4GLMA 1Q82U 4M75D 4BE0A 1I81A 1N8RU 3EGUA 4A4EA 2QQRA 3H0HA 3CCLA 1BK2A 1KQSS 2CDTA 1FMWA 3PE0A 2R5MA 4M77C 3NMZC 2K4YA 4BY6C 3META 4ZTFA 2LP5A 1TUGB 2GBQA 1FWZA 1YITQ 4Y91A 2JVVA 3VYHB 2LMJA 2FB7A 2K9GA 4LDVA 2DRMA 8ATCB 2L8DA 5FRMA 3EHRA 4HXJA 2BKDN 4B9WA 2XU8A 2X4XA 1KC8R 1BIBA 4LDUA 1UHFA 1GCPA 2QQSA 1WX6A 1ARKA 2EQKA 3C4SA 4LD9K 3ME9A 5LL6S 4AMCA 1PC0A 3G7ZA 4ANJA 3CMEQ 5GAMe 3CBMA 1NLPC 2HZYA 1KIKA 2QA4T 4PNOA 1KD1R 3PIPA 2M16A 3JCMg 3M9QA 5GAN6 3CC7T 1J3TA 1NZ9A 2CT3A 5HKCA 4OB2B 3HRSA 3QSUA 1QVGS 5GMKj 1Z9ZA 3GBQA 3MEVA 4FCYA 1IGQA 5LJ3h 2KRNA 3HKSA 4IUPA 2EYYA 1GBQA 1RAHB 2DX1A 2O4XB 2QAZA 3ER0A 4OB1B 3CCRT 4E7KA 1Q81R 5J26A 5FU7C 3TVTA 2RI3A 1PRMC 3L1AA 1F1BB 2DAQA 3N5BB 1G2BA 1NLOC 3QPHA 2FZCB 2PVGB 5CQYA 2L3SA 1VQ9A 2CZ7B 4M78F 1N27A 4XTWA 2RQVA 2DF6A 4PLLA 1ZQ1A 3GNFB 2CKKA 2OAWA 2V1RA 3OYIA 4XU2A 2HAXA 1G3WA 2QTXA 1AT1B 2EYQA 2QI2A 3TEEA 2DD5A 1SRLA 5GJWB 4RTVA 4C5IA 1VQ4A 3CCJT 2ZPHB 4X1VA 1V1CA 2L3RA 2RK2A 2DEQA 4LXCA 1RABB 2CH4A 2NUTB 3BDLA 4RMOA 3EGDB 1NJIC 4WCIA 4AFQC 2EIFA 2VYTA 4PJLA 1C1AA 2RHYA 4ZNXA 2OI3A 2YSQA 4C5HA 4KGXB 4RTYA 4M75G 2M51A 4NOYA 3LX7A 3T9NA 6AT1B 2DXCA 3A8MB 3CCMQ
chains in the Genus database with same CATH topology
1K9MU 2JTMA 3L42A 2OTLT 2E6NA 3RKYA 4EDUA 3C95A 4A4FA 2LCLA 3JB9J 2CS7A 4JLGA 2DO3A 5CK9A 1M90U 5DLQE 2E6ZA 2RO0A 3LGFA 2A3LA 3MCAB 2CGHA 3SWNB 4EMKA 4C92E 3L2VA 1M1GA 3VJPA 3M56A 5M9OA 4M78E 2LT1A 4FU6A 1G3TA 4BI3A 3JCMJ 1VQ4T 1YJNA 4C8QC 1H641 2ZCFB 4FSXA 2VXEA 1BI1A 1WNLA 1G3SA 5GANe 3LH0A 4D6WA 1NJIU 1X6OA 3LGLA 4OMFB 3CCQA 2P0PA 3JCMW 4PJOF 3NFCA 4C92F 3CCUT 3CCVA 4X9DA 1JJ2A 2VV5A 3CXCS 2EAYA 2EFIA 3JCMf 2RI2A 2K3YA 5LJ3d 3SFMA 2YHTA 3EFSA 2R57A 3L2ZA 2EWNA 4L6V5 3QBYA 4A4KA 1M1KC 1VQLT 5LJ5f 2DZ9A 2DTHA 3BY7A 4ME7A 3FEOA 3CCLT 3V8KA 4HKEA 4DOWA 1YJWT 3OB9A 1M9SA 3PGGA 1KHIA 2MF2A 3E19A 4RCCA 3R6OA 3SDZA 4CI0C 3CC2T 4C0DB 4RG2A 4M77A 3CCST 3Q1JA 2RM4A 3FB9A 3TCJA 5KCHA 4P5NA 3A8LB 1W2BA 4XTZA 5I2SA 5HK3A 2KMTA 4HCZA 5GAMh 4C92C 4HCBA 2E64A 1MHNA 2LQ8A 2JTFA 2PUKB 4M75C 5FLXE 2P4TA 3X25B 2VXFA 3X24B 3RMQA 5IAYA 3CCJA 1W4SA 3TREA 4C0ZA 5GAN5 3JB9I 3L2QA 1K8AC 1UGRB 1ZBXA 2LX9A 1HK9A 1BI3A 2RK1A 3O8VA 4BI4A 3JCMe 4JRPA 3EFRA 1Q86C 3LLRA 4M7DB 2Y4YA 2E12A 1U1SA 4KULA 1Y7XA 1YJNT 2QXFA 3X26B 2JN0A 3CD6T 4C92D 3QIIA 4C5EA 2XDDA 2DPPB 2ZPEB 3GPLA 3CMET 3CCEA 4LD6A 4M7DA 3OYMA 5IN1A 3I55T 1UGSB 1MGQA 3QXEB 3QZ9B 4FM4B 2CZ1B 2E1HA 4XU3A 4ZGJB 2X4YA 5GANd 4M7AA 2GFUA 4MDXA 3P8BB 2LCCA 3MEAA 2JNGA 4C0DC 2MI6A 3E1SA 3OMGA 4XQ3A 1P92A 1RI0A 2KVQG 2O01E 2WSCE 3LWHA 2DJZA 1I4K1 2V8IA 4MZMA 4XK8E 4IKFA 2EQMA 1WPYA 1KD1U 3PMTA 5LJ3g 3VV0A 1VQLA 2AHJB 1K9MC 4HA8A 3CBOA 4M7DD 3L2UA 3JCMQ 4WF2A 4ELYC 3V8JA 4PJOG 2RJCA 3JCMd 1JBMA 1BIAA 2I2LA 4FT2A 5GAOr 4M75E 2RHUA 4A4GA 4J7FA 3L2RA 4F7UG 3RIRA 3QYGB 4ZN3A 1EIFA 2CYZB 5GANj 1I5LA 3QUIA 1N9SA 1GXIE 5KH6A 3FJPA 4M7DE 2L89A 4X9CA 1KHCA 3HHTB 4EMHA 4KUIA 5LJ5e 3CC4T 4M7AE 3UPUA 4OVAA 3H8ZA 1WQWA 4M77D 1Y96B 1TH7A 2RHZA 4A53A 3CCVT 1YJ9A 4QQDA 3MHXA 3KBGA 4XU1A 2LNVA 2E5QA 5CQXA 1S72T 4BDZA 2EJFA 3SWNC 4XU0A 1VQ5A 5GAN3 1WJQA 1X01A 1NPRA 2F69A 3CEYA 3G4SA 3URGA 4EPCA 5CKDA 3TU4K 2WSFE 3HPWA 3HP9A 4J7IA 4M77F 4NL2A 4M78G 3CMEA 5FU7B 4C0FA 3CBPA 3FLGA 3OBYA 3NTIA 1D3BB 3P8HA 4N4IA 4CRIA 3OYHA 3JCMX 3RKXA 3BW1A 5GAN4 3S6WA 2RJFA 2XD0A 2GCXA 4OP0A 4FT4A 2KSSA 4M7DF 3CCMT 1DJ7B 2Y90A 1KG1A 2XICA 3M4YA 1N8RC 3MEWA 3PMIA 2BUDA 4C0GA 2X35A 3DB3A 4J6XA 3OYJA 2VUBA 2PU9B 3M54A 1K73C 4M77E 5I2MA 3I56T 4QW2A 2RD1A 2QEXA 2M1HA 1VUBA 4IUQA 2E65A 1H3ZA 2E41A 3WXMB 4KBMB 1Q7YC 3VYGA 4BB7A 4DOVA 2XIDA 2DXTA 5D6XA 1YBYA 3S3NA 2LT4A 4XTYA 2DD4A 3OBWA 3MP8A 5I21A 3OS1A 4PLIA 2RI5A 1AHJB 4BD3A 2JOYA 4DA4A 3OQ5A 2FYKA 4EMKC 1WJRA 1VQMT 2LC4A 4BACA 4ZGEB 2K5LA 3JCMh 3ZFJA 5GAOq 1W2BS 3CCSA 1QVPA 3MO8A 3OW2S 1YJ9T 4N0AC 2DVEA 1YI2T 4PJOB 5LJ5d 1PSFA 1YHQT 2CZ6B 2LVMA 5KCOA 1M5Q1 3V8LA 2XHCA 3VKIA 3G4ST 4C8QB 5DLOA 2KAFA 4ZN1A 2JUFA 3G6ET 5J39A 1B34B 4MDWA 3JB9H 2M9UA 3CPWA 5GMKh 5GANg 3HRUA 2QDYB 4M78B 1FX7A 2QQAA 4N0AA 5GAN8 2VGNA 2KY9A 3ASKA 3CCQT 1YI2A 2ZPIB 2YLCA 3G71T 4NS5A 1IZ6A 2FVUA 5CKEA 5LJ3j 3OYCA 1YITA 1K73U 2IVWA 5GAMg 1VQ7T 3VUZA 3OYNA 5KE2A 3A8HB 4PJOA 2HNIA 2QQBA 4LDYA 3CCET 4N4GA 2IG0A 1SSFA 2KK4A 1R8OB 4PL6A 3JCMV 2OTLA 3I56A 3OYLA 5GAOn 5GMKe 1Q82C 1VQKT 2R5AA 4O5VA 1PSEA 4XTVA 2OTJT 4QVDA 4V2SA 3OYKA 1ZHIA 4ATOA 3OS5A 2DXBA 4GY5A 3UT1A 5GAMd 3CXCA 3OYFA 4J6WA 2GF7A 4OGEA 4R55A 4M7AF 1BYMA 1UB4A 4XAXB 3QJ6A 5GANf 2F5TX 5CAIA 1KQSA 1OZ3A 1QVFA 2Y4XA 3A5ZB 1M90C 1QW1A 2LDMA 4JDSA 4F7UF 1VQ8A 3F70A 1M1KU 4JLIA 4BUGA 1NPPA 3HRTA 3JB9G 1WJSA 3QG1A 3DB4A 1N6AA 2DK3A 3JAME 3CCMA 3E9GA 4HCCA 3GP8A 5D6WA 3MP6A 4ELZC 1LOJA 1U8RA 5GAOm 4L59A 3H6ZA 2D9TA 2K2VA 3V7RA 3CD6A 2DIQA 2X4WA 3V7CA 2MAMA 1LJOA 1O75A 1QP2A 5CKBA 1YIJT 3OYYA 4M78A 4II1A 3J7AF 4MZPA 3X28B 4M78D 4BE1A 4L5GA 5C0MA 3G71A 4Z02A 4C8QA 1VQ6A 1S72A 1UGPB 3CC2A 3JCMc 1VQ9T 3CMAT 4BE2A 5AYFA 1KC8U 1B34A 1QP3A 5D6YA 2HD0A 1Y07A 4JUVA 4M7DG 5L8RE 3OS0A 5CCAA 2XDBA 3PNWC 3FDRA 5LJ3e 4A4HA 2WSEE 2RB6A 4QQGA 2C06A 2RHXA 4PKCC 1OI1A 1Y96A 2F5KA 2K3XA 2PVDB 4FL6A 3OY9A 2V8JA 4MZTA 1VQKA 3GIBA 3PFSA 3SD4A 2WACA 4DQ2A 3KXTA 4E7LA 3CMAA 5LJ5j 3JB9D 3CCRA 3A8OB 2XK0A 4B9XA 3X20B 1VQNA 1YCYA 4A54A 2E10A 2EKOA 2B8AA 3NTHA 1G3YA 1X75C 3CPFA 2GQVA 3DLMA 1I8FA 1WGSA 2R58A 3ZEHA 2MWPA 3M55A 3QZ5B 1KD1C 3GOXA 3V7SA 3HFNA 3OA6A 1XNIA 4ZTJA 4QVCA 2ZPFB 1IREB 5GAN2 3FC3A 3M57A 2M0OA 3MP1A 5FROA 3UDCA 4F7UA 4BY6B 5DY9A 4HT9A 4M7AC 1BI2A 3OSSC 1VQNT 1YITT 4JS5A 5HY6A 3PIOA 4J5YA 4XTUA 3HSBA 1KQ1A 3OW2A 2XKOC 3UWNA 3OS2A 1QVFS 5GAOp 3INZA 3RERA 1D3BA 2D0QB 3JCMb 5GAOl 3QDRB 3P8DA 2CZ0B 3HL8A 3RMSA 2K5FA 1KC8C 3OMCA 2YRVA 5FU6B 4IUVA 5J3BA 3VU3C 2P0KA 2EQJA 4O6JA 3WVDB 4M75D 5GMKi 1Q82U 2OTJA 2ZZDA 3RKWA 4C8QG 2OAUA 3OYEA 4BE0A 1VQOA 1HXDA 1JB0E 4M75A 1I81A 1M1FA 2XI9A 3S3MA 1YHQA 3BFMA 1XOVA 1N8RU 2LRQA 4LDWA 4A4EA 2PQWA 2QQRA 4YTLA 3LWIA 3CCLA 1KQSS 2DTIA 2NLUA 2XDPA 1N9RA 1VQPA 4ZGDB 4OGCA 3L2WA 2R5MA 4M77C 2K4YA 4BY6C 3META 4FIBA 2DZCA 3SB2A 2EJGA 4JS4A 3JSCA 2LQKA 2LTOA 4ZTFA 2E70A 1K8AU 2RJDA 3PT9A 1LNXA 2H3JA 5HK0A 3CPWS 4C92B 3QKJA 4Q5WA 4OB0B 1FWZA 4BI8B 1VQ7A 4Y91A 2A7YA 4X34A 1Y71A 2JVVA 5GAMj 3VYHB 1VQPT 2RA2A 4J8OA 2EJ9A 2FB7A 5FU6C 4LDVA 4F7UE 3VUBA 2L8DA 2FL7A 2RJEA 3CCUA 1Q7YU 5FRMA 3FRNA 3RUXA 3S3OA 1OZ2A 3EAEA 2BKDN 2EQUA 5CIUA 1FXXA 4B9WA 2XU8A 4C8QF 2X4XA 5A0LA 4KT0E 4GLKA 3I55A 1XTDA 2FHDA 3GLXA 1BIBA 4LDUA 1Q86U 2GFAA 4E7JA 4IUTA 3OSVA 2QQSA 4M7AB 2JZ2A 2EQKA 3C4SA 4KUDK 4LD9K 3ME9A 1VIEA 5LL6S 1OYXA 5A2QE 1UEBA 3G7ZA 1O9SA 5GAMe 1Q81C 1BI0A 3CBMA 5IT9E 4VUBA 1JJ2S 2MMPA 5CKHA 4M75B 4UC4A 5GMKm 4EMKB 3QJYA 2QA4T 4PJOD 3FIFA 4J83A 4JRKA 4Y28E 4C5GA 1QVGA 3OYDA 4RG8A 2X4JA 2ZGWA 4PNOA 3A8GB 3GNGA 5C6SA 2M16A 3PIPA 3J80E 1VQ6T 3JCMg 2P0QA 4OF1A 3AHUA 3M9QA 4E47A 5GAN6 2HBPA 3CC7T 1NZ9A 3C94A 1V29B 2YLBA 2BIVA 5A0DA 4OB2B 3HRSA 3RESA 5HKCA 1QVGS 3M58A 3QSUA 3GF5A 5GMKj 2KQWA 3QO3A 4F7UB 2QEXT 2D6FA 1Q81U 3MEVA 2DIGA 1UGQB 5LJ3h 2L5QA 4TVRA 5KE3A 2HQEA 4M77G 1YJWA 3CC4A 4M7AD 4E7HA 4XTXA 2V8KA 3HKSA 2DXUA 4IUPA 3G6EA 4M78C 4OB3B 4JRQA 4E7IA 2RHIA 2VC8A 3ZBDA 5GMKl 1BKBA 4IURA 4C8QD 5GANh 4NL3A 1VQ5T 1RL2A 3OYAA 2O4XB 3ER0A 4OB1B 3CCRT 4E7KA 1NE8A 2MWOA 5J26A 4QQ6A 4C92A 3HFOA 2RH2A 4J6YA 4HT8A 3LW5E 5FU7C 3MEUA 4LDXA 5EG2A 2RI3A 3L1AA 5GAN7 1YIJA 2DAQA 3N5BB 1JRIA 3QPHA 2PVGB 4R56A 5CQYA 1VQ9A 2CZ7B 4MMLA 4M78F 4N4HA 3KUFA 1N27A 1VIFA 4XTWA 2QQ9A 2PUOB 4PLLA 4QVZA 3SWNA 1ZQ1A 3GNFB 3M4GA 5FRNA 2CKKA 2VGMA 5LJ5g 3OYIA 3QYHB 4XU2A 1VQ8T 4JRIA 2HAXA 1G3WA 2QTXA 2PVOB 4RKUE 4PJOC 2G3RA 4EMGA 2EYQA 3M59A 2QI2A 3J81E 3DLLA 3JCMP 1VQOT 3TEEA 1KQ2A 2DTOA 2ZPBB 2DD5A 2KDSA 3C12A 4BDYA 5DM7R 3OYBA 4C5IA 1VQMA 1U1TA 1WQ7A 1VQ4A 1G5VA 3QHSA 5LJ3f 3CCJT 2ZPHB 4JJNK 3NTKA 2L3RA 4M77B 5GAMf 2RK2A 2DEQA 3M5AA 3M53A 4RMOA 3BDLA 3LYIA 5CKFA 3BDUA 1NJIC 2DKGA 4C8QE 5A0GA 2K5IA 1M8VA 2ZPGB 5CO7A 2EIFA 2HQXA 2K57A 2VYTA 2O4XA 3E9FA 5LJ5h 2XG8D 4PJOE 2RHYA 5CVIA 2QA4A 4C92G 5CR2A 4IUUA 1XQHA 4M75F 3WVEB 4C5HA 4M75G 4RCBA 4NOYA 3PTAA 3JRZA 3LX7A 3CC7A 3T9NA 3JB9F 4M7DC 4MMKA 2DXCA 3A8MB 3OYGA 1M4ZA 3DKMA 4M7AG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L42 A;  2QQS A;  4QQD A;  2E6N A;  2DIQ A;  2E5Q A;  2X4W A;  2JZ2 A;  2EQK A;  3C4S A;  4EDU A;  4BDZ A;  3ME9 A;  4A4F A;  1OYX A;  1WJQ A;  4II1 A;  3CEY A;  4BE1 A;  5C0M A;  2RO0 A;  3LGF A;  4Z02 A;  4UC4 A;  3L2V A;  4BE2 A;  3FLG A;  4N4I A;  3OYH A;  3NTI A;  4C5G A;  3P8H A;  4CRI A;  5M9O A;  3OYD A;  5D6Y A;  5C6S A;  4FU6 A;  2M16 A;  3S6W A;  2RJF A;  3OS0 A;  3M9Q A;  3PNW C;  2D9T A;  3FDR A;  4A4H A;  3MEW A;  4QQG A;  3PMI A;  2BUD A;  2RHX A;  1OI1 A;  2BIV A;  2F5K A;  2K3X A;  2X35 A;  3DB3 A;  3LH0 A;  4FL6 A;  3OY9 A;  3OYJ A;  3LGL A;  3PFS A;  3SD4 A;  2WAC A;  4QW2 A;  4E7L A;  3MEV A;  2DIG A;  2M1H A;  5KE3 A;  2EFI A;  2HQE A;  4IUQ A;  4E7H A;  1H3Z A;  2RI2 A;  2XK0 A;  2K3Y A;  4IUP A;  4B9X A;  4E7I A;  2RHI A;  2R57 A;  4IUR A;  3QBY A;  5D6X A;  2EKO A;  2B8A A;  3NTH A;  3OYA A;  2O4X B;  3DLM A;  3FEO A;  1WGS A;  2R58 A;  3ZEH A;  4E7K A;  2MWP A;  3OB9 A;  3OS1 A;  3MP8 A;  3S3N A;  4PLI A;  2MWO A;  2RI5 A;  5J26 A;  3GOX A;  3OA6 A;  1XNI A;  4ZTJ A;  4BD3 A;  4QQ6 A;  3FC3 A;  2M0O A;  3MP1 A;  3OQ5 A;  4RG2 A;  5FRO A;  3Q1J A;  1WJR A;  3MEU A;  4BAC A;  2RI3 A;  5KCH A;  2DAQ A;  4HCZ A;  3MO8 A;  1MHN A;  3OS2 A;  3UWN A;  2JTF A;  5IAY A;  2LVM A;  3KUF A;  4N4H A;  1N27 A;  5KCO A;  3L2Q A;  4E7J A;  3P8D A;  3O8V A;  3OMC A;  2YRV A;  4PLL A;  4QVZ A;  4IUV A;  5FRN A;  3LLR A;  2P0K A;  2EQJ A;  2CKK A;  5J39 A;  4BE0 A;  3OYI A;  3OYE A;  3S3M A;  2LRQ A;  3QII A;  4C5E A;  3ASK A;  2PQW A;  4A4E A;  2QQR A;  4LD6 A;  2G3R A;  3OYM A;  5IN1 A;  4NS5 A;  3OYC A;  2NLU A;  2XDP A;  4BDY A;  2X4Y A;  2GFU A;  2LCC A;  3MEA A;  3L2W A;  2R5M A;  3OYB A;  4C5I A;  3OYN A;  5KE2 A;  3OMG A;  1G5V A;  1RI0 A;  3MET A;  4L59 A;  2IG0 A;  1SSF A;  4N4G A;  4PL6 A;  2LTO A;  3NTK A;  4ZTF A;  3OYL A;  2L3R A;  2RJD A;  2R5A A;  3BDL A;  3LYI A;  2EQM A;  3QKJ A;  4IKF A;  4Q5W A;  3PMT A;  3OYK A;  4X34 A;  4GY5 A;  3UT1 A;  3L2U A;  3OYF A;  2GF7 A;  2RJC A;  3QJ6 A;  2HQX A;  1OZ3 A;  2VYT A;  2O4X A;  3E9F A;  2L8D A;  2LDM A;  2RHY A;  2RJE A;  5FRM A;  3F70 A;  2RHU A;  4A4G A;  3L2R A;  4IUU A;  4C5H A;  3S3O A;  1WJS A;  1OZ2 A;  3DB4 A;  3EAE A;  5KH6 A;  2BKD N;  2EQU A;  3LX7 A;  2L89 A;  3E9G A;  5CIU A;  4B9W A;  1KHC A;  5D6W A;  2X4X A;  3MP6 A;  2FHD A;  3OYG A;  4OVA A;  2GFA A;  3H8Z A;  3H6Z A;  4IUT A;  2RHZ A; 
#chains in the Genus database with same CATH topology
 1K9M U;  2JTM A;  1Y57 A;  2E6N A;  3RKY A;  2K3B A;  2RO0 A;  2CGH A;  1NEG A;  1M1G A;  1MUZ A;  3VJP A;  1I0C A;  2VAS A;  5M9O A;  2HMA A;  4FU6 A;  8AT1 B;  4C8Q C;  1M90 R;  4FSX A;  2BTT A;  5GAN e;  3LH0 A;  1RAE B;  2P0P A;  3JCM W;  3QWY A;  4PJO F;  3CCU T;  4X9D A;  1NBE B;  2OJ2 A;  3CXC S;  2EFI A;  1VQL T;  4L6V 5;  1WXT A;  3V8K A;  3EGD A;  4RCC A;  3SDZ A;  1PG5 B;  3Q1J A;  3FB9 A;  2AKK A;  1W2B A;  3A8L B;  4XTZ A;  2E64 A;  4LUD A;  1PHT A;  2J6F A;  2JTF A;  4AFS C;  3X25 B;  2VXF A;  5GAN 5;  3JCM e;  1ZBX A;  3O8V A;  1BI3 A;  3EH1 A;  2MCN A;  4RTX A;  2J06 A;  3HTR A;  2QXF A;  3X26 B;  2JN0 A;  3VRY A;  3EG3 A;  2X4Y A;  4M7A A;  3MEA A;  3OMG A;  1P92 A;  2KVQ G;  3A1P A;  1B3Q A;  3REA B;  2DJZ A;  4IKF A;  4FSS A;  3PMT A;  1K73 R;  2AHJ B;  1K9M C;  3CBO A;  2RJC A;  1UFF A;  2JMA A;  2M0Y A;  2CP3 A;  1EIF A;  5GAN j;  3QUI A;  4M4Z A;  3HHT B;  2DER A;  2QK0 A;  2F1L A;  1NYG A;  1NM7 A;  1TH7 A;  4QQD A;  4XU1 A;  1S72 T;  5CQX A;  2LNV A;  1EX4 A;  4XU0 A;  1S72 Q;  1YNZ A;  2QDL A;  2X51 A;  2F69 A;  3CEY A;  3G4S A;  3TU4 K;  5CKD A;  3FJ5 A;  4NL2 A;  3FLG A;  3NTI A;  2JJ9 A;  3JCM X;  2YRD A;  5GAN 4;  3S6W A;  2YWW A;  2CH4 W;  2XIC A;  3PMI A;  2MK5 A;  3M54 A;  2PU9 B;  1OEB A;  1TG0 A;  4QW2 A;  2L0A A;  2W10 A;  2M1H A;  4F16 A;  1M3B A;  3WXM B;  4KBM B;  4BB7 A;  5D6X A;  2DXT A;  2J7I A;  2DD4 A;  5I21 A;  3MP8 A;  4PLI A;  2RI5 A;  1BBZ A;  4Z89 A;  3EG9 A;  1MMD A;  5KYU B;  2K5L A;  1ABO A;  2DVJ A;  2C0I A;  4HCK A;  3ZFJ A;  1WZO A;  3OW2 S;  4D8D A;  1YI2 T;  5LJ5 d;  5KCO A;  1M5Q 1;  3V8L A;  2NUP A;  3VKI A;  2QA4 Q;  1I1J A;  2EYW A;  4FW1 A;  1VQ6 Q;  2DJQ A;  3JB9 H;  3CC2 Q;  1AVZ C;  1K9M R;  1FX7 A;  4N0A A;  2AIR B;  2YLC A;  3G71 T;  2FVU A;  5LJ3 j;  1VQ7 T;  2JM8 A;  2QQB A;  4LDY A;  3CCE T;  1SSF A;  2OTL A;  3C0C A;  3JCM V;  3OYL A;  3MJX A;  1VQK T;  2R5A A;  1PSE A;  4XTV A;  4V2S A;  1ZHI A;  2X3W D;  4ATO A;  3OS5 A;  2OTJ Q;  3VS7 A;  4J6W A;  3OYF A;  1B7T A;  2F5T X;  5CAI A;  1KQS A;  2Y4X A;  4F7U F;  3F70 A;  2HQH A;  2KXD A;  1N6A A;  5ECA A;  4J9I A;  2PNI A;  4CC3 A;  4ELZ C;  3CCS Q;  1ZA2 B;  1ZLM A;  1X69 A;  3V7R A;  2FRY A;  2DIQ A;  2X4W A;  1Q7Y R;  4OML A;  5CKB A;  4M78 A;  3X28 B;  3UA7 A;  2DYB A;  5AYF A;  1W70 A;  1QP3 A;  4JUV A;  2JW4 A;  4E7S A;  5L8R E;  1TSF A;  2XDB A;  2QGG A;  1TU0 B;  4QQG A;  2RHX A;  3M0Q A;  2F5K A;  1R77 A;  4PFZ A;  2RMO A;  1VQK A;  2J6K A;  3PFS A;  3SD4 A;  3CCR A;  4A54 A;  3NTH A;  1QWE A;  2B8A A;  3EFO B;  1I8F A;  2R58 A;  3QZ5 B;  4DBF A;  3HFN A;  1AWJ A;  3M57 A;  1WLP B;  2KE9 A;  1VQN T;  1YIT T;  3OS2 A;  3RDV A;  3INZ A;  3RER A;  2BE7 D;  2RPN A;  2K2M A;  2IIM A;  3OMC A;  1NYF A;  1PKT A;  2ZZD A;  4KGZ B;  4C8Q G;  1YHQ A;  4M75 A;  1M1F A;  4QT7 A;  1XOV A;  2LRQ A;  4LDW A;  3LWI A;  1OU9 A;  2AK5 A;  4QKU A;  1UJY A;  1YJ9 Q;  4OGC A;  3L2W A;  3EGX A;  2BE9 B;  4FIB A;  4HVW A;  2E70 A;  2JS2 A;  1LNX A;  5HK0 A;  1FMK A;  2A08 A;  2C0O A;  2A7Y A;  1Y71 A;  5L23 A;  1VQP T;  1SF9 A;  4CC2 A;  2MIO A;  2EJ9 A;  3G71 Q;  3CCU A;  2RJE A;  1Q7Y U;  1BCO A;  5IHI A;  2JM9 A;  1M2V A;  2QYZ A;  3I55 A;  3GLX A;  2GFA A;  4E7J A;  1AWW A;  2JZ2 A;  3EH2 A;  5IT9 E;  1JJ2 S;  2MMP A;  5CKH A;  3FIF A;  2D8J A;  4J83 A;  1VYT A;  3OYD A;  3AHU A;  4D8K A;  1M8M A;  4E47 A;  1U5S A;  1TUC A;  2DL8 A;  3C94 A;  1V29 B;  1WHL A;  2QEX Q;  3GF5 A;  4LNP A;  2KQW A;  2QEX T;  2D6F A;  2DIG A;  1UGQ B;  1YJW A;  2HQE A;  2VC8 A;  5GAN h;  3OYA A;  1RAF B;  4AG2 C;  1JO8 A;  1BU1 A;  4Z8A A;  1NE8 A;  2MWO A;  1M3C A;  1OV3 A;  4QQ6 A;  4C92 A;  4J6Y A;  2LQN A;  3EHQ A;  3MEU A;  1D0X A;  4R56 A;  1PRL C;  1SPK A;  1VIF A;  1M1K R;  1SRM A;  1OOT A;  2PUO B;  2QQ9 A;  5FRN A;  3SWN A;  2HL5 C;  1VQ8 T;  2AKL A;  3DLL A;  3JCM P;  2ZPB B;  3C12 A;  1YCS B;  3I5S A;  3CCR Q;  3QHS A;  1IGU A;  1N5Z A;  5LJ3 f;  3UA6 A;  4JJN K;  4M77 B;  5CKF A;  4DEX A;  2X3X D;  3VS1 A;  5KYY B;  2ZPG B;  1PD0 A;  2K57 A;  3E9F A;  5CVI A;  3H0I A;  2F2X A;  5CR2 A;  4IUU A;  1XQH A;  1OU8 A;  2NUT A;  2JTE A;  4M7D C;  4MMK A;  5GJV B;  4M7A G;  1WDX A;  3C95 A;  4A4F A;  2CS7 A;  5CK9 A;  2E6Z A;  2A3L A;  4EMK A;  4C92 E;  3L2V A;  3M56 A;  1UG1 A;  1H64 1;  2ZCF B;  2Z0W A;  2VXE A;  2C0T A;  4KGV B;  1AZE A;  2FEI A;  4JZ4 A;  1VQM Q;  2LJ0 A;  3LGL A;  3NFC A;  2EAY A;  1TTH B;  2K3Y A;  5LJ3 d;  1JEG A;  4DBR A;  2R57 A;  3L2Z A;  2EWN A;  4A4K A;  2DZ9 A;  2A37 A;  3MKD A;  2MF2 A;  3R6O A;  2RN8 A;  2B86 A;  3TCJ A;  1K0X A;  2JXB A;  5I2S A;  5HK3 A;  5GAM h;  4C92 C;  2LQ8 A;  4ESR A;  1IB8 A;  2PUK B;  5FLX E;  3JB9 I;  3UF4 A;  3VS4 A;  2LX9 A;  1HK9 A;  4M7D B;  3LLR A;  1Y7X A;  1YJN T;  1IHV A;  3QII A;  2XDD A;  2DPP B;  2ZPE B;  3CME T;  1K76 A;  4M7D A;  3OYM A;  3I55 T;  3QZ9 B;  2CZ1 B;  2E1H A;  5GAN d;  2DFU A;  2MPX C;  2LCC A;  3VS3 A;  1YJW Q;  2MI6 A;  2E5K A;  1ABQ A;  4XK8 E;  1PWT A;  2EQM A;  1OPK A;  2ED0 A;  2X9H A;  1SHG A;  3V8J A;  4PJO G;  1BIA A;  1JBM A;  2I2L A;  4M75 E;  3L2R A;  4A4G A;  1W6X A;  4ZN3 A;  2CYZ B;  1CKB A;  1N9S A;  5KH6 A;  3CC4 Q;  4X9C A;  1KHC A;  3TQ7 P;  4EMH A;  3EGX B;  4PJM A;  3ZL7 C;  1E6H A;  2G6F X;  4A53 A;  2CRE A;  2E5Q A;  3SWN C;  1NPR A;  3URG A;  2WSF E;  3HP9 A;  3CME A;  5FU7 B;  4C0F A;  3OBY A;  3P8H A;  1AD5 A;  3EG1 A;  2K79 A;  1DJ7 B;  3M4Y A;  3MEW A;  4C0G A;  4J6X A;  2OTL Q;  1PNJ A;  4M77 E;  1VQP Q;  2NWM A;  3LH5 A;  1VUB A;  1RAA B;  1IHW A;  1H3Z A;  2DNU A;  1Q7Y C;  1TXQ A;  2XID A;  2EPD A;  2FPE A;  1OX8 A;  3S3N A;  4XTY A;  2CSI A;  2KI7 A;  1AHJ B;  1OUL A;  3REB B;  4BD3 A;  2JOY A;  5IXF A;  1QLY A;  1WJR A;  1VQM T;  4ZGE B;  3JCM h;  4KH1 B;  1Y0M A;  3CCS A;  1QVP A;  4N0A C;  5IXB A;  1T3S A;  2CZ6 B;  2XHC A;  1MMN A;  1ZSZ A;  1T0J A;  2JUF A;  1MMG A;  2M9U A;  2EVR A;  4J9G A;  5GMK h;  5GAN g;  1M3A A;  1YI2 A;  3CCQ T;  2EYX A;  1HJD A;  5CKE A;  2IVW A;  4J9H A;  5GAM g;  1XJW B;  5KE2 A;  2HNI A;  1R8O B;  4PL6 A;  5IHN A;  1Q82 C;  3CXC A;  3QJ6 A;  2DMO A;  1OZ3 A;  3RBB B;  1QW1 A;  2LDM A;  4JDS A;  1VQ8 A;  1M1K U;  4FYV B;  3HRT A;  2V26 A;  3M0S A;  3QG1 A;  1Z9Q A;  3E9G A;  4HCC A;  5D6W A;  1KSW A;  2D9T A;  1YIJ Q;  1LJO A;  1QP2 A;  1VQ8 Q;  2O31 A;  4M78 D;  4L5G A;  5C0M A;  1S72 A;  3JCM c;  4J9B A;  1VQ9 T;  5D6Y A;  2HSP A;  4M7D G;  3OS0 A;  5CCA A;  4DBH A;  4DBQ A;  2C06 A;  1D0Z A;  3CCV Q;  1Y96 A;  2V8J A;  4MZT A;  1TWB A;  3GIB A;  3CMA A;  3EG9 B;  1G3Y A;  1WGS A;  1WHJ A;  1QKW A;  1KD1 C;  3V7S A;  1XNI A;  2ZPF B;  3FC3 A;  1WHK A;  5FRO A;  3UDC A;  4F7U A;  2A28 A;  1RAI B;  3OSS C;  1ZSZ C;  5HY6 A;  3RR6 A;  1Q82 R;  4LN2 A;  2CP2 A;  4XTU A;  1YP5 A;  3UWN A;  2VVK A;  1QMC A;  2D0Q B;  5GAO l;  1KC8 C;  3QDR B;  1H3H A;  2YRV A;  3VU3 C;  1LVK A;  2OTJ A;  1MND A;  2A0F B;  3RKW A;  3OYE A;  1VQO A;  1HXD A;  1JB0 E;  2YT6 A;  3S3M A;  4YTL A;  2DTI A;  2YUQ A;  1TUD A;  3H0F A;  1N9R A;  1VQP A;  4ZGD B;  3M0R A;  3G1J A;  1GCQ C;  2KEA A;  2DZC A;  3SB2 A;  2EJG A;  1K8A U;  3JSC A;  2DBK A;  3CPW S;  3E2U A;  4C92 B;  4Q5W A;  4BI8 B;  2M02 A;  4X34 A;  2DE0 X;  4J8O A;  1GFD A;  3THK A;  1JJ2 P;  5FU6 C;  4F7U E;  2KRS A;  3VUB A;  2FL7 A;  1QWF A;  4F14 A;  3FRN A;  1HSQ A;  3RUX A;  2FZK B;  1D1C A;  3S3O A;  3EAE A;  4IIM A;  5A0L A;  1ZX6 A;  3VS2 A;  4GLK A;  2FPD A;  1Q86 U;  2YDL A;  4IUT A;  3OSV A;  1YJN Q;  4M7A B;  2ENM A;  4KUD K;  1VIE A;  1OYX A;  2CUB A;  1YI2 Q;  1O9S A;  4F17 A;  1BI0 A;  2KRO A;  4PJJ A;  4UC4 A;  5GMK m;  3QJY A;  3G4S Q;  2COZ A;  4HVU A;  4C5G A;  1AZG B;  1QVG A;  4PJO D;  4RG8 A;  2X4J A;  3GNG A;  1QCO A;  1VQ6 T;  3J80 E;  2P0Q A;  4OF1 A;  2E4H A;  2K7A A;  3RES A;  3QO3 A;  4JZ3 A;  4F7U B;  1RAC B;  1Q81 U;  4TVR A;  4M7A D;  1HYO A;  3JV3 A;  4E7H A;  4XTX A;  2DXU A;  1R0C B;  4M78 C;  4OB3 B;  2RHI A;  5GMK l;  4GBQ A;  4C8Q D;  1U3O A;  2F2V A;  3EG2 A;  2DM1 A;  2D1X A;  4LDX A;  2RF0 A;  3CPW P;  5HCK A;  2OX7 A;  1YIJ A;  1JRI A;  2KGT A;  1ZA1 B;  2KYB A;  1EFN A;  4Z88 A;  2O9V A;  3KUF A;  2ED1 A;  4QVZ A;  3M4G A;  2VGM A;  3QYH B;  4JJB A;  1V76 A;  1CKA A;  4Y92 A;  3I5R A;  2G3R A;  2ROL A;  3D7S B;  3J81 E;  1VQO T;  1KQ2 A;  1MV0 B;  4AT1 B;  2HBW A;  3CMA Q;  5DM7 R;  1VQM A;  1QVG P;  1G5V A;  3NTK A;  2VKN A;  2L2P A;  2YUO A;  3RNJ A;  3M53 A;  1A0N B;  2L3Q A;  3LYI A;  2KBT A;  2DKG A;  1ACM B;  2K5I A;  1K4U S;  1M8V A;  1M2O A;  2JT4 A;  5CO7 A;  2EBP A;  1SHF A;  4PJO E;  2XG8 D;  2QA4 A;  3H9N A;  4C92 G;  1I5O B;  4M75 F;  3WVE B;  5I22 A;  1MMA A;  3PTA A;  3CC7 A;  1JQQ A;  2LX7 A;  2QAS A;  2SRC A;  3TSW A;  2E3H A;  1H92 A;  1AWX A;  3DKM A;  4OMQ A;  2ATC B;  4LE9 A;  3JB9 J;  4JLG A;  2DO3 A;  2FG0 A;  1M90 U;  1UGV A;  3LGF A;  3SWN B;  2RQU A;  2VWF A;  4BI3 A;  3JCM J;  1YJN A;  1WNL A;  1YFN A;  1G3S A;  1K0S A;  4D6W A;  1X6O A;  1EZZ B;  2LQW A;  4HVV A;  4R0K A;  2JMC A;  2RI2 A;  2YUN A;  2YHT A;  3CCL Q;  1UE9 A;  4ME7 A;  4PFO A;  3CCL T;  4DOW A;  1YJW T;  4FW2 A;  3OB9 A;  3E19 A;  3CC2 T;  1AEY A;  4CI0 C;  4M77 A;  4DEY A;  1OX9 A;  5KCH A;  4P5N A;  2KXC A;  2IPO B;  2KMT A;  2A36 A;  1ZUY A;  4HCB A;  1MHN A;  3RMQ A;  1ZSG A;  3M0T A;  3TRE A;  5IH2 A;  4C0Z A;  3L2Q A;  1UGR B;  2RK1 A;  4EIK A;  1Q86 C;  3EFR A;  2Y4Y A;  1Q86 R;  1U1S A;  4KUL A;  2MYS A;  1LCK A;  3GPL A;  4LD6 A;  4JJD A;  5IN1 A;  1UGS B;  4XU3 A;  4ZGJ B;  4OMP A;  3BE3 A;  4RUG A;  3E1S A;  2E3I A;  4XQ3 A;  1RI0 A;  2O01 E;  4MZM A;  2V8I A;  1KQS P;  2CP7 A;  4HA8 A;  3L2U A;  4ELY C;  2JS0 A;  2RQR A;  4J7F A;  1VQ5 Q;  2ZAE A;  3M0U A;  1PCX A;  2GNC A;  3FJP A;  2EGA A;  2L89 A;  2LNH B;  1SSH A;  2V1Q A;  3CD6 Q;  4KUI A;  2CP5 A;  4M7A E;  3UPU A;  2VB6 A;  1WQW A;  4M77 D;  1Y96 B;  2RHZ A;  3I55 Q;  3UAT A;  1YJ9 A;  3MHX A;  1VQ5 A;  1X01 A;  2GTO A;  2PTK A;  4EPC A;  2DET A;  1Q95 G;  3HPW A;  1D1B A;  4J9C A;  4M78 G;  4N4I A;  1D3B B;  4CRI A;  2XD0 A;  2GCX A;  4OP0 A;  4M7D F;  3CCM T;  1KG1 A;  2Y90 A;  1NEB A;  1GRI A;  2BUD A;  1VOM A;  2YXY A;  3OYJ A;  2QEX A;  4IUQ A;  1NG2 A;  2E41 A;  1ZBJ A;  4DOV A;  1X2Q A;  3OS1 A;  3OBW A;  3QWX X;  1X6G A;  4DA4 A;  3OQ5 A;  5I11 A;  4EMK C;  5FW9 A;  3I9Q A;  1YJ9 T;  2DVE A;  4B6M A;  1OPL A;  1PSF A;  2QG9 B;  2LVM A;  3G4S T;  1BB9 A;  3NPF A;  3PVL A;  4C8Q B;  4ZN1 A;  1B34 B;  4MDW A;  4M78 B;  2PZ1 A;  2QDY B;  2QQA A;  2VGN A;  2ZPI B;  4NS5 A;  1K73 U;  1VQ7 Q;  3U23 A;  1RLP C;  2HEQ A;  3A8H B;  2DL3 A;  1U06 A;  2IG0 A;  2F2W A;  7AT1 B;  3I56 A;  5GAO n;  5GMK e;  4KH0 B;  1M27 C;  2OTJ T;  1I07 A;  3OYK A;  3SHW A;  2DXB A;  2CP0 A;  2GF7 A;  3VRZ A;  4R55 A;  4AFZ C;  4M7A F;  1UB4 A;  1BYM A;  2COY A;  5GAN f;  1QVF A;  2AZV A;  4BUG A;  1NPP A;  1QQJ A;  3CCM A;  2LZ6 B;  3SEM A;  3GP8 A;  3VS6 A;  1HD3 A;  1LOJ A;  1G83 A;  4L59 A;  2K2V A;  1FMV A;  2MAM A;  2H8H A;  4II1 A;  3J7A F;  1VQO Q;  3CQT A;  2ABL A;  3CMA T;  1RLQ C;  1B34 A;  4FYW B;  2W0Z A;  5KYN A;  1KK7 A;  5LJ3 e;  1KJW A;  4IIO A;  2WSE E;  2RB6 A;  4A4H A;  2LCS A;  1OI1 A;  2K3X A;  4FL6 A;  2COW A;  1T0H A;  2WAC A;  4JPB W;  2J05 A;  1X75 C;  2GQV A;  3ZEH A;  3M55 A;  2QGF B;  2HCK A;  3OA6 A;  1IRE B;  3MP1 A;  4HT9 A;  1BI2 A;  2DA9 A;  4KRT A;  4JS5 A;  1VQ9 Q;  3PIO A;  3HSB A;  1QVF S;  5GAO p;  4PFP A;  3P8D A;  2CZ0 B;  1K1Z A;  3RMS A;  2HSE B;  5FU6 B;  5J3B A;  2P0K A;  2EQJ A;  4O6J A;  3WVD B;  5GMK i;  2O2O A;  2OAU A;  2XI9 A;  2NUP B;  3BFM A;  1NJI R;  1GCQ A;  2PQW A;  2KNB B;  5AT1 B;  1JXO A;  2NLU A;  2HDA A;  2XDP A;  1X27 A;  4CC7 A;  4F04 B;  4JS4 A;  5KYU A;  2KRM A;  2LQK A;  2LTO A;  3PT9 A;  2RJD A;  1YWO A;  2H3J A;  1SEM A;  5KYX A;  1M2V B;  3QKJ A;  4OB0 B;  1VQ7 A;  5GAM j;  2RA2 A;  1SKU B;  2SEM A;  2BZY A;  1SG5 A;  2HKN A;  1OZ2 A;  2EQU A;  5CIU A;  1FXX A;  3TSZ A;  4C8Q F;  1VQ4 Q;  4KT0 E;  1XTD A;  1T3L A;  2FHD A;  1TS9 A;  2DRK A;  2KT1 A;  5A2Q E;  1UEB A;  1Q81 C;  2HL3 A;  4VUB A;  4M75 B;  4EMK B;  3MPU B;  3JB9 F;  4JRK A;  4Y28 E;  2ZGW A;  3A8G B;  5C6S A;  3G6E Q;  3NHN A;  1TOV A;  3R6N A;  2HBP A;  1WXU A;  1UJ0 A;  2YLB A;  2BIV A;  5A0D A;  3M58 A;  5KE3 A;  2L5Q A;  4M77 G;  3CC4 A;  2V8K A;  3G6E A;  1RAD B;  4JRQ A;  4E7I A;  3ZBD A;  4NL3 A;  1BKB A;  4IUR A;  1VQ5 T;  1FYN A;  1RL2 A;  1D0Y A;  2QTV A;  3EG0 A;  3CCJ Q;  3HFO A;  2RH2 A;  4HT8 A;  3LW5 E;  5EG2 A;  1MV3 A;  9ATC B;  5GAN 7;  4J9D A;  4MML A;  2GQI A;  2L3P A;  4N4H A;  1WIE A;  4J9F A;  1PKS A;  1GL5 A;  1UTI A;  5LJ5 g;  3M0P A;  4JRI A;  2PVO B;  4RKU E;  4PJO C;  1IXD A;  4EMG A;  3M59 A;  2XMF A;  1RI9 A;  2DTO A;  4BDY A;  2KDS A;  3OYB A;  2CP6 A;  1U1T A;  1WQ7 A;  1ZUU A;  5GAM f;  3M5A A;  2D8H A;  3BDU A;  4C8Q E;  2RQW A;  5A0G A;  1E7O A;  1PM3 A;  1PD1 A;  2HQX A;  5LJ5 h;  2O4X A;  2RNA A;  1M30 A;  1UEC A;  2YUP A;  4RCB A;  3JRZ A;  1IO6 A;  3QDF A;  2DBM A;  3OYG A;  2EGC A;  1M4Z A;  1X2K A;  3L42 A;  2OTL T;  2DL7 A;  4EDU A;  4OMN A;  2LCL A;  1E6G A;  1R0B G;  5DLQ E;  3VS5 A;  3MCA B;  2EW3 A;  3VS0 A;  3O5Z A;  4M78 E;  1IRX A;  2LT1 A;  1G3T A;  1VQ4 T;  1BI1 A;  1VQK Q;  1NJI U;  4OMF B;  1VA7 A;  3CCQ A;  3CCV A;  4C92 F;  1JJ2 A;  2VV5 A;  1RAG B;  3JCM f;  3SFM A;  3EFS A;  1B07 A;  1M1K C;  3QBY A;  5LJ5 f;  2YRC A;  2DTH A;  3BY7 A;  3FEO A;  4HKE A;  1M9S A;  1WHG A;  2EGE A;  3PGG A;  1KHI A;  2H3E B;  4RTW A;  4C0D B;  4RG2 A;  3CCS T;  2RM4 A;  1WA7 A;  2ESW A;  1QVF P;  2D0N A;  2KT8 A;  4E2F B;  4HCZ A;  5KYW B;  4JJC A;  4M75 C;  2P4T A;  5IAY A;  3X24 B;  3CCJ A;  1W4S A;  2BZ8 A;  1K8A C;  2ECZ A;  4RTZ A;  4BI4 A;  1C6V X;  4JRP A;  2P84 A;  4OMM A;  2E12 A;  4ORZ A;  3A98 A;  3CD6 T;  4C92 D;  4C5E A;  2DYI A;  4OMO A;  1MNE A;  3CCE A;  3KFV A;  1VQL Q;  1MGQ A;  3QXE B;  4FM4 B;  2DEU A;  2GFU A;  4MDX A;  3P8B B;  2JNG A;  4A63 B;  4C0D C;  4AG1 C;  4AFU C;  2AT1 B;  2WSC E;  3LWH A;  1I4K 1;  1WI7 A;  1WPY A;  4FYY B;  1KD1 U;  5LJ3 g;  3VV0 A;  1VQL A;  4M7D D;  3JCM Q;  2P4R A;  4WF2 A;  3JCM d;  4RTU A;  5EC7 A;  4FT2 A;  1VQN Q;  5KYX B;  5GAO r;  2RHU A;  4F7U G;  3RIR A;  3QYG B;  1I5L A;  1GXI E;  4M7D E;  1UUE A;  3OW2 P;  2GGR A;  5LJ5 e;  3CC4 T;  1S1N A;  3AT1 B;  4OVA A;  3H8Z A;  4FYX B;  3CCV T;  3KBG A;  4CC4 B;  2EJF A;  4BDZ A;  5GAN 3;  1WJQ A;  1OQK A;  5FWC A;  1GFC A;  2DIL A;  1CSK A;  4J7I A;  4M77 F;  3CBP A;  3OYH A;  2LJ1 A;  2NUZ A;  3RKX A;  3BW1 A;  2RJF A;  4FT4 A;  2KSS A;  1N8R C;  2X35 A;  3DB3 A;  1W1F A;  5KYW A;  2VUB A;  3I56 Q;  1AOJ A;  2AZS A;  1K73 C;  5I2M A;  3I56 T;  2RD1 A;  1LPL A;  3PVQ A;  2E65 A;  2GTJ A;  4K11 A;  3VYG A;  3H41 A;  1YBY A;  1D1A A;  5D7U A;  2LJ3 A;  2LT4 A;  2KR3 A;  1VYV A;  4E6R A;  4PJN A;  1X43 A;  2FYK A;  2K6D A;  2LC4 A;  1G8X A;  4BAC A;  2FO0 A;  5GAO q;  1WYX A;  2CT4 A;  2EKH A;  3IQL A;  1W2B S;  3MO8 A;  1WHH A;  1W2B P;  2DL4 A;  1QCF A;  4PJO B;  1YHQ T;  1YHQ Q;  2DLP A;  5DLO A;  2KAF A;  3G6E T;  1ZUK A;  5J39 A;  3CPW A;  3HRU A;  5GAN 8;  2KY9 A;  3ASK A;  1IZ6 A;  3OYC A;  3CCQ Q;  1YIT A;  4LUE A;  3VUZ A;  3OYN A;  2EYZ A;  4WTO B;  5FWB A;  4PJO A;  1AWO A;  2J6O A;  4N4G A;  2KK4 A;  1GBR A;  1N8R R;  4O5V A;  1BCM A;  4QVD A;  5KYY A;  3EFO A;  4GY5 A;  3UT1 A;  5GAM d;  3CCU Q;  4OGE A;  4XAX B;  2RQT A;  3NGP A;  3A5Z B;  2FRW A;  1M90 C;  1K8A R;  4JLI A;  1WXB A;  3JB9 G;  1WHM A;  1WJS A;  1KFZ A;  4E7Z A;  3DB4 A;  2DK3 A;  3JAM E;  1QCN A;  3MP6 A;  2O9S A;  1U8R A;  3CC7 Q;  5GAO m;  2EQI A;  1UDL A;  3H6Z A;  2FZG B;  3CD6 A;  2NYS A;  2HKQ B;  3V7C A;  1O75 A;  1K9A A;  1YIJ T;  2O88 A;  3OYY A;  1QKX A;  2KYM A;  4MZP A;  3CCE Q;  4BE1 A;  3G71 A;  4Z02 A;  4C8Q A;  1VQ6 A;  1D09 B;  1UGP B;  3CC2 A;  1RUW A;  1YWP A;  4BE2 A;  1KC8 U;  1VYU A;  2CUD A;  2HD0 A;  1Y07 A;  1ZSZ B;  3CXC P;  3PNW C;  3FDR A;  1JXM A;  2FPF A;  4PKC C;  2PVD B;  3OY9 A;  3I35 A;  4DQ2 A;  3KXT A;  4E7L A;  5LJ5 j;  3JB9 D;  3A8O B;  1H8K A;  1YN8 A;  2XK0 A;  1WFW A;  2I0N A;  3X20 B;  1YCY A;  4B9X A;  1VQN A;  4J9E A;  2E10 A;  2ROT A;  2EKO A;  3ULR B;  4PK4 A;  2BZX A;  3CPF A;  3DLM A;  5IHK A;  2MWP A;  1C0M A;  1X6B A;  3GOX A;  4ZTJ A;  4QVC A;  5GAN 2;  2M0O A;  4RTT A;  2MOX A;  4BY6 B;  5DY9 A;  4M7A C;  1UHC A;  1JU5 C;  2CSQ A;  2DL5 A;  4J5Y A;  1KQ1 A;  3OW2 A;  2XKO C;  1D3B A;  3JCM b;  3HL8 A;  2K5F A;  4IUV A;  4GLM A;  1Q82 U;  4M75 D;  4BE0 A;  1I81 A;  1N8R U;  3EGU A;  4A4E A;  2QQR A;  3H0H A;  3CCL A;  1BK2 A;  1KQS S;  2CDT A;  1FMW A;  3PE0 A;  2R5M A;  4M77 C;  3NMZ C;  2K4Y A;  4BY6 C;  3MET A;  4ZTF A;  2LP5 A;  1TUG B;  2GBQ A;  1FWZ A;  1YIT Q;  4Y91 A;  2JVV A;  3VYH B;  2LMJ A;  2FB7 A;  2K9G A;  4LDV A;  2DRM A;  8ATC B;  2L8D A;  5FRM A;  3EHR A;  4HXJ A;  2BKD N;  4B9W A;  2XU8 A;  2X4X A;  1KC8 R;  1BIB A;  4LDU A;  1UHF A;  1GCP A;  2QQS A;  1WX6 A;  1ARK A;  2EQK A;  3C4S A;  4LD9 K;  3ME9 A;  5LL6 S;  4AMC A;  1PC0 A;  3G7Z A;  4ANJ A;  3CME Q;  5GAM e;  3CBM A;  1NLP C;  2HZY A;  1KIK A;  2QA4 T;  4PNO A;  1KD1 R;  3PIP A;  2M16 A;  3JCM g;  3M9Q A;  5GAN 6;  3CC7 T;  1J3T A;  1NZ9 A;  2CT3 A;  5HKC A;  4OB2 B;  3HRS A;  3QSU A;  1QVG S;  5GMK j;  1Z9Z A;  3GBQ A;  3MEV A;  4FCY A;  1IGQ A;  5LJ3 h;  2KRN A;  3HKS A;  4IUP A;  2EYY A;  1GBQ A;  1RAH B;  2DX1 A;  2O4X B;  2QAZ A;  3ER0 A;  4OB1 B;  3CCR T;  4E7K A;  1Q81 R;  5J26 A;  5FU7 C;  3TVT A;  2RI3 A;  1PRM C;  3L1A A;  1F1B B;  2DAQ A;  3N5B B;  1G2B A;  1NLO C;  3QPH A;  2FZC B;  2PVG B;  5CQY A;  2L3S A;  1VQ9 A;  2CZ7 B;  4M78 F;  1N27 A;  4XTW A;  2RQV A;  2DF6 A;  4PLL A;  1ZQ1 A;  3GNF B;  2CKK A;  2OAW A;  2V1R A;  3OYI A;  4XU2 A;  2HAX A;  1G3W A;  2QTX A;  1AT1 B;  2EYQ A;  2QI2 A;  3TEE A;  2DD5 A;  1SRL A;  5GJW B;  4RTV A;  4C5I A;  1VQ4 A;  3CCJ T;  2ZPH B;  4X1V A;  1V1C A;  2L3R A;  2RK2 A;  2DEQ A;  4LXC A;  1RAB B;  2CH4 A;  2NUT B;  3BDL A;  4RMO A;  3EGD B;  1NJI C;  4WCI A;  4AFQ C;  2EIF A;  2VYT A;  4PJL A;  1C1A A;  2RHY A;  4ZNX A;  2OI3 A;  2YSQ A;  4C5H A;  4KGX B;  4RTY A;  4M75 G;  2M51 A;  4NOY A;  3LX7 A;  3T9N A;  6AT1 B;  2DXC A;  3A8M B;  3CCM Q; 
#chains in the Genus database with same CATH homology
 1K9M U;  2JTM A;  3L42 A;  2OTL T;  2E6N A;  3RKY A;  4EDU A;  3C95 A;  4A4F A;  2LCL A;  3JB9 J;  2CS7 A;  4JLG A;  2DO3 A;  5CK9 A;  1M90 U;  5DLQ E;  2E6Z A;  2RO0 A;  3LGF A;  2A3L A;  3MCA B;  2CGH A;  3SWN B;  4EMK A;  4C92 E;  3L2V A;  1M1G A;  3VJP A;  3M56 A;  5M9O A;  4M78 E;  2LT1 A;  4FU6 A;  1G3T A;  4BI3 A;  3JCM J;  1VQ4 T;  1YJN A;  4C8Q C;  1H64 1;  2ZCF B;  4FSX A;  2VXE A;  1BI1 A;  1WNL A;  1G3S A;  5GAN e;  3LH0 A;  4D6W A;  1NJI U;  1X6O A;  3LGL A;  4OMF B;  3CCQ A;  2P0P A;  3JCM W;  4PJO F;  3NFC A;  4C92 F;  3CCU T;  3CCV A;  4X9D A;  1JJ2 A;  2VV5 A;  3CXC S;  2EAY A;  2EFI A;  3JCM f;  2RI2 A;  2K3Y A;  5LJ3 d;  3SFM A;  2YHT A;  3EFS A;  2R57 A;  3L2Z A;  2EWN A;  4L6V 5;  3QBY A;  4A4K A;  1M1K C;  1VQL T;  5LJ5 f;  2DZ9 A;  2DTH A;  3BY7 A;  4ME7 A;  3FEO A;  3CCL T;  3V8K A;  4HKE A;  4DOW A;  1YJW T;  3OB9 A;  1M9S A;  3PGG A;  1KHI A;  2MF2 A;  3E19 A;  4RCC A;  3R6O A;  3SDZ A;  4CI0 C;  3CC2 T;  4C0D B;  4RG2 A;  4M77 A;  3CCS T;  3Q1J A;  2RM4 A;  3FB9 A;  3TCJ A;  5KCH A;  4P5N A;  3A8L B;  1W2B A;  4XTZ A;  5I2S A;  5HK3 A;  2KMT A;  4HCZ A;  5GAM h;  4C92 C;  4HCB A;  2E64 A;  1MHN A;  2LQ8 A;  2JTF A;  2PUK B;  4M75 C;  5FLX E;  2P4T A;  3X25 B;  2VXF A;  3X24 B;  3RMQ A;  5IAY A;  3CCJ A;  1W4S A;  3TRE A;  4C0Z A;  5GAN 5;  3JB9 I;  3L2Q A;  1K8A C;  1UGR B;  1ZBX A;  2LX9 A;  1HK9 A;  1BI3 A;  2RK1 A;  3O8V A;  4BI4 A;  3JCM e;  4JRP A;  3EFR A;  1Q86 C;  3LLR A;  4M7D B;  2Y4Y A;  2E12 A;  1U1S A;  4KUL A;  1Y7X A;  1YJN T;  2QXF A;  3X26 B;  2JN0 A;  3CD6 T;  4C92 D;  3QII A;  4C5E A;  2XDD A;  2DPP B;  2ZPE B;  3GPL A;  3CME T;  3CCE A;  4LD6 A;  4M7D A;  3OYM A;  5IN1 A;  3I55 T;  1UGS B;  1MGQ A;  3QXE B;  3QZ9 B;  4FM4 B;  2CZ1 B;  2E1H A;  4XU3 A;  4ZGJ B;  2X4Y A;  5GAN d;  4M7A A;  2GFU A;  4MDX A;  3P8B B;  2LCC A;  3MEA A;  2JNG A;  4C0D C;  2MI6 A;  3E1S A;  3OMG A;  4XQ3 A;  1P92 A;  1RI0 A;  2KVQ G;  2O01 E;  2WSC E;  3LWH A;  2DJZ A;  1I4K 1;  2V8I A;  4MZM A;  4XK8 E;  4IKF A;  2EQM A;  1WPY A;  1KD1 U;  3PMT A;  5LJ3 g;  3VV0 A;  1VQL A;  2AHJ B;  1K9M C;  4HA8 A;  3CBO A;  4M7D D;  3L2U A;  3JCM Q;  4WF2 A;  4ELY C;  3V8J A;  4PJO G;  2RJC A;  3JCM d;  1JBM A;  1BIA A;  2I2L A;  4FT2 A;  5GAO r;  4M75 E;  2RHU A;  4A4G A;  4J7F A;  3L2R A;  4F7U G;  3RIR A;  3QYG B;  4ZN3 A;  1EIF A;  2CYZ B;  5GAN j;  1I5L A;  3QUI A;  1N9S A;  1GXI E;  5KH6 A;  3FJP A;  4M7D E;  2L89 A;  4X9C A;  1KHC A;  3HHT B;  4EMH A;  4KUI A;  5LJ5 e;  3CC4 T;  4M7A E;  3UPU A;  4OVA A;  3H8Z A;  1WQW A;  4M77 D;  1Y96 B;  1TH7 A;  2RHZ A;  4A53 A;  3CCV T;  1YJ9 A;  4QQD A;  3MHX A;  3KBG A;  4XU1 A;  2LNV A;  2E5Q A;  5CQX A;  1S72 T;  4BDZ A;  2EJF A;  3SWN C;  4XU0 A;  1VQ5 A;  5GAN 3;  1WJQ A;  1X01 A;  1NPR A;  2F69 A;  3CEY A;  3G4S A;  3URG A;  4EPC A;  5CKD A;  3TU4 K;  2WSF E;  3HPW A;  3HP9 A;  4J7I A;  4M77 F;  4NL2 A;  4M78 G;  3CME A;  5FU7 B;  4C0F A;  3CBP A;  3FLG A;  3OBY A;  3NTI A;  1D3B B;  3P8H A;  4N4I A;  4CRI A;  3OYH A;  3JCM X;  3RKX A;  3BW1 A;  5GAN 4;  3S6W A;  2RJF A;  2XD0 A;  2GCX A;  4OP0 A;  4FT4 A;  2KSS A;  4M7D F;  3CCM T;  1DJ7 B;  2Y90 A;  1KG1 A;  2XIC A;  3M4Y A;  1N8R C;  3MEW A;  3PMI A;  2BUD A;  4C0G A;  2X35 A;  3DB3 A;  4J6X A;  3OYJ A;  2VUB A;  2PU9 B;  3M54 A;  1K73 C;  4M77 E;  5I2M A;  3I56 T;  4QW2 A;  2RD1 A;  2QEX A;  2M1H A;  1VUB A;  4IUQ A;  2E65 A;  1H3Z A;  2E41 A;  3WXM B;  4KBM B;  1Q7Y C;  3VYG A;  4BB7 A;  4DOV A;  2XID A;  2DXT A;  5D6X A;  1YBY A;  3S3N A;  2LT4 A;  4XTY A;  2DD4 A;  3OBW A;  3MP8 A;  5I21 A;  3OS1 A;  4PLI A;  2RI5 A;  1AHJ B;  4BD3 A;  2JOY A;  4DA4 A;  3OQ5 A;  2FYK A;  4EMK C;  1WJR A;  1VQM T;  2LC4 A;  4BAC A;  4ZGE B;  2K5L A;  3JCM h;  3ZFJ A;  5GAO q;  1W2B S;  3CCS A;  1QVP A;  3MO8 A;  3OW2 S;  1YJ9 T;  4N0A C;  2DVE A;  1YI2 T;  4PJO B;  5LJ5 d;  1PSF A;  1YHQ T;  2CZ6 B;  2LVM A;  5KCO A;  1M5Q 1;  3V8L A;  2XHC A;  3VKI A;  3G4S T;  4C8Q B;  5DLO A;  2KAF A;  4ZN1 A;  2JUF A;  3G6E T;  5J39 A;  1B34 B;  4MDW A;  3JB9 H;  2M9U A;  3CPW A;  5GMK h;  5GAN g;  3HRU A;  2QDY B;  4M78 B;  1FX7 A;  2QQA A;  4N0A A;  5GAN 8;  2VGN A;  2KY9 A;  3ASK A;  3CCQ T;  1YI2 A;  2ZPI B;  2YLC A;  3G71 T;  4NS5 A;  1IZ6 A;  2FVU A;  5CKE A;  5LJ3 j;  3OYC A;  1YIT A;  1K73 U;  2IVW A;  5GAM g;  1VQ7 T;  3VUZ A;  3OYN A;  5KE2 A;  3A8H B;  4PJO A;  2HNI A;  2QQB A;  4LDY A;  3CCE T;  4N4G A;  2IG0 A;  1SSF A;  2KK4 A;  1R8O B;  4PL6 A;  3JCM V;  2OTL A;  3I56 A;  3OYL A;  5GAO n;  5GMK e;  1Q82 C;  1VQK T;  2R5A A;  4O5V A;  1PSE A;  4XTV A;  2OTJ T;  4QVD A;  4V2S A;  3OYK A;  1ZHI A;  4ATO A;  3OS5 A;  2DXB A;  4GY5 A;  3UT1 A;  5GAM d;  3CXC A;  3OYF A;  4J6W A;  2GF7 A;  4OGE A;  4R55 A;  4M7A F;  1BYM A;  1UB4 A;  4XAX B;  3QJ6 A;  5GAN f;  2F5T X;  5CAI A;  1KQS A;  1OZ3 A;  1QVF A;  2Y4X A;  3A5Z B;  1M90 C;  1QW1 A;  2LDM A;  4JDS A;  4F7U F;  1VQ8 A;  3F70 A;  1M1K U;  4JLI A;  4BUG A;  1NPP A;  3HRT A;  3JB9 G;  1WJS A;  3QG1 A;  3DB4 A;  1N6A A;  2DK3 A;  3JAM E;  3CCM A;  3E9G A;  4HCC A;  3GP8 A;  5D6W A;  3MP6 A;  4ELZ C;  1LOJ A;  1U8R A;  5GAO m;  4L59 A;  3H6Z A;  2D9T A;  2K2V A;  3V7R A;  3CD6 A;  2DIQ A;  2X4W A;  3V7C A;  2MAM A;  1LJO A;  1O75 A;  1QP2 A;  5CKB A;  1YIJ T;  3OYY A;  4M78 A;  4II1 A;  3J7A F;  4MZP A;  3X28 B;  4M78 D;  4BE1 A;  4L5G A;  5C0M A;  3G71 A;  4Z02 A;  4C8Q A;  1VQ6 A;  1S72 A;  1UGP B;  3CC2 A;  3JCM c;  1VQ9 T;  3CMA T;  4BE2 A;  5AYF A;  1KC8 U;  1B34 A;  1QP3 A;  5D6Y A;  2HD0 A;  1Y07 A;  4JUV A;  4M7D G;  5L8R E;  3OS0 A;  5CCA A;  2XDB A;  3PNW C;  3FDR A;  5LJ3 e;  4A4H A;  2WSE E;  2RB6 A;  4QQG A;  2C06 A;  2RHX A;  4PKC C;  1OI1 A;  1Y96 A;  2F5K A;  2K3X A;  2PVD B;  4FL6 A;  3OY9 A;  2V8J A;  4MZT A;  1VQK A;  3GIB A;  3PFS A;  3SD4 A;  2WAC A;  4DQ2 A;  3KXT A;  4E7L A;  3CMA A;  5LJ5 j;  3JB9 D;  3CCR A;  3A8O B;  2XK0 A;  4B9X A;  3X20 B;  1VQN A;  1YCY A;  4A54 A;  2E10 A;  2EKO A;  2B8A A;  3NTH A;  1G3Y A;  1X75 C;  3CPF A;  2GQV A;  3DLM A;  1I8F A;  1WGS A;  2R58 A;  3ZEH A;  2MWP A;  3M55 A;  3QZ5 B;  1KD1 C;  3GOX A;  3V7S A;  3HFN A;  3OA6 A;  1XNI A;  4ZTJ A;  4QVC A;  2ZPF B;  1IRE B;  5GAN 2;  3FC3 A;  3M57 A;  2M0O A;  3MP1 A;  5FRO A;  3UDC A;  4F7U A;  4BY6 B;  5DY9 A;  4HT9 A;  4M7A C;  1BI2 A;  3OSS C;  1VQN T;  1YIT T;  4JS5 A;  5HY6 A;  3PIO A;  4J5Y A;  4XTU A;  3HSB A;  1KQ1 A;  3OW2 A;  2XKO C;  3UWN A;  3OS2 A;  1QVF S;  5GAO p;  3INZ A;  3RER A;  1D3B A;  2D0Q B;  3JCM b;  5GAO l;  3QDR B;  3P8D A;  2CZ0 B;  3HL8 A;  3RMS A;  2K5F A;  1KC8 C;  3OMC A;  2YRV A;  5FU6 B;  4IUV A;  5J3B A;  3VU3 C;  2P0K A;  2EQJ A;  4O6J A;  3WVD B;  4M75 D;  5GMK i;  1Q82 U;  2OTJ A;  2ZZD A;  3RKW A;  4C8Q G;  2OAU A;  3OYE A;  4BE0 A;  1VQO A;  1HXD A;  1JB0 E;  4M75 A;  1I81 A;  1M1F A;  2XI9 A;  3S3M A;  1YHQ A;  3BFM A;  1XOV A;  1N8R U;  2LRQ A;  4LDW A;  4A4E A;  2PQW A;  2QQR A;  4YTL A;  3LWI A;  3CCL A;  1KQS S;  2DTI A;  2NLU A;  2XDP A;  1N9R A;  1VQP A;  4ZGD B;  4OGC A;  3L2W A;  2R5M A;  4M77 C;  2K4Y A;  4BY6 C;  3MET A;  4FIB A;  2DZC A;  3SB2 A;  2EJG A;  4JS4 A;  3JSC A;  2LQK A;  2LTO A;  4ZTF A;  2E70 A;  1K8A U;  2RJD A;  3PT9 A;  1LNX A;  2H3J A;  5HK0 A;  3CPW S;  4C92 B;  3QKJ A;  4Q5W A;  4OB0 B;  1FWZ A;  4BI8 B;  1VQ7 A;  4Y91 A;  2A7Y A;  4X34 A;  1Y71 A;  2JVV A;  5GAM j;  3VYH B;  1VQP T;  2RA2 A;  4J8O A;  2EJ9 A;  2FB7 A;  5FU6 C;  4LDV A;  4F7U E;  3VUB A;  2L8D A;  2FL7 A;  2RJE A;  3CCU A;  1Q7Y U;  5FRM A;  3FRN A;  3RUX A;  3S3O A;  1OZ2 A;  3EAE A;  2BKD N;  2EQU A;  5CIU A;  1FXX A;  4B9W A;  2XU8 A;  4C8Q F;  2X4X A;  5A0L A;  4KT0 E;  4GLK A;  3I55 A;  1XTD A;  2FHD A;  3GLX A;  1BIB A;  4LDU A;  1Q86 U;  2GFA A;  4E7J A;  4IUT A;  3OSV A;  2QQS A;  4M7A B;  2JZ2 A;  2EQK A;  3C4S A;  4KUD K;  4LD9 K;  3ME9 A;  1VIE A;  5LL6 S;  1OYX A;  5A2Q E;  1UEB A;  3G7Z A;  1O9S A;  5GAM e;  1Q81 C;  1BI0 A;  3CBM A;  5IT9 E;  4VUB A;  1JJ2 S;  2MMP A;  5CKH A;  4M75 B;  4UC4 A;  5GMK m;  4EMK B;  3QJY A;  2QA4 T;  4PJO D;  3FIF A;  4J83 A;  4JRK A;  4Y28 E;  4C5G A;  1QVG A;  3OYD A;  4RG8 A;  2X4J A;  2ZGW A;  4PNO A;  3A8G B;  3GNG A;  5C6S A;  2M16 A;  3PIP A;  3J80 E;  1VQ6 T;  3JCM g;  2P0Q A;  4OF1 A;  3AHU A;  3M9Q A;  4E47 A;  5GAN 6;  2HBP A;  3CC7 T;  1NZ9 A;  3C94 A;  1V29 B;  2YLB A;  2BIV A;  5A0D A;  4OB2 B;  3HRS A;  3RES A;  5HKC A;  1QVG S;  3M58 A;  3QSU A;  3GF5 A;  5GMK j;  2KQW A;  3QO3 A;  4F7U B;  2QEX T;  2D6F A;  1Q81 U;  3MEV A;  2DIG A;  1UGQ B;  5LJ3 h;  2L5Q A;  4TVR A;  5KE3 A;  2HQE A;  4M77 G;  1YJW A;  3CC4 A;  4M7A D;  4E7H A;  4XTX A;  2V8K A;  3HKS A;  2DXU A;  4IUP A;  3G6E A;  4M78 C;  4OB3 B;  4JRQ A;  4E7I A;  2RHI A;  2VC8 A;  3ZBD A;  5GMK l;  1BKB A;  4IUR A;  4C8Q D;  5GAN h;  4NL3 A;  1VQ5 T;  1RL2 A;  3OYA A;  2O4X B;  3ER0 A;  4OB1 B;  3CCR T;  4E7K A;  1NE8 A;  2MWO A;  5J26 A;  4QQ6 A;  4C92 A;  3HFO A;  2RH2 A;  4J6Y A;  4HT8 A;  3LW5 E;  5FU7 C;  3MEU A;  4LDX A;  5EG2 A;  2RI3 A;  3L1A A;  5GAN 7;  1YIJ A;  2DAQ A;  3N5B B;  1JRI A;  3QPH A;  2PVG B;  4R56 A;  5CQY A;  1VQ9 A;  2CZ7 B;  4MML A;  4M78 F;  4N4H A;  3KUF A;  1N27 A;  1VIF A;  4XTW A;  2QQ9 A;  2PUO B;  4PLL A;  4QVZ A;  3SWN A;  1ZQ1 A;  3GNF B;  3M4G A;  5FRN A;  2CKK A;  2VGM A;  5LJ5 g;  3OYI A;  3QYH B;  4XU2 A;  1VQ8 T;  4JRI A;  2HAX A;  1G3W A;  2QTX A;  2PVO B;  4RKU E;  4PJO C;  2G3R A;  4EMG A;  2EYQ A;  3M59 A;  2QI2 A;  3J81 E;  3DLL A;  3JCM P;  1VQO T;  3TEE A;  1KQ2 A;  2DTO A;  2ZPB B;  2DD5 A;  2KDS A;  3C12 A;  4BDY A;  5DM7 R;  3OYB A;  4C5I A;  1VQM A;  1U1T A;  1WQ7 A;  1VQ4 A;  1G5V A;  3QHS A;  5LJ3 f;  3CCJ T;  2ZPH B;  4JJN K;  3NTK A;  2L3R A;  4M77 B;  5GAM f;  2RK2 A;  2DEQ A;  3M5A A;  3M53 A;  4RMO A;  3BDL A;  3LYI A;  5CKF A;  3BDU A;  1NJI C;  2DKG A;  4C8Q E;  5A0G A;  2K5I A;  1M8V A;  2ZPG B;  5CO7 A;  2EIF A;  2HQX A;  2K57 A;  2VYT A;  2O4X A;  3E9F A;  5LJ5 h;  2XG8 D;  4PJO E;  2RHY A;  5CVI A;  2QA4 A;  4C92 G;  5CR2 A;  4IUU A;  1XQH A;  4M75 F;  3WVE B;  4C5H A;  4M75 G;  4RCB A;  4NOY A;  3PTA A;  3JRZ A;  3LX7 A;  3CC7 A;  3T9N A;  3JB9 F;  4M7D C;  4MMK A;  2DXC A;  3A8M B;  3OYG A;  1M4Z A;  3DKM A;  4M7A G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...