2R5MA

Crystal structure of the two mbt repeats from sex-comb on midleg (scm) in complex with peptide r-(me)k-s
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPGHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Polycomb protein Scm
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5mA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2r5mA01
3NTHA 3OYFA 2GF7A 3QJ6A 3DB3A 4C5GA 4PLIA 2MWPA 3CEYA 2X4WA 3MP8A 3OYCA 3PFSA 2X35A 4N4IA 3PMIA 4IURA 2O4XA 3LGFA 3FDRA 5D6WA 2LVMA 2MWOA 3PMTA 1WGSA 2LDMA 3BDLA 3H8ZA 2EQMA 5IAYA 3OYBA 3UWNA 5D6XA 3Q1JA 4BE1A 4IKFA 2L8DA 4E7HA 3S3MA 1XNIA 3QBYA 4C5IA 3OY9A 2VYTA 2RHXA 4FU6A 2BIVA 4NS5A 3OYDA 4E7IA 3OYNA 3S3NA 3EAEA 1OYXA 2LCCA 2B8AA 3S3OA 5FROA 1RI0A 1MHNA 1WJSA 3L2WA 4E7LA 4Q5WA 3QKJA 4N4HA 3MEWA 2LRQA 3H6ZA 5FRMA 4A4GA 3MEUA 3OQ5A 2DAQA 3OMCA 5KCHA 2R57A 4IUQA 2EQJA 3FLGA 3M9QA 3FEOA 4II1A 2IG0A 2R58A 5KE2A 2DIQA 2RI2A 3SD4A 4B9XA 3OYJA 2HQEA 4BE0A 3P8HA 2RI3A 3OS0A 4GY5A 3L2RA 5IN1A 1WJQA 3KUFA 2X4XA 3QIIA 4C5EA 2RJFA 1WJRA 5KE3A 3P8DA 2M16A 2LTOA 2D9TA 2EKOA 3OYIA 1OZ2A 2RI5A 2K3YA 2RO0A 4Z02A 3OYHA 2RHZA 2M0OA 1KHCA 3E9FA 2FHDA 4IUUA 4CRIA 3ME9A 3NTIA 3FC3A 4BACA 4ZTJA 2GFUA 2BKDN 1N27A 3MP1A 2L89A 4IUPA 3OYAA 2EQUA 3MEVA 3UT1A 4B9WA 2HQXA 1OZ3A 2XK0A 2CKKA 2RHUA 4A4HA 2XDPA 4QVZA 5CIUA 2E5QA 2O4XB 2PQWA 3LLRA 4A4FA 1G5VA 2G3RA 2RHYA 5J39A 2RJCA 3S6WA 3DB4A 2R5MA 2F5KA 2X4YA 3DLMA 3MP6A 2BUDA 4QQGA 4FL6A 5M9OA 3LGLA 4IUVA 3F70A 2EFIA 4EDUA 3OB9A 2GFAA 2DIGA 3LX7A 2R5AA 5J26A 4PL6A 4BDZA 2RJDA 1SSFA 1OI1A 3OYEA 2JTFA 3OMGA 2WACA 3ASKA 4IUTA 3OYKA 3OYGA 2RJEA 3GOXA 2YRVA 3O8VA 3NTKA 2QQRA 3ZEHA 2QQSA 5C0MA 4OVAA 4QQ6A 1H3ZA 5C6SA 2K3XA 4BD3A 5KCOA 4UC4A 3E9GA 4HCZA 4LD6A 2E6NA 2P0KA 4E7JA 3MEAA 4RG2A 5D6YA 2NLUA 4N4GA 4E7KA 3PNWC 3META 2RHIA 3C4SA 5FRNA 3OS2A 3OA6A 2JZ2A 3OYLA 4ZTFA 4A4EA 4QQDA 3LYIA 3L42A 3L2VA 2M1HA 4X34A 4QW2A 2EQKA 4L59A 3LH0A 5KH6A 3OS1A 3MO8A 3OYMA 3L2QA 3L2UA 4BE2A 4C5HA 4BDYA 2L3RA 4PLLA
chains in the Genus database with same CATH superfamily
2A37A 3DB3A 4HCCA 2GGRA 2BE9B 1PSEA 1N5ZA 3CEYA 3TSWA 5GAOp 4N4IA 4FCYA 3A1PA 3A5ZB 3G6EA 1YJ9T 5IAYA 5GAMd 3M0UA 3R6OA 2L8DA 1HYOA 3QBYA 4JJNK 3RKYA 4N0AC 4O5VA 4LDWA 2WSFE 3JCMJ 1WXTA 2QQBA 1ZX6A 3EFOA 3GIBA 4KH1B 3OQ5A 1GBQA 3RBBB 4J9HA 3A8HB 4J9GA 3CMET 3CC7T 2R58A 1YP5A 1NBEB 1PRLC 4OF1A 3TREA 2FB7A 1RLPC 4Y92A 1UE9A 3CMEA 3CC7A 2KDSA 3HHTB 3P8DA 2XDBA 1S72A 1Y0MA 4OMMA 2YUOA 3UDCA 4QVDA 1D0YA 3PVLA 3NPFA 1N27A 2NUPB 4FYVB 4C0ZA 4JS4A 2A7YA 2HL5C 4F7UB 4ME7A 2RPNA 4QVZA 1D09B 4A4FA 1RL2A 4FIBA 4OB1B 2DEUA 4QQGA 1MGQA 1BIAA 2FPFA 1ACMB 2XMFA 4M7AA 3F70A 1GBRA 2AKLA 3CCMQ 5ECAA 4OB0B 1I5OB 1TG0A 2CP7A 2D8JA 2DE0X 3CCJA 3RMQA 2QQRA 1D0ZA 3CCSA 1VQPT 2QQAA 1WPYA 5KCOA 4TVRA 4LD6A 4N4GA 3FRNA 5IHIA 2VGMA 4DBRA 4QW2A 1I1JA 2L5QA 1RUWA 3CCQA 4MMKA 1M2VB 3EFSA 1Y57A 2QG9B 2QA4Q 2EKHA 3C12A 2F69A 1PRMC 5FU6B 2BE7D 2PVGB 3REBB 2CZ7B 2FG0A 3CBOA 4JPBW 1WYXA 5CQYA 3ZL7C 1IHVA 1K9AA 2QAZA 1MMAA 1H8KA 2Z0WA 2ZZDA 1X27A 4JS5A 4DEYA 1VQOQ 1NLPC 3OY9A 1QWEA 1RAAB 3OW2A 2BIVA 4NS5A 5GAOr 2FVUA 2GQVA 4ANJA 3QO3A 3CCQT 1RAFB 1Y96A 2Y4XA 5GAMf 4PJMA 3V7CA 3SHWA 4XK8E 3VS7A 4DBFA 1U8RA 1O9SA 4EMGA 3VS3A 2EKOA 1OZ2A 1NG2A 1PD1A 5CKDA 1RAHB 2QYZA 3CCUT 3KBGA 3NGPA 4JRPA 2XDPA 1V1CA 3EFOB 1N8RR 4M78A 1MNEA 3VYGA 2R5MA 1Y7XA 1YCSB 1I5LA 2DRMA 1W2BP 4L5GA 4QKUA 2K9GA 3CD6T 2GTJA 5KYYA 3DLLA 1AWWA 4Z88A 4OVAA 3OBYA 1K9MR 3CC4Q 4JRQA 1Q86C 4ZGDB 4BI4A 2OTLA 3RKWA 4FYWB 3TCJA 2DTHA 3MHXA 5L8RE 4RTYA 2HNIA 2M1HA 3QYGB 1B7TA 3OW2S 3CCJT 1HXDA 1MV3A 2DBKA 1JB0E 3THKA 3EG3A 4AT1B 2ZPFB 3CMAT 1NEGA 2XG8D 4M75E 3JCMg 3JB9J 1IREB 1TSFA 1TTHB 1WA7A 1KD1C 4EMKC 4ELYC 4E7HA 4D8DA 4FU6A 4AG2C 1KG1A 1W4SA 1JXMA 3INZA 5FROA 4J6XA 1UGSB 2FZKB 2CUDA 1S72T 3MEUA 1VQ9Q 1GXIE 3PGGA 1TWBA 2CZ0B 3JB9F 4OP0A 1Q86U 2HCKA 4F17A 2SEMA 2RI2A 1WHLA 2HQEA 1KJWA 3P8HA 3G4SQ 2RQVA 3EGDA 3JCMP 1ZSZA 1WQWA 2DYBA 3PIOA 5GAMe 1VQ6T 2AHJB 2DKGA 5CQXA 2RHZA 4JRKA 1KQSA 1I81A 1W70A 2DXBA 3JCMW 2BTTA 3MP1A 3CCMT 3GF5A 4J7IA 2CREA 1FYNA 1IZ6A 2E5QA 2O4XB 1YHQQ 2RHYA 3I5SA 2DXTA 4C0DB 7AT1B 5GAN2 3M0RA 4BDZA 4QT7A 2XD0A 4WCIA 4MZTA 1KC8U 1QVPA 4DQ2A 1VQ6A 3EHRA 4DOVA 1X01A 4R56A 4HVUA 1KQ1A 4XTXA 2LMJA 2ZCFB 4RG2A 4E7KA 2HZYA 1U1SA 1O75A 1CKAA 2H8HA 4FYXB 3EGXB 6AT1B 3L2VA 2VC8A 3CCRQ 3LH0A 4C0DC 5CCAA 2P0PA 4OGEA 1IGUA 1X43A 2DVEA 3EG9A 4XTWA 3OSSC 4M75C 2DFUA 4KBMB 2VB6A 2V8JA 3GNFB 3KFVA 2O4XA 3V7RA 3G71Q 2KVQG 1SHFA 1U1TA 3PMTA 5GANg 3H8ZA 4F7UE 5I2MA 1RAEB 1V76A 4C8QD 2OAWA 2I2LA 2QA4T 4D6WA 3NHNA 3S3NA 4E7IA 1Q82U 2M0YA 4C92F 1EIFA 9ATCB 1JRIA 5FRMA 2EJ9A 4XAXB 3FLGA 3SWNB 3M58A 3VS1A 3UA6A 1LOJA 4WTOB 4BE0A 3I55Q 1QLYA 4ELZC 1KK7A 4HCBA 2M16A 2LTOA 2K3YA 1H92A 3NTIA 2JS0A 2HKNA 2W0ZA 1Q81C 2LT1A 2ZPGB 2LQNA 5GJVB 2CYZB 2K6DA 2QDLA 3TQ7P 4M75D 2KYBA 3VS0A 3ER0A 2DRKA 3HP9A 2OTLT 4C0GA 1QP2A 4V2SA 4Y28E 5KYUB 2MIOA 3OYYA 1BI3A 1MMDA 1N9RA 4MZMA 5CAIA 2F2XA 2LT4A 2COZA 4M75G 3QZ5B 4FT2A 4HCZA 3TEEA 4JRIA 2E6NA 1K76A 3HFNA 5HK3A 3OA6A 1VQPA 3RR6A 4JLGA 4X34A 1WDXA 1OX8A 4EMKB 3G4ST 4XQ3A 2E10A 2JTEA 3LW5E 4M7AF 3VS6A 1VQKQ 1ZSGA 4BI3A 1AVZC 2KGTA 3GBQA 1W2BA 5GAOq 2HSEB 4B6MA 1BKBA 2CH4A 4BE1A 2MOXA 5KYWA 3CCRA 2OTLQ 3D7SB 4XU2A 1MHNA 1YHQA 1PKSA 3X25B 4AMCA 2DAQA 2ZPIB 2FZCB 4QVCA 2VGNA 3SD4A 1JJ2S 3VRZA 2CP5A 2JJ9A 3JB9H 4NOYA 1R77A 1TH7A 1VQLA 2DEQA 5GANh 1YJNA 2VKNA 1LNXA 1X2KA 2YHTA 4J6WA 1K1ZA 3QWXX 3SFMA 1IGQA 3JRZA 2RO0A 4C8QG 5IHKA 3T9NA 3EH2A 4BY6C 4ZTJA 1MMNA 5GAOl 4MZPA 4B9WA 1AT1B 4KGXB 5CIUA 2RJCA 4HA8A 2D0NA 3UATA 2RQWA 1B3QA 2JW4A 2NWMA 5J26A 4J9CA 2PNIA 2DD5A 1VYUA 4M7AE 4XTZA 1VQ4Q 1XJWB 2WACA 4PJOF 1JEGA 3G71A 3O8VA 5LJ3g 3ZEHA 2X51A 2QTVA 1VQOA 2COYA 4HT8A 2QEXT 5KYNA 4PFPA 2O01E 1YITQ 2DX1A 5IXBA 2HAXA 2F2VA 3V8LA 2ED1A 4FSSA 2O9VA 1VQ8A 1YN8A 1BCMA 3RNJA 5LJ5e 4J9BA 1YWOA 1YJ9A 2YUQA 3KXTA 3EG1A 1YITT 5EC7A 3M55A 2CH4W 2QEXA 1BK2A 3LGFA 2LVMA 4HCKA 2BZYA 2MWOA 2FYKA 1G3TA 3BDLA 2XI9A 5GANd 2QI2A 3JCMc 3PT9A 1M1GA 1QKWA 4C5IA 1YIJQ 2P84A 3OYNA 4LUEA 3WVDB 3EGXA 2V1RA 3CPFA 5EG2A 2EQIA 1D0XA 4F7UF 1KC8R 2MPXC 3OMCA 3NFCA 1AD5A 5LJ5j 2EQJA 1VQ7A 3GLXA 1R8OB 4BUGA 1M90U 2KYMA 1WHHA 4M7DC 1T0HA 2E3IA 2AK5A 2JUFA 2JS2A 3L2RA 1WJQA 1JQQA 4A54A 3CCMA 3L1AA 4AFUC 3SEMA 5GAN7 3OYIA 2YLBA 4M77D 3SDZA 2M0OA 1KHCA 5D7UA 2BKDN 2LJ3A 1VQNQ 2XK0A 1OZ3A 3BW1A 2MMPA 2VV5A 3LLRA 2PQWA 3CCVT 1AZEA 2EGCA 2G3RA 2MI6A 2ECZA 1CKBA 2JMCA 2QDYB 5DLQE 3CCLQ 4KH0B 3I55A 2KI7A 3V7SA 1Y96B 2LX7A 2K3BA 2DPPB 3VUBA 1YWPA 5LJ3e 1Z9QA 3OYKA 4P5NA 2E41A 4JLIA 3GOXA 4EIKA 2X4JA 3CXCA 4YTLA 3M0SA 3CCLT 1PSFA 5GANe 5C6SA 2K3XA 4BD3A 4UC4A 1M90C 4E2FB 3QYHB 4RUGA 4J5YA 2PVDB 3CCVA 5FRNA 1VQNT 2JZ2A 2V8IA 1Z9ZA 2WSEE 2L3PA 3M59A 3EGDB 2V1QA 2E3HA 3MJXA 1RADB 1FMVA 2L0AA 2VVKA 4M7DA 2MCNA 1LJOA 3M53A 3MP8A 3RERA 1U5SA 1OX9A 2X35A 3NMZC 1B34B 3PMIA 1TUGB 3FDRA 5D6WA 4C0FA 1WGSA 1W2BS 2CP2A 4IIOA 1ZA1B 4LDUA 2LNVA 2NUPA 2B86A 2HQHA 4JDSA 3J7AF 3EAEA 1KC8C 4LD9K 1YNZA 4N4HA 3MEWA 5A0LA 2AZSA 4II1A 1C6VX 1WHGA 4C92C 4RTZA 2DIQA 3EGUA 3X26B 1FXXA 5A0GA 2RN8A 2I0NA 2X4XA 1WJRA 1JXOA 1RABB 1RACB 1VQKA 1UDLA 1M1KR 2ROLA 2HBWA 1PKTA 2EPDA 1M2VA 4XTVA 2FHDA 2FPDA 1NJIC 4OMOA 5GAMg 2L89A 3ZFJA 4ZGJB 1VOMA 1G3WA 3CPWS 2KR3A 1WLPB 2DA9A 4PFZA 1JO8A 2EAYA 1M8VA 1LCKA 3CBMA 4A4KA 1VQOT 3FIFA 4HVWA 1G83A 4EDUA 2CP0A 3O5ZA 5GMKm 1QW1A 1VQ4T 3GPLA 1Q82C 1AHJB 1GCQA 3JCMX 1IHWA 1KHIA 5GAOn 2Y4YA 8AT1B 4KUDK 2OJ2A 2O9SA 3IQLA 5J3BA 4PJOB 1VUBA 1LVKA 2COWA 5D6YA 3E1SA 3HFOA 1QVFA 4A4EA 1M8MA 4JJDA 1FWZA 2D6FA 2DETA 4M75A 4M7DE 2J6KA 1HSQA 1K9MU 3JCMf 1QQJA 2C0OA 2E65A 5HK0A 3NTHA 4FM4B 3WVEB 4GBQA 1OULA 3OYCA 2LNHB 3A8GB 2YT6A 1KQSP 2J05A 4J9EA 2E6ZA 2L3SA 1OPKA 2EYYA 1PCXA 1M2OA 3OYBA 1M90R 5KYXA 1NYGA 2DZ9A 1D1AA 1UGPB 1OEBA 3H6ZA 2RF0A 5KYWB 1SSHA 1NEBA 4D8KA 4KULA 4OMQA 3REAB 1R0BG 2GQIA 1AZGB 4OMPA 1UEBA 4NL3A 3OYJA 3OS0A 2ZPBB 3AT1B 2M9UA 3GP8A 1HK9A 3QIIA 4RCBA 5KE3A 1PD0A 4PKCC 3I9QA 2RK1A 2A0FB 1SPKA 1QP3A 2GCXA 2BZXA 1KFZA 2GNCA 3JCMQ 3JB9D 4IUUA 2LQ8A 4C92B 4BACA 2KY9A 2DZCA 1WHMA 5GJWB 2D8HA 2HEQA 4OMLA 3DB4A 3I56T 2DBMA 3GNGA 1OU8A 1ZUKA 2V8KA 2EGAA 4C8QC 2DL5A 3RUXA 4LN2A 1FMKA 2DIGA 1UJYA 1YJWQ 4J9DA 1HD3A 4C8QA 4IUTA 3LH5A 2AZVA 2CP3A 3H9NA 4OGCA 1W6XA 1UTIA 2F5TX 1YI2Q 3QJYA 1D3BA 1V29B 4F7UG 4XTYA 1QVGP 2HKQB 2EYZA 4X9DA 5LJ5f 2H3EB 1D1CA 3FJPA 2Y90A 1PG5B 2KRNA 3OYMA 1B34A 2EIFA 4MDXA 5CKEA 3CCUA 2FEIA 2OTJT 2VUBA 3CXCP 3QPHA 3RMSA 3RESA 3JCMe 2YRDA 4IURA 4EPCA 1SRLA 1KIKA 4M77F 2ZGWA 5CKHA 1VQ7T 2BZ8A 5CVIA 2OTJA 2ATCB 3SWNC 5IH2A 3A8LB 2QA4A 1G3YA 2DF6A 1QWFA 2RI3A 2LP5A 4RG8A 5IN1A 1VQMQ 1VIEA 2CT4A 4AFSC 3QZ9B 1IRXA 1X6BA 1I8FA 1T0JA 4M7DD 3CCRT 3OBWA 3OYAA 2O88A 2DJQA 1RAGB 2K5FA 2KSSA 2YLCA 5GAMj 2J6OA 3UT1A 1VQ9A 1GFCA 2KRMA 1UG1A 5GMKh 2MAMA 2ABLA 2FPEA 3DLMA 3MP6A 4Z89A 1WI7A 3CCEA 1A0NB 4C8QE 2VXFA 2K79A 3LX7A 4XU0A 1KD1R 3CCQQ 4PJOA 3I5RA 2QEXQ 2E70A 2RJEA 3M54A 2JM8A 4E47A 4HVVA 4KGZB 2RM4A 4NL2A 5FWCA 2V26A 2ZAEA 2P0KA 4CC3A 3A8MB 1N8RC 3C94A 4ZTFA 1P92A 5KYXB 1WXBA 4DA4A 3UPUA 4LE9A 1ZSZC 5HCKA 4M78F 1VQ6Q 1NYFA 2A08A 2QXFA 1X2QA 1D1BA 5GMKi 2YDLA 3EG9B 2J7IA 1ABOA 2DL7A 1VQLT 1X75C 1VQLQ 5CK9A 1SKUB 4RMOA 3SB2A 3TVTA 3CC4T 1KSWA 5I21A 1NJIR 3X20B 5LJ5h 1OYXA 4VUBA 1M3BA 2PU9B 3L2WA 5FU7C 3QKJA 4F7UA 1VQNA 2R57A 2LCLA 1ZSZB 5KE2A 3G6ET 2CP6A 4M4ZA 1TUCA 2HMAA 1C0MA 2LZ6B 3KUFA 1N8RU 1Q82R 2G6FX 5GAMh 1YI2T 4BY6B 1NM7A 1IXDA 3MCAB 4C92D 5GMKj 3CCJQ 3TU4K 1UFFA 2PZ1A 3JV3A 4IUPA 4J9FA 1VQKT 3M5AA 4J83A 1PNJA 1Q95G 2EVRA 2LQKA 1BCOA 2A36A 4E7ZA 2F5KA 1GRIA 3EFRA 2YSQA 1EFNA 2R5AA 3CD6Q 4HT9A 2J06A 2RD1A 3OMGA 3ASKA 2PVOB 2XKOC 4M7DG 2LJ0A 1M30A 2DLPA 3QDRB 3QUIA 4MMLA 4RCCA 2NLUA 2RQTA 4AG1C 2A3LA 1JJ2A 1WQ7A 1JJ2P 3L42A 3L2QA 2EQKA 1YFNA 3MO8A 2CSIA 4C5HA 3J80E 2IPOB 3C95A 1E6GA 2DK3A 1VQ4A 1UHFA 1VQ7Q 2YWWA 3E19A 3OYFA 1VQMA 3HSBA 3QJ6A 4OMFB 4PLIA 1YJWA 1Q7YR 1M3AA 2NUZA 1QCOA 2LJ1A 1HJDA 1E7OA 1QCFA 1AEYA 2XDDA 1U06A 1I4K1 4CC7A 4LNPA 1K8AR 4AFZC 3H0HA 3QXEB 4Y91A 1ZUUA 3EG0A 2EJFA 1WFWA 1YCYA 4BI8B 4F16A 4ORZA 3V8KA 2LRQA 2VWFA 4IUQA 4M7DB 2AKKA 3JB9G 4XU1A 3U23A 4RTTA 3EHQA 1OV3A 2F1LA 2DTOA 5CR2A 4BB7A 1QVGS 1ZBXA 2GBQA 3TSZA 1TU0B 3C0CA 4Z02A 2ENMA 2GFUA 1WZOA 1S1NA 5IHNA 3VS5A 2EQUA 1Y07A 2QK0A 4FYYB 1GFDA 3S6WA 2EGEA 1M1KC 4PJJA 3I56A 2X4YA 2KNBB 3R6NA 5IT9E 4J9IA 1BI2A 2DM1A 1XOVA 3HRUA 3OB9A 1IO6A 2KT1A 4PL6A 2HD0A 5AT1B 1QVFP 4N0AA 3G4SA 4DBQA 3M0TA 5CKFA 2YRVA 3OS5A 3NTKA 2KXDA 3FB9A 1BB9A 2GTOA 3H41A 4LDYA 4M78E 2E5KA 1H3ZA 3G6EQ 5LL6S 2YUNA 3C4SA 1BYMA 2W10A 3BDUA 4QQDA 3LYIA 3CCLA 2JTMA 2KMTA 2QGGA 2FRYA 2E4HA 4M77C 1UGRB 1VQ5Q 1CSKA 1NJIU 3CPWP 1JU5C 2KAFA 2CT3A 1G3SA 2E64A 2C0IA 1C1AA 1LPLA 1PWTA 1ZA2B 2FZGB 3PFSA 1VQ8Q 1FX7A 1M1KU 1BI1A 5CO7A 2EQMA 4EMHA 3PE0A 4M78D 4JZ4A 5AYFA 4OB2B 1WNLA 2NUTA 1YITA 2VYTA 3A98A 3OYDA 3ZBDA 1ZLMA 5GAN3 1WJSA 1VQ8T 2KBTA 4A4GA 2KRSA 1YJ9Q 3M9QA 3X24B 2MF2A 4M7AG 3RDVA 2DTIA 4M78B 2AT1B 2DERA 4M77G 2JXBA 3J81E 1QVFS 1Q7YU 1TXQA 2DILA 5LJ5d 2D9TA 1K0XA 4KUIA 5GMKe 2KXCA 4RTWA 2OX7A 1E6HA 3G71T 1K8AC 2KROA 3QG1A 2DL3A 1I0CA 1NPRA 2E12A 1T3LA 2RA2A 4RTVA 2JM9A 1QCNA 4PFOA 1G5VA 2F2WA 4FL6A 3PIPA 2K4YA 1Y71A 3LGLA 3MPUB 3BE3A 2ZPEB 4M78C 4IUVA 2EFIA 3M56A 3HRTA 3VUZA 2L2PA 4C8QF 1NPPA 2JTFA 1VA7A 4LDXA 4F04B 3OYGA 2DXCA 2L3QA 2DYIA 3E2UA 4CC4B 4PJOD 4QQ6A 2KEAA 4E7SA 4ZN1A 2YXYA 3E9GA 4C92A 8ATCB 2CS7A 1PC0A 1Q7YC 4LUDA 1SG5A 1N6AA 5KH6A 1MV0B 3M4YA 1K8AU 4PJOG 4CI0C 1Q81U 1WHKA 3FJ5A 3CCET 1YBYA 3H0IA 2MWPA 3CCSQ 5KYYB 1OQKA 3VS4A 2HL3A 5I2SA 2QQ9A 4PJNA 3CCUQ 2LDMA 2K5LA 3URGA 3H0FA 1YJNQ 3QHSA 3UWNA 3OSVA 3RKXA 3Q1JA 4IKFA 2XIDA 4C92E 1KQ2A 2RB6A 5LJ3f 1UHCA 1K73R 1K0SA 3UA7A 4XTUA 2P0QA 3LWIA 2B8AA 3S3OA 1ZQ1A 2EBPA 4Q5WA 4DOWA 3JCMV 4ZN3A 2X9HA 4PJOE 4RTUA 3RIRA 3FEOA 1NLOC 2DVJA 4LDVA 1BU1A 2CZ6B 2M51A 1RI9A 2LX9A 3OW2P 4C5EA 2CDTA 4M7AB 2LQWA 4A63B 3VKIA 1R0CB 2RI5A 2ZPHB 2DJZA 4M77E 1TS9A 3CXCS 1YHQT 4RTXA 5GAOm 3FC3A 1YI2A 5GANj 4L6V5 1X6OA 2KT8A 2HQXA 4A4HA 1GL5A 4LXCA 1EZZB 4GLMA 3EH1A 2QTXA 5FU7B 3JB9I 4MDWA 3CPWA 4PK4A 1UECA 5LJ3j 4M75B 3VJPA 4FT4A 5DLOA 2LCSA 2RQRA 2XICA 2RH2A 1KQSS 1WHJA 3DKMA 1OI1A 1RLQC 3HPWA 1QVGA 1DJ7B 1GCPA 4DEXA 2KK4A 2QQSA 1S72Q 2CUBA 1J3TA 3OS2A 2CGHA 2JVVA 2EYXA 4FSXA 1G2BA 1XTDA 1TUDA 2ROTA 3HL8A 5GANf 4BE2A 5A2QE 2P4TA 3VRYA 2L3RA 4JZ3A 3CMAQ 1YIJT 4IIMA 3JSCA 4R0KA 2EYWA 1MNDA 4EMKA 4FW1A 2NYSA 3HKSA 3CMAA 2FO0A 1H3HA 1AWJA 5D6XA 1XNIA 4FW2A 2RHXA 5FWBA 4X1VA 4AFQC 1VQ5A 2LCCA 1B07A 1U3OA 1X6GA 2PTKA 5FW9A 4E7LA 2JNGA 2DD4A 3UF4A 4PJLA 2VXEA 2HSPA 2K2MA 4ZGEB 4WF2A 2C0TA 4PJOC 4DBHA 3MKDA 1VIFA 2K7AA 2M02A 3HRSA 5I22A 5KYUA 2JMAA 3CD6A 1VQMT 5LJ5g 2K2VA 3M4GA 1WX6A 1JBMA 2KE9A 5LJ3h 1D3BB 1W1FA 3QDFA 4K11A 2OAUA 2WSCE 4KRTA 2DL8A 2IIMA 3QSUA 2OI3A 2EYQA 2BUDA 2X3XD 2EJGA 1KD1U 1Q86R 4RKUE 2DMOA 3OYEA 1BBZA 2CZ1B 3SWNA 1BI0A 1VQPQ 2H3JA 4C92G 5HY6A 4CC2A 2CSQA 3I55T 1SEMA 1TOVA 4PNOA 3A8OB 3N5BB 2K5IA 3META 2RHIA 3OYLA 3CCST 3ULRB 3CCEQ 3V8JA 2K57A 1AWXA 4OMNA 5DM7R 5I11A 1SF9A 1N9SA 4M78G 3JCMb 4M7DF 4C5GA 2ESWA 3JAME 2ED0A 5GAN8 3G7ZA 2PUOB 1F1BB 2QASA 1UJ0A 2VASA 2XU8A 3S3MA 2JN0A 1H641 4X9CA 5A0DA 4JJCA 4M7AC 1M5Q1 4M77B 1AWOA 4J8OA 1UUEA 4F14A 1YJNT 2IG0A 2DXUA 2OTJQ 4B9XA 4JJBA 1M3CA 1NE8A 1IB8A 1OOTA 1K9MC 2MK5A 2YUPA 3JCMd 2RQUA 3I35A 4ESRA 2C06A 2CKKA 2RHUA 1T3SA 5GAN4 1M4ZA 3CCVQ 1YJWT 2RK2A 1ZUYA 5M9OA 2EWNA 1AOJA 2GFAA 1VYVA 1UB4A 3PTAA 1FMWA 3I56Q 3JCMh 5GMKl 3CMEQ 3CC7Q 2MYSA 2O31A 2QGFB 4HKEA 2JT4A 3BY7A 1ZBJA 4E7JA 1SHGA 1I07A 2DNUA 2AIRB 1YIJA 3OS1A 1VQ9T 3L2UA 1ZHIA 4M75F 2FRWA 1PM3A 2DO3A 4PLLA 1X69A 4ATOA 2YRCA 1VQ5T 1K73U 2GF7A 4J7FA 1EX4A 2X4WA 5GAN6 2HBPA 2D0QB 2E1HA 5LJ3d 2SRCA 1QKXA 1G8XA 3M57A 2J6FA 4XU3A 3WXMB 4R55A 1XQHA 2A28A 3CQTA 5DY9A 3X28B 1WXUA 3VV0A 2HDAA 1RI0A 3BFMA 4KT0E 1SRMA 1GCQC 1MMGA 3QWYA 1M9SA 5KCHA 1RAIB 2KQWA 4J6YA 1PHTA 2JOYA 4JUVA 4A53A 1VYTA 1Q81R 4GY5A 1ARKA 3G1JA 3VS2A 1UGQB 5GAN5 3LWHA 2RJFA 2NUTB 2O2OA 4O6JA 5HKCA 1ABQA 3OYHA 3E9FA 3EG2A 4CRIA 2IVWA 3ME9A 3M0PA 3HTRA 5L23A 1K73C 3AHUA 1K4US 3MEVA 3CC4A 2XHCA 4OB3B 4M77A 4Z8AA 2PUKB 5J39A 4C8QB 1OU9A 2LC4A 3CBPA 2RNAA 1OPLA 4HXJA 5FLXE 5CKBA 1M27C 1MUZA 2RJDA 1SSFA 3P8BB 1QMCA 3VU3C 3VYHB 5IXFA 3CC2T 3CC2A 4M7AD 2X3WD 4ZNXA 4KGVB 5C0MA 2EW3A 1WIEA 3CC2Q 3MEAA 2D1XA 4GLKA 3PNWC 5FU6C 2P4RA 2DL4A 1NZ9A 2RMOA 1M1FA 4L59A 2FL7A 4E6RA 3PVQA 1UGVA 3L2ZA 4BDYA 1BIBA 3M0QA
chains in the Genus database with same CATH topology
1Q81U 4XQ3A 2E10A 2VUBA 3DB3A 3CCET 4HCCA 1YBYA 1PSEA 2MWPA 3CEYA 3LW5E 3QPHA 3RMSA 4M7AF 3RESA 3JCMe 5GAOp 4N4IA 5I2SA 4IURA 4BI3A 2QQ9A 3A5ZB 2LDMA 1W2BA 2K5LA 3URGA 4EPCA 3G6EA 1YJ9T 5IAYA 5GAOq 3QHSA 4M77F 3OSVA 3RKXA 1BKBA 3UWNA 3Q1JA 3R6OA 2ZGWA 2L8DA 5GAMd 2XIDA 4BE1A 5CKHA 4C92E 4IKFA 2RB6A 3QBYA 5LJ3f 3CCUA 1VQ7T 1KQ2A 4JJNK 3RKYA 4N0AC 4O5VA 2P0QA 4XTUA 3LWIA 3CCRA 4LDWA 5CVIA 2B8AA 3S3OA 1ZQ1A 2WSFE 4XU2A 3JCMJ 1MHNA 1YHQA 2QQBA 3X25B 2OTJA 4Q5WA 3SWNC 4DOWA 3JCMV 3GIBA 3A8LB 4ZN3A 3OQ5A 2DAQA 2QA4A 4PJOE 1G3YA 3A8HB 3RIRA 3FEOA 2ZPIB 3CMET 3CC7T 2R58A 4QVCA 2VGNA 4LDVA 4OF1A 3SD4A 1JJ2S 2RI3A 4RG8A 3TREA 2CZ6B 2FB7A 5IN1A 3JB9H 1VIEA 2LX9A 4NOYA 1TH7A 1VQLA 2DEQA 3CMEA 3CC7A 4C5EA 2KDSA 5GANh 1YJNA 3HHTB 1LNXA 2YHTA 3P8DA 4J6WA 4M7AB 2XDBA 3VKIA 3SFMA 2ZPHB 2RI5A 2DJZA 3JRZA 3QZ9B 1S72A 1I8FA 2RO0A 4M77E 4C8QG 3T9NA 3CXCS 1YHQT 4M7DD 5GAOm 4BY6C 3UDCA 4QVDA 4ZTJA 3FC3A 3CCRT 1N27A 4C0ZA 3OBWA 3OYAA 4JS4A 2K5FA 2YLCA 1YI2A 2A7YA 2KSSA 5GAMj 5GAOl 5GANj 4L6V5 3UT1A 4MZPA 1X6OA 4B9WA 1VQ9A 2HQXA 4A4HA 4F7UB 4ME7A 4QVZA 5CIUA 5GMKh 5FU7B 2QTXA 2MAMA 4A4FA 3JB9I 4MDWA 3CPWA 2RJCA 4HA8A 5LJ3j 1RL2A 4FIBA 4OB1B 4M75B 3VJPA 4FT4A 3DLMA 3MP6A 5DLOA 4QQGA 1MGQA 2XICA 3CCEA 1BIAA 2RH2A 4C8QE 1KQSS 2VXFA 4M7AA 3F70A 3LX7A 4XU0A 5J26A 3DKMA 4OB0B 1OI1A 2DD5A 4M7AE 4PJOA 4XTZA 3HPWA 2WACA 4PJOF 1QVGA 2E70A 3G71A 2RJEA 3CCJA 1DJ7B 3M54A 3O8VA 2QQRA 3RMQA 3ZEHA 5LJ3g 2KK4A 2QQSA 3CCSA 4E47A 1VQPT 2QQAA 1WPYA 1VQOA 2RM4A 5KCOA 4NL2A 4TVRA 4HT8A 4LD6A 2P0KA 2QEXT 4N4GA 3FRNA 3OS2A 3A8MB 1N8RC 3C94A 4ZTFA 2O01E 2CGHA 1P92A 2JVVA 4FSXA 2VGMA 2HAXA 1XTDA 4DA4A 3HL8A 4QW2A 3V8LA 2L5QA 3UPUA 5GANf 4BE2A 3CCQA 5A2QE 2P4TA 1VQ8A 4M78F 4MMKA 2L3RA 3EFSA 5LJ5e 1YIJT 3C12A 1YJ9A 3JSCA 2F69A 3KXTA 5FU6B 2PVGB 2CZ7B 2QXFA 3CBOA 5GMKi 1YITT 3M55A 2QEXA 4EMKA 5CQYA 1VQLT 3LGFA 2LVMA 1X75C 2MWOA 3HKSA 5CK9A 4RMOA 3CMAA 2FYKA 1G3TA 3BDLA 2XI9A 3SB2A 3CC4T 2ZZDA 5GANd 4JS5A 5D6XA 5I21A 2QI2A 3JCMc 3PT9A 3X20B 1M1GA 5LJ5h 1XNIA 4C5IA 3OY9A 2RHXA 3OW2A 2BIVA 4NS5A 3OYNA 5GAOr 1VQ5A 1OYXA 2FVUA 2LCCA 4VUBA 2PU9B 3WVDB 2GQVA 3L2WA 4E7LA 2JNGA 2DD4A 5FU7C 3QKJA 2VXEA 4F7UA 3CPFA 3QO3A 5EG2A 3CCQT 4ZGEB 4WF2A 4F7UF 1VQNA 3OMCA 4PJOC 3NFCA 2R57A 5LJ5j 2EQJA 1VQ7A 2LCLA 3GLXA 1Y96A 1VIFA 2Y4XA 5KE2A 1R8OB 4BUGA 5GAMf 3G6ET 1M90U 3V7CA 4M7DC 4XK8E 2JUFA 3L2RA 1WJQA 1U8RA 3KUFA 1N8RU 1O9SA 3HRSA 4A54A 4EMGA 3L1AA 5GAMh 3CCMA 1YI2T 2EKOA 4BY6B 3OYIA 5GAN7 1OZ2A 2YLBA 3MCAB 4M77D 3SDZA 3CD6A 4C92D 5GMKj 5LJ5g 1VQMT 2K2VA 3M4GA 5CKDA 2M0OA 3TU4K 1KHCA 1JBMA 5LJ3h 3CCUT 1D3BB 3KBGA 2BKDN 1VQKT 4IUPA 1YJWA 3M5AA 4J83A 2OAUA 2XK0A 1OZ3A 2WSCE 4JRPA 2XDPA 3BW1A 2MMPA 2VV5A 3LLRA 2PQWA 2LQKA 3CCVT 2G3RA 2MI6A 4M78A 3QSUA 3VYGA 2R5MA 2F5KA 2EYQA 2QDYB 5DLQE 2BUDA 1Y7XA 2EJGA 3I55A 1KD1U 3V7SA 1Y96B 3EFRA 4RKUE 1I5LA 2DPPB 3VUBA 2R5AA 4L5GA 5LJ3e 4HT9A 3OYEA 2RD1A 3CD6T 3OMGA 3ASKA 3OYKA 2CZ1B 2PVOB 4P5NA 2E41A 3SWNA 4JLIA 3GOXA 2XKOC 3DLLA 4M7DG 1BI0A 2X4JA 3CXCA 4YTLA 2H3JA 4C92G 4OVAA 3QDRB 3OBYA 1PSFA 3CCLT 5HY6A 5GANe 3QUIA 4MMLA 2K3XA 4BD3A 5C6SA 4JRQA 4UC4A 1Q86C 1M90C 4ZGDB 4BI4A 4RCCA 3QYHB 3I55T 4PNOA 4J5YA 2NLUA 2PVDB 3A8OB 3N5BB 2K5IA 3META 3RKWA 2RHIA 2OTLA 3CCVA 5FRNA 1VQNT 2JZ2A 3OYLA 2V8IA 3TCJA 2A3LA 2DTHA 2WSEE 3CCST 1JJ2A 3MHXA 1WQ7A 3M59A 5L8RE 3L42A 2HNIA 2M1HA 3QYGB 2EQKA 3V8JA 3L2QA 3MO8A 2K57A 3OW2S 3CCJT 1HXDA 4C5HA 3J80E 3C95A 5DM7R 1JB0E 2DK3A 4M78G 1N9SA 3JCMb 1VQ4A 4M7DF 2ZPFB 3E19A 3OYFA 1VQMA 3HSBA 3QJ6A 4C5GA 3CMAT 4M7DA 3JAME 4OMFB 2XG8D 1LJOA 4PLIA 3M53A 3G7ZA 2PUOB 4M75E 3MP8A 3JCMg 5GAN8 3JB9J 3RERA 1IREB 2X35A 1B34B 3PMIA 3FDRA 5D6WA 2XDDA 4C0FA 1WGSA 1I4K1 1W2BS 1KD1C 4EMKC 4LDUA 2XU8A 2LNVA 3QXEB 4ELYC 4E7HA 3S3MA 4Y91A 2JN0A 1H641 4FU6A 1KG1A 4X9CA 4JDSA 3J7AF 1W4SA 2EJFA 3INZA 3EAEA 1YCYA 4BI8B 5A0DA 1KC8C 5FROA 4J6XA 4LD9K 4M7AC 1M5Q1 1UGSB 4N4HA 3V8KA 4M77B 3MEWA 2LRQA 1S72T 3MEUA 5A0LA 1GXIE 3PGGA 4J8OA 4IUQA 4M7DB 2CZ0B 1YJNT 4II1A 3JB9F 4OP0A 2IG0A 3JB9G 4XU1A 1Q86U 2DXUA 4C92C 2DIQA 2RI2A 4B9XA 3X26B 2HQEA 1FXXA 3P8HA 5A0GA 2DTOA 3JCMP 2X4XA 5CR2A 4BB7A 1WJRA 1WQWA 3PIOA 1QVGS 5GAMe 1VQKA 1VQ6T 1ZBXA 2AHJB 2DKGA 5CQXA 1NE8A 4Z02A 2RHZA 4XTVA 4JRKA 2FHDA 1NJIC 1K9MC 3JCMd 1I81A 2DXBA 3JCMW 2GFUA 5GAMg 1KQSA 3MP1A 2L89A 3CCMT 2EQUA 3ZFJA 4ZGJB 1Y07A 3GF5A 4J7IA 1G3WA 2C06A 2CKKA 2RHUA 3CPWS 1IZ6A 2E5QA 2O4XB 5GAN4 2RHYA 1M4ZA 2EAYA 3S6WA 1M8VA 1M1KC 2DXTA 3CBMA 4A4KA 4C0DB 3I56A 2X4YA 5IT9E 1YJWT 2RK2A 5M9OA 1VQOT 2EWNA 1BI2A 3FIFA 5GAN2 4EDUA 1XOVA 3HRUA 3OB9A 2GFAA 5GMKm 4PL6A 1QW1A 1UB4A 2HD0A 4BDZA 3PTAA 4N0AA 3G4SA 1VQ4T 2XD0A 3GPLA 1Q82C 1KC8U 4MZTA 1AHJB 1QVPA 4DQ2A 5CKFA 1VQ6A 3JCMh 5GMKl 4DOVA 3JCMX 1X01A 2YRVA 3OS5A 3NTKA 1KHIA 4R56A 5GAOn 3FB9A 1KQ1A 4XTXA 4LDYA 2Y4YA 4M78E 4KUDK 1H3ZA 4HKEA 2ZCFB 5J3BA 3BY7A 4PJOB 4E7JA 1VUBA 4RG2A 5D6YA 4E7KA 1U1SA 1O75A 3E1SA 3HFOA 3C4SA 5LL6S 1QVFA 1BYMA 3BDUA 4A4EA 4QQDA 3LYIA 3CCLA 1YIJA 1FWZA 3L2VA 2D6FA 2VC8A 2JTMA 2KMTA 4M77C 3LH0A 3OS1A 1VQ9T 3L2UA 1UGRB 1ZHIA 4M75A 4C0DC 4M75F 5CCAA 2P0PA 4M7DE 4OGEA 1K9MU 1NJIU 2DO3A 2DVEA 3JCMf 4PLLA 2KAFA 4ATOA 2E65A 5HK0A 1K73U 1VQ5T 3NTHA 1G3SA 2E64A 2GF7A 4XTWA 4J7FA 4FM4B 3WVEB 3OSSC 4M75C 2X4WA 3OYCA 5GAN6 4KBMB 2V8JA 2HBPA 3A8GB 2D0QB 3GNFB 3PFSA 1FX7A 2E1HA 2O4XA 3V7RA 2E6ZA 2KVQG 1M1KU 1BI1A 5LJ3d 1U1TA 3PMTA 5GANg 3H8ZA 5CO7A 4F7UE 3M57A 5I2MA 2EQMA 4XU3A 3OYBA 3WXMB 4EMHA 4C8QD 4M78D 4R55A 1XQHA 4OB2B 1WNLA 5AYFA 2I2LA 2QA4T 1YITA 5DY9A 3X28B 2VYTA 4D6WA 2DZ9A 3OYDA 3S3NA 4E7IA 1Q82U 3VV0A 1RI0A 3BFMA 1EIFA 3ZBDA 1JRIA 4C92F 1WJSA 4KT0E 5GAN3 1VQ8T 1UGPB 3H6ZA 5FRMA 4A4GA 1M9SA 2EJ9A 5KCHA 4XAXB 2KQWA 4KULA 3FLGA 3M9QA 4J6YA 2JOYA 3SWNB 3X24B 4JUVA 2MF2A 3M58A 4M7AG 1UEBA 4A53A 2DTIA 4M78B 4NL3A 3OYJA 4M77G 1LOJA 4BE0A 3OS0A 4GY5A 2ZPBB 3J81E 4HCBA 4ELZC 1QVFS 1Q7YU 2M9UA 1UGQB 3GP8A 1HK9A 3QIIA 2RJFA 4RCBA 5KE3A 5GAN5 3LWHA 2M16A 2LTOA 4PKCC 2D9TA 2RK1A 4O6JA 5HKCA 5LJ5d 4KUIA 5GMKe 2K3YA 1QP3A 2GCXA 3OYHA 3JCMQ 3JB9D 3G71T 3E9FA 4IUUA 4CRIA 2IVWA 3ME9A 3NTIA 1K8AC 2LQ8A 4C92B 4BACA 2KY9A 1Q81C 2LT1A 1K73C 3QG1A 2ZPGB 3AHUA 3MEVA 1NPRA 2CYZB 3CC4A 2XHCA 2DZCA 2E12A 4OB3B 4M77A 4M75D 2PUKB 2RA2A 1G5VA 3ER0A 3HP9A 5J39A 2OTLT 4C0GA 1QP2A 3DB4A 4C8QB 3I56T 3GNGA 2LC4A 4FL6A 3CBPA 2K4YA 1Y71A 2V8KA 3LGLA 4Y28E 3PIPA 4V2SA 2ZPEB 4C8QC 4M78C 4IUVA 5FLXE 2EFIA 3M56A 3OYYA 3HRTA 5CKBA 3RUXA 2DIGA 1BI3A 3VUZA 1N9RA 1SSFA 2RJDA 4MZMA 3P8BB 4C8QF 3VU3C 1NPPA 2JTFA 3VYHB 3CC2T 4C8QA 3CC2A 4LDXA 4IUTA 3OYGA 4M7AD 5CAIA 2DXCA 2LT4A 4M75G 4OGCA 3QZ5B 2F5TX 5C0MA 4QQ6A 4PJOD 4FT2A 3QJYA 1D3BA 1V29B 4F7UG 4ZN1A 3E9GA 4HCZA 4XTYA 3TEEA 4C92A 4JRIA 2E6NA 3MEAA 4GLKA 2CS7A 3PNWC 4X9DA 3HFNA 5FU6C 5HK3A 5LJ5f 1Q7YC 3OA6A 1VQPA 3FJPA 1NZ9A 2Y90A 4JLGA 1M1FA 1N6AA 4L59A 4X34A 2FL7A 5KH6A 3OYMA 3M4YA 1B34A 3L2ZA 4EMKB 3G4ST 4BDYA 2EIFA 1K8AU 1BIBA 5CKEA 4PJOG 4CI0C 4MDXA 2OTJT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTH A;  3OYF A;  2GF7 A;  3QJ6 A;  3DB3 A;  4C5G A;  4PLI A;  2MWP A;  3CEY A;  2X4W A;  3MP8 A;  3OYC A;  3PFS A;  2X35 A;  4N4I A;  3PMI A;  4IUR A;  2O4X A;  3LGF A;  3FDR A;  5D6W A;  2LVM A;  2MWO A;  3PMT A;  1WGS A;  2LDM A;  3BDL A;  3H8Z A;  2EQM A;  5IAY A;  3OYB A;  3UWN A;  5D6X A;  3Q1J A;  4BE1 A;  4IKF A;  2L8D A;  4E7H A;  3S3M A;  1XNI A;  3QBY A;  4C5I A;  3OY9 A;  2VYT A;  2RHX A;  4FU6 A;  2BIV A;  4NS5 A;  3OYD A;  4E7I A;  3OYN A;  3S3N A;  3EAE A;  1OYX A;  2LCC A;  2B8A A;  3S3O A;  5FRO A;  1RI0 A;  1MHN A;  1WJS A;  3L2W A;  4E7L A;  4Q5W A;  3QKJ A;  4N4H A;  3MEW A;  2LRQ A;  3H6Z A;  5FRM A;  4A4G A;  3MEU A;  3OQ5 A;  2DAQ A;  3OMC A;  5KCH A;  2R57 A;  4IUQ A;  2EQJ A;  3FLG A;  3M9Q A;  3FEO A;  4II1 A;  2IG0 A;  2R58 A;  5KE2 A;  2DIQ A;  2RI2 A;  3SD4 A;  4B9X A;  3OYJ A;  2HQE A;  4BE0 A;  3P8H A;  2RI3 A;  3OS0 A;  4GY5 A;  3L2R A;  5IN1 A;  1WJQ A;  3KUF A;  2X4X A;  3QII A;  4C5E A;  2RJF A;  1WJR A;  5KE3 A;  3P8D A;  2M16 A;  2LTO A;  2D9T A;  2EKO A;  3OYI A;  1OZ2 A;  2RI5 A;  2K3Y A;  2RO0 A;  4Z02 A;  3OYH A;  2RHZ A;  2M0O A;  1KHC A;  3E9F A;  2FHD A;  4IUU A;  4CRI A;  3ME9 A;  3NTI A;  3FC3 A;  4BAC A;  4ZTJ A;  2GFU A;  2BKD N;  1N27 A;  3MP1 A;  2L89 A;  4IUP A;  3OYA A;  2EQU A;  3MEV A;  3UT1 A;  4B9W A;  2HQX A;  1OZ3 A;  2XK0 A;  2CKK A;  2RHU A;  4A4H A;  2XDP A;  4QVZ A;  5CIU A;  2E5Q A;  2O4X B;  2PQW A;  3LLR A;  4A4F A;  1G5V A;  2G3R A;  2RHY A;  5J39 A;  2RJC A;  3S6W A;  3DB4 A;  2R5M A;  2F5K A;  2X4Y A;  3DLM A;  3MP6 A;  2BUD A;  4QQG A;  4FL6 A;  5M9O A;  3LGL A;  4IUV A;  3F70 A;  2EFI A;  4EDU A;  3OB9 A;  2GFA A;  2DIG A;  3LX7 A;  2R5A A;  5J26 A;  4PL6 A;  4BDZ A;  2RJD A;  1SSF A;  1OI1 A;  3OYE A;  2JTF A;  3OMG A;  2WAC A;  3ASK A;  4IUT A;  3OYK A;  3OYG A;  2RJE A;  3GOX A;  2YRV A;  3O8V A;  3NTK A;  2QQR A;  3ZEH A;  2QQS A;  5C0M A;  4OVA A;  4QQ6 A;  1H3Z A;  5C6S A;  2K3X A;  4BD3 A;  5KCO A;  4UC4 A;  3E9G A;  4HCZ A;  4LD6 A;  2E6N A;  2P0K A;  4E7J A;  3MEA A;  4RG2 A;  5D6Y A;  2NLU A;  4N4G A;  4E7K A;  3PNW C;  3MET A;  2RHI A;  3C4S A;  5FRN A;  3OS2 A;  3OA6 A;  2JZ2 A;  3OYL A;  4ZTF A;  4A4E A;  4QQD A;  3LYI A;  3L42 A;  3L2V A;  2M1H A;  4X34 A;  4QW2 A;  2EQK A;  4L59 A;  3LH0 A;  5KH6 A;  3OS1 A;  3MO8 A;  3OYM A;  3L2Q A;  3L2U A;  4BE2 A;  4C5H A;  4BDY A;  2L3R A;  4PLL A; 
#chains in the Genus database with same CATH topology
 2A37 A;  3DB3 A;  4HCC A;  2GGR A;  2BE9 B;  1PSE A;  1N5Z A;  3CEY A;  3TSW A;  5GAO p;  4N4I A;  4FCY A;  3A1P A;  3A5Z B;  3G6E A;  1YJ9 T;  5IAY A;  5GAM d;  3M0U A;  3R6O A;  2L8D A;  1HYO A;  3QBY A;  4JJN K;  3RKY A;  4N0A C;  4O5V A;  4LDW A;  2WSF E;  3JCM J;  1WXT A;  2QQB A;  1ZX6 A;  3EFO A;  3GIB A;  4KH1 B;  3OQ5 A;  1GBQ A;  3RBB B;  4J9H A;  3A8H B;  4J9G A;  3CME T;  3CC7 T;  2R58 A;  1YP5 A;  1NBE B;  1PRL C;  4OF1 A;  3TRE A;  2FB7 A;  1RLP C;  4Y92 A;  1UE9 A;  3CME A;  3CC7 A;  2KDS A;  3HHT B;  3P8D A;  2XDB A;  1S72 A;  1Y0M A;  4OMM A;  2YUO A;  3UDC A;  4QVD A;  1D0Y A;  3PVL A;  3NPF A;  1N27 A;  2NUP B;  4FYV B;  4C0Z A;  4JS4 A;  2A7Y A;  2HL5 C;  4F7U B;  4ME7 A;  2RPN A;  4QVZ A;  1D09 B;  4A4F A;  1RL2 A;  4FIB A;  4OB1 B;  2DEU A;  4QQG A;  1MGQ A;  1BIA A;  2FPF A;  1ACM B;  2XMF A;  4M7A A;  3F70 A;  1GBR A;  2AKL A;  3CCM Q;  5ECA A;  4OB0 B;  1I5O B;  1TG0 A;  2CP7 A;  2D8J A;  2DE0 X;  3CCJ A;  3RMQ A;  2QQR A;  1D0Z A;  3CCS A;  1VQP T;  2QQA A;  1WPY A;  5KCO A;  4TVR A;  4LD6 A;  4N4G A;  3FRN A;  5IHI A;  2VGM A;  4DBR A;  4QW2 A;  1I1J A;  2L5Q A;  1RUW A;  3CCQ A;  4MMK A;  1M2V B;  3EFS A;  1Y57 A;  2QG9 B;  2QA4 Q;  2EKH A;  3C12 A;  2F69 A;  1PRM C;  5FU6 B;  2BE7 D;  2PVG B;  3REB B;  2CZ7 B;  2FG0 A;  3CBO A;  4JPB W;  1WYX A;  5CQY A;  3ZL7 C;  1IHV A;  1K9A A;  2QAZ A;  1MMA A;  1H8K A;  2Z0W A;  2ZZD A;  1X27 A;  4JS5 A;  4DEY A;  1VQO Q;  1NLP C;  3OY9 A;  1QWE A;  1RAA B;  3OW2 A;  2BIV A;  4NS5 A;  5GAO r;  2FVU A;  2GQV A;  4ANJ A;  3QO3 A;  3CCQ T;  1RAF B;  1Y96 A;  2Y4X A;  5GAM f;  4PJM A;  3V7C A;  3SHW A;  4XK8 E;  3VS7 A;  4DBF A;  1U8R A;  1O9S A;  4EMG A;  3VS3 A;  2EKO A;  1OZ2 A;  1NG2 A;  1PD1 A;  5CKD A;  1RAH B;  2QYZ A;  3CCU T;  3KBG A;  3NGP A;  4JRP A;  2XDP A;  1V1C A;  3EFO B;  1N8R R;  4M78 A;  1MNE A;  3VYG A;  2R5M A;  1Y7X A;  1YCS B;  1I5L A;  2DRM A;  1W2B P;  4L5G A;  4QKU A;  2K9G A;  3CD6 T;  2GTJ A;  5KYY A;  3DLL A;  1AWW A;  4Z88 A;  4OVA A;  3OBY A;  1K9M R;  3CC4 Q;  4JRQ A;  1Q86 C;  4ZGD B;  4BI4 A;  2OTL A;  3RKW A;  4FYW B;  3TCJ A;  2DTH A;  3MHX A;  5L8R E;  4RTY A;  2HNI A;  2M1H A;  3QYG B;  1B7T A;  3OW2 S;  3CCJ T;  1HXD A;  1MV3 A;  2DBK A;  1JB0 E;  3THK A;  3EG3 A;  4AT1 B;  2ZPF B;  3CMA T;  1NEG A;  2XG8 D;  4M75 E;  3JCM g;  3JB9 J;  1IRE B;  1TSF A;  1TTH B;  1WA7 A;  1KD1 C;  4EMK C;  4ELY C;  4E7H A;  4D8D A;  4FU6 A;  4AG2 C;  1KG1 A;  1W4S A;  1JXM A;  3INZ A;  5FRO A;  4J6X A;  1UGS B;  2FZK B;  2CUD A;  1S72 T;  3MEU A;  1VQ9 Q;  1GXI E;  3PGG A;  1TWB A;  2CZ0 B;  3JB9 F;  4OP0 A;  1Q86 U;  2HCK A;  4F17 A;  2SEM A;  2RI2 A;  1WHL A;  2HQE A;  1KJW A;  3P8H A;  3G4S Q;  2RQV A;  3EGD A;  3JCM P;  1ZSZ A;  1WQW A;  2DYB A;  3PIO A;  5GAM e;  1VQ6 T;  2AHJ B;  2DKG A;  5CQX A;  2RHZ A;  4JRK A;  1KQS A;  1I81 A;  1W70 A;  2DXB A;  3JCM W;  2BTT A;  3MP1 A;  3CCM T;  3GF5 A;  4J7I A;  2CRE A;  1FYN A;  1IZ6 A;  2E5Q A;  2O4X B;  1YHQ Q;  2RHY A;  3I5S A;  2DXT A;  4C0D B;  7AT1 B;  5GAN 2;  3M0R A;  4BDZ A;  4QT7 A;  2XD0 A;  4WCI A;  4MZT A;  1KC8 U;  1QVP A;  4DQ2 A;  1VQ6 A;  3EHR A;  4DOV A;  1X01 A;  4R56 A;  4HVU A;  1KQ1 A;  4XTX A;  2LMJ A;  2ZCF B;  4RG2 A;  4E7K A;  2HZY A;  1U1S A;  1O75 A;  1CKA A;  2H8H A;  4FYX B;  3EGX B;  6AT1 B;  3L2V A;  2VC8 A;  3CCR Q;  3LH0 A;  4C0D C;  5CCA A;  2P0P A;  4OGE A;  1IGU A;  1X43 A;  2DVE A;  3EG9 A;  4XTW A;  3OSS C;  4M75 C;  2DFU A;  4KBM B;  2VB6 A;  2V8J A;  3GNF B;  3KFV A;  2O4X A;  3V7R A;  3G71 Q;  2KVQ G;  1SHF A;  1U1T A;  3PMT A;  5GAN g;  3H8Z A;  4F7U E;  5I2M A;  1RAE B;  1V76 A;  4C8Q D;  2OAW A;  2I2L A;  2QA4 T;  4D6W A;  3NHN A;  3S3N A;  4E7I A;  1Q82 U;  2M0Y A;  4C92 F;  1EIF A;  9ATC B;  1JRI A;  5FRM A;  2EJ9 A;  4XAX B;  3FLG A;  3SWN B;  3M58 A;  3VS1 A;  3UA6 A;  1LOJ A;  4WTO B;  4BE0 A;  3I55 Q;  1QLY A;  4ELZ C;  1KK7 A;  4HCB A;  2M16 A;  2LTO A;  2K3Y A;  1H92 A;  3NTI A;  2JS0 A;  2HKN A;  2W0Z A;  1Q81 C;  2LT1 A;  2ZPG B;  2LQN A;  5GJV B;  2CYZ B;  2K6D A;  2QDL A;  3TQ7 P;  4M75 D;  2KYB A;  3VS0 A;  3ER0 A;  2DRK A;  3HP9 A;  2OTL T;  4C0G A;  1QP2 A;  4V2S A;  4Y28 E;  5KYU B;  2MIO A;  3OYY A;  1BI3 A;  1MMD A;  1N9R A;  4MZM A;  5CAI A;  2F2X A;  2LT4 A;  2COZ A;  4M75 G;  3QZ5 B;  4FT2 A;  4HCZ A;  3TEE A;  4JRI A;  2E6N A;  1K76 A;  3HFN A;  5HK3 A;  3OA6 A;  1VQP A;  3RR6 A;  4JLG A;  4X34 A;  1WDX A;  1OX8 A;  4EMK B;  3G4S T;  4XQ3 A;  2E10 A;  2JTE A;  3LW5 E;  4M7A F;  3VS6 A;  1VQK Q;  1ZSG A;  4BI3 A;  1AVZ C;  2KGT A;  3GBQ A;  1W2B A;  5GAO q;  2HSE B;  4B6M A;  1BKB A;  2CH4 A;  4BE1 A;  2MOX A;  5KYW A;  3CCR A;  2OTL Q;  3D7S B;  4XU2 A;  1MHN A;  1YHQ A;  1PKS A;  3X25 B;  4AMC A;  2DAQ A;  2ZPI B;  2FZC B;  4QVC A;  2VGN A;  3SD4 A;  1JJ2 S;  3VRZ A;  2CP5 A;  2JJ9 A;  3JB9 H;  4NOY A;  1R77 A;  1TH7 A;  1VQL A;  2DEQ A;  5GAN h;  1YJN A;  2VKN A;  1LNX A;  1X2K A;  2YHT A;  4J6W A;  1K1Z A;  3QWX X;  3SFM A;  1IGQ A;  3JRZ A;  2RO0 A;  4C8Q G;  5IHK A;  3T9N A;  3EH2 A;  4BY6 C;  4ZTJ A;  1MMN A;  5GAO l;  4MZP A;  4B9W A;  1AT1 B;  4KGX B;  5CIU A;  2RJC A;  4HA8 A;  2D0N A;  3UAT A;  2RQW A;  1B3Q A;  2JW4 A;  2NWM A;  5J26 A;  4J9C A;  2PNI A;  2DD5 A;  1VYU A;  4M7A E;  4XTZ A;  1VQ4 Q;  1XJW B;  2WAC A;  4PJO F;  1JEG A;  3G71 A;  3O8V A;  5LJ3 g;  3ZEH A;  2X51 A;  2QTV A;  1VQO A;  2COY A;  4HT8 A;  2QEX T;  5KYN A;  4PFP A;  2O01 E;  1YIT Q;  2DX1 A;  5IXB A;  2HAX A;  2F2V A;  3V8L A;  2ED1 A;  4FSS A;  2O9V A;  1VQ8 A;  1YN8 A;  1BCM A;  3RNJ A;  5LJ5 e;  4J9B A;  1YWO A;  1YJ9 A;  2YUQ A;  3KXT A;  3EG1 A;  1YIT T;  5EC7 A;  3M55 A;  2CH4 W;  2QEX A;  1BK2 A;  3LGF A;  2LVM A;  4HCK A;  2BZY A;  2MWO A;  2FYK A;  1G3T A;  3BDL A;  2XI9 A;  5GAN d;  2QI2 A;  3JCM c;  3PT9 A;  1M1G A;  1QKW A;  4C5I A;  1YIJ Q;  2P84 A;  3OYN A;  4LUE A;  3WVD B;  3EGX A;  2V1R A;  3CPF A;  5EG2 A;  2EQI A;  1D0X A;  4F7U F;  1KC8 R;  2MPX C;  3OMC A;  3NFC A;  1AD5 A;  5LJ5 j;  2EQJ A;  1VQ7 A;  3GLX A;  1R8O B;  4BUG A;  1M90 U;  2KYM A;  1WHH A;  4M7D C;  1T0H A;  2E3I A;  2AK5 A;  2JUF A;  2JS2 A;  3L2R A;  1WJQ A;  1JQQ A;  4A54 A;  3CCM A;  3L1A A;  4AFU C;  3SEM A;  5GAN 7;  3OYI A;  2YLB A;  4M77 D;  3SDZ A;  2M0O A;  1KHC A;  5D7U A;  2BKD N;  2LJ3 A;  1VQN Q;  2XK0 A;  1OZ3 A;  3BW1 A;  2MMP A;  2VV5 A;  3LLR A;  2PQW A;  3CCV T;  1AZE A;  2EGC A;  2G3R A;  2MI6 A;  2ECZ A;  1CKB A;  2JMC A;  2QDY B;  5DLQ E;  3CCL Q;  4KH0 B;  3I55 A;  2KI7 A;  3V7S A;  1Y96 B;  2LX7 A;  2K3B A;  2DPP B;  3VUB A;  1YWP A;  5LJ3 e;  1Z9Q A;  3OYK A;  4P5N A;  2E41 A;  4JLI A;  3GOX A;  4EIK A;  2X4J A;  3CXC A;  4YTL A;  3M0S A;  3CCL T;  1PSF A;  5GAN e;  5C6S A;  2K3X A;  4BD3 A;  4UC4 A;  1M90 C;  4E2F B;  3QYH B;  4RUG A;  4J5Y A;  2PVD B;  3CCV A;  5FRN A;  1VQN T;  2JZ2 A;  2V8I A;  1Z9Z A;  2WSE E;  2L3P A;  3M59 A;  3EGD B;  2V1Q A;  2E3H A;  3MJX A;  1RAD B;  1FMV A;  2L0A A;  2VVK A;  4M7D A;  2MCN A;  1LJO A;  3M53 A;  3MP8 A;  3RER A;  1U5S A;  1OX9 A;  2X35 A;  3NMZ C;  1B34 B;  3PMI A;  1TUG B;  3FDR A;  5D6W A;  4C0F A;  1WGS A;  1W2B S;  2CP2 A;  4IIO A;  1ZA1 B;  4LDU A;  2LNV A;  2NUP A;  2B86 A;  2HQH A;  4JDS A;  3J7A F;  3EAE A;  1KC8 C;  4LD9 K;  1YNZ A;  4N4H A;  3MEW A;  5A0L A;  2AZS A;  4II1 A;  1C6V X;  1WHG A;  4C92 C;  4RTZ A;  2DIQ A;  3EGU A;  3X26 B;  1FXX A;  5A0G A;  2RN8 A;  2I0N A;  2X4X A;  1WJR A;  1JXO A;  1RAB B;  1RAC B;  1VQK A;  1UDL A;  1M1K R;  2ROL A;  2HBW A;  1PKT A;  2EPD A;  1M2V A;  4XTV A;  2FHD A;  2FPD A;  1NJI C;  4OMO A;  5GAM g;  2L89 A;  3ZFJ A;  4ZGJ B;  1VOM A;  1G3W A;  3CPW S;  2KR3 A;  1WLP B;  2DA9 A;  4PFZ A;  1JO8 A;  2EAY A;  1M8V A;  1LCK A;  3CBM A;  4A4K A;  1VQO T;  3FIF A;  4HVW A;  1G83 A;  4EDU A;  2CP0 A;  3O5Z A;  5GMK m;  1QW1 A;  1VQ4 T;  3GPL A;  1Q82 C;  1AHJ B;  1GCQ A;  3JCM X;  1IHW A;  1KHI A;  5GAO n;  2Y4Y A;  8AT1 B;  4KUD K;  2OJ2 A;  2O9S A;  3IQL A;  5J3B A;  4PJO B;  1VUB A;  1LVK A;  2COW A;  5D6Y A;  3E1S A;  3HFO A;  1QVF A;  4A4E A;  1M8M A;  4JJD A;  1FWZ A;  2D6F A;  2DET A;  4M75 A;  4M7D E;  2J6K A;  1HSQ A;  1K9M U;  3JCM f;  1QQJ A;  2C0O A;  2E65 A;  5HK0 A;  3NTH A;  4FM4 B;  3WVE B;  4GBQ A;  1OUL A;  3OYC A;  2LNH B;  3A8G B;  2YT6 A;  1KQS P;  2J05 A;  4J9E A;  2E6Z A;  2L3S A;  1OPK A;  2EYY A;  1PCX A;  1M2O A;  3OYB A;  1M90 R;  5KYX A;  1NYG A;  2DZ9 A;  1D1A A;  1UGP B;  1OEB A;  3H6Z A;  2RF0 A;  5KYW B;  1SSH A;  1NEB A;  4D8K A;  4KUL A;  4OMQ A;  3REA B;  1R0B G;  2GQI A;  1AZG B;  4OMP A;  1UEB A;  4NL3 A;  3OYJ A;  3OS0 A;  2ZPB B;  3AT1 B;  2M9U A;  3GP8 A;  1HK9 A;  3QII A;  4RCB A;  5KE3 A;  1PD0 A;  4PKC C;  3I9Q A;  2RK1 A;  2A0F B;  1SPK A;  1QP3 A;  2GCX A;  2BZX A;  1KFZ A;  2GNC A;  3JCM Q;  3JB9 D;  4IUU A;  2LQ8 A;  4C92 B;  4BAC A;  2KY9 A;  2DZC A;  1WHM A;  5GJW B;  2D8H A;  2HEQ A;  4OML A;  3DB4 A;  3I56 T;  2DBM A;  3GNG A;  1OU8 A;  1ZUK A;  2V8K A;  2EGA A;  4C8Q C;  2DL5 A;  3RUX A;  4LN2 A;  1FMK A;  2DIG A;  1UJY A;  1YJW Q;  4J9D A;  1HD3 A;  4C8Q A;  4IUT A;  3LH5 A;  2AZV A;  2CP3 A;  3H9N A;  4OGC A;  1W6X A;  1UTI A;  2F5T X;  1YI2 Q;  3QJY A;  1D3B A;  1V29 B;  4F7U G;  4XTY A;  1QVG P;  2HKQ B;  2EYZ A;  4X9D A;  5LJ5 f;  2H3E B;  1D1C A;  3FJP A;  2Y90 A;  1PG5 B;  2KRN A;  3OYM A;  1B34 A;  2EIF A;  4MDX A;  5CKE A;  3CCU A;  2FEI A;  2OTJ T;  2VUB A;  3CXC P;  3QPH A;  3RMS A;  3RES A;  3JCM e;  2YRD A;  4IUR A;  4EPC A;  1SRL A;  1KIK A;  4M77 F;  2ZGW A;  5CKH A;  1VQ7 T;  2BZ8 A;  5CVI A;  2OTJ A;  2ATC B;  3SWN C;  5IH2 A;  3A8L B;  2QA4 A;  1G3Y A;  2DF6 A;  1QWF A;  2RI3 A;  2LP5 A;  4RG8 A;  5IN1 A;  1VQM Q;  1VIE A;  2CT4 A;  4AFS C;  3QZ9 B;  1IRX A;  1X6B A;  1I8F A;  1T0J A;  4M7D D;  3CCR T;  3OBW A;  3OYA A;  2O88 A;  2DJQ A;  1RAG B;  2K5F A;  2KSS A;  2YLC A;  5GAM j;  2J6O A;  3UT1 A;  1VQ9 A;  1GFC A;  2KRM A;  1UG1 A;  5GMK h;  2MAM A;  2ABL A;  2FPE A;  3DLM A;  3MP6 A;  4Z89 A;  1WI7 A;  3CCE A;  1A0N B;  4C8Q E;  2VXF A;  2K79 A;  3LX7 A;  4XU0 A;  1KD1 R;  3CCQ Q;  4PJO A;  3I5R A;  2QEX Q;  2E70 A;  2RJE A;  3M54 A;  2JM8 A;  4E47 A;  4HVV A;  4KGZ B;  2RM4 A;  4NL2 A;  5FWC A;  2V26 A;  2ZAE A;  2P0K A;  4CC3 A;  3A8M B;  1N8R C;  3C94 A;  4ZTF A;  1P92 A;  5KYX B;  1WXB A;  4DA4 A;  3UPU A;  4LE9 A;  1ZSZ C;  5HCK A;  4M78 F;  1VQ6 Q;  1NYF A;  2A08 A;  2QXF A;  1X2Q A;  1D1B A;  5GMK i;  2YDL A;  3EG9 B;  2J7I A;  1ABO A;  2DL7 A;  1VQL T;  1X75 C;  1VQL Q;  5CK9 A;  1SKU B;  4RMO A;  3SB2 A;  3TVT A;  3CC4 T;  1KSW A;  5I21 A;  1NJI R;  3X20 B;  5LJ5 h;  1OYX A;  4VUB A;  1M3B A;  2PU9 B;  3L2W A;  5FU7 C;  3QKJ A;  4F7U A;  1VQN A;  2R57 A;  2LCL A;  1ZSZ B;  5KE2 A;  3G6E T;  2CP6 A;  4M4Z A;  1TUC A;  2HMA A;  1C0M A;  2LZ6 B;  3KUF A;  1N8R U;  1Q82 R;  2G6F X;  5GAM h;  1YI2 T;  4BY6 B;  1NM7 A;  1IXD A;  3MCA B;  4C92 D;  5GMK j;  3CCJ Q;  3TU4 K;  1UFF A;  2PZ1 A;  3JV3 A;  4IUP A;  4J9F A;  1VQK T;  3M5A A;  4J83 A;  1PNJ A;  1Q95 G;  2EVR A;  2LQK A;  1BCO A;  2A36 A;  4E7Z A;  2F5K A;  1GRI A;  3EFR A;  2YSQ A;  1EFN A;  2R5A A;  3CD6 Q;  4HT9 A;  2J06 A;  2RD1 A;  3OMG A;  3ASK A;  2PVO B;  2XKO C;  4M7D G;  2LJ0 A;  1M30 A;  2DLP A;  3QDR B;  3QUI A;  4MML A;  4RCC A;  2NLU A;  2RQT A;  4AG1 C;  2A3L A;  1JJ2 A;  1WQ7 A;  1JJ2 P;  3L42 A;  3L2Q A;  2EQK A;  1YFN A;  3MO8 A;  2CSI A;  4C5H A;  3J80 E;  2IPO B;  3C95 A;  1E6G A;  2DK3 A;  1VQ4 A;  1UHF A;  1VQ7 Q;  2YWW A;  3E19 A;  3OYF A;  1VQM A;  3HSB A;  3QJ6 A;  4OMF B;  4PLI A;  1YJW A;  1Q7Y R;  1M3A A;  2NUZ A;  1QCO A;  2LJ1 A;  1HJD A;  1E7O A;  1QCF A;  1AEY A;  2XDD A;  1U06 A;  1I4K 1;  4CC7 A;  4LNP A;  1K8A R;  4AFZ C;  3H0H A;  3QXE B;  4Y91 A;  1ZUU A;  3EG0 A;  2EJF A;  1WFW A;  1YCY A;  4BI8 B;  4F16 A;  4ORZ A;  3V8K A;  2LRQ A;  2VWF A;  4IUQ A;  4M7D B;  2AKK A;  3JB9 G;  4XU1 A;  3U23 A;  4RTT A;  3EHQ A;  1OV3 A;  2F1L A;  2DTO A;  5CR2 A;  4BB7 A;  1QVG S;  1ZBX A;  2GBQ A;  3TSZ A;  1TU0 B;  3C0C A;  4Z02 A;  2ENM A;  2GFU A;  1WZO A;  1S1N A;  5IHN A;  3VS5 A;  2EQU A;  1Y07 A;  2QK0 A;  4FYY B;  1GFD A;  3S6W A;  2EGE A;  1M1K C;  4PJJ A;  3I56 A;  2X4Y A;  2KNB B;  3R6N A;  5IT9 E;  4J9I A;  1BI2 A;  2DM1 A;  1XOV A;  3HRU A;  3OB9 A;  1IO6 A;  2KT1 A;  4PL6 A;  2HD0 A;  5AT1 B;  1QVF P;  4N0A A;  3G4S A;  4DBQ A;  3M0T A;  5CKF A;  2YRV A;  3OS5 A;  3NTK A;  2KXD A;  3FB9 A;  1BB9 A;  2GTO A;  3H41 A;  4LDY A;  4M78 E;  2E5K A;  1H3Z A;  3G6E Q;  5LL6 S;  2YUN A;  3C4S A;  1BYM A;  2W10 A;  3BDU A;  4QQD A;  3LYI A;  3CCL A;  2JTM A;  2KMT A;  2QGG A;  2FRY A;  2E4H A;  4M77 C;  1UGR B;  1VQ5 Q;  1CSK A;  1NJI U;  3CPW P;  1JU5 C;  2KAF A;  2CT3 A;  1G3S A;  2E64 A;  2C0I A;  1C1A A;  1LPL A;  1PWT A;  1ZA2 B;  2FZG B;  3PFS A;  1VQ8 Q;  1FX7 A;  1M1K U;  1BI1 A;  5CO7 A;  2EQM A;  4EMH A;  3PE0 A;  4M78 D;  4JZ4 A;  5AYF A;  4OB2 B;  1WNL A;  2NUT A;  1YIT A;  2VYT A;  3A98 A;  3OYD A;  3ZBD A;  1ZLM A;  5GAN 3;  1WJS A;  1VQ8 T;  2KBT A;  4A4G A;  2KRS A;  1YJ9 Q;  3M9Q A;  3X24 B;  2MF2 A;  4M7A G;  3RDV A;  2DTI A;  4M78 B;  2AT1 B;  2DER A;  4M77 G;  2JXB A;  3J81 E;  1QVF S;  1Q7Y U;  1TXQ A;  2DIL A;  5LJ5 d;  2D9T A;  1K0X A;  4KUI A;  5GMK e;  2KXC A;  4RTW A;  2OX7 A;  1E6H A;  3G71 T;  1K8A C;  2KRO A;  3QG1 A;  2DL3 A;  1I0C A;  1NPR A;  2E12 A;  1T3L A;  2RA2 A;  4RTV A;  2JM9 A;  1QCN A;  4PFO A;  1G5V A;  2F2W A;  4FL6 A;  3PIP A;  2K4Y A;  1Y71 A;  3LGL A;  3MPU B;  3BE3 A;  2ZPE B;  4M78 C;  4IUV A;  2EFI A;  3M56 A;  3HRT A;  3VUZ A;  2L2P A;  4C8Q F;  1NPP A;  2JTF A;  1VA7 A;  4LDX A;  4F04 B;  3OYG A;  2DXC A;  2L3Q A;  2DYI A;  3E2U A;  4CC4 B;  4PJO D;  4QQ6 A;  2KEA A;  4E7S A;  4ZN1 A;  2YXY A;  3E9G A;  4C92 A;  8ATC B;  2CS7 A;  1PC0 A;  1Q7Y C;  4LUD A;  1SG5 A;  1N6A A;  5KH6 A;  1MV0 B;  3M4Y A;  1K8A U;  4PJO G;  4CI0 C;  1Q81 U;  1WHK A;  3FJ5 A;  3CCE T;  1YBY A;  3H0I A;  2MWP A;  3CCS Q;  5KYY B;  1OQK A;  3VS4 A;  2HL3 A;  5I2S A;  2QQ9 A;  4PJN A;  3CCU Q;  2LDM A;  2K5L A;  3URG A;  3H0F A;  1YJN Q;  3QHS A;  3UWN A;  3OSV A;  3RKX A;  3Q1J A;  4IKF A;  2XID A;  4C92 E;  1KQ2 A;  2RB6 A;  5LJ3 f;  1UHC A;  1K73 R;  1K0S A;  3UA7 A;  4XTU A;  2P0Q A;  3LWI A;  2B8A A;  3S3O A;  1ZQ1 A;  2EBP A;  4Q5W A;  4DOW A;  3JCM V;  4ZN3 A;  2X9H A;  4PJO E;  4RTU A;  3RIR A;  3FEO A;  1NLO C;  2DVJ A;  4LDV A;  1BU1 A;  2CZ6 B;  2M51 A;  1RI9 A;  2LX9 A;  3OW2 P;  4C5E A;  2CDT A;  4M7A B;  2LQW A;  4A63 B;  3VKI A;  1R0C B;  2RI5 A;  2ZPH B;  2DJZ A;  4M77 E;  1TS9 A;  3CXC S;  1YHQ T;  4RTX A;  5GAO m;  3FC3 A;  1YI2 A;  5GAN j;  4L6V 5;  1X6O A;  2KT8 A;  2HQX A;  4A4H A;  1GL5 A;  4LXC A;  1EZZ B;  4GLM A;  3EH1 A;  2QTX A;  5FU7 B;  3JB9 I;  4MDW A;  3CPW A;  4PK4 A;  1UEC A;  5LJ3 j;  4M75 B;  3VJP A;  4FT4 A;  5DLO A;  2LCS A;  2RQR A;  2XIC A;  2RH2 A;  1KQS S;  1WHJ A;  3DKM A;  1OI1 A;  1RLQ C;  3HPW A;  1QVG A;  1DJ7 B;  1GCP A;  4DEX A;  2KK4 A;  2QQS A;  1S72 Q;  2CUB A;  1J3T A;  3OS2 A;  2CGH A;  2JVV A;  2EYX A;  4FSX A;  1G2B A;  1XTD A;  1TUD A;  2ROT A;  3HL8 A;  5GAN f;  4BE2 A;  5A2Q E;  2P4T A;  3VRY A;  2L3R A;  4JZ3 A;  3CMA Q;  1YIJ T;  4IIM A;  3JSC A;  4R0K A;  2EYW A;  1MND A;  4EMK A;  4FW1 A;  2NYS A;  3HKS A;  3CMA A;  2FO0 A;  1H3H A;  1AWJ A;  5D6X A;  1XNI A;  4FW2 A;  2RHX A;  5FWB A;  4X1V A;  4AFQ C;  1VQ5 A;  2LCC A;  1B07 A;  1U3O A;  1X6G A;  2PTK A;  5FW9 A;  4E7L A;  2JNG A;  2DD4 A;  3UF4 A;  4PJL A;  2VXE A;  2HSP A;  2K2M A;  4ZGE B;  4WF2 A;  2C0T A;  4PJO C;  4DBH A;  3MKD A;  1VIF A;  2K7A A;  2M02 A;  3HRS A;  5I22 A;  5KYU A;  2JMA A;  3CD6 A;  1VQM T;  5LJ5 g;  2K2V A;  3M4G A;  1WX6 A;  1JBM A;  2KE9 A;  5LJ3 h;  1D3B B;  1W1F A;  3QDF A;  4K11 A;  2OAU A;  2WSC E;  4KRT A;  2DL8 A;  2IIM A;  3QSU A;  2OI3 A;  2EYQ A;  2BUD A;  2X3X D;  2EJG A;  1KD1 U;  1Q86 R;  4RKU E;  2DMO A;  3OYE A;  1BBZ A;  2CZ1 B;  3SWN A;  1BI0 A;  1VQP Q;  2H3J A;  4C92 G;  5HY6 A;  4CC2 A;  2CSQ A;  3I55 T;  1SEM A;  1TOV A;  4PNO A;  3A8O B;  3N5B B;  2K5I A;  3MET A;  2RHI A;  3OYL A;  3CCS T;  3ULR B;  3CCE Q;  3V8J A;  2K57 A;  1AWX A;  4OMN A;  5DM7 R;  5I11 A;  1SF9 A;  1N9S A;  4M78 G;  3JCM b;  4M7D F;  4C5G A;  2ESW A;  3JAM E;  2ED0 A;  5GAN 8;  3G7Z A;  2PUO B;  1F1B B;  2QAS A;  1UJ0 A;  2VAS A;  2XU8 A;  3S3M A;  2JN0 A;  1H64 1;  4X9C A;  5A0D A;  4JJC A;  4M7A C;  1M5Q 1;  4M77 B;  1AWO A;  4J8O A;  1UUE A;  4F14 A;  1YJN T;  2IG0 A;  2DXU A;  2OTJ Q;  4B9X A;  4JJB A;  1M3C A;  1NE8 A;  1IB8 A;  1OOT A;  1K9M C;  2MK5 A;  2YUP A;  3JCM d;  2RQU A;  3I35 A;  4ESR A;  2C06 A;  2CKK A;  2RHU A;  1T3S A;  5GAN 4;  1M4Z A;  3CCV Q;  1YJW T;  2RK2 A;  1ZUY A;  5M9O A;  2EWN A;  1AOJ A;  2GFA A;  1VYV A;  1UB4 A;  3PTA A;  1FMW A;  3I56 Q;  3JCM h;  5GMK l;  3CME Q;  3CC7 Q;  2MYS A;  2O31 A;  2QGF B;  4HKE A;  2JT4 A;  3BY7 A;  1ZBJ A;  4E7J A;  1SHG A;  1I07 A;  2DNU A;  2AIR B;  1YIJ A;  3OS1 A;  1VQ9 T;  3L2U A;  1ZHI A;  4M75 F;  2FRW A;  1PM3 A;  2DO3 A;  4PLL A;  1X69 A;  4ATO A;  2YRC A;  1VQ5 T;  1K73 U;  2GF7 A;  4J7F A;  1EX4 A;  2X4W A;  5GAN 6;  2HBP A;  2D0Q B;  2E1H A;  5LJ3 d;  2SRC A;  1QKX A;  1G8X A;  3M57 A;  2J6F A;  4XU3 A;  3WXM B;  4R55 A;  1XQH A;  2A28 A;  3CQT A;  5DY9 A;  3X28 B;  1WXU A;  3VV0 A;  2HDA A;  1RI0 A;  3BFM A;  4KT0 E;  1SRM A;  1GCQ C;  1MMG A;  3QWY A;  1M9S A;  5KCH A;  1RAI B;  2KQW A;  4J6Y A;  1PHT A;  2JOY A;  4JUV A;  4A53 A;  1VYT A;  1Q81 R;  4GY5 A;  1ARK A;  3G1J A;  3VS2 A;  1UGQ B;  5GAN 5;  3LWH A;  2RJF A;  2NUT B;  2O2O A;  4O6J A;  5HKC A;  1ABQ A;  3OYH A;  3E9F A;  3EG2 A;  4CRI A;  2IVW A;  3ME9 A;  3M0P A;  3HTR A;  5L23 A;  1K73 C;  3AHU A;  1K4U S;  3MEV A;  3CC4 A;  2XHC A;  4OB3 B;  4M77 A;  4Z8A A;  2PUK B;  5J39 A;  4C8Q B;  1OU9 A;  2LC4 A;  3CBP A;  2RNA A;  1OPL A;  4HXJ A;  5FLX E;  5CKB A;  1M27 C;  1MUZ A;  2RJD A;  1SSF A;  3P8B B;  1QMC A;  3VU3 C;  3VYH B;  5IXF A;  3CC2 T;  3CC2 A;  4M7A D;  2X3W D;  4ZNX A;  4KGV B;  5C0M A;  2EW3 A;  1WIE A;  3CC2 Q;  3MEA A;  2D1X A;  4GLK A;  3PNW C;  5FU6 C;  2P4R A;  2DL4 A;  1NZ9 A;  2RMO A;  1M1F A;  4L59 A;  2FL7 A;  4E6R A;  3PVQ A;  1UGV A;  3L2Z A;  4BDY A;  1BIB A;  3M0Q A; 
#chains in the Genus database with same CATH homology
 1Q81 U;  4XQ3 A;  2E10 A;  2VUB A;  3DB3 A;  3CCE T;  4HCC A;  1YBY A;  1PSE A;  2MWP A;  3CEY A;  3LW5 E;  3QPH A;  3RMS A;  4M7A F;  3RES A;  3JCM e;  5GAO p;  4N4I A;  5I2S A;  4IUR A;  4BI3 A;  2QQ9 A;  3A5Z B;  2LDM A;  1W2B A;  2K5L A;  3URG A;  4EPC A;  3G6E A;  1YJ9 T;  5IAY A;  5GAO q;  3QHS A;  4M77 F;  3OSV A;  3RKX A;  1BKB A;  3UWN A;  3Q1J A;  3R6O A;  2ZGW A;  2L8D A;  5GAM d;  2XID A;  4BE1 A;  5CKH A;  4C92 E;  4IKF A;  2RB6 A;  3QBY A;  5LJ3 f;  3CCU A;  1VQ7 T;  1KQ2 A;  4JJN K;  3RKY A;  4N0A C;  4O5V A;  2P0Q A;  4XTU A;  3LWI A;  3CCR A;  4LDW A;  5CVI A;  2B8A A;  3S3O A;  1ZQ1 A;  2WSF E;  4XU2 A;  3JCM J;  1MHN A;  1YHQ A;  2QQB A;  3X25 B;  2OTJ A;  4Q5W A;  3SWN C;  4DOW A;  3JCM V;  3GIB A;  3A8L B;  4ZN3 A;  3OQ5 A;  2DAQ A;  2QA4 A;  4PJO E;  1G3Y A;  3A8H B;  3RIR A;  3FEO A;  2ZPI B;  3CME T;  3CC7 T;  2R58 A;  4QVC A;  2VGN A;  4LDV A;  4OF1 A;  3SD4 A;  1JJ2 S;  2RI3 A;  4RG8 A;  3TRE A;  2CZ6 B;  2FB7 A;  5IN1 A;  3JB9 H;  1VIE A;  2LX9 A;  4NOY A;  1TH7 A;  1VQL A;  2DEQ A;  3CME A;  3CC7 A;  4C5E A;  2KDS A;  5GAN h;  1YJN A;  3HHT B;  1LNX A;  2YHT A;  3P8D A;  4J6W A;  4M7A B;  2XDB A;  3VKI A;  3SFM A;  2ZPH B;  2RI5 A;  2DJZ A;  3JRZ A;  3QZ9 B;  1S72 A;  1I8F A;  2RO0 A;  4M77 E;  4C8Q G;  3T9N A;  3CXC S;  1YHQ T;  4M7D D;  5GAO m;  4BY6 C;  3UDC A;  4QVD A;  4ZTJ A;  3FC3 A;  3CCR T;  1N27 A;  4C0Z A;  3OBW A;  3OYA A;  4JS4 A;  2K5F A;  2YLC A;  1YI2 A;  2A7Y A;  2KSS A;  5GAM j;  5GAO l;  5GAN j;  4L6V 5;  3UT1 A;  4MZP A;  1X6O A;  4B9W A;  1VQ9 A;  2HQX A;  4A4H A;  4F7U B;  4ME7 A;  4QVZ A;  5CIU A;  5GMK h;  5FU7 B;  2QTX A;  2MAM A;  4A4F A;  3JB9 I;  4MDW A;  3CPW A;  2RJC A;  4HA8 A;  5LJ3 j;  1RL2 A;  4FIB A;  4OB1 B;  4M75 B;  3VJP A;  4FT4 A;  3DLM A;  3MP6 A;  5DLO A;  4QQG A;  1MGQ A;  2XIC A;  3CCE A;  1BIA A;  2RH2 A;  4C8Q E;  1KQS S;  2VXF A;  4M7A A;  3F70 A;  3LX7 A;  4XU0 A;  5J26 A;  3DKM A;  4OB0 B;  1OI1 A;  2DD5 A;  4M7A E;  4PJO A;  4XTZ A;  3HPW A;  2WAC A;  4PJO F;  1QVG A;  2E70 A;  3G71 A;  2RJE A;  3CCJ A;  1DJ7 B;  3M54 A;  3O8V A;  2QQR A;  3RMQ A;  3ZEH A;  5LJ3 g;  2KK4 A;  2QQS A;  3CCS A;  4E47 A;  1VQP T;  2QQA A;  1WPY A;  1VQO A;  2RM4 A;  5KCO A;  4NL2 A;  4TVR A;  4HT8 A;  4LD6 A;  2P0K A;  2QEX T;  4N4G A;  3FRN A;  3OS2 A;  3A8M B;  1N8R C;  3C94 A;  4ZTF A;  2O01 E;  2CGH A;  1P92 A;  2JVV A;  4FSX A;  2VGM A;  2HAX A;  1XTD A;  4DA4 A;  3HL8 A;  4QW2 A;  3V8L A;  2L5Q A;  3UPU A;  5GAN f;  4BE2 A;  3CCQ A;  5A2Q E;  2P4T A;  1VQ8 A;  4M78 F;  4MMK A;  2L3R A;  3EFS A;  5LJ5 e;  1YIJ T;  3C12 A;  1YJ9 A;  3JSC A;  2F69 A;  3KXT A;  5FU6 B;  2PVG B;  2CZ7 B;  2QXF A;  3CBO A;  5GMK i;  1YIT T;  3M55 A;  2QEX A;  4EMK A;  5CQY A;  1VQL T;  3LGF A;  2LVM A;  1X75 C;  2MWO A;  3HKS A;  5CK9 A;  4RMO A;  3CMA A;  2FYK A;  1G3T A;  3BDL A;  2XI9 A;  3SB2 A;  3CC4 T;  2ZZD A;  5GAN d;  4JS5 A;  5D6X A;  5I21 A;  2QI2 A;  3JCM c;  3PT9 A;  3X20 B;  1M1G A;  5LJ5 h;  1XNI A;  4C5I A;  3OY9 A;  2RHX A;  3OW2 A;  2BIV A;  4NS5 A;  3OYN A;  5GAO r;  1VQ5 A;  1OYX A;  2FVU A;  2LCC A;  4VUB A;  2PU9 B;  3WVD B;  2GQV A;  3L2W A;  4E7L A;  2JNG A;  2DD4 A;  5FU7 C;  3QKJ A;  2VXE A;  4F7U A;  3CPF A;  3QO3 A;  5EG2 A;  3CCQ T;  4ZGE B;  4WF2 A;  4F7U F;  1VQN A;  3OMC A;  4PJO C;  3NFC A;  2R57 A;  5LJ5 j;  2EQJ A;  1VQ7 A;  2LCL A;  3GLX A;  1Y96 A;  1VIF A;  2Y4X A;  5KE2 A;  1R8O B;  4BUG A;  5GAM f;  3G6E T;  1M90 U;  3V7C A;  4M7D C;  4XK8 E;  2JUF A;  3L2R A;  1WJQ A;  1U8R A;  3KUF A;  1N8R U;  1O9S A;  3HRS A;  4A54 A;  4EMG A;  3L1A A;  5GAM h;  3CCM A;  1YI2 T;  2EKO A;  4BY6 B;  3OYI A;  5GAN 7;  1OZ2 A;  2YLB A;  3MCA B;  4M77 D;  3SDZ A;  3CD6 A;  4C92 D;  5GMK j;  5LJ5 g;  1VQM T;  2K2V A;  3M4G A;  5CKD A;  2M0O A;  3TU4 K;  1KHC A;  1JBM A;  5LJ3 h;  3CCU T;  1D3B B;  3KBG A;  2BKD N;  1VQK T;  4IUP A;  1YJW A;  3M5A A;  4J83 A;  2OAU A;  2XK0 A;  1OZ3 A;  2WSC E;  4JRP A;  2XDP A;  3BW1 A;  2MMP A;  2VV5 A;  3LLR A;  2PQW A;  2LQK A;  3CCV T;  2G3R A;  2MI6 A;  4M78 A;  3QSU A;  3VYG A;  2R5M A;  2F5K A;  2EYQ A;  2QDY B;  5DLQ E;  2BUD A;  1Y7X A;  2EJG A;  3I55 A;  1KD1 U;  3V7S A;  1Y96 B;  3EFR A;  4RKU E;  1I5L A;  2DPP B;  3VUB A;  2R5A A;  4L5G A;  5LJ3 e;  4HT9 A;  3OYE A;  2RD1 A;  3CD6 T;  3OMG A;  3ASK A;  3OYK A;  2CZ1 B;  2PVO B;  4P5N A;  2E41 A;  3SWN A;  4JLI A;  3GOX A;  2XKO C;  3DLL A;  4M7D G;  1BI0 A;  2X4J A;  3CXC A;  4YTL A;  2H3J A;  4C92 G;  4OVA A;  3QDR B;  3OBY A;  1PSF A;  3CCL T;  5HY6 A;  5GAN e;  3QUI A;  4MML A;  2K3X A;  4BD3 A;  5C6S A;  4JRQ A;  4UC4 A;  1Q86 C;  1M90 C;  4ZGD B;  4BI4 A;  4RCC A;  3QYH B;  3I55 T;  4PNO A;  4J5Y A;  2NLU A;  2PVD B;  3A8O B;  3N5B B;  2K5I A;  3MET A;  3RKW A;  2RHI A;  2OTL A;  3CCV A;  5FRN A;  1VQN T;  2JZ2 A;  3OYL A;  2V8I A;  3TCJ A;  2A3L A;  2DTH A;  2WSE E;  3CCS T;  1JJ2 A;  3MHX A;  1WQ7 A;  3M59 A;  5L8R E;  3L42 A;  2HNI A;  2M1H A;  3QYG B;  2EQK A;  3V8J A;  3L2Q A;  3MO8 A;  2K57 A;  3OW2 S;  3CCJ T;  1HXD A;  4C5H A;  3J80 E;  3C95 A;  5DM7 R;  1JB0 E;  2DK3 A;  4M78 G;  1N9S A;  3JCM b;  1VQ4 A;  4M7D F;  2ZPF B;  3E19 A;  3OYF A;  1VQM A;  3HSB A;  3QJ6 A;  4C5G A;  3CMA T;  4M7D A;  3JAM E;  4OMF B;  2XG8 D;  1LJO A;  4PLI A;  3M53 A;  3G7Z A;  2PUO B;  4M75 E;  3MP8 A;  3JCM g;  5GAN 8;  3JB9 J;  3RER A;  1IRE B;  2X35 A;  1B34 B;  3PMI A;  3FDR A;  5D6W A;  2XDD A;  4C0F A;  1WGS A;  1I4K 1;  1W2B S;  1KD1 C;  4EMK C;  4LDU A;  2XU8 A;  2LNV A;  3QXE B;  4ELY C;  4E7H A;  3S3M A;  4Y91 A;  2JN0 A;  1H64 1;  4FU6 A;  1KG1 A;  4X9C A;  4JDS A;  3J7A F;  1W4S A;  2EJF A;  3INZ A;  3EAE A;  1YCY A;  4BI8 B;  5A0D A;  1KC8 C;  5FRO A;  4J6X A;  4LD9 K;  4M7A C;  1M5Q 1;  1UGS B;  4N4H A;  3V8K A;  4M77 B;  3MEW A;  2LRQ A;  1S72 T;  3MEU A;  5A0L A;  1GXI E;  3PGG A;  4J8O A;  4IUQ A;  4M7D B;  2CZ0 B;  1YJN T;  4II1 A;  3JB9 F;  4OP0 A;  2IG0 A;  3JB9 G;  4XU1 A;  1Q86 U;  2DXU A;  4C92 C;  2DIQ A;  2RI2 A;  4B9X A;  3X26 B;  2HQE A;  1FXX A;  3P8H A;  5A0G A;  2DTO A;  3JCM P;  2X4X A;  5CR2 A;  4BB7 A;  1WJR A;  1WQW A;  3PIO A;  1QVG S;  5GAM e;  1VQK A;  1VQ6 T;  1ZBX A;  2AHJ B;  2DKG A;  5CQX A;  1NE8 A;  4Z02 A;  2RHZ A;  4XTV A;  4JRK A;  2FHD A;  1NJI C;  1K9M C;  3JCM d;  1I81 A;  2DXB A;  3JCM W;  2GFU A;  5GAM g;  1KQS A;  3MP1 A;  2L89 A;  3CCM T;  2EQU A;  3ZFJ A;  4ZGJ B;  1Y07 A;  3GF5 A;  4J7I A;  1G3W A;  2C06 A;  2CKK A;  2RHU A;  3CPW S;  1IZ6 A;  2E5Q A;  2O4X B;  5GAN 4;  2RHY A;  1M4Z A;  2EAY A;  3S6W A;  1M8V A;  1M1K C;  2DXT A;  3CBM A;  4A4K A;  4C0D B;  3I56 A;  2X4Y A;  5IT9 E;  1YJW T;  2RK2 A;  5M9O A;  1VQO T;  2EWN A;  1BI2 A;  3FIF A;  5GAN 2;  4EDU A;  1XOV A;  3HRU A;  3OB9 A;  2GFA A;  5GMK m;  4PL6 A;  1QW1 A;  1UB4 A;  2HD0 A;  4BDZ A;  3PTA A;  4N0A A;  3G4S A;  1VQ4 T;  2XD0 A;  3GPL A;  1Q82 C;  1KC8 U;  4MZT A;  1AHJ B;  1QVP A;  4DQ2 A;  5CKF A;  1VQ6 A;  3JCM h;  5GMK l;  4DOV A;  3JCM X;  1X01 A;  2YRV A;  3OS5 A;  3NTK A;  1KHI A;  4R56 A;  5GAO n;  3FB9 A;  1KQ1 A;  4XTX A;  4LDY A;  2Y4Y A;  4M78 E;  4KUD K;  1H3Z A;  4HKE A;  2ZCF B;  5J3B A;  3BY7 A;  4PJO B;  4E7J A;  1VUB A;  4RG2 A;  5D6Y A;  4E7K A;  1U1S A;  1O75 A;  3E1S A;  3HFO A;  3C4S A;  5LL6 S;  1QVF A;  1BYM A;  3BDU A;  4A4E A;  4QQD A;  3LYI A;  3CCL A;  1YIJ A;  1FWZ A;  3L2V A;  2D6F A;  2VC8 A;  2JTM A;  2KMT A;  4M77 C;  3LH0 A;  3OS1 A;  1VQ9 T;  3L2U A;  1UGR B;  1ZHI A;  4M75 A;  4C0D C;  4M75 F;  5CCA A;  2P0P A;  4M7D E;  4OGE A;  1K9M U;  1NJI U;  2DO3 A;  2DVE A;  3JCM f;  4PLL A;  2KAF A;  4ATO A;  2E65 A;  5HK0 A;  1K73 U;  1VQ5 T;  3NTH A;  1G3S A;  2E64 A;  2GF7 A;  4XTW A;  4J7F A;  4FM4 B;  3WVE B;  3OSS C;  4M75 C;  2X4W A;  3OYC A;  5GAN 6;  4KBM B;  2V8J A;  2HBP A;  3A8G B;  2D0Q B;  3GNF B;  3PFS A;  1FX7 A;  2E1H A;  2O4X A;  3V7R A;  2E6Z A;  2KVQ G;  1M1K U;  1BI1 A;  5LJ3 d;  1U1T A;  3PMT A;  5GAN g;  3H8Z A;  5CO7 A;  4F7U E;  3M57 A;  5I2M A;  2EQM A;  4XU3 A;  3OYB A;  3WXM B;  4EMH A;  4C8Q D;  4M78 D;  4R55 A;  1XQH A;  4OB2 B;  1WNL A;  5AYF A;  2I2L A;  2QA4 T;  1YIT A;  5DY9 A;  3X28 B;  2VYT A;  4D6W A;  2DZ9 A;  3OYD A;  3S3N A;  4E7I A;  1Q82 U;  3VV0 A;  1RI0 A;  3BFM A;  1EIF A;  3ZBD A;  1JRI A;  4C92 F;  1WJS A;  4KT0 E;  5GAN 3;  1VQ8 T;  1UGP B;  3H6Z A;  5FRM A;  4A4G A;  1M9S A;  2EJ9 A;  5KCH A;  4XAX B;  2KQW A;  4KUL A;  3FLG A;  3M9Q A;  4J6Y A;  2JOY A;  3SWN B;  3X24 B;  4JUV A;  2MF2 A;  3M58 A;  4M7A G;  1UEB A;  4A53 A;  2DTI A;  4M78 B;  4NL3 A;  3OYJ A;  4M77 G;  1LOJ A;  4BE0 A;  3OS0 A;  4GY5 A;  2ZPB B;  3J81 E;  4HCB A;  4ELZ C;  1QVF S;  1Q7Y U;  2M9U A;  1UGQ B;  3GP8 A;  1HK9 A;  3QII A;  2RJF A;  4RCB A;  5KE3 A;  5GAN 5;  3LWH A;  2M16 A;  2LTO A;  4PKC C;  2D9T A;  2RK1 A;  4O6J A;  5HKC A;  5LJ5 d;  4KUI A;  5GMK e;  2K3Y A;  1QP3 A;  2GCX A;  3OYH A;  3JCM Q;  3JB9 D;  3G71 T;  3E9F A;  4IUU A;  4CRI A;  2IVW A;  3ME9 A;  3NTI A;  1K8A C;  2LQ8 A;  4C92 B;  4BAC A;  2KY9 A;  1Q81 C;  2LT1 A;  1K73 C;  3QG1 A;  2ZPG B;  3AHU A;  3MEV A;  1NPR A;  2CYZ B;  3CC4 A;  2XHC A;  2DZC A;  2E12 A;  4OB3 B;  4M77 A;  4M75 D;  2PUK B;  2RA2 A;  1G5V A;  3ER0 A;  3HP9 A;  5J39 A;  2OTL T;  4C0G A;  1QP2 A;  3DB4 A;  4C8Q B;  3I56 T;  3GNG A;  2LC4 A;  4FL6 A;  3CBP A;  2K4Y A;  1Y71 A;  2V8K A;  3LGL A;  4Y28 E;  3PIP A;  4V2S A;  2ZPE B;  4C8Q C;  4M78 C;  4IUV A;  5FLX E;  2EFI A;  3M56 A;  3OYY A;  3HRT A;  5CKB A;  3RUX A;  2DIG A;  1BI3 A;  3VUZ A;  1N9R A;  1SSF A;  2RJD A;  4MZM A;  3P8B B;  4C8Q F;  3VU3 C;  1NPP A;  2JTF A;  3VYH B;  3CC2 T;  4C8Q A;  3CC2 A;  4LDX A;  4IUT A;  3OYG A;  4M7A D;  5CAI A;  2DXC A;  2LT4 A;  4M75 G;  4OGC A;  3QZ5 B;  2F5T X;  5C0M A;  4QQ6 A;  4PJO D;  4FT2 A;  3QJY A;  1D3B A;  1V29 B;  4F7U G;  4ZN1 A;  3E9G A;  4HCZ A;  4XTY A;  3TEE A;  4C92 A;  4JRI A;  2E6N A;  3MEA A;  4GLK A;  2CS7 A;  3PNW C;  4X9D A;  3HFN A;  5FU6 C;  5HK3 A;  5LJ5 f;  1Q7Y C;  3OA6 A;  1VQP A;  3FJP A;  1NZ9 A;  2Y90 A;  4JLG A;  1M1F A;  1N6A A;  4L59 A;  4X34 A;  2FL7 A;  5KH6 A;  3OYM A;  3M4Y A;  1B34 A;  3L2Z A;  4EMK B;  3G4S T;  4BDY A;  2EIF A;  1K8A U;  1BIB A;  5CKE A;  4PJO G;  4CI0 C;  4MDX A;  2OTJ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...