2R5MA

Crystal structure of the two mbt repeats from sex-comb on midleg (scm) in complex with peptide r-(me)k-s
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPGHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycomb protein Scm
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5mA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5mA01
3EAEA 3LX7A 2XDPA 2QQSA 3MEVA 3OQ5A 3E9FA 3OYHA 4E7HA 2G3RA 4L59A 5FROA 1N27A 2M1HA 3OY9A 4PLIA 2RHUA 5C6SA 4ZTJA 3UWNA 4QQDA 2RO0A 1WJSA 2JTFA 3DB3A 3OMCA 3M9QA 3QBYA 3QJ6A 4PLLA 4GY5A 4BE2A 4BE1A 2X4WA 4II1A 2VYTA 3KUFA 4IUVA 5CIUA 4EDUA 3BDLA 2PQWA 4Z02A 3FDRA 4CRIA 4FL6A 4E7IA 5IAYA 2BIVA 3OB9A 2R57A 1OI1A 2M0OA 4BE0A 2EQKA 2FHDA 3OYEA 3OMGA 2RHXA 3L2WA 3L2VA 2E5QA 2X35A 2MWOA 4NS5A 3NTHA 1OZ2A 4QQ6A 2LTOA 2O4XB 3S3NA 2DIQA 2RJEA 3LH0A 4A4GA 2D9TA 1MHNA 4BACA 3NTIA 2IG0A 2R5AA 4A4FA 3OYLA 2BUDA 3MEUA 2K3XA 4IKFA 1WJRA 2K3YA 3PMIA 2RI3A 3H8ZA 3PNWC 2DIGA 3DB4A 5KCHA 3OYCA 2EQMA 3META 4N4HA 2XK0A 4X34A 3OYJA 2M16A 1H3ZA 3L2RA 2LRQA 4N4IA 2EFIA 1G5VA 3OYBA 3GOXA 4QW2A 4IURA 2L3RA 3OYKA 2GFAA 1KHCA 5J26A 3CEYA 2RHYA 3OYDA 3P8DA 3FEOA 3MP8A 4E7JA 4QVZA 1OYXA 3LGLA 3OYFA 4FU6A 5KH6A 3OYGA 2GFUA 2QQRA 4ZTFA 3PMTA 3OS1A 2BKDN 3ME9A 4UC4A 3L42A 1WGSA 3FC3A 2HQEA 3OYMA 2RI5A 3MP6A 1OZ3A 4C5HA 1XNIA 4QQGA 1RI0A 4A4HA 4B9WA 5D6WA 5IN1A 3OYAA 3F70A 2GF7A 2P0KA 2RHZA 5KCOA 3S6WA 3QKJA 3FLGA 4N4GA 2LVMA 2L89A 4C5GA 5D6XA 2RHIA 4OVAA 4PL6A 4RG2A 4BDYA 2DAQA 4IUQA 5M9OA 3OS2A 1SSFA 4LD6A 2WACA 3UT1A 2LCCA 3L2UA 2NLUA 4IUTA 2EKOA 2LDMA 2RJFA 3MO8A 2F5KA 3MP1A 4BDZA 2R5MA 3PFSA 4BD3A 5C0MA 2R58A 4IUPA 2L8DA 3OYNA 3ASKA 3MEWA 4A4EA 4E7KA 5FRNA 3QIIA 2O4XA 2YRVA 2RI2A 3C4SA 2X4XA 3L2QA 3P8HA 5FRMA 3MEAA 3DLMA 2E6NA 3LGFA 3NTKA 3LLRA 2JZ2A 2RJDA 2X4YA 1WJQA 2MWPA 3O8VA 3ZEHA 2EQJA 3E9GA 4E7LA 5D6YA 3OA6A 2EQUA 2RJCA 3SD4A 4C5EA 3LYIA 3H6ZA 2HQXA 2B8AA 4B9XA 4C5IA 5J39A 5KE3A 5KE2A 3OYIA 4Q5WA 3S3OA 4IUUA 2CKKA 4HCZA 3S3MA 3OS0A 3Q1JA
chains in the Genus database with same CATH superfamily
4HXJA 2D1XA 1KQ1A 4OMQA 1ZQ1A 2IPOB 4MZPA 2KYBA 4RCBA 4RKUE 2L3PA 4J9FA 4PLIA 2DYBA 1NJIR 3JAME 5GAN3 1NE8A 3NPFA 3UPUA 1PSEA 3G71A 2RPNA 3VRZA 5GANf 4HVVA 1RUWA 3BW1A 2DMOA 1VQ7T 2VASA 1K9MR 3BE3A 1PHTA 2FHDA 3G71Q 2E5QA 4MZTA 1YIJA 1M1KU 3I9QA 2JNGA 4EMHA 2LJ0A 1YJ9T 2X9HA 3WVDB 3VS5A 1KD1R 1YIJQ 4M78G 2DIGA 4LXCA 2EQMA 3MPUB 5GAOl 1WHHA 1Q7YU 3CCET 5A2QE 1YJNA 2ZPGB 4QW2A 5CAIA 3UA6A 5GAMd 1YJNQ 5GAN2 1Z9ZA 1TOVA 1EZZB 3PMTA 2DZCA 3SB2A 1G3YA 1TUDA 1UUEA 4RTTA 2YUQA 3NMZC 1AT1B 4JJDA 4J9GA 3G4SA 1BBZA 3M59A 4N4GA 4J9CA 4PL6A 5CKFA 3JCMW 4DOWA 1SF9A 2YT6A 4ORZA 2LQWA 3G4SQ 5CCAA 1QVPA 1MMGA 3UDCA 4ANJA 1FXXA 3MO8A 2QI2A 1VQLT 1TH7A 1K73R 3JCMV 3UATA 2BZYA 4M4ZA 1Y7XA 5FRMA 3DLMA 1PKTA 4Y92A 1UHFA 1GL5A 4C92C 5LL6S 3VV0A 5J39A 4J83A 1QCFA 1N5ZA 3VS0A 1X01A 1KQSA 4E6RA 1QCNA 1WNLA 2QYZA 3A8HB 4C8QE 2G3RA 1N27A 2COWA 4EIKA 1K0XA 4M7DG 1T3SA 2RD1A 4JRQA 3QBYA 5GAMf 2ZGWA 4A54A 1UGSB 1T0HA 2DVEA 4XTWA 4E7IA 2DKGA 2RK2A 3EFOB 2KYMA 4JDSA 1UB4A 2CP0A 4JRKA 4L6V5 2G6FX 4DBRA 4E7SA 2J06A 2X4JA 2V8KA 2AT1B 2RJEA 3GF5A 3ZL7C 2LNVA 5CKBA 3NTIA 4FT4A 1VYTA 2HL3A 3QO3A 1AOJA 1M2VA 2RMOA 2LRQA 3TU4K 3CD6Q 4IURA 2H3JA 1KHCA 3CCRT 4FIBA 1D3BB 4QT7A 4J6YA 4F7UG 5HK0A 1CKBA 3CCQT 1OPLA 5CQYA 1YITT 1LPLA 3VS1A 3MKDA 4HVUA 1Q82U 1N8RR 1K9AA 5GAN5 3P8BB 4PJOB 4M7AE 1W2BP 2CGHA 2EIFA 2HSPA 4AT1B 2BE7D 2P0KA 4PJJA 2RHZA 5KCOA 4ZGJB 1M3AA 1ZA1B 2FZCB 3FLGA 4BDYA 2RHIA 3HTRA 3OW2A 1UJ0A 1SSFA 4IUTA 5CO7A 4PFZA 3M54A 2L8DA 2KMTA 4OMLA 5GMKe 1FMWA 1Y96A 2E6NA 2PVDB 3LGFA 4XU3A 1AZEA 2VV5A 4DEXA 3CC7T 3M58A 2EQJA 3E9GA 4PJOF 3CCST 3CCJT 1Y71A 3SD4A 2J05A 3CCMT 2DD4A 2W10A 5GJWB 4LNPA 2DXTA 2QQSA 3OQ5A 5GAOq 3EFOA 4L59A 3H9NA 2AZSA 4ZTJA 1VQ4T 2RO0A 2O9VA 3M57A 4M78B 1BCMA 2JMCA 1VQ5T 1X75C 1MMDA 3G1JA 1N9RA 4JPBW 3QWYA 2JUFA 2RHXA 1IRXA 1ACMB 3N5BB 4C8QC 2E64A 3LH0A 3V8LA 1ZBXA 2LZ6B 2RQWA 3MEUA 1TU0B 3H0HA 3PIOA 3CMAA 3RR6A 3OBYA 3SWNC 1H3HA 2M16A 1HD3A 4FSXA 4E47A 1SHGA 2BZXA 1QVFA 4PK4A 3CMAQ 2OTJT 4AFQC 5IXFA 4M78F 2VWFA 3JCMg 3CPWA 3MP8A 4E7JA 2QEXT 4J8OA 1PG5B 1IO6A 1K8AC 2YHTA 4ZTFA 2KI7A 3OYMA 3MP6A 1JB0E 1QP3A 1XNIA 3JCMe 1RI0A 4JLIA 1JQQA 1RAIB 1VIFA 5EC7A 4IIOA 2A0FB 2C0TA 2DAQA 5D7UA 4IUQA 5IT9E 2CZ1B 1M8MA 3CCVA 2NLUA 2F5KA 2MOXA 5IHIA 2HMAA 3CCVQ 1LJOA 4M7AC 3ASKA 3KXTA 2OAUA 2LC4A 4M7DB 3HRSA 3JB9I 4D8KA 2J6FA 2ENMA 1RAHB 3OYIA 4XTXA 4F16A 4LUEA 2OI3A 3H0IA 4OB3B 1V76A 2QAZA 1YI2T 2HDAA 4K11A 3E2UA 3PTAA 1OU8A 2JOYA 2XIDA 1T3LA 1ZSGA 1VQ4Q 3C94A 1M3BA 4ZGEB 8AT1B 5DLOA 1QVGS 1OEBA 4BI3A 2FPEA 1R0BG 4F7UB 3GLXA 1Q81R 1PM3A 1WA7A 1C0MA 2IG0A 3SWNA 4J6XA 1UDLA 4EMKB 1ZHIA 4BI8B 1W70A 3L2RA 3TCJA 1BU1A 1GFDA 2OJ2A 5GMKl 1BI0A 1OYXA 2KT1A 3ZBDA 3QHSA 3NHNA 2YUPA 2DO3A 2JMAA 3X26B 4F7UF 3VS6A 3EG1A 3OS1A 3G6ET 1WGSA 5J3BA 1NPRA 3SHWA 1NJIC 1SRLA 3JCMX 2KNBB 1TXQA 4PNOA 3V7CA 3F70A 1YBYA 3S6WA 2XI9A 1RAGB 1C1AA 1MUZA 4M7AA 3QDFA 2CSIA 2CP5A 2LNHB 1GXIE 1NZ9A 2L3QA 5IXBA 1PNJA 2ZPIB 4FYVB 2CP6A 1KD1C 1WXTA 5KYNA 2RJDA 2X4YA 3I5SA 5AT1B 4C0DB 1HK9A 4CI0C 2RJCA 5FU7B 2I2LA 4C5IA 1VQNA 3M53A 2GGRA 4M77E 2XDDA 2VKNA 2I0NA 5GMKh 4E7HA 2YRDA 4MDWA 2RHUA 2AK5A 5FLXE 1QLYA 1UG1A 3SDZA 5I2SA 3JB9G 3M4GA 1D0YA 3MCAB 4BE1A 1RACB 2CT4A 4J9HA 1RADB 1U1TA 5I2MA 2CSQA 5CIUA 3A8GB 3FDRA 3M0SA 3FJPA 3R6OA 2DL3A 5IAYA 4JRIA 4OB0B 2EQKA 3OMGA 4C0ZA 3I56T 3RKWA 1K8AU 1MGQA 3X25B 1SPKA 1R0CB 4IKFA 2BUDA 2ED0A 1B07A 2RB6A 2RI3A 5GAN8 1H3ZA 3OYBA 3GBQA 1RLPC 4AMCA 4MMKA 2L3RA 3EG2A 4R55A 1VYUA 1B34A 1PWTA 2CP3A 2KBTA 1G3TA 4C92G 3JRZA 4ZGDB 2EQIA 2ATCB 2VGNA 3QG1A 2QTXA 3FB9A 3M56A 4AG2C 4QKUA 3URGA 2K3BA 1DJ7B 5A0LA 2FEIA 2JTMA 3OS2A 4A63B 1JXMA 4GLKA 2EKOA 2LDMA 5KYUB 3QYGB 2X3WD 2MK5A 3JCMh 4P5NA 2FRWA 4E7KA 1RLQC 3PE0A 2EPDA 3P8HA 1KC8R 3GP8A 3CMET 1PD1A 1W2BS 4E7LA 2MWPA 3ZEHA 1YJWT 5LJ3h 1F1BB 5CVIA 1ZX6A 3GNFB 4DOVA 1UE9A 4OB2B 1S72A 1OPKA 2O2OA 4Q5WA 2EBPA 5HK3A 1D1BA 1S72Q 1YHQA 2RQRA 3L1AA 2J6OA 1WXBA 1K1ZA 5I21A 1YHQQ 1WJSA 1N8RC 2PNIA 4BE2A 3CPFA 5EG2A 3I5RA 2GQVA 1QVGP 4Z8AA 4JLGA 3JCMJ 1JJ2A 2GCXA 2R57A 2RH2A 4M77C 3TQ7P 5GAN7 3OS5A 4HKEA 4A4GA 5FWCA 4BACA 2F2XA 3H0FA 1NJIU 1QKWA 3WXMB 3PNWC 2DETA 1OX8A 3CCUA 2KXCA 2DL7A 3U23A 1R77A 7AT1B 5FWBA 2E1HA 1K9MU 1VQMT 3CCUQ 1P92A 1XOVA 1T0JA 2DF6A 1GFCA 2QQ9A 4RTXA 5KH6A 1X6BA 2HEQA 4HT9A 2QQRA 1IREB 1D0XA 2QA4A 3V7RA 1KD1U 5KYUA 4PKCC 4X1VA 2QA4Q 3V8JA 1OV3A 5IN1A 3OYAA 3RESA 3LW5E 5KYXA 1JBMA 2JVVA 1LNXA 2LVMA 1MV0B 4OVAA 1D0ZA 4KUIA 2RF0A 5KYWB 2KRNA 1Y07A 4XAXB 1VQOA 1VQ6T 3EG9A 1M2VB 1LCKA 2C06A 1VQ8A 4C8QG 2KT8A 2GNCA 1H641 1G83A 2V1QA 1VQOQ 1WHJA 4OMOA 3I55A 1VQ8Q 4OMPA 4J6WA 3CBMA 1VUBA 3OW2P 1NPPA 2EQUA 2EW3A 5GAMg 3I55Q 4FCYA 4OGCA 1YCYA 4KGZB 2MI6A 1BI3A 1M9SA 1K73U 1LVKA 3A1PA 3EG0A 1O75A 3HRUA 1PSFA 2EYZA 1Q86R 3V7SA 1QWFA 4EDUA 1VQ9A 1TG0A 3BDLA 4Z02A 4CRIA 3RKYA 3PT9A 3JB9F 2QK0A 2M0OA 1VQ9Q 4CC4B 2MYSA 2X35A 3VS2A 1M90U 5FU6C 1Y96B 2DL8A 4X9DA 3VS4A 4C92B 2OAWA 2KGTA 3SEMA 5LJ5g 2E3HA 5KYYA 3PMIA 1IB8A 2ECZA 1V29B 3M0UA 3CQTA 4N4IA 4M7AG 3QXEB 3VS7A 1IZ6A 1WI7A 4FYWB 5J26A 3KFVA 5LJ5e 4XTYA 2P4TA 4J5YA 1VQ7Q 3VUBA 5GAOm 2KEAA 2RQTA 2A37A 1FYNA 2ZPFB 5KYWA 5HY6A 3CD6A 1YJ9Q 3CCEA 4C92F 1UHCA 2AIRB 3HSBA 3TREA 2DRKA 2BTTA 2XKOC 4LDWA 2XDBA 3CCEQ 5D6XA 4QVCA 4LDUA 1X43A 3T9NA 4XK8E 3CCLT 2RJFA 3MP1A 1M30A 1R8OB 2OTLT 2E70A 1YFNA 3OYNA 1H8KA 1Q81C 4A4EA 5FRNA 3QIIA 1N8RU 2NUPB 3LWHA 1VOMA 2DERA 1KHIA 1UEBA 4V2SA 2CUDA 1OQKA 4C5EA 1M8VA 3H6ZA 3RUXA 2K7AA 5GAOn 2CS7A 2RK1A 4DBHA 1VQLA 2GTJA 2Y4YA 5LJ5j 2QQBA 1MMNA 1VQLQ 5GAN4 1Q82R 3OY9A 5C6SA 3EFSA 4KUDK 4QQDA 1ZSZC 3JB9D 3EHRA 5CQXA 3RERA 4C92A 4IUVA 3MHXA 4FYXB 2XU8A 3TVTA 3L2VA 3CC4T 3J81E 1GRIA 2K2MA 4AFZC 3V8KA 2YUOA 2YSQA 4A4FA 2LQKA 3JB9J 2V8JA 4PFPA 5KCHA 4HCKA 2LJ1A 2EYQA 1WDXA 4JS4A 4VUBA 2K6DA 2YDLA 3OYDA 4QVDA 2ZZDA 2P0PA 4M78C 5L23A 2JN0A 3HKSA 4C0FA 4CC2A 4C92D 1JXOA 1OX9A 1AD5A 4A4HA 3CC2T 4A53A 5D6WA 2DK3A 3CCRA 2A08A 2NUPA 1X2QA 3QKJA 5GMKj 1BI2A 1YITA 1LOJA 2GTOA 2VB6A 4Y91A 1QMCA 3CCRQ 2E5KA 5I22A 3JCMd 3SWNB 3CCQQ 1VQPT 2KVQG 1YITQ 3PFSA 4DA4A 4M75E 1FX7A 2R58A 4IUPA 4X9CA 2AHJB 2O4XA 5LJ3g 4OP0A 4O5VA 1O9SA 2F2VA 4RTWA 4C8QF 1RAAB 1QCOA 4GBQA 1ZA2B 3HFOA 3CXCP 1MNEA 2HKNA 2LT4A 5LJ3e 1RL2A 4WCIA 4XTZA 2V8IA 1I0CA 3OS0A 3Q1JA 1QP2A 4XTVA 5GJVB 1TSFA 1ZSZA 2P84A 1PRMC 3CC7A 2CDTA 2JTFA 3M9QA 4RUGA 3CCJA 1W2BA 2AZVA 2SRCA 3CCMA 3CC7Q 4MDXA 1CSKA 4M7AB 3CCSQ 2ESWA 2QGGA 3CCJQ 3RMQA 3M0PA 1J3TA 3CCMQ 2PU9B 2DX1A 4NOYA 4NS5A 4F14A 4M7DC 5GAMh 2JTEA 4QQ6A 2KRSA 2D9TA 1K4US 3TEEA 2HQHA 1VQ4A 2R5AA 2PUOB 2XICA 4LDVA 2DJZA 1Q95G 3DB4A 3JCMb 4X34A 2QDLA 1VQ5A 1KC8C 2K57A 1VA7A 1WYXA 4C8QA 1VQ5Q 6AT1B 3J80E 4KGVB 2QXFA 1VQNT 1UFFA 4M7AF 2JT4A 1IHWA 4FU6A 4XU0A 2DILA 3E1SA 4RMOA 4KRTA 3TSZA 5LJ3j 1Q81U 2J6KA 2M9UA 3L42A 1D09B 1SSHA 3THKA 4D8DA 2KQWA 2D8HA 5LJ5h 2D8JA 2E65A 2DTHA 4HA8A 2OTJQ 4ELYC 1BIAA 5C0MA 2LCSA 2QEXQ 3JCMP 1QQJA 4M77G 3HL8A 4Y28E 2Y4XA 2DD5A 3CBPA 1VQKT 1PRLC 1JEGA 2CUBA 4C8QD 2E10A 1B34B 1UGRB 5D6YA 1NLOC 2NUTA 2M02A 4L5GA 4B9XA 2EYXA 2QASA 2ROLA 4B6MA 4HCZA 4KBMB 3H41A 4M75C 2EGAA 1ZUKA 5FROA 2YLCA 1WFWA 2K5LA 2K5FA 2ROTA 2JM9A 2EWNA 3OSVA 3ULRB 2ED1A 3KUFA 4AFSC 1W4SA 4OF1A 1KJWA 3OW2S 3EGDA 2LCLA 3M0QA 3OYYA 2YWWA 4YTLA 2MWOA 1M1GA 1YI2A 2CZ0B 3EG3A 1YI2Q 1PC0A 1NBEB 3META 2XK0A 2DPPB 2RM4A 4M7AD 1U06A 1WQWA 3CEYA 3CBOA 2FG0A 2LQ8A 4ZN3A 1XJWB 3BY7A 1G3WA 2CYZB 3ME9A 3BDUA 1AHJB 1I07A 4JJNK 3M0RA 1FWZA 4QQGA 4AFUC 2KY9A 1I8FA 1Q86C 2HAXA 3C95A 1M3CA 3PVQA 3SFMA 1TTHB 1XTDA 2LMJA 1MV3A 1FMKA 2DL4A 3VYGA 4J9IA 3G6EA 2L2PA 3EH2A 4J9DA 1M1FA 1JO8A 3JB9H 1W1FA 2YRVA 1EIFA 2E4HA 3D7SB 3G6EQ 2X4XA 2K2VA 2JM8A 2C0OA 1Y0MA 4OB1B 2HD0A 4GLMA 2EJFA 2DLPA 1GCPA 1AWOA 3GNGA 2FB7A 2VVKA 3HPWA 3G71T 1W6XA 3OSSC 3S3MA 4KGXB 4LUDA 3E9FA 5IHNA 1RI9A 1UTIA 2KDSA 2M1HA 1YIJT 2QG9B 5KYXB 1KC8U 4GY5A 3VU3C 1TS9A 2JJ9A 5HKCA 2KSSA 4EPCA 1YJNT 4DBFA 4FYYB 3EG9B 4BE0A 4OMFB 5GANg 4ZNXA 3QZ9B 2PTKA 2H3EB 3S3NA 2O01E 2MCNA 1VYVA 1U1SA 2F2WA 1QW1A 2JW4A 4N4HA 3RMSA 5GANe 4KH0B 1ZLMA 4E7ZA 5CKEA 4OMMA 1QKXA 3G4ST 1KQSP 1M27C 2MAMA 1PCXA 4BY6C 2GFUA 3I56Q 1G2BA 3J7AF 3JCMc 2FZGB 3RKXA 1Q82C 2HQEA 1WZOA 2RQUA 2K79A 2RI5A 4M77B 4C5HA 2A3LA 2D0QB 4C5GA 1WHLA 5M9OA 4JZ3A 5CKDA 4O6JA 2LCCA 1SHFA 9ATCB 5KYYB 1ARKA 5DLQE 4BUGA 1GCQC 1I81A 1WHKA 3BFMA 2DVJA 2RI2A 3C4SA 4C0GA 4OGEA 3L2QA 2CREA 2KR3A 4M77F 2IVWA 1KFZA 1YWPA 1I4K1 3HHTB 2EKHA 3UA7A 5GANj 2YLBA 4RG8A 2KK4A 2B8AA 1FMVA 2DRMA 1A0NB 1OULA 4PJOE 1M1KR 2EVRA 2E6ZA 1M5Q1 4MMLA 4EMGA 4ATOA 2PVOB 1PKSA 3CMEA 2JS2A 1YJWA 3CD6T 4PLLA 3EGUA 2P4RA 2CT3A 1Q7YR 1M2OA 4RTYA 2FPFA 3CMEQ 3M4YA 1YJWQ 2SEMA 2BIVA 5CK9A 2FL7A 3CXCS 4ME7A 3VYHB 1V1CA 2J7IA 4OMNA 3INZA 2L3SA 3X20B 4LD9K 4F04B 5GAMe 3OYCA 1Q86U 3VS3A 1TWBA 2AKKA 1NG2A 3GOXA 4M77A 3OYKA 2CH4W 1RAEB 2RN8A 3FRNA 4RTUA 3JSCA 4XQ3A 3VJPA 2WSFE 1B7TA 3OYGA 4R56A 2CZ6B 2KROA 4M78E 4UC4A 4J7FA 2DXBA 4WTOB 1WX6A 5LJ5d 2NYSA 5IH2A 1WXUA 5FU6B 2GBQA 1QVGA 2V1RA 1VQ7A 2DBMA 2A7YA 1VQMA 2EYWA 1AWXA 1KIKA 4NL3A 3UT1A 3EH1A 1M90R 5FW9A 1VQMQ 1GCQA 2E41A 2DEQA 4FW2A 4J9BA 1YJ9A 4FSSA 2VXFA 1E6HA 4M77D 3MEAA 4PJLA 2JXBA 4HCBA 5GAMj 3LLRA 1QVFP 3O8VA 3MJXA 2HBWA 2DL5A 3HRTA 2HBPA 1X6OA 4DEYA 1X6GA 3CPWP 2WSEE 1ZBJA 4Z88A 3REAB 5KE3A 4WF2A 3S3OA 3FJ5A 3PGGA 3IQLA 4F17A 1VQ6A 3UF4A 4XU2A 3MEVA 3OYHA 2O31A 3X24B 2K5IA 1G3SA 3FIFA 1VQ6Q 1IHVA 4ZN1A 4JJCA 3QJ6A 3OMCA 4KULA 3CMAT 4PJMA 1KQ2A 3DLLA 5A0GA 2PQWA 3VRYA 5A0DA 1GBQA 1YNZA 2FVUA 3OYEA 4PJOC 1NEGA 2EGCA 2QTVA 1RABB 1OZ2A 2O4XB 5LJ5f 4J7IA 2DIQA 2KRMA 4M7DE 4PFOA 1UECA 2K3XA 2DTOA 2YUNA 3FC3A 1MNDA 3C0CA 3HFNA 1AVZC 4LE9A 1BKBA 2EFIA 5CR2A 2LT1A 1OOTA 2GFAA 2RQVA 2RHYA 1MMAA 4AG1C 1D1CA 1ZSZB 2ZAEA 3CCVT 3L2ZA 1Z9QA 2LX9A 2OX7A 5GANh 4M75G 4KT0E 1BIBA 1AWJA 1TUGB 1UGPB 4LDYA 4F7UE 5IHKA 1JJ2S 1BK2A 2DBKA 2MMPA 3OBWA 2MF2A 2B86A 4LD6A 2KE9A 3A8OB 4DBQA 1B3QA 3E19A 2RA2A 3RNJA 2H8HA 1BYMA 1Y57A 4HVWA 4XTUA 4IIMA 2NUZA 3MEWA 2GQIA 2Y90A 2O9SA 2E3IA 2KAFA 5CKHA 3NTKA 4C8QB 3LWIA 2JZ2A 2AKLA 1WJQA 2O88A 3CCQA 5GAN6 3CCLA 4JS5A 1SRMA 4E2FB 2XMFA 1PD0A 3QDRB 1D3BA 4FT2A 8ATCB 2OTLA 3CCLQ 2FYKA 2M0YA 2WSCE 4J9EA 2BE9B 3UWNA 2OTLQ 2XD0A 4FW1A 5LJ3d 2PZ1A 2M51A 2DEUA 1AEYA 4PJOA 4A4KA 2BZ8A 2K9GA 5I11A 3REBB 1NYGA 3NTHA 3M5AA 4KH1B 4ESRA 4JJBA 2NUTB 2K3YA 3H8ZA 1EX4A 1KG1A 2X51A 1SG5A 2PVGB 3OYJA 2E12A 3CCSA 3QZ5B 2IIMA 2CZ7B 3CC4A 3P8DA 3TSWA 1U5SA 2DM1A 3OYFA 4RTZA 3M0TA 2C0IA 1ABQA 2K4YA 3CC4Q 1HJDA 5GAOr 1S1NA 4PJOD 3QWXX 1OZ3A 5L8RE 1IGQA 2VC8A 4N0AC 1N6AA 1H92A 3EGDB 4BB7A 1UJYA 3QPHA 1ZUYA 3QUIA 2LJ3A 3JCMf 4M78A 2F69A 2WACA 3HP9A 4LDXA 2JS0A 1YWOA 4BDZA 1KQSS 3C12A 2R5MA 3ZFJA 5LJ3f 3DKMA 2D6FA 3AHUA 2L5QA 1NLPC 2QDYB 3CC2A 1ABOA 2D0NA 3RBBB 2NWMA 4LN2A 2Z0WA 2HKQB 2OTJA 1YCSB 4JRPA 3CC2Q 4JZ4A 3QYHB 2HCKA 3PIPA 4M7DF 3QJYA 2DJQA 5KE2A 1VQPA 2QEXA 4IUUA 4HCCA 2FPDA 4EMKC 2ZPHB 2XDPA 2LX7A 1VQPQ 3R6NA 4D6WA 4NL2A 1GBRA 2RNAA 2EYYA 3LH5A 4M78D 3DB3A 2F1LA 5DM7R 3KBGA 3VKIA 1C6VX 2X4WA 1RAFB 4II1A 2VYTA 3EFRA 3X28B 4FL6A 2XHCA 1K0SA 3L2WA 1SEMA 1WQ7A 2LTOA 3A98A 3QSUA 2HSEB 1BI1A 3A5ZB 1MHNA 1I5LA 3OYLA 2HZYA 1NM7A 4ELZC 1EFNA 2A28A 4M75B 1SKUB 1JRIA 2A36A 1I1JA 1BB9A 4DQ2A 2ZPBB 5ECAA 3ER0A 4M7DA 1K9MC 3FEOA 3CXCA 2FZKB 1I5OB 3NGPA 1AWWA 3LGLA 4C0DC 2COYA 2MPXC 4N0AA 1IGUA 2DYIA 2LQNA 2V26A 1JU5C 1M1KC 5FU7C 1WIEA 1WHGA 1UGQB 4RTVA 2QQAA 1VIEA 2EGEA 3NFCA 2F5TX 2EJGA 1JJ2P 2PUKB 1Q7YC 4M75F 2L89A 3EGXB 1NYFA 2DXCA 3L2UA 2HNIA 1S72T 2COZA 1VQNQ 2CP7A 3EHQA 1IXDA 4BD3A 2YXYA 2W0ZA 5DY9A 5HCKA 4F7UA 2DTIA 1YHQT 4CC7A 3JV3A 5GMKm 4M7DD 1OU9A 4MZMA 3I35A 3G7ZA 3GPLA 4EMKA 2DFUA 3LYIA 2FO0A 2CKKA 4PJNA 3PVLA 1U8RA 2L0AA 2LP5A 3EAEA 1K8AR 3LX7A 4XU1A 2ZCFB 4R0KA 5GAOp 1QWEA 1VQKA 1HSQA 4Z89A 1K73C 4RCCA 3M55A 3RDVA 1VQKQ 2CP2A 1X69A 2DE0X 1QVFS 1KSWA 3CCUT 3OB9A 1OI1A 4M75A 3CPWS 1KK7A 1U3OA 2QGFB 1M90C 1ZUUA 2ABLA 4FM4B 2FRYA 2CH4A 2X3XD 1HXDA 1TUCA 1WJRA 2QA4T 4CC3A 1X27A 1X2KA 3JCMQ 1G5VA 2DNUA 3O5ZA 4TVRA 2KXDA 1YN8A 1M4ZA 1UGVA 1HYOA 4QVZA 4JUVA 5GANd 1WLPB 3EGXA 1E7OA 1XQHA 5AYFA 3GIBA 2BKDN 2EAYA 1NEBA 1VQOT 2VGMA 1K76A 1N9SA 1YP5A 2HL5C 3A8MB 1VQ8T 2YRCA 1G8XA 4M75D 4B9WA 3AT1B 3I55T 2GF7A 1D1AA 4RG2A 4HT8A 3RIRA 2DZ9A 3I56A 2ZPEB 4C92E 3WVEB 2EJ9A 2P0QA 1E6GA 3VUZA 4PJOG 2DXUA 2DA9A 4BI4A 4BY6B 1BCOA 3OA6A 1WPYA 2VUBA 2VXEA 2XG8D 2MIOA 1VQ9T 1AZGB 2HQXA 5GMKi 1WHMA 3A8LB 1CKAA
chains in the Genus database with same CATH topology
4M77E 1QP2A 3ZBDA 2XDDA 1KQ1A 4XU2A 1ZQ1A 3MEVA 4MZPA 4RCBA 4RKUE 4XTVA 5GMKh 3OYHA 3X24B 2K5IA 4E7HA 1G3SA 3FIFA 4MDWA 4PLIA 2RHUA 5FLXE 3JAME 3SDZA 5I2SA 4ZN1A 3JB9G 3M4GA 3CC7A 2JTFA 3QJ6A 3OMCA 3M9QA 4KULA 3MCAB 3CMAT 3CCJA 5GAN3 1NE8A 4BE1A 3UPUA 1W2BA 1PSEA 1U1TA 5I2MA 5CIUA 3G71A 1KQ2A 3DLLA 3A8GB 5A0GA 3CCMA 2PQWA 5GANf 3FDRA 4MDXA 4M7AB 3FJPA 3BW1A 3R6OA 5IAYA 1VQ7T 4JRIA 3RMQA 4OB0B 5A0DA 2EQKA 2FHDA 2FVUA 3OYEA 4PJOC 3OMGA 2PU9B 2E5QA 4NOYA 4NS5A 4C0ZA 3I56T 4M7DC 1OZ2A 4MZTA 3RKWA 4QQ6A 2O4XB 5GAMh 5LJ5f 4J7IA 1YIJA 1K8AU 1M1KU 2DIQA 1MGQA 2D9TA 3TEEA 3X25B 2JNGA 4EMHA 1VQ4A 2R5AA 4M7DE 1YJ9T 2PUOB 3WVDB 2XICA 4LDVA 2BUDA 4IKFA 2K3XA 2DTOA 2RB6A 4M78G 3FC3A 2RI3A 2DJZA 2DIGA 3DB4A 5GAN8 2EQMA 3HFNA 4X34A 3JCMb 1H3ZA 1VQ5A 5GAOl 1KC8C 1BKBA 2EFIA 5CR2A 2K57A 3OYBA 1Q7YU 3CCET 5A2QE 1YJNA 2ZPGB 2LT1A 4MMKA 4QW2A 2L3RA 5CAIA 2GFAA 4C8QA 2RHYA 3J80E 5GAMd 4R55A 2QXFA 1VQNT 1B34A 5GAN2 4M7AF 1G3TA 3CCVT 4FU6A 3L2ZA 4XU0A 3E1SA 4RMOA 4C92G 5LJ3j 1Q81U 3JRZA 2M9UA 2LX9A 3PMTA 4ZGDB 3L42A 5GANh 2VGNA 3QG1A 2QTXA 4M75G 3FB9A 4KT0E 3M56A 4M7AC 1BIBA 2DZCA 3SB2A 2KQWA 1G3YA 3URGA 1DJ7B 1UGPB 5A0LA 5LJ5h 4LDYA 4F7UE 3G4SA 1JJ2S 2E65A 3M59A 4N4GA 2MMPA 4PL6A 5CKFA 3JCMW 2DTHA 4DOWA 2JTMA 4HA8A 3OBWA 2MF2A 3OS2A 4LD6A 3A8OB 5CCAA 1QVPA 4GLKA 2EKOA 2LDMA 3E19A 1FXXA 3MO8A 3UDCA 4ELYC 2QI2A 2RA2A 3QYGB 1BIAA 1VQLT 1BYMA 5C0MA 3JCMP 1TH7A 3JCMh 4P5NA 4XTUA 4M77G 3HL8A 4Y28E 2Y4XA 3MEWA 3JCMV 4E7KA 2DD5A 2Y90A 3CBPA 1VQKT 4C8QD 1Y7XA 3P8HA 2E10A 5FRMA 2KAFA 3DLMA 5CKHA 3NTKA 4C8QB 3LWIA 3GP8A 3CMET 1W2BS 2JZ2A 4E7LA 1WJQA 2MWPA 1B34B 3ZEHA 1UGRB 5LJ3h 1YJWT 5D6YA 5CVIA 3CCQA 4C92C 5LL6S 3GNFB 4L5GA 4DOVA 4B9XA 4OB2B 5GAN6 1S72A 3VV0A 5J39A 3CCLA 4J83A 4JS5A 4Q5WA 4HCZA 4KBMB 4M75C 1X01A 1KQSA 5HK3A 3QDRB 1D3BA 4FT2A 2OTLA 1WNLA 2FYKA 3A8HB 4C8QE 1YHQA 2G3RA 5FROA 1N27A 2YLCA 3L1AA 2WSCE 2K5LA 3UWNA 2K5FA 4M7DG 5I21A 2RD1A 1WJSA 1N8RC 2XD0A 5LJ3d 4JRQA 2EWNA 3CPFA 3QBYA 5GAMf 5EG2A 3OSVA 4BE2A 2GQVA 2ZGWA 4A54A 1UGSB 3KUFA 4JLGA 1W4SA 2DVEA 4XTWA 3JCMJ 1JJ2A 4PJOA 4E7IA 4OF1A 2DKGA 2GCXA 4A4KA 3OW2S 2RK2A 4JDSA 2LCLA 2R57A 1UB4A 2RH2A 3OYYA 4JRKA 4L6V5 4M77C 5GAN7 4YTLA 3OS5A 2MWOA 3NTHA 2X4JA 2V8KA 1M1GA 1YI2A 4HKEA 2RJEA 3GF5A 4A4GA 3M5AA 2CZ0B 2LNVA 5CKBA 3NTIA 4BACA 4FT4A 1NJIU 3WXMB 3QO3A 2K3YA 3PNWC 3H8ZA 1KG1A 3META 2PVGB 2XK0A 3OYJA 2E12A 2LRQA 3TU4K 3CCSA 2DPPB 3CCUA 2RM4A 3QZ5B 4M7AD 2CZ7B 4IURA 2H3JA 1KHCA 3CCRT 4FIBA 2E1HA 1D3BB 1WQWA 3CEYA 4J6YA 4F7UG 3CBOA 5HK0A 3CCQT 1K9MU 3CC4A 3P8DA 1VQMT 1P92A 1XOVA 5CQYA 1YITT 2LQ8A 2QQ9A 3OYFA 4ZN3A 5KH6A 3BY7A 1G3WA 2K4YA 4HT9A 2QQRA 1IREB 5GAOr 2CYZB 3ME9A 3BDUA 2QA4A 1Q82U 3V7RA 1AHJB 1KD1U 4PJOD 5GAN5 4JJNK 3P8BB 4PKCC 1OZ3A 4PJOB 5L8RE 1FWZA 2VC8A 4N0AC 4QQGA 4M7AE 1N6AA 2CGHA 2KY9A 2EIFA 1I8FA 3V8JA 4BB7A 3QPHA 5IN1A 3OYAA 1Q86C 2HAXA 3RESA 3QUIA 3LW5E 2P0KA 2RHZA 3C95A 3JCMf 1JBMA 2JVVA 5KCOA 4ZGJB 1LNXA 3FLGA 2LVMA 3SFMA 4BDYA 2RHIA 4OVAA 3OW2A 4KUIA 4M78A 1XTDA 2F69A 1SSFA 2WACA 3HP9A 4IUTA 5CO7A 4LDXA 1Y07A 3VYGA 4XAXB 4BDZA 1KQSS 3C12A 2R5MA 3ZFJA 5LJ3f 3G6EA 3DKMA 1VQOA 1VQ6T 2D6FA 3AHUA 3M54A 2C06A 2L8DA 2KMTA 2L5QA 4C8QG 1VQ8A 1M1FA 3JB9H 2QDYB 2YRVA 1EIFA 3CC2A 1H641 2X4XA 5GMKe 2K2VA 1Y96A 2E6NA 2PVDB 3LGFA 4XU3A 3I55A 2HD0A 2VV5A 4OB1B 2EJFA 3CC7T 3M58A 4J6WA 3CBMA 2OTJA 1VUBA 2EQJA 3E9GA 4PJOF 3CCST 4JRPA 3CCJT 1Y71A 1NPPA 3GNGA 2EQUA 3QYHB 3SD4A 5GAMg 2FB7A 3PIPA 3HPWA 3QJYA 3G71T 4M7DF 3CCMT 2DD4A 4OGCA 5KE2A 1YCYA 1VQPA 3OSSC 2QEXA 4IUUA 4HCCA 4EMKC 2MI6A 2DXTA 3S3MA 2ZPHB 1BI3A 2XDPA 2QQSA 3OQ5A 5GAOq 3E9FA 1M9SA 4L59A 1K73U 2KDSA 2M1HA 1YIJT 1O75A 4D6WA 3HRUA 1PSFA 4NL2A 4ZTJA 1VQ4T 2RO0A 1KC8U 3M57A 4M78D 3DB3A 5DM7R 3KBGA 4GY5A 4M78B 3V7SA 3VKIA 2X4WA 3VU3C 4II1A 2VYTA 4EDUA 1VQ9A 1VQ5T 3BDLA 3EFRA 1X75C 4Z02A 3X28B 5HKCA 4CRIA 1N9RA 4FL6A 2KSSA 3PT9A 2JUFA 3RKYA 4EPCA 1YJNT 3JB9F 2XHCA 2M0OA 4BE0A 3Q1JA 4OMFB 2RHXA 4C8QC 5GANg 3N5BB 3L2WA 2E64A 2X35A 3QZ9B 1M90U 1WQ7A 2LTOA 5FU6C 3S3NA 3LH0A 3QSUA 1BI1A 1Y96B 3A5ZB 1MHNA 3V8LA 1ZBXA 1I5LA 4X9DA 2O01E 4C92B 1U1SA 3MEUA 3OYLA 5LJ5g 3PMIA 3PIOA 3CMAA 1QW1A 4ELZC 3OBYA 1V29B 4N4HA 3RMSA 4M75B 2M16A 3SWNC 5GANe 4N4IA 1JRIA 4M7AG 3QXEB 4FSXA 4E47A 1IZ6A 4DQ2A 1QVFA 2OTJT 5CKEA 4M78F 5J26A 2ZPBB 3ER0A 3G4ST 4M7DA 3JCMg 3CPWA 1K9MC 3FEOA 4XTYA 2P4TA 3MP8A 4J5YA 5LJ5e 3CXCA 4E7JA 3LGLA 3VUBA 2QEXT 4J8OA 2MAMA 4BY6C 5GAOm 2GFUA 4C0DC 1K8AC 2YHTA 4N0AA 4ZTFA 1M1KC 2ZPFB 3J7AF 3JCMc 5FU7C 3RKXA 1Q82C 1UGQB 2HQEA 5HY6A 4M77B 2RI5A 3MP6A 3OYMA 1JB0E 4C5HA 1QP3A 1XNIA 3JCMe 3CD6A 2QQAA 1RI0A 2A3LA 2D0QB 1VIEA 3CCEA 4C92F 3HSBA 4JLIA 3NFCA 3TREA 2F5TX 2EJGA 1VIFA 2XKOC 4LDWA 2PUKB 1Q7YC 2XDBA 4M75F 2L89A 4C5GA 5D6XA 2DAQA 4QVCA 4IUQA 5M9OA 5IT9E 2CZ1B 5CKDA 2DXCA 3CCVA 4LDUA 4O6JA 3T9NA 2LCCA 3L2UA 2HNIA 2NLUA 4XK8E 3CCLT 1S72T 2RJFA 2F5KA 3MP1A 4BD3A 5DLQE 1LJOA 1R8OB 5DY9A 2E70A 4BUGA 3OYNA 2OTLT 1Q81C 3ASKA 4F7UA 2DTIA 1I81A 3BFMA 4A4EA 3KXTA 1YHQT 3QIIA 1N8RU 5FRNA 2OAUA 2RI2A 3C4SA 4C0GA 4OGEA 3LWHA 5GMKm 3L2QA 4M7DD 1KHIA 2LC4A 1UEBA 4MZMA 4M7DB 3HRSA 3JB9I 4M77F 2IVWA 4V2SA 1I4K1 3HHTB 3G7ZA 3GPLA 4C5EA 5GANj 2YLBA 4EMKA 3LYIA 3H6ZA 4RG8A 3RUXA 2KK4A 1M8VA 2B8AA 5GAOn 3OYIA 2CS7A 2RK1A 4XTXA 1VQLA 2CKKA 1U8RA 3EAEA 2Y4YA 3LX7A 4OB3B 4XU1A 4PJOE 5LJ5j 2QQBA 2ZCFB 5GAOp 1VQKA 2E6ZA 1M5Q1 5GAN4 1YI2T 4MMLA 4RCCA 4EMGA 1K73C 3OY9A 4ATOA 3PTAA 5C6SA 3EFSA 2PVOB 4KUDK 3M55A 2JOYA 2XIDA 4QQDA 3CMEA 1YJWA 3CD6T 4PLLA 3C94A 4ZGEB 5CQXA 5DLOA 3JB9D 3RERA 1QVGS 4C92A 4IUVA 1QVFS 4BI3A 3MHXA 3M4YA 3CCUT 2BIVA 3OB9A 5CK9A 2XU8A 1OI1A 4M75A 2FL7A 3CPWS 3CXCS 4ME7A 3VYHB 3L2VA 4F7UB 3CC4T 3J81E 3GLXA 1M90C 3INZA 3X20B 4LD9K 4FM4B 3V8KA 2IG0A 3SWNA 4A4FA 2LQKA 5GAMe 3JB9J 1HXDA 1WJRA 2V8JA 4J6XA 5KCHA 3OYCA 2QA4T 4EMKB 1ZHIA 3JCMQ 2EYQA 1Q86U 4BI8B 3L2RA 3TCJA 1G5VA 4TVRA 4JS4A 3GOXA 4VUBA 4M77A 3OYKA 1M4ZA 5GMKl 4QVDA 3OYDA 3FRNA 2ZZDA 1BI0A 1OYXA 2P0PA 3JSCA 3QHSA 4JUVA 4M78C 4QVZA 4XQ3A 3VJPA 2WSFE 2JN0A 5GANd 3OYGA 2DO3A 4R56A 1XQHA 2CZ6B 3X26B 3HKSA 5AYFA 4C0FA 4F7UF 3OS1A 2BKDN 2EAYA 4M78E 4UC4A 4C92D 3G6ET 1VQOT 3GIBA 1WGSA 2VGMA 5J3BA 1NPRA 1N9SA 2DXBA 4J7FA 1NJIC 1VQ8T 3A8MB 5LJ5d 4A4HA 4M75D 3JCMX 4PNOA 4B9WA 3CC2T 4A53A 5D6WA 3V7CA 5FU6B 3F70A 2DK3A 3CCRA 3I55T 1QVGA 2GF7A 1YBYA 3S6WA 5GMKj 3QKJA 1VQ7A 1BI2A 2A7YA 2XI9A 1VQMA 4RG2A 1YITA 1LOJA 4Y91A 4HT8A 3RIRA 2DZ9A 4NL3A 3UT1A 3I56A 2ZPEB 3SWNB 4C92E 3JCMd 3WVEB 2EJ9A 2P0QA 1VQPT 4M7AA 2KVQG 2E41A 3PFSA 2DEQA 4DA4A 1GXIE 1NZ9A 4M75E 1FX7A 1YJ9A 2VXFA 2R58A 3VUZA 4IUPA 4PJOG 2ZPIB 4X9CA 4M77D 2AHJB 2DXUA 2O4XA 5LJ3g 1VQ6A 4OP0A 4O5VA 1KD1C 3MEAA 4BI4A 4HCBA 1O9SA 4BY6B 5GAMj 3LLRA 2RJDA 2X4YA 3O8VA 4C0DB 4CI0C 1HK9A 4C8QF 3OA6A 1WPYA 2VUBA 2VXEA 2RJCA 2XG8D 5FU7B 3HRTA 1VQ9T 2HBPA 1X6OA 2HQXA 2I2LA 3HFOA 2WSEE 3M53A 4C5IA 1VQNA 5KE3A 4WF2A 2LT4A 5LJ3e 1RL2A 3PGGA 4XTZA 5GMKi 3S3OA 2V8IA 3OS0A 3A8LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAE A;  3LX7 A;  2XDP A;  2QQS A;  3MEV A;  3OQ5 A;  3E9F A;  3OYH A;  4E7H A;  2G3R A;  4L59 A;  5FRO A;  1N27 A;  2M1H A;  3OY9 A;  4PLI A;  2RHU A;  5C6S A;  4ZTJ A;  3UWN A;  4QQD A;  2RO0 A;  1WJS A;  2JTF A;  3DB3 A;  3OMC A;  3M9Q A;  3QBY A;  3QJ6 A;  4PLL A;  4GY5 A;  4BE2 A;  4BE1 A;  2X4W A;  4II1 A;  2VYT A;  3KUF A;  4IUV A;  5CIU A;  4EDU A;  3BDL A;  2PQW A;  4Z02 A;  3FDR A;  4CRI A;  4FL6 A;  4E7I A;  5IAY A;  2BIV A;  3OB9 A;  2R57 A;  1OI1 A;  2M0O A;  4BE0 A;  2EQK A;  2FHD A;  3OYE A;  3OMG A;  2RHX A;  3L2W A;  3L2V A;  2E5Q A;  2X35 A;  2MWO A;  4NS5 A;  3NTH A;  1OZ2 A;  4QQ6 A;  2LTO A;  2O4X B;  3S3N A;  2DIQ A;  2RJE A;  3LH0 A;  4A4G A;  2D9T A;  1MHN A;  4BAC A;  3NTI A;  2IG0 A;  2R5A A;  4A4F A;  3OYL A;  2BUD A;  3MEU A;  2K3X A;  4IKF A;  1WJR A;  2K3Y A;  3PMI A;  2RI3 A;  3H8Z A;  3PNW C;  2DIG A;  3DB4 A;  5KCH A;  3OYC A;  2EQM A;  3MET A;  4N4H A;  2XK0 A;  4X34 A;  3OYJ A;  2M16 A;  1H3Z A;  3L2R A;  2LRQ A;  4N4I A;  2EFI A;  1G5V A;  3OYB A;  3GOX A;  4QW2 A;  4IUR A;  2L3R A;  3OYK A;  2GFA A;  1KHC A;  5J26 A;  3CEY A;  2RHY A;  3OYD A;  3P8D A;  3FEO A;  3MP8 A;  4E7J A;  4QVZ A;  1OYX A;  3LGL A;  3OYF A;  4FU6 A;  5KH6 A;  3OYG A;  2GFU A;  2QQR A;  4ZTF A;  3PMT A;  3OS1 A;  2BKD N;  3ME9 A;  4UC4 A;  3L42 A;  1WGS A;  3FC3 A;  2HQE A;  3OYM A;  2RI5 A;  3MP6 A;  1OZ3 A;  4C5H A;  1XNI A;  4QQG A;  1RI0 A;  4A4H A;  4B9W A;  5D6W A;  5IN1 A;  3OYA A;  3F70 A;  2GF7 A;  2P0K A;  2RHZ A;  5KCO A;  3S6W A;  3QKJ A;  3FLG A;  4N4G A;  2LVM A;  2L89 A;  4C5G A;  5D6X A;  2RHI A;  4OVA A;  4PL6 A;  4RG2 A;  4BDY A;  2DAQ A;  4IUQ A;  5M9O A;  3OS2 A;  1SSF A;  4LD6 A;  2WAC A;  3UT1 A;  2LCC A;  3L2U A;  2NLU A;  4IUT A;  2EKO A;  2LDM A;  2RJF A;  3MO8 A;  2F5K A;  3MP1 A;  4BDZ A;  2R5M A;  3PFS A;  4BD3 A;  5C0M A;  2R58 A;  4IUP A;  2L8D A;  3OYN A;  3ASK A;  3MEW A;  4A4E A;  4E7K A;  5FRN A;  3QII A;  2O4X A;  2YRV A;  2RI2 A;  3C4S A;  2X4X A;  3L2Q A;  3P8H A;  5FRM A;  3MEA A;  3DLM A;  2E6N A;  3LGF A;  3NTK A;  3LLR A;  2JZ2 A;  2RJD A;  2X4Y A;  1WJQ A;  2MWP A;  3O8V A;  3ZEH A;  2EQJ A;  3E9G A;  4E7L A;  5D6Y A;  3OA6 A;  2EQU A;  2RJC A;  3SD4 A;  4C5E A;  3LYI A;  3H6Z A;  2HQX A;  2B8A A;  4B9X A;  4C5I A;  5J39 A;  5KE3 A;  5KE2 A;  3OYI A;  4Q5W A;  3S3O A;  4IUU A;  2CKK A;  4HCZ A;  3S3M A;  3OS0 A;  3Q1J A; 
#chains in the Genus database with same CATH topology
 4HXJ A;  2D1X A;  1KQ1 A;  4OMQ A;  1ZQ1 A;  2IPO B;  4MZP A;  2KYB A;  4RCB A;  4RKU E;  2L3P A;  4J9F A;  4PLI A;  2DYB A;  1NJI R;  3JAM E;  5GAN 3;  1NE8 A;  3NPF A;  3UPU A;  1PSE A;  3G71 A;  2RPN A;  3VRZ A;  5GAN f;  4HVV A;  1RUW A;  3BW1 A;  2DMO A;  1VQ7 T;  2VAS A;  1K9M R;  3BE3 A;  1PHT A;  2FHD A;  3G71 Q;  2E5Q A;  4MZT A;  1YIJ A;  1M1K U;  3I9Q A;  2JNG A;  4EMH A;  2LJ0 A;  1YJ9 T;  2X9H A;  3WVD B;  3VS5 A;  1KD1 R;  1YIJ Q;  4M78 G;  2DIG A;  4LXC A;  2EQM A;  3MPU B;  5GAO l;  1WHH A;  1Q7Y U;  3CCE T;  5A2Q E;  1YJN A;  2ZPG B;  4QW2 A;  5CAI A;  3UA6 A;  5GAM d;  1YJN Q;  5GAN 2;  1Z9Z A;  1TOV A;  1EZZ B;  3PMT A;  2DZC A;  3SB2 A;  1G3Y A;  1TUD A;  1UUE A;  4RTT A;  2YUQ A;  3NMZ C;  1AT1 B;  4JJD A;  4J9G A;  3G4S A;  1BBZ A;  3M59 A;  4N4G A;  4J9C A;  4PL6 A;  5CKF A;  3JCM W;  4DOW A;  1SF9 A;  2YT6 A;  4ORZ A;  2LQW A;  3G4S Q;  5CCA A;  1QVP A;  1MMG A;  3UDC A;  4ANJ A;  1FXX A;  3MO8 A;  2QI2 A;  1VQL T;  1TH7 A;  1K73 R;  3JCM V;  3UAT A;  2BZY A;  4M4Z A;  1Y7X A;  5FRM A;  3DLM A;  1PKT A;  4Y92 A;  1UHF A;  1GL5 A;  4C92 C;  5LL6 S;  3VV0 A;  5J39 A;  4J83 A;  1QCF A;  1N5Z A;  3VS0 A;  1X01 A;  1KQS A;  4E6R A;  1QCN A;  1WNL A;  2QYZ A;  3A8H B;  4C8Q E;  2G3R A;  1N27 A;  2COW A;  4EIK A;  1K0X A;  4M7D G;  1T3S A;  2RD1 A;  4JRQ A;  3QBY A;  5GAM f;  2ZGW A;  4A54 A;  1UGS B;  1T0H A;  2DVE A;  4XTW A;  4E7I A;  2DKG A;  2RK2 A;  3EFO B;  2KYM A;  4JDS A;  1UB4 A;  2CP0 A;  4JRK A;  4L6V 5;  2G6F X;  4DBR A;  4E7S A;  2J06 A;  2X4J A;  2V8K A;  2AT1 B;  2RJE A;  3GF5 A;  3ZL7 C;  2LNV A;  5CKB A;  3NTI A;  4FT4 A;  1VYT A;  2HL3 A;  3QO3 A;  1AOJ A;  1M2V A;  2RMO A;  2LRQ A;  3TU4 K;  3CD6 Q;  4IUR A;  2H3J A;  1KHC A;  3CCR T;  4FIB A;  1D3B B;  4QT7 A;  4J6Y A;  4F7U G;  5HK0 A;  1CKB A;  3CCQ T;  1OPL A;  5CQY A;  1YIT T;  1LPL A;  3VS1 A;  3MKD A;  4HVU A;  1Q82 U;  1N8R R;  1K9A A;  5GAN 5;  3P8B B;  4PJO B;  4M7A E;  1W2B P;  2CGH A;  2EIF A;  2HSP A;  4AT1 B;  2BE7 D;  2P0K A;  4PJJ A;  2RHZ A;  5KCO A;  4ZGJ B;  1M3A A;  1ZA1 B;  2FZC B;  3FLG A;  4BDY A;  2RHI A;  3HTR A;  3OW2 A;  1UJ0 A;  1SSF A;  4IUT A;  5CO7 A;  4PFZ A;  3M54 A;  2L8D A;  2KMT A;  4OML A;  5GMK e;  1FMW A;  1Y96 A;  2E6N A;  2PVD B;  3LGF A;  4XU3 A;  1AZE A;  2VV5 A;  4DEX A;  3CC7 T;  3M58 A;  2EQJ A;  3E9G A;  4PJO F;  3CCS T;  3CCJ T;  1Y71 A;  3SD4 A;  2J05 A;  3CCM T;  2DD4 A;  2W10 A;  5GJW B;  4LNP A;  2DXT A;  2QQS A;  3OQ5 A;  5GAO q;  3EFO A;  4L59 A;  3H9N A;  2AZS A;  4ZTJ A;  1VQ4 T;  2RO0 A;  2O9V A;  3M57 A;  4M78 B;  1BCM A;  2JMC A;  1VQ5 T;  1X75 C;  1MMD A;  3G1J A;  1N9R A;  4JPB W;  3QWY A;  2JUF A;  2RHX A;  1IRX A;  1ACM B;  3N5B B;  4C8Q C;  2E64 A;  3LH0 A;  3V8L A;  1ZBX A;  2LZ6 B;  2RQW A;  3MEU A;  1TU0 B;  3H0H A;  3PIO A;  3CMA A;  3RR6 A;  3OBY A;  3SWN C;  1H3H A;  2M16 A;  1HD3 A;  4FSX A;  4E47 A;  1SHG A;  2BZX A;  1QVF A;  4PK4 A;  3CMA Q;  2OTJ T;  4AFQ C;  5IXF A;  4M78 F;  2VWF A;  3JCM g;  3CPW A;  3MP8 A;  4E7J A;  2QEX T;  4J8O A;  1PG5 B;  1IO6 A;  1K8A C;  2YHT A;  4ZTF A;  2KI7 A;  3OYM A;  3MP6 A;  1JB0 E;  1QP3 A;  1XNI A;  3JCM e;  1RI0 A;  4JLI A;  1JQQ A;  1RAI B;  1VIF A;  5EC7 A;  4IIO A;  2A0F B;  2C0T A;  2DAQ A;  5D7U A;  4IUQ A;  5IT9 E;  2CZ1 B;  1M8M A;  3CCV A;  2NLU A;  2F5K A;  2MOX A;  5IHI A;  2HMA A;  3CCV Q;  1LJO A;  4M7A C;  3ASK A;  3KXT A;  2OAU A;  2LC4 A;  4M7D B;  3HRS A;  3JB9 I;  4D8K A;  2J6F A;  2ENM A;  1RAH B;  3OYI A;  4XTX A;  4F16 A;  4LUE A;  2OI3 A;  3H0I A;  4OB3 B;  1V76 A;  2QAZ A;  1YI2 T;  2HDA A;  4K11 A;  3E2U A;  3PTA A;  1OU8 A;  2JOY A;  2XID A;  1T3L A;  1ZSG A;  1VQ4 Q;  3C94 A;  1M3B A;  4ZGE B;  8AT1 B;  5DLO A;  1QVG S;  1OEB A;  4BI3 A;  2FPE A;  1R0B G;  4F7U B;  3GLX A;  1Q81 R;  1PM3 A;  1WA7 A;  1C0M A;  2IG0 A;  3SWN A;  4J6X A;  1UDL A;  4EMK B;  1ZHI A;  4BI8 B;  1W70 A;  3L2R A;  3TCJ A;  1BU1 A;  1GFD A;  2OJ2 A;  5GMK l;  1BI0 A;  1OYX A;  2KT1 A;  3ZBD A;  3QHS A;  3NHN A;  2YUP A;  2DO3 A;  2JMA A;  3X26 B;  4F7U F;  3VS6 A;  3EG1 A;  3OS1 A;  3G6E T;  1WGS A;  5J3B A;  1NPR A;  3SHW A;  1NJI C;  1SRL A;  3JCM X;  2KNB B;  1TXQ A;  4PNO A;  3V7C A;  3F70 A;  1YBY A;  3S6W A;  2XI9 A;  1RAG B;  1C1A A;  1MUZ A;  4M7A A;  3QDF A;  2CSI A;  2CP5 A;  2LNH B;  1GXI E;  1NZ9 A;  2L3Q A;  5IXB A;  1PNJ A;  2ZPI B;  4FYV B;  2CP6 A;  1KD1 C;  1WXT A;  5KYN A;  2RJD A;  2X4Y A;  3I5S A;  5AT1 B;  4C0D B;  1HK9 A;  4CI0 C;  2RJC A;  5FU7 B;  2I2L A;  4C5I A;  1VQN A;  3M53 A;  2GGR A;  4M77 E;  2XDD A;  2VKN A;  2I0N A;  5GMK h;  4E7H A;  2YRD A;  4MDW A;  2RHU A;  2AK5 A;  5FLX E;  1QLY A;  1UG1 A;  3SDZ A;  5I2S A;  3JB9 G;  3M4G A;  1D0Y A;  3MCA B;  4BE1 A;  1RAC B;  2CT4 A;  4J9H A;  1RAD B;  1U1T A;  5I2M A;  2CSQ A;  5CIU A;  3A8G B;  3FDR A;  3M0S A;  3FJP A;  3R6O A;  2DL3 A;  5IAY A;  4JRI A;  4OB0 B;  2EQK A;  3OMG A;  4C0Z A;  3I56 T;  3RKW A;  1K8A U;  1MGQ A;  3X25 B;  1SPK A;  1R0C B;  4IKF A;  2BUD A;  2ED0 A;  1B07 A;  2RB6 A;  2RI3 A;  5GAN 8;  1H3Z A;  3OYB A;  3GBQ A;  1RLP C;  4AMC A;  4MMK A;  2L3R A;  3EG2 A;  4R55 A;  1VYU A;  1B34 A;  1PWT A;  2CP3 A;  2KBT A;  1G3T A;  4C92 G;  3JRZ A;  4ZGD B;  2EQI A;  2ATC B;  2VGN A;  3QG1 A;  2QTX A;  3FB9 A;  3M56 A;  4AG2 C;  4QKU A;  3URG A;  2K3B A;  1DJ7 B;  5A0L A;  2FEI A;  2JTM A;  3OS2 A;  4A63 B;  1JXM A;  4GLK A;  2EKO A;  2LDM A;  5KYU B;  3QYG B;  2X3W D;  2MK5 A;  3JCM h;  4P5N A;  2FRW A;  4E7K A;  1RLQ C;  3PE0 A;  2EPD A;  3P8H A;  1KC8 R;  3GP8 A;  3CME T;  1PD1 A;  1W2B S;  4E7L A;  2MWP A;  3ZEH A;  1YJW T;  5LJ3 h;  1F1B B;  5CVI A;  1ZX6 A;  3GNF B;  4DOV A;  1UE9 A;  4OB2 B;  1S72 A;  1OPK A;  2O2O A;  4Q5W A;  2EBP A;  5HK3 A;  1D1B A;  1S72 Q;  1YHQ A;  2RQR A;  3L1A A;  2J6O A;  1WXB A;  1K1Z A;  5I21 A;  1YHQ Q;  1WJS A;  1N8R C;  2PNI A;  4BE2 A;  3CPF A;  5EG2 A;  3I5R A;  2GQV A;  1QVG P;  4Z8A A;  4JLG A;  3JCM J;  1JJ2 A;  2GCX A;  2R57 A;  2RH2 A;  4M77 C;  3TQ7 P;  5GAN 7;  3OS5 A;  4HKE A;  4A4G A;  5FWC A;  4BAC A;  2F2X A;  3H0F A;  1NJI U;  1QKW A;  3WXM B;  3PNW C;  2DET A;  1OX8 A;  3CCU A;  2KXC A;  2DL7 A;  3U23 A;  1R77 A;  7AT1 B;  5FWB A;  2E1H A;  1K9M U;  1VQM T;  3CCU Q;  1P92 A;  1XOV A;  1T0J A;  2DF6 A;  1GFC A;  2QQ9 A;  4RTX A;  5KH6 A;  1X6B A;  2HEQ A;  4HT9 A;  2QQR A;  1IRE B;  1D0X A;  2QA4 A;  3V7R A;  1KD1 U;  5KYU A;  4PKC C;  4X1V A;  2QA4 Q;  3V8J A;  1OV3 A;  5IN1 A;  3OYA A;  3RES A;  3LW5 E;  5KYX A;  1JBM A;  2JVV A;  1LNX A;  2LVM A;  1MV0 B;  4OVA A;  1D0Z A;  4KUI A;  2RF0 A;  5KYW B;  2KRN A;  1Y07 A;  4XAX B;  1VQO A;  1VQ6 T;  3EG9 A;  1M2V B;  1LCK A;  2C06 A;  1VQ8 A;  4C8Q G;  2KT8 A;  2GNC A;  1H64 1;  1G83 A;  2V1Q A;  1VQO Q;  1WHJ A;  4OMO A;  3I55 A;  1VQ8 Q;  4OMP A;  4J6W A;  3CBM A;  1VUB A;  3OW2 P;  1NPP A;  2EQU A;  2EW3 A;  5GAM g;  3I55 Q;  4FCY A;  4OGC A;  1YCY A;  4KGZ B;  2MI6 A;  1BI3 A;  1M9S A;  1K73 U;  1LVK A;  3A1P A;  3EG0 A;  1O75 A;  3HRU A;  1PSF A;  2EYZ A;  1Q86 R;  3V7S A;  1QWF A;  4EDU A;  1VQ9 A;  1TG0 A;  3BDL A;  4Z02 A;  4CRI A;  3RKY A;  3PT9 A;  3JB9 F;  2QK0 A;  2M0O A;  1VQ9 Q;  4CC4 B;  2MYS A;  2X35 A;  3VS2 A;  1M90 U;  5FU6 C;  1Y96 B;  2DL8 A;  4X9D A;  3VS4 A;  4C92 B;  2OAW A;  2KGT A;  3SEM A;  5LJ5 g;  2E3H A;  5KYY A;  3PMI A;  1IB8 A;  2ECZ A;  1V29 B;  3M0U A;  3CQT A;  4N4I A;  4M7A G;  3QXE B;  3VS7 A;  1IZ6 A;  1WI7 A;  4FYW B;  5J26 A;  3KFV A;  5LJ5 e;  4XTY A;  2P4T A;  4J5Y A;  1VQ7 Q;  3VUB A;  5GAO m;  2KEA A;  2RQT A;  2A37 A;  1FYN A;  2ZPF B;  5KYW A;  5HY6 A;  3CD6 A;  1YJ9 Q;  3CCE A;  4C92 F;  1UHC A;  2AIR B;  3HSB A;  3TRE A;  2DRK A;  2BTT A;  2XKO C;  4LDW A;  2XDB A;  3CCE Q;  5D6X A;  4QVC A;  4LDU A;  1X43 A;  3T9N A;  4XK8 E;  3CCL T;  2RJF A;  3MP1 A;  1M30 A;  1R8O B;  2OTL T;  2E70 A;  1YFN A;  3OYN A;  1H8K A;  1Q81 C;  4A4E A;  5FRN A;  3QII A;  1N8R U;  2NUP B;  3LWH A;  1VOM A;  2DER A;  1KHI A;  1UEB A;  4V2S A;  2CUD A;  1OQK A;  4C5E A;  1M8V A;  3H6Z A;  3RUX A;  2K7A A;  5GAO n;  2CS7 A;  2RK1 A;  4DBH A;  1VQL A;  2GTJ A;  2Y4Y A;  5LJ5 j;  2QQB A;  1MMN A;  1VQL Q;  5GAN 4;  1Q82 R;  3OY9 A;  5C6S A;  3EFS A;  4KUD K;  4QQD A;  1ZSZ C;  3JB9 D;  3EHR A;  5CQX A;  3RER A;  4C92 A;  4IUV A;  3MHX A;  4FYX B;  2XU8 A;  3TVT A;  3L2V A;  3CC4 T;  3J81 E;  1GRI A;  2K2M A;  4AFZ C;  3V8K A;  2YUO A;  2YSQ A;  4A4F A;  2LQK A;  3JB9 J;  2V8J A;  4PFP A;  5KCH A;  4HCK A;  2LJ1 A;  2EYQ A;  1WDX A;  4JS4 A;  4VUB A;  2K6D A;  2YDL A;  3OYD A;  4QVD A;  2ZZD A;  2P0P A;  4M78 C;  5L23 A;  2JN0 A;  3HKS A;  4C0F A;  4CC2 A;  4C92 D;  1JXO A;  1OX9 A;  1AD5 A;  4A4H A;  3CC2 T;  4A53 A;  5D6W A;  2DK3 A;  3CCR A;  2A08 A;  2NUP A;  1X2Q A;  3QKJ A;  5GMK j;  1BI2 A;  1YIT A;  1LOJ A;  2GTO A;  2VB6 A;  4Y91 A;  1QMC A;  3CCR Q;  2E5K A;  5I22 A;  3JCM d;  3SWN B;  3CCQ Q;  1VQP T;  2KVQ G;  1YIT Q;  3PFS A;  4DA4 A;  4M75 E;  1FX7 A;  2R58 A;  4IUP A;  4X9C A;  2AHJ B;  2O4X A;  5LJ3 g;  4OP0 A;  4O5V A;  1O9S A;  2F2V A;  4RTW A;  4C8Q F;  1RAA B;  1QCO A;  4GBQ A;  1ZA2 B;  3HFO A;  3CXC P;  1MNE A;  2HKN A;  2LT4 A;  5LJ3 e;  1RL2 A;  4WCI A;  4XTZ A;  2V8I A;  1I0C A;  3OS0 A;  3Q1J A;  1QP2 A;  4XTV A;  5GJV B;  1TSF A;  1ZSZ A;  2P84 A;  1PRM C;  3CC7 A;  2CDT A;  2JTF A;  3M9Q A;  4RUG A;  3CCJ A;  1W2B A;  2AZV A;  2SRC A;  3CCM A;  3CC7 Q;  4MDX A;  1CSK A;  4M7A B;  3CCS Q;  2ESW A;  2QGG A;  3CCJ Q;  3RMQ A;  3M0P A;  1J3T A;  3CCM Q;  2PU9 B;  2DX1 A;  4NOY A;  4NS5 A;  4F14 A;  4M7D C;  5GAM h;  2JTE A;  4QQ6 A;  2KRS A;  2D9T A;  1K4U S;  3TEE A;  2HQH A;  1VQ4 A;  2R5A A;  2PUO B;  2XIC A;  4LDV A;  2DJZ A;  1Q95 G;  3DB4 A;  3JCM b;  4X34 A;  2QDL A;  1VQ5 A;  1KC8 C;  2K57 A;  1VA7 A;  1WYX A;  4C8Q A;  1VQ5 Q;  6AT1 B;  3J80 E;  4KGV B;  2QXF A;  1VQN T;  1UFF A;  4M7A F;  2JT4 A;  1IHW A;  4FU6 A;  4XU0 A;  2DIL A;  3E1S A;  4RMO A;  4KRT A;  3TSZ A;  5LJ3 j;  1Q81 U;  2J6K A;  2M9U A;  3L42 A;  1D09 B;  1SSH A;  3THK A;  4D8D A;  2KQW A;  2D8H A;  5LJ5 h;  2D8J A;  2E65 A;  2DTH A;  4HA8 A;  2OTJ Q;  4ELY C;  1BIA A;  5C0M A;  2LCS A;  2QEX Q;  3JCM P;  1QQJ A;  4M77 G;  3HL8 A;  4Y28 E;  2Y4X A;  2DD5 A;  3CBP A;  1VQK T;  1PRL C;  1JEG A;  2CUB A;  4C8Q D;  2E10 A;  1B34 B;  1UGR B;  5D6Y A;  1NLO C;  2NUT A;  2M02 A;  4L5G A;  4B9X A;  2EYX A;  2QAS A;  2ROL A;  4B6M A;  4HCZ A;  4KBM B;  3H41 A;  4M75 C;  2EGA A;  1ZUK A;  5FRO A;  2YLC A;  1WFW A;  2K5L A;  2K5F A;  2ROT A;  2JM9 A;  2EWN A;  3OSV A;  3ULR B;  2ED1 A;  3KUF A;  4AFS C;  1W4S A;  4OF1 A;  1KJW A;  3OW2 S;  3EGD A;  2LCL A;  3M0Q A;  3OYY A;  2YWW A;  4YTL A;  2MWO A;  1M1G A;  1YI2 A;  2CZ0 B;  3EG3 A;  1YI2 Q;  1PC0 A;  1NBE B;  3MET A;  2XK0 A;  2DPP B;  2RM4 A;  4M7A D;  1U06 A;  1WQW A;  3CEY A;  3CBO A;  2FG0 A;  2LQ8 A;  4ZN3 A;  1XJW B;  3BY7 A;  1G3W A;  2CYZ B;  3ME9 A;  3BDU A;  1AHJ B;  1I07 A;  4JJN K;  3M0R A;  1FWZ A;  4QQG A;  4AFU C;  2KY9 A;  1I8F A;  1Q86 C;  2HAX A;  3C95 A;  1M3C A;  3PVQ A;  3SFM A;  1TTH B;  1XTD A;  2LMJ A;  1MV3 A;  1FMK A;  2DL4 A;  3VYG A;  4J9I A;  3G6E A;  2L2P A;  3EH2 A;  4J9D A;  1M1F A;  1JO8 A;  3JB9 H;  1W1F A;  2YRV A;  1EIF A;  2E4H A;  3D7S B;  3G6E Q;  2X4X A;  2K2V A;  2JM8 A;  2C0O A;  1Y0M A;  4OB1 B;  2HD0 A;  4GLM A;  2EJF A;  2DLP A;  1GCP A;  1AWO A;  3GNG A;  2FB7 A;  2VVK A;  3HPW A;  3G71 T;  1W6X A;  3OSS C;  3S3M A;  4KGX B;  4LUD A;  3E9F A;  5IHN A;  1RI9 A;  1UTI A;  2KDS A;  2M1H A;  1YIJ T;  2QG9 B;  5KYX B;  1KC8 U;  4GY5 A;  3VU3 C;  1TS9 A;  2JJ9 A;  5HKC A;  2KSS A;  4EPC A;  1YJN T;  4DBF A;  4FYY B;  3EG9 B;  4BE0 A;  4OMF B;  5GAN g;  4ZNX A;  3QZ9 B;  2PTK A;  2H3E B;  3S3N A;  2O01 E;  2MCN A;  1VYV A;  1U1S A;  2F2W A;  1QW1 A;  2JW4 A;  4N4H A;  3RMS A;  5GAN e;  4KH0 B;  1ZLM A;  4E7Z A;  5CKE A;  4OMM A;  1QKX A;  3G4S T;  1KQS P;  1M27 C;  2MAM A;  1PCX A;  4BY6 C;  2GFU A;  3I56 Q;  1G2B A;  3J7A F;  3JCM c;  2FZG B;  3RKX A;  1Q82 C;  2HQE A;  1WZO A;  2RQU A;  2K79 A;  2RI5 A;  4M77 B;  4C5H A;  2A3L A;  2D0Q B;  4C5G A;  1WHL A;  5M9O A;  4JZ3 A;  5CKD A;  4O6J A;  2LCC A;  1SHF A;  9ATC B;  5KYY B;  1ARK A;  5DLQ E;  4BUG A;  1GCQ C;  1I81 A;  1WHK A;  3BFM A;  2DVJ A;  2RI2 A;  3C4S A;  4C0G A;  4OGE A;  3L2Q A;  2CRE A;  2KR3 A;  4M77 F;  2IVW A;  1KFZ A;  1YWP A;  1I4K 1;  3HHT B;  2EKH A;  3UA7 A;  5GAN j;  2YLB A;  4RG8 A;  2KK4 A;  2B8A A;  1FMV A;  2DRM A;  1A0N B;  1OUL A;  4PJO E;  1M1K R;  2EVR A;  2E6Z A;  1M5Q 1;  4MML A;  4EMG A;  4ATO A;  2PVO B;  1PKS A;  3CME A;  2JS2 A;  1YJW A;  3CD6 T;  4PLL A;  3EGU A;  2P4R A;  2CT3 A;  1Q7Y R;  1M2O A;  4RTY A;  2FPF A;  3CME Q;  3M4Y A;  1YJW Q;  2SEM A;  2BIV A;  5CK9 A;  2FL7 A;  3CXC S;  4ME7 A;  3VYH B;  1V1C A;  2J7I A;  4OMN A;  3INZ A;  2L3S A;  3X20 B;  4LD9 K;  4F04 B;  5GAM e;  3OYC A;  1Q86 U;  3VS3 A;  1TWB A;  2AKK A;  1NG2 A;  3GOX A;  4M77 A;  3OYK A;  2CH4 W;  1RAE B;  2RN8 A;  3FRN A;  4RTU A;  3JSC A;  4XQ3 A;  3VJP A;  2WSF E;  1B7T A;  3OYG A;  4R56 A;  2CZ6 B;  2KRO A;  4M78 E;  4UC4 A;  4J7F A;  2DXB A;  4WTO B;  1WX6 A;  5LJ5 d;  2NYS A;  5IH2 A;  1WXU A;  5FU6 B;  2GBQ A;  1QVG A;  2V1R A;  1VQ7 A;  2DBM A;  2A7Y A;  1VQM A;  2EYW A;  1AWX A;  1KIK A;  4NL3 A;  3UT1 A;  3EH1 A;  1M90 R;  5FW9 A;  1VQM Q;  1GCQ A;  2E41 A;  2DEQ A;  4FW2 A;  4J9B A;  1YJ9 A;  4FSS A;  2VXF A;  1E6H A;  4M77 D;  3MEA A;  4PJL A;  2JXB A;  4HCB A;  5GAM j;  3LLR A;  1QVF P;  3O8V A;  3MJX A;  2HBW A;  2DL5 A;  3HRT A;  2HBP A;  1X6O A;  4DEY A;  1X6G A;  3CPW P;  2WSE E;  1ZBJ A;  4Z88 A;  3REA B;  5KE3 A;  4WF2 A;  3S3O A;  3FJ5 A;  3PGG A;  3IQL A;  4F17 A;  1VQ6 A;  3UF4 A;  4XU2 A;  3MEV A;  3OYH A;  2O31 A;  3X24 B;  2K5I A;  1G3S A;  3FIF A;  1VQ6 Q;  1IHV A;  4ZN1 A;  4JJC A;  3QJ6 A;  3OMC A;  4KUL A;  3CMA T;  4PJM A;  1KQ2 A;  3DLL A;  5A0G A;  2PQW A;  3VRY A;  5A0D A;  1GBQ A;  1YNZ A;  2FVU A;  3OYE A;  4PJO C;  1NEG A;  2EGC A;  2QTV A;  1RAB B;  1OZ2 A;  2O4X B;  5LJ5 f;  4J7I A;  2DIQ A;  2KRM A;  4M7D E;  4PFO A;  1UEC A;  2K3X A;  2DTO A;  2YUN A;  3FC3 A;  1MND A;  3C0C A;  3HFN A;  1AVZ C;  4LE9 A;  1BKB A;  2EFI A;  5CR2 A;  2LT1 A;  1OOT A;  2GFA A;  2RQV A;  2RHY A;  1MMA A;  4AG1 C;  1D1C A;  1ZSZ B;  2ZAE A;  3CCV T;  3L2Z A;  1Z9Q A;  2LX9 A;  2OX7 A;  5GAN h;  4M75 G;  4KT0 E;  1BIB A;  1AWJ A;  1TUG B;  1UGP B;  4LDY A;  4F7U E;  5IHK A;  1JJ2 S;  1BK2 A;  2DBK A;  2MMP A;  3OBW A;  2MF2 A;  2B86 A;  4LD6 A;  2KE9 A;  3A8O B;  4DBQ A;  1B3Q A;  3E19 A;  2RA2 A;  3RNJ A;  2H8H A;  1BYM A;  1Y57 A;  4HVW A;  4XTU A;  4IIM A;  2NUZ A;  3MEW A;  2GQI A;  2Y90 A;  2O9S A;  2E3I A;  2KAF A;  5CKH A;  3NTK A;  4C8Q B;  3LWI A;  2JZ2 A;  2AKL A;  1WJQ A;  2O88 A;  3CCQ A;  5GAN 6;  3CCL A;  4JS5 A;  1SRM A;  4E2F B;  2XMF A;  1PD0 A;  3QDR B;  1D3B A;  4FT2 A;  8ATC B;  2OTL A;  3CCL Q;  2FYK A;  2M0Y A;  2WSC E;  4J9E A;  2BE9 B;  3UWN A;  2OTL Q;  2XD0 A;  4FW1 A;  5LJ3 d;  2PZ1 A;  2M51 A;  2DEU A;  1AEY A;  4PJO A;  4A4K A;  2BZ8 A;  2K9G A;  5I11 A;  3REB B;  1NYG A;  3NTH A;  3M5A A;  4KH1 B;  4ESR A;  4JJB A;  2NUT B;  2K3Y A;  3H8Z A;  1EX4 A;  1KG1 A;  2X51 A;  1SG5 A;  2PVG B;  3OYJ A;  2E12 A;  3CCS A;  3QZ5 B;  2IIM A;  2CZ7 B;  3CC4 A;  3P8D A;  3TSW A;  1U5S A;  2DM1 A;  3OYF A;  4RTZ A;  3M0T A;  2C0I A;  1ABQ A;  2K4Y A;  3CC4 Q;  1HJD A;  5GAO r;  1S1N A;  4PJO D;  3QWX X;  1OZ3 A;  5L8R E;  1IGQ A;  2VC8 A;  4N0A C;  1N6A A;  1H92 A;  3EGD B;  4BB7 A;  1UJY A;  3QPH A;  1ZUY A;  3QUI A;  2LJ3 A;  3JCM f;  4M78 A;  2F69 A;  2WAC A;  3HP9 A;  4LDX A;  2JS0 A;  1YWO A;  4BDZ A;  1KQS S;  3C12 A;  2R5M A;  3ZFJ A;  5LJ3 f;  3DKM A;  2D6F A;  3AHU A;  2L5Q A;  1NLP C;  2QDY B;  3CC2 A;  1ABO A;  2D0N A;  3RBB B;  2NWM A;  4LN2 A;  2Z0W A;  2HKQ B;  2OTJ A;  1YCS B;  4JRP A;  3CC2 Q;  4JZ4 A;  3QYH B;  2HCK A;  3PIP A;  4M7D F;  3QJY A;  2DJQ A;  5KE2 A;  1VQP A;  2QEX A;  4IUU A;  4HCC A;  2FPD A;  4EMK C;  2ZPH B;  2XDP A;  2LX7 A;  1VQP Q;  3R6N A;  4D6W A;  4NL2 A;  1GBR A;  2RNA A;  2EYY A;  3LH5 A;  4M78 D;  3DB3 A;  2F1L A;  5DM7 R;  3KBG A;  3VKI A;  1C6V X;  2X4W A;  1RAF B;  4II1 A;  2VYT A;  3EFR A;  3X28 B;  4FL6 A;  2XHC A;  1K0S A;  3L2W A;  1SEM A;  1WQ7 A;  2LTO A;  3A98 A;  3QSU A;  2HSE B;  1BI1 A;  3A5Z B;  1MHN A;  1I5L A;  3OYL A;  2HZY A;  1NM7 A;  4ELZ C;  1EFN A;  2A28 A;  4M75 B;  1SKU B;  1JRI A;  2A36 A;  1I1J A;  1BB9 A;  4DQ2 A;  2ZPB B;  5ECA A;  3ER0 A;  4M7D A;  1K9M C;  3FEO A;  3CXC A;  2FZK B;  1I5O B;  3NGP A;  1AWW A;  3LGL A;  4C0D C;  2COY A;  2MPX C;  4N0A A;  1IGU A;  2DYI A;  2LQN A;  2V26 A;  1JU5 C;  1M1K C;  5FU7 C;  1WIE A;  1WHG A;  1UGQ B;  4RTV A;  2QQA A;  1VIE A;  2EGE A;  3NFC A;  2F5T X;  2EJG A;  1JJ2 P;  2PUK B;  1Q7Y C;  4M75 F;  2L89 A;  3EGX B;  1NYF A;  2DXC A;  3L2U A;  2HNI A;  1S72 T;  2COZ A;  1VQN Q;  2CP7 A;  3EHQ A;  1IXD A;  4BD3 A;  2YXY A;  2W0Z A;  5DY9 A;  5HCK A;  4F7U A;  2DTI A;  1YHQ T;  4CC7 A;  3JV3 A;  5GMK m;  4M7D D;  1OU9 A;  4MZM A;  3I35 A;  3G7Z A;  3GPL A;  4EMK A;  2DFU A;  3LYI A;  2FO0 A;  2CKK A;  4PJN A;  3PVL A;  1U8R A;  2L0A A;  2LP5 A;  3EAE A;  1K8A R;  3LX7 A;  4XU1 A;  2ZCF B;  4R0K A;  5GAO p;  1QWE A;  1VQK A;  1HSQ A;  4Z89 A;  1K73 C;  4RCC A;  3M55 A;  3RDV A;  1VQK Q;  2CP2 A;  1X69 A;  2DE0 X;  1QVF S;  1KSW A;  3CCU T;  3OB9 A;  1OI1 A;  4M75 A;  3CPW S;  1KK7 A;  1U3O A;  2QGF B;  1M90 C;  1ZUU A;  2ABL A;  4FM4 B;  2FRY A;  2CH4 A;  2X3X D;  1HXD A;  1TUC A;  1WJR A;  2QA4 T;  4CC3 A;  1X27 A;  1X2K A;  3JCM Q;  1G5V A;  2DNU A;  3O5Z A;  4TVR A;  2KXD A;  1YN8 A;  1M4Z A;  1UGV A;  1HYO A;  4QVZ A;  4JUV A;  5GAN d;  1WLP B;  3EGX A;  1E7O A;  1XQH A;  5AYF A;  3GIB A;  2BKD N;  2EAY A;  1NEB A;  1VQO T;  2VGM A;  1K76 A;  1N9S A;  1YP5 A;  2HL5 C;  3A8M B;  1VQ8 T;  2YRC A;  1G8X A;  4M75 D;  4B9W A;  3AT1 B;  3I55 T;  2GF7 A;  1D1A A;  4RG2 A;  4HT8 A;  3RIR A;  2DZ9 A;  3I56 A;  2ZPE B;  4C92 E;  3WVE B;  2EJ9 A;  2P0Q A;  1E6G A;  3VUZ A;  4PJO G;  2DXU A;  2DA9 A;  4BI4 A;  4BY6 B;  1BCO A;  3OA6 A;  1WPY A;  2VUB A;  2VXE A;  2XG8 D;  2MIO A;  1VQ9 T;  1AZG B;  2HQX A;  5GMK i;  1WHM A;  3A8L B;  1CKA A; 
#chains in the Genus database with same CATH homology
 4M77 E;  1QP2 A;  3ZBD A;  2XDD A;  1KQ1 A;  4XU2 A;  1ZQ1 A;  3MEV A;  4MZP A;  4RCB A;  4RKU E;  4XTV A;  5GMK h;  3OYH A;  3X24 B;  2K5I A;  4E7H A;  1G3S A;  3FIF A;  4MDW A;  4PLI A;  2RHU A;  5FLX E;  3JAM E;  3SDZ A;  5I2S A;  4ZN1 A;  3JB9 G;  3M4G A;  3CC7 A;  2JTF A;  3QJ6 A;  3OMC A;  3M9Q A;  4KUL A;  3MCA B;  3CMA T;  3CCJ A;  5GAN 3;  1NE8 A;  4BE1 A;  3UPU A;  1W2B A;  1PSE A;  1U1T A;  5I2M A;  5CIU A;  3G71 A;  1KQ2 A;  3DLL A;  3A8G B;  5A0G A;  3CCM A;  2PQW A;  5GAN f;  3FDR A;  4MDX A;  4M7A B;  3FJP A;  3BW1 A;  3R6O A;  5IAY A;  1VQ7 T;  4JRI A;  3RMQ A;  4OB0 B;  5A0D A;  2EQK A;  2FHD A;  2FVU A;  3OYE A;  4PJO C;  3OMG A;  2PU9 B;  2E5Q A;  4NOY A;  4NS5 A;  4C0Z A;  3I56 T;  4M7D C;  1OZ2 A;  4MZT A;  3RKW A;  4QQ6 A;  2O4X B;  5GAM h;  5LJ5 f;  4J7I A;  1YIJ A;  1K8A U;  1M1K U;  2DIQ A;  1MGQ A;  2D9T A;  3TEE A;  3X25 B;  2JNG A;  4EMH A;  1VQ4 A;  2R5A A;  4M7D E;  1YJ9 T;  2PUO B;  3WVD B;  2XIC A;  4LDV A;  2BUD A;  4IKF A;  2K3X A;  2DTO A;  2RB6 A;  4M78 G;  3FC3 A;  2RI3 A;  2DJZ A;  2DIG A;  3DB4 A;  5GAN 8;  2EQM A;  3HFN A;  4X34 A;  3JCM b;  1H3Z A;  1VQ5 A;  5GAO l;  1KC8 C;  1BKB A;  2EFI A;  5CR2 A;  2K57 A;  3OYB A;  1Q7Y U;  3CCE T;  5A2Q E;  1YJN A;  2ZPG B;  2LT1 A;  4MMK A;  4QW2 A;  2L3R A;  5CAI A;  2GFA A;  4C8Q A;  2RHY A;  3J80 E;  5GAM d;  4R55 A;  2QXF A;  1VQN T;  1B34 A;  5GAN 2;  4M7A F;  1G3T A;  3CCV T;  4FU6 A;  3L2Z A;  4XU0 A;  3E1S A;  4RMO A;  4C92 G;  5LJ3 j;  1Q81 U;  3JRZ A;  2M9U A;  2LX9 A;  3PMT A;  4ZGD B;  3L42 A;  5GAN h;  2VGN A;  3QG1 A;  2QTX A;  4M75 G;  3FB9 A;  4KT0 E;  3M56 A;  4M7A C;  1BIB A;  2DZC A;  3SB2 A;  2KQW A;  1G3Y A;  3URG A;  1DJ7 B;  1UGP B;  5A0L A;  5LJ5 h;  4LDY A;  4F7U E;  3G4S A;  1JJ2 S;  2E65 A;  3M59 A;  4N4G A;  2MMP A;  4PL6 A;  5CKF A;  3JCM W;  2DTH A;  4DOW A;  2JTM A;  4HA8 A;  3OBW A;  2MF2 A;  3OS2 A;  4LD6 A;  3A8O B;  5CCA A;  1QVP A;  4GLK A;  2EKO A;  2LDM A;  3E19 A;  1FXX A;  3MO8 A;  3UDC A;  4ELY C;  2QI2 A;  2RA2 A;  3QYG B;  1BIA A;  1VQL T;  1BYM A;  5C0M A;  3JCM P;  1TH7 A;  3JCM h;  4P5N A;  4XTU A;  4M77 G;  3HL8 A;  4Y28 E;  2Y4X A;  3MEW A;  3JCM V;  4E7K A;  2DD5 A;  2Y90 A;  3CBP A;  1VQK T;  4C8Q D;  1Y7X A;  3P8H A;  2E10 A;  5FRM A;  2KAF A;  3DLM A;  5CKH A;  3NTK A;  4C8Q B;  3LWI A;  3GP8 A;  3CME T;  1W2B S;  2JZ2 A;  4E7L A;  1WJQ A;  2MWP A;  1B34 B;  3ZEH A;  1UGR B;  5LJ3 h;  1YJW T;  5D6Y A;  5CVI A;  3CCQ A;  4C92 C;  5LL6 S;  3GNF B;  4L5G A;  4DOV A;  4B9X A;  4OB2 B;  5GAN 6;  1S72 A;  3VV0 A;  5J39 A;  3CCL A;  4J83 A;  4JS5 A;  4Q5W A;  4HCZ A;  4KBM B;  4M75 C;  1X01 A;  1KQS A;  5HK3 A;  3QDR B;  1D3B A;  4FT2 A;  2OTL A;  1WNL A;  2FYK A;  3A8H B;  4C8Q E;  1YHQ A;  2G3R A;  5FRO A;  1N27 A;  2YLC A;  3L1A A;  2WSC E;  2K5L A;  3UWN A;  2K5F A;  4M7D G;  5I21 A;  2RD1 A;  1WJS A;  1N8R C;  2XD0 A;  5LJ3 d;  4JRQ A;  2EWN A;  3CPF A;  3QBY A;  5GAM f;  5EG2 A;  3OSV A;  4BE2 A;  2GQV A;  2ZGW A;  4A54 A;  1UGS B;  3KUF A;  4JLG A;  1W4S A;  2DVE A;  4XTW A;  3JCM J;  1JJ2 A;  4PJO A;  4E7I A;  4OF1 A;  2DKG A;  2GCX A;  4A4K A;  3OW2 S;  2RK2 A;  4JDS A;  2LCL A;  2R57 A;  1UB4 A;  2RH2 A;  3OYY A;  4JRK A;  4L6V 5;  4M77 C;  5GAN 7;  4YTL A;  3OS5 A;  2MWO A;  3NTH A;  2X4J A;  2V8K A;  1M1G A;  1YI2 A;  4HKE A;  2RJE A;  3GF5 A;  4A4G A;  3M5A A;  2CZ0 B;  2LNV A;  5CKB A;  3NTI A;  4BAC A;  4FT4 A;  1NJI U;  3WXM B;  3QO3 A;  2K3Y A;  3PNW C;  3H8Z A;  1KG1 A;  3MET A;  2PVG B;  2XK0 A;  3OYJ A;  2E12 A;  2LRQ A;  3TU4 K;  3CCS A;  2DPP B;  3CCU A;  2RM4 A;  3QZ5 B;  4M7A D;  2CZ7 B;  4IUR A;  2H3J A;  1KHC A;  3CCR T;  4FIB A;  2E1H A;  1D3B B;  1WQW A;  3CEY A;  4J6Y A;  4F7U G;  3CBO A;  5HK0 A;  3CCQ T;  1K9M U;  3CC4 A;  3P8D A;  1VQM T;  1P92 A;  1XOV A;  5CQY A;  1YIT T;  2LQ8 A;  2QQ9 A;  3OYF A;  4ZN3 A;  5KH6 A;  3BY7 A;  1G3W A;  2K4Y A;  4HT9 A;  2QQR A;  1IRE B;  5GAO r;  2CYZ B;  3ME9 A;  3BDU A;  2QA4 A;  1Q82 U;  3V7R A;  1AHJ B;  1KD1 U;  4PJO D;  5GAN 5;  4JJN K;  3P8B B;  4PKC C;  1OZ3 A;  4PJO B;  5L8R E;  1FWZ A;  2VC8 A;  4N0A C;  4QQG A;  4M7A E;  1N6A A;  2CGH A;  2KY9 A;  2EIF A;  1I8F A;  3V8J A;  4BB7 A;  3QPH A;  5IN1 A;  3OYA A;  1Q86 C;  2HAX A;  3RES A;  3QUI A;  3LW5 E;  2P0K A;  2RHZ A;  3C95 A;  3JCM f;  1JBM A;  2JVV A;  5KCO A;  4ZGJ B;  1LNX A;  3FLG A;  2LVM A;  3SFM A;  4BDY A;  2RHI A;  4OVA A;  3OW2 A;  4KUI A;  4M78 A;  1XTD A;  2F69 A;  1SSF A;  2WAC A;  3HP9 A;  4IUT A;  5CO7 A;  4LDX A;  1Y07 A;  3VYG A;  4XAX B;  4BDZ A;  1KQS S;  3C12 A;  2R5M A;  3ZFJ A;  5LJ3 f;  3G6E A;  3DKM A;  1VQO A;  1VQ6 T;  2D6F A;  3AHU A;  3M54 A;  2C06 A;  2L8D A;  2KMT A;  2L5Q A;  4C8Q G;  1VQ8 A;  1M1F A;  3JB9 H;  2QDY B;  2YRV A;  1EIF A;  3CC2 A;  1H64 1;  2X4X A;  5GMK e;  2K2V A;  1Y96 A;  2E6N A;  2PVD B;  3LGF A;  4XU3 A;  3I55 A;  2HD0 A;  2VV5 A;  4OB1 B;  2EJF A;  3CC7 T;  3M58 A;  4J6W A;  3CBM A;  2OTJ A;  1VUB A;  2EQJ A;  3E9G A;  4PJO F;  3CCS T;  4JRP A;  3CCJ T;  1Y71 A;  1NPP A;  3GNG A;  2EQU A;  3QYH B;  3SD4 A;  5GAM g;  2FB7 A;  3PIP A;  3HPW A;  3QJY A;  3G71 T;  4M7D F;  3CCM T;  2DD4 A;  4OGC A;  5KE2 A;  1YCY A;  1VQP A;  3OSS C;  2QEX A;  4IUU A;  4HCC A;  4EMK C;  2MI6 A;  2DXT A;  3S3M A;  2ZPH B;  1BI3 A;  2XDP A;  2QQS A;  3OQ5 A;  5GAO q;  3E9F A;  1M9S A;  4L59 A;  1K73 U;  2KDS A;  2M1H A;  1YIJ T;  1O75 A;  4D6W A;  3HRU A;  1PSF A;  4NL2 A;  4ZTJ A;  1VQ4 T;  2RO0 A;  1KC8 U;  3M57 A;  4M78 D;  3DB3 A;  5DM7 R;  3KBG A;  4GY5 A;  4M78 B;  3V7S A;  3VKI A;  2X4W A;  3VU3 C;  4II1 A;  2VYT A;  4EDU A;  1VQ9 A;  1VQ5 T;  3BDL A;  3EFR A;  1X75 C;  4Z02 A;  3X28 B;  5HKC A;  4CRI A;  1N9R A;  4FL6 A;  2KSS A;  3PT9 A;  2JUF A;  3RKY A;  4EPC A;  1YJN T;  3JB9 F;  2XHC A;  2M0O A;  4BE0 A;  3Q1J A;  4OMF B;  2RHX A;  4C8Q C;  5GAN g;  3N5B B;  3L2W A;  2E64 A;  2X35 A;  3QZ9 B;  1M90 U;  1WQ7 A;  2LTO A;  5FU6 C;  3S3N A;  3LH0 A;  3QSU A;  1BI1 A;  1Y96 B;  3A5Z B;  1MHN A;  3V8L A;  1ZBX A;  1I5L A;  4X9D A;  2O01 E;  4C92 B;  1U1S A;  3MEU A;  3OYL A;  5LJ5 g;  3PMI A;  3PIO A;  3CMA A;  1QW1 A;  4ELZ C;  3OBY A;  1V29 B;  4N4H A;  3RMS A;  4M75 B;  2M16 A;  3SWN C;  5GAN e;  4N4I A;  1JRI A;  4M7A G;  3QXE B;  4FSX A;  4E47 A;  1IZ6 A;  4DQ2 A;  1QVF A;  2OTJ T;  5CKE A;  4M78 F;  5J26 A;  2ZPB B;  3ER0 A;  3G4S T;  4M7D A;  3JCM g;  3CPW A;  1K9M C;  3FEO A;  4XTY A;  2P4T A;  3MP8 A;  4J5Y A;  5LJ5 e;  3CXC A;  4E7J A;  3LGL A;  3VUB A;  2QEX T;  4J8O A;  2MAM A;  4BY6 C;  5GAO m;  2GFU A;  4C0D C;  1K8A C;  2YHT A;  4N0A A;  4ZTF A;  1M1K C;  2ZPF B;  3J7A F;  3JCM c;  5FU7 C;  3RKX A;  1Q82 C;  1UGQ B;  2HQE A;  5HY6 A;  4M77 B;  2RI5 A;  3MP6 A;  3OYM A;  1JB0 E;  4C5H A;  1QP3 A;  1XNI A;  3JCM e;  3CD6 A;  2QQA A;  1RI0 A;  2A3L A;  2D0Q B;  1VIE A;  3CCE A;  4C92 F;  3HSB A;  4JLI A;  3NFC A;  3TRE A;  2F5T X;  2EJG A;  1VIF A;  2XKO C;  4LDW A;  2PUK B;  1Q7Y C;  2XDB A;  4M75 F;  2L89 A;  4C5G A;  5D6X A;  2DAQ A;  4QVC A;  4IUQ A;  5M9O A;  5IT9 E;  2CZ1 B;  5CKD A;  2DXC A;  3CCV A;  4LDU A;  4O6J A;  3T9N A;  2LCC A;  3L2U A;  2HNI A;  2NLU A;  4XK8 E;  3CCL T;  1S72 T;  2RJF A;  2F5K A;  3MP1 A;  4BD3 A;  5DLQ E;  1LJO A;  1R8O B;  5DY9 A;  2E70 A;  4BUG A;  3OYN A;  2OTL T;  1Q81 C;  3ASK A;  4F7U A;  2DTI A;  1I81 A;  3BFM A;  4A4E A;  3KXT A;  1YHQ T;  3QII A;  1N8R U;  5FRN A;  2OAU A;  2RI2 A;  3C4S A;  4C0G A;  4OGE A;  3LWH A;  5GMK m;  3L2Q A;  4M7D D;  1KHI A;  2LC4 A;  1UEB A;  4MZM A;  4M7D B;  3HRS A;  3JB9 I;  4M77 F;  2IVW A;  4V2S A;  1I4K 1;  3HHT B;  3G7Z A;  3GPL A;  4C5E A;  5GAN j;  2YLB A;  4EMK A;  3LYI A;  3H6Z A;  4RG8 A;  3RUX A;  2KK4 A;  1M8V A;  2B8A A;  5GAO n;  3OYI A;  2CS7 A;  2RK1 A;  4XTX A;  1VQL A;  2CKK A;  1U8R A;  3EAE A;  2Y4Y A;  3LX7 A;  4OB3 B;  4XU1 A;  4PJO E;  5LJ5 j;  2QQB A;  2ZCF B;  5GAO p;  1VQK A;  2E6Z A;  1M5Q 1;  5GAN 4;  1YI2 T;  4MML A;  4RCC A;  4EMG A;  1K73 C;  3OY9 A;  4ATO A;  3PTA A;  5C6S A;  3EFS A;  2PVO B;  4KUD K;  3M55 A;  2JOY A;  2XID A;  4QQD A;  3CME A;  1YJW A;  3CD6 T;  4PLL A;  3C94 A;  4ZGE B;  5CQX A;  5DLO A;  3JB9 D;  3RER A;  1QVG S;  4C92 A;  4IUV A;  1QVF S;  4BI3 A;  3MHX A;  3M4Y A;  3CCU T;  2BIV A;  3OB9 A;  5CK9 A;  2XU8 A;  1OI1 A;  4M75 A;  2FL7 A;  3CPW S;  3CXC S;  4ME7 A;  3VYH B;  3L2V A;  4F7U B;  3CC4 T;  3J81 E;  3GLX A;  1M90 C;  3INZ A;  3X20 B;  4LD9 K;  4FM4 B;  3V8K A;  2IG0 A;  3SWN A;  4A4F A;  2LQK A;  5GAM e;  3JB9 J;  1HXD A;  1WJR A;  2V8J A;  4J6X A;  5KCH A;  3OYC A;  2QA4 T;  4EMK B;  1ZHI A;  3JCM Q;  2EYQ A;  1Q86 U;  4BI8 B;  3L2R A;  3TCJ A;  1G5V A;  4TVR A;  4JS4 A;  3GOX A;  4VUB A;  4M77 A;  3OYK A;  1M4Z A;  5GMK l;  4QVD A;  3OYD A;  3FRN A;  2ZZD A;  1BI0 A;  1OYX A;  2P0P A;  3JSC A;  3QHS A;  4JUV A;  4M78 C;  4QVZ A;  4XQ3 A;  3VJP A;  2WSF E;  2JN0 A;  5GAN d;  3OYG A;  2DO3 A;  4R56 A;  1XQH A;  2CZ6 B;  3X26 B;  3HKS A;  5AYF A;  4C0F A;  4F7U F;  3OS1 A;  2BKD N;  2EAY A;  4M78 E;  4UC4 A;  4C92 D;  3G6E T;  1VQO T;  3GIB A;  1WGS A;  2VGM A;  5J3B A;  1NPR A;  1N9S A;  2DXB A;  4J7F A;  1NJI C;  1VQ8 T;  3A8M B;  5LJ5 d;  4A4H A;  4M75 D;  3JCM X;  4PNO A;  4B9W A;  3CC2 T;  4A53 A;  5D6W A;  3V7C A;  5FU6 B;  3F70 A;  2DK3 A;  3CCR A;  3I55 T;  1QVG A;  2GF7 A;  1YBY A;  3S6W A;  5GMK j;  3QKJ A;  1VQ7 A;  1BI2 A;  2A7Y A;  2XI9 A;  1VQM A;  4RG2 A;  1YIT A;  1LOJ A;  4Y91 A;  4HT8 A;  3RIR A;  2DZ9 A;  4NL3 A;  3UT1 A;  3I56 A;  2ZPE B;  3SWN B;  4C92 E;  3JCM d;  3WVE B;  2EJ9 A;  2P0Q A;  1VQP T;  4M7A A;  2KVQ G;  2E41 A;  3PFS A;  2DEQ A;  4DA4 A;  1GXI E;  1NZ9 A;  4M75 E;  1FX7 A;  1YJ9 A;  2VXF A;  2R58 A;  3VUZ A;  4IUP A;  4PJO G;  2ZPI B;  4X9C A;  4M77 D;  2AHJ B;  2DXU A;  2O4X A;  5LJ3 g;  1VQ6 A;  4OP0 A;  4O5V A;  1KD1 C;  3MEA A;  4BI4 A;  4HCB A;  1O9S A;  4BY6 B;  5GAM j;  3LLR A;  2RJD A;  2X4Y A;  3O8V A;  4C0D B;  4CI0 C;  1HK9 A;  4C8Q F;  3OA6 A;  1WPY A;  2VUB A;  2VXE A;  2RJC A;  2XG8 D;  5FU7 B;  3HRT A;  1VQ9 T;  2HBP A;  1X6O A;  2HQX A;  2I2L A;  3HFO A;  2WSE E;  3M53 A;  4C5I A;  1VQN A;  5KE3 A;  4WF2 A;  2LT4 A;  5LJ3 e;  1RL2 A;  3PGG A;  4XTZ A;  5GMK i;  3S3O A;  2V8I A;  3OS0 A;  3A8L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...