2R5XA

Crystal structure of uncharacterized conserved protein yugn from geobacillus kaustophilus hta426
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
115
Chain Sequence
b'SLKFENTGLENQTVELSRLDDIMERLGFVRAAQWDYERVTYDRKYVVKEGTYYLRVQGYAIEGNVDSRYALIKLLTPIMGKHYYPHDEHFPSSLVSQCQNVLAQVKSELEKIKEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein YugN from Geobacillus kaustophilus HTA426.
rcsb
molecule keywords Uncharacterized conserved protein
source organism Geobacillus kaustophilus
molecule tags Structural genomics, unknown function
total genus 30
structure length 115
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08868 YugN YugN-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.100 Alpha Beta 2-Layer Sandwich TATA-Binding Protein YugN-like 2r5xA00
2R5XA 2PWWA
chains in the Genus database with same CATH superfamily
1LWWA 1QTSA 2QREA 3VN5A 1P5GX 2DKDA 2VJ0A 3CVSA 1VKLA 1QN6A 2JHJA 2NLVA 1KYFA 1B9KA 1PVSA 3OH9A 4ROCB 1QNCA 3EAYA 2D0CA 2D0AA 1YTFA 5IYDP 3DPTA 3CWTA 4WXAA 3N89A 1QN3A 1K2YX 2G30A 3CWUA 5AN4A 2YH5A 1EUVA 1UT4A 1UT7A 2NOIA 3OLPA 1D3UA 2NOEA 1Q9UA 5IYCP 4MRQA 2YA3A 3C04A 3F10A 3H1ZA 4D7QA 2EHBD 1PZDA 2LAEA 3TDHA 2XHIA 4EJYA 1KYUA 2IV9A 5BMNA 1PCJX 1M3QA 1LWYA 3D7QA 1WQAA 3TE5A 1NVPA 4EALA 3OC3C 3OSEA 3EIKA 2D0BA 1KY7A 2Y8QA 3HS8A 1QTPA 1YQKA 2V92A 4HJHA 4EAKA 1QN7A 4EAGA 4WZSD 2DKCA 3CWSA 1QNBA 3KRMA 5KL0A 3SNSA 2OOYA 1VTOA 2JPIA 1HU0A 1N3AA 1AISA 4WX8A 3OCIA 1W80A 2DKAA 3I0WA 1QN9A 1YTBA 1C4GA 3OSMA 3NA5A 2O3OA 3OH6A 2QRDA 2NOZA 1C9BB 4IL8A 1YQRA 2FGTA 1KO9A 1KYDA 1LXTA 3UW2A 3CVTA 4BJUA 1TBPA 1QN8A 1QN5A 2IV8A 4QG5A 1N39A 2MZ8A 3F0ZA 1VTLE 1J3MA 3KTUA 4B0AA 2HL9A 2JOIA 2H4LX 2FKMX 1JFIC 1QNEA 1QNAA 4ROEB 2HKPA 1V5SA 4Q11A 1DIZA 1YQLA 2Z0FA 1TBAB 3T4NA 2QR1A 1MPGA 5F9CA 3ASMA 5JN5A 1TGHA 4TPSA 3ENCA 4PY5A 2JHNA 5HSHA 3PMGA 3CW7A 5BMPA 2H5AX 1K35A 1NGMA 1M5Q1 2NVMA 1TUOA 2PWWA 2NWVA 1NH2A 1CDWA 5JMVD 3HS9A 2NOFA 2FKFA 3D4VA 4EAJA 1KY6A 1WJWA 2HZSA 1VOKA 1C47A 4I8OA 3BKQX 3CWAA 4RODB 2MJ7A 1LWVA 1M3HA 1RM1A 2Y8LA 4D7RA 1MP9A 3RSMA 3RPJA 2QRCA 1FN7A 2F7LA 3ULXA 1VOLB 1KFIA 1QN4A 2NOBA 1UL7A 2ZFDB 2I5WA 4DULA 2V8QA 1R4XA 1YQMA 3I0XA 1N3CA 3OSTA 3OGDA 1T6AA 2FUVA 3IH7A 4EJZA 3DPUA 1PCMX 1E42A 4EAIA 1KFQA 4CFFA 1JDYA 2OOXA 4C7PA 5EPCA 1P5DX 3PDKA 1EBMA 2HZMA 2R5XA 5IYBP 2Z8UA 3I3WA 2V9JA 1XSZA 2NOHA 2QLVA 2NOLA 2HL8A 1PCZA 3ENOC
chains in the Genus database with same CATH topology
2R5XA 2PWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5X A;  2PWW A; 
#chains in the Genus database with same CATH topology
 1LWW A;  1QTS A;  2QRE A;  3VN5 A;  1P5G X;  2DKD A;  2VJ0 A;  3CVS A;  1VKL A;  1QN6 A;  2JHJ A;  2NLV A;  1KYF A;  1B9K A;  1PVS A;  3OH9 A;  4ROC B;  1QNC A;  3EAY A;  2D0C A;  2D0A A;  1YTF A;  5IYD P;  3DPT A;  3CWT A;  4WXA A;  3N89 A;  1QN3 A;  1K2Y X;  2G30 A;  3CWU A;  5AN4 A;  2YH5 A;  1EUV A;  1UT4 A;  1UT7 A;  2NOI A;  3OLP A;  1D3U A;  2NOE A;  1Q9U A;  5IYC P;  4MRQ A;  2YA3 A;  3C04 A;  3F10 A;  3H1Z A;  4D7Q A;  2EHB D;  1PZD A;  2LAE A;  3TDH A;  2XHI A;  4EJY A;  1KYU A;  2IV9 A;  5BMN A;  1PCJ X;  1M3Q A;  1LWY A;  3D7Q A;  1WQA A;  3TE5 A;  1NVP A;  4EAL A;  3OC3 C;  3OSE A;  3EIK A;  2D0B A;  1KY7 A;  2Y8Q A;  3HS8 A;  1QTP A;  1YQK A;  2V92 A;  4HJH A;  4EAK A;  1QN7 A;  4EAG A;  4WZS D;  2DKC A;  3CWS A;  1QNB A;  3KRM A;  5KL0 A;  3SNS A;  2OOY A;  1VTO A;  2JPI A;  1HU0 A;  1N3A A;  1AIS A;  4WX8 A;  3OCI A;  1W80 A;  2DKA A;  3I0W A;  1QN9 A;  1YTB A;  1C4G A;  3OSM A;  3NA5 A;  2O3O A;  3OH6 A;  2QRD A;  2NOZ A;  1C9B B;  4IL8 A;  1YQR A;  2FGT A;  1KO9 A;  1KYD A;  1LXT A;  3UW2 A;  3CVT A;  4BJU A;  1TBP A;  1QN8 A;  1QN5 A;  2IV8 A;  4QG5 A;  1N39 A;  2MZ8 A;  3F0Z A;  1VTL E;  1J3M A;  3KTU A;  4B0A A;  2HL9 A;  2JOI A;  2H4L X;  2FKM X;  1JFI C;  1QNE A;  1QNA A;  4ROE B;  2HKP A;  1V5S A;  4Q11 A;  1DIZ A;  1YQL A;  2Z0F A;  1TBA B;  3T4N A;  2QR1 A;  1MPG A;  5F9C A;  3ASM A;  5JN5 A;  1TGH A;  4TPS A;  3ENC A;  4PY5 A;  2JHN A;  5HSH A;  3PMG A;  3CW7 A;  5BMP A;  2H5A X;  1K35 A;  1NGM A;  1M5Q 1;  2NVM A;  1TUO A;  2PWW A;  2NWV A;  1NH2 A;  1CDW A;  5JMV D;  3HS9 A;  2NOF A;  2FKF A;  3D4V A;  4EAJ A;  1KY6 A;  1WJW A;  2HZS A;  1VOK A;  1C47 A;  4I8O A;  3BKQ X;  3CWA A;  4ROD B;  2MJ7 A;  1LWV A;  1M3H A;  1RM1 A;  2Y8L A;  4D7R A;  1MP9 A;  3RSM A;  3RPJ A;  2QRC A;  1FN7 A;  2F7L A;  3ULX A;  1VOL B;  1KFI A;  1QN4 A;  2NOB A;  1UL7 A;  2ZFD B;  2I5W A;  4DUL A;  2V8Q A;  1R4X A;  1YQM A;  3I0X A;  1N3C A;  3OST A;  3OGD A;  1T6A A;  2FUV A;  3IH7 A;  4EJZ A;  3DPU A;  1PCM X;  1E42 A;  4EAI A;  1KFQ A;  4CFF A;  1JDY A;  2OOX A;  4C7P A;  5EPC A;  1P5D X;  3PDK A;  1EBM A;  2HZM A;  2R5X A;  5IYB P;  2Z8U A;  3I3W A;  2V9J A;  1XSZ A;  2NOH A;  2QLV A;  2NOL A;  2HL8 A;  1PCZ A;  3ENO C; 
#chains in the Genus database with same CATH homology
 2R5X A;  2PWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...