2R61A

Crystal structure of the staphylococcal superantigen-like protein ssl5 in complex with sialyl-lewis x at ph 7.4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
197
structure length
195
Chain Sequence
ENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDAHQAFTRIQIFGKDIERLKARKNPGLDIFVVKEAENRTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
molecule keywords Exotoxin 3
total genus 52
structure length 195
sequence length 197
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r61A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2r61A01
1PRTB 1XTCD 1SJED 1CQVA 1I4HA 1MD2D 1YN3A 1LTTD 2RDHA 1S5BD 3DWPA 1CHQD 1PZJD 2R61A 2XRSD 3BYTB 1D5ZC 1UNSA 1FNVA 1S5DD 1TS5A 2AQ3B 2RDGA 1BCPF 1BXTA 1G8ZD 3BYYB 3EFXD 1BCPC 2O2LD 1V1OA 1PZKD 4RGMA 1S5CD 2NTSA 2G9HD 1L0YB 1RD9D 3TSSA 1ENFA 1I4QA 1LT5D 1S5ED 1B44D 1F77A 1AW7A 3MFGA 1LTAD 3CHBD 1LTBD 4RGOS 1EU3A 1QILA 1SE3A 4BWGB 4Z9CB 3DWAA 1JWMD 2QEJC 4RHRA 1UUPA 4C56C 3EA6A 2J4XA 1KLGD 4ZYSA 1STEA 1SE2A 1ET9A 1JWUD 1EWCA 1RDPD 1ET6A 1T5XD 2ICIA 1TS4A 1I4GA 4DXGA 4TSSA 1M4VA 1PTOH 1LT6D 1LLRD 1XXGA 1HQRD 1LTRD 1TY0A 3R2TA 4RCOA 1JQYD 2NTTA 1L0XB 1LT4D 1CK1A 1HA5A 1TS3A 1V1PA 3O13A 3MC0B 3V05A 4RFBA 2QILA 1RCVD 1PRTF 1CHPD 1TY2A 5TSSA 1BCPD 1D5XC 5D3IB 4K6LA 1YN5A 1JCKB 1PYWD 1CT1D 1HXYD 1LTGD 1PRTC 1EEFD 3URYA 3BVZA 2CHBD 1KLUD 2XN9C 1HTLD 1S5FD 4UDUC 1BCPB 4OHJA 5FK9C 1D5MC 1SJHD 1RF2D 1FD7D 2TSSA 4RH6A 1ESFA 1KTKA 5ELDA 1PTOD 3R8BA 4RGTA 5ELCA 2AQ1B 1I4PA 1SE4A 1B1ZA 3BVGA 1TS2A 2XRQD 1LTSD 3R2IA 1SXTA 5ELBA 2SEBD 2WV6D 1LTID 3OWEB 4L6TB 3W2DA 1DYQA 1LO5D 5D3DA 1YN4A 3BZDB 5ELEA 1FNWA 5FKAC 1D6EC 1EFID 1I4XA 4L63B 1SBBB 5I4DA 1FNUA 1PRTD 1SEBD 2XNAC 3SEBA 1V1PB 1FGBD 1DJRD 2IJ0A 1PTOB 5ELFA 3GP7A 1PZID 3KLSX 4DXFA 3DWQA 1AN8A 4RGNA 2IPKD 1PTOC 4RHSA 1GOZA 3BVMA 4O1NA 1EEID 1JR0D 1JWSD 1I4RA 1PTOF 2Z8LA 2AQ2B 4NZLB 1LT3D 1EU4A
chains in the Genus database with same CATH superfamily
1PRTB 3UINB 3EJIA 5LMUQ 4KKTA 3NQTA 1FL0A 4JI7L 3DVNU 4KX6B 1JMLA 1KM7A 2RDHA 2A6HC 4GKKQ 3IT6B 1VJKA 4RNAA 2R7DA 1STNA 5ELNA 2OJRA 3TQYA 5IE8A 1XCQL 2RVLA 5DPRA 1YX6B 2NZHA 3U9SA 4A3EG 4EX5A 4RG1A 1OQQA 2KC1A 4DV2L 3JAML 1UZXB 2LHEA 2WAQG 4LF6Q 2RR9A 1TR5A 4C4VA 1WH3A 1BUIC 2FXQA 4K7SA 1ENFA 1T3QA 4DV6Q 2IO0B 2NVXB 5IN7A 4Y7NH 3TP7A 1AW7A 4LK0M 2EYMA 2CWAA 1C4QA 2INNE 2PJHA 2A8VA 4X62Q 3T8MA 1B2TA 4GOPC 4OX9L 3I4NH 1EOTA 4MHEA 4IFDH 3VTVA 4KY7A 2BS3B 4F87A 5FO7B 3SVMA 4ZRQA 5DPSA 4KZCA 5H92C 3RNAC 3VUXA 2E2HB 3K57A 3X0WA 3NTKA 1QNKA 2P5ZX 1VQGA 4LF8Q 2E2IB 1WGRA 2G45B 5BMIA 4LDTB 2RSOA 5D14A 2KA7A 3NJTA 3UDXA 4MTNA 4JI4L 1I6HH 5IWAQ 4H2AA 3UI3A 3P1HA 1CFMA 1Q81C 4QY7A 2L0CA 4LWCA 4A3PA 1MHWC 3ZJTA 1V1PA 1FEHA 4GN1A 1HPCA 1ESRA 4GKKL 5BO4B 1F2MA 4NJCA 5TSSA 3QX1A 1TQOA 2UUAL 1H8CA 2PMZE 2B3AA 4HCPB 1JORA 3OG5A 1MGSA 2PVGC 2MA9B 2K5QA 1P7EA 3KJPA 2VUMG 4YIJA 5JZEB 2Y0SG 1TWGH 3RUZA 3CCUA 2WXGA 2A69C 2UYZB 3T1HQ 1EOVA 2EIFA 1G291 3TCAA 4WAAA 2GLSA 2N0SB 2N55A 3SXHA 5F2DA 4HIDA 3S24A 2X8XX 4KY5A 5M3MG 1E8YA 3CC4A 1SE8A 5C4XG 3ZNZB 1Q0WB 1Z5SB 1IGDA 4HJ9A 1TS2A 3D6CA 1HTPA 5FJ8G 2VH1A 4IWQA 4JG2A 5C4ZA 1WM2A 2N7DA 5IGEA 3A0JA 2FJ2A 1DOKA 2F52A 2A4ZA 2LUMA 1BR9A 2NVYB 3AB9A 4JI3Q 5NUCA 3GTLH 3DXJC 3PLVA 4KKSA 4EZKA 2WS3B 1FNWA 1WTVA 3AU4A 5I4DA 1IBXA 1L1OA 2WWZA 1SEBD 1GD7A 2WNMA 1WR1A 4BKSA 1R4PB 2Y3AA 2WGSA 1I6HB 2BYVE 2B2WA 4APVA 3ZUNA 4XWWA 1QT9A 3MEFA 4RKLA 5C3EB 1ZW7A 1KHIA 1HNZQ 4P73A 2HCIA 3ULLA 5C4XH 3PGZA 5E4XA 2MRPA 2PZUA 2ZXOA 3I9V1 1PDXA 2ATWA 2EKEC 5CV8A 3KVFB 2Q8TA 3QARA 4DK0A 4KHVA 1ZOYB 3B9JA 4FLHA 1WJJA 4UHVA 3PV0A 3HOVB 1EWIA 2AQ2B 2OCEA 3ITPA 2K9XA 4HEA1 4NAMA 2LY7A 3TN2A 3A1QB 2PO4A 1GJXA 1QOBA 2A6HD 1S5BD 3FP9A 3S1NH 2NVXH 3JAMc 5IIFA 3Q24A 4B3TL 2WDRB 3Q8AA 3FKIG 2KCMA 1GB1A 3MXNA 5CV6A 3Q8CA 1AE2A 5DAUA 2KKCA 1N9WA 2SDFA 2UXCQ 2KHJA 2HQLA 3A9JA 3BYYB 3DWGC 1F9RA 3L2PA 4FF2A 3FKYA 4W9GA 1O7LA 4AH6A 1EY4A 3VAWA 2QGQA 2W3RA 2KFKA 3B6YA 1EUVB 3NVZA 2WU2B 4NPNA 5KGUA 4RM9A 2ZTCA 2D0PA 3QIJA 3X23A 3U9OA 2ZZPB 4WAFA 3VR9B 1XPRA 2R93G 3JC66 1IL8A 3HUIA 4B3MQ 3E9IA 2RSNA 3DHQA 3HOYH 2NVTH 1VQHA 3RT3B 5EKLA 2CU3A 2OEDA 4EFOA 3NY5A 1JOKA 2CJOA 1BVSA 4KTAA 4CBVA 3I90A 4H44C 1SE2A 1VQPA 1HEZE 3Q2AC 4NAWA 1VQEA 4H0LC 3TUOA 4U673 2ZPNA 4LUOA 2UUCL 1BMLC 1WX7A 3VDZA 1I4GA 4J3OD 4ALPA 2N1WA 1JT8A 1UD7A 3DVNV 3J80L 3QC8B 2KJRA 2PIAA 3J7AV 3R2TA 1EFWA 3NEMA 2I38A 2V3PA 3RNFC 3NS8A 1LT4D 3L3OC 3QWNA 4IQZA 1MI2A 4MACA 5J17A 4BBRG 1GC6A 1GUNA 5IGDA 2KQ3A 2JX5A 2RF4A 3I4NG 2WXFA 2KHIA 3NTHA 4R4CA 5CTRC 1TY2A 3MJ5A 2Q8RE 1FFUA 4WWMA 2H5XA 1MJEA 1L6UA 1P1AA 1V5TA 4MGYE 5EPLA 3GS2A 3QAQA 2N9LA 4DV6L 2JA5B 4BKSD 4OWXB 1D8LA 1CZPA 3AU5A 3U4EG 3TEZA 2BA1A 1EEFD 4A3BG 1OTRB 1VLBA 3HRDD 2CVRA 3MXGA 1Q1EA 2F3VA 5AZGA 1MG4A 3CC7A 4ZRPA 1K0RA 5BN5A 4YWGG 1D5MC 1SJHD 3PZ7A 1E22A 2LFIA 2YTVA 3NWSA 2PPBC 2TSSA 4OO1G 1S4ZA 3CF6E 1UE7A 2B2TC 1V6EA 4A3GG 1WYWB 2PNHA 3KF6B 5E4WC 4EVOA 4DAPA 5FLMG 2F4IA 2HDMA 3BVGA 3C0RB 1RFAA 4DFAA 4G4KA 3T1HL 2LGXA 4URKA 4WH4A 1Y1WG 4KIKB 3N9YC 1E2ZA 4XC2A 3Q8DA 2JE6I 3VXWA 2F4VQ 1MPEA 4BY7B 2JEAI 1YN4A 2KAJA 2JA9A 2VUMH 1UELA 3LB8C 1CMXB 2KTRB 2E5LQ 4JYAQ 1E8ZA 2XVSA 1JJGA 2XNAC 4J8QA 3Q3MC 4DR5Q 2LXCA 2K01A 2NUCA 3K81C 4GN3B 3SR1A 4BY1G 3C2PA 4MJSB 4GNXA 3ML8A 4MT5A 4IM0A 2IHEA 3VR8B 3OAWA 4IALA 3L0OA 4FXDA 1VF5C 1WI0A 5HFYA 1L5PA 2BW2A 3RYTA 2XK5B 1TGZB 3JVZX 3CCLA 1F52A 5C4JB 2LSSA 3IL8A 5IYBH 1P98A 5IP7G 4TV3A 2VQEL 1HZCA 4IUNA 4IZ8A 3IAYA 1P7FA 4L5RC 2YLMA 3I4MB 4GZYC 1WZ3A 4HMJA 3AFQA 1K0SA 3NVVA 1D5ZC 2WLBA 2R6GA 2BKRB 2JYEA 1SYFA 4FHKA 2CS4A 4GLSC 2JJQA 3U4VA 1ZPSA 1TIID 4B9WA 1FXTB 1G8ZD 1QB5D 3IFDA 4YL8A 4DBGA 1WGDA 5EAYA 4ZRJA 3W1YA 2FCNA 4BA1I 1WWTA 4K5XA 2KCCA 3KFUA 1HR0W 3MXNB 2F0LA 5KNDA 3H0GB 3GTPH 2ON8A 3DDCB 4LMQD 4XYOA 2JA8G 1SYEA 1PYBA 1RTOA 3FKIH 2L0FA 3DWAA 1A3UA 3A9JB 5A2QE 4MGIE 2VW9A 1S3SG 4IPDA 1NYRA 4DR1Q 1Y56A 2DYOA 3PO3G 3ABVB 4WQMA 1C9FA 1QJOA 4BFRA 1D3ZA 4GLXA 3ZYYX 3S2DH 1ENAA 1W6KA 3HOZG 4DXGA 1UAPA 5KRUA 2VZKD 3QOLA 1C77A 1XYIA 3I4OA 3S17H 1C3TA 1X32A 1X9NA 1XMOL 4MGKE 1EY6A 2L00B 4OVUA 4R4OA 2VB3X 3FPUB 1P3QU 3RD2A 1QUQB 3IHPC 4LNQA 4IC7B 3S1MH 3CSTA 4YTMB 4IO9A 4L2YA 1PFBA 3I56A 2PZTA 4A3IB 4DA2A 1L1OC 2JN4A 1QOAA 2ACZB 3RCZA 1IBLQ 1NR2A 3SFEB 4KDIC 3VYUA 1X3EA 4FXKC 2DZIA 1W2BA 2JUOA 5TR5A 3BVZA 1EIFA 1MSGA 2IDYA 4I7AA 1EIGA 4OVVA 1CKNA 4UDUC 1S5FD 2KCTA 2GBNA 3DLLA 1F2RC 3U7ZA 2O6VB 2LGIA 2FBWB 3T1YQ 1VQ6A 3BWUD 4XWTA 1SROA 4IOIE 4TMAB 2EYHA 1R9TH 4QL5A 4A3MB 4ANWA 1VZ6A 1LTSD 1CZWA 1SYGA 2ZJRA 3TZDA 1YNTE 3WCQA 4E71A 1SR3A 1LO5D 2LGYA 4M8AA 1J5EQ 4ZK9B 5FKAC 4N9TA 1VQ8A 4N9PA 5D65A 1YJWA 2K14A 4LF4Q 4DR7L 1PRTD 1JW9D 1UF0A 3NP8A 3GTJB 1WSPA 4FJZA 4DAVA 1PGBA 2F0GA 4A20A 3LWEA 2EE1A 4DXAB 2JA6H 2CHXA 4DV1L 2BCOA 3GP7A 4JI1L 4EGVA 1S72A 2AMCB 1PFNA 1KD1C 5FLMH 5D2MB 4LF8L 4XGAB 3APFA 5JHAA 2SNSA 4S3SA 3HM6X 3AE3B 3P20A 3DWMA 4WIPA 4KV2A 4CHKA 2LD9A 3RNEC 1I4RA 1Q90A 4YWKA 2OTJA 2ASQA 1IYJB 1FYCA 4DR6Q 2MPMA 3ND9A 1K73C 3RR5A 4DV7Q 2O6VD 1GJZA 1I4HA 3OYYA 3OHXC 4GN4B 1H9SA 5D6JB 4ACFA 5DM73 4ZOHC 1KC8C 3DWPA 4QGUA 2G9DA 1CHQD 3MHBA 3FDTA 3H0GH 3H94A 5J39A 3GTPB 4ZKBB 1RL2A 2VNUD 3IXSA 3NBHA 1T0QC 4LJZC 4LNKA 3V60A 2N49A 1GUAB 2KWDA 5M9OA 3TEWA 3N6RA 4IPGA 2KVRA 2DAFA 4FP5D 1MVKA 1L0YB 2UXBQ 1VMCA 2F0VA 4A3DG 2D3GA 1U9RA 1LT5D 1DZ1A 4ULLA 1T0RC 2K5WA 2O4XA 1WYDA 3H6MA 1E7VA 3Q3FA 4C2MH 1XX8A 4NMZA 3CHBD 3LGJA 5EPJA 1LTBD 4C3HG 4C3IG 5EPKA 2ICEC 4A3CH 3M3JA 2QEJC 3NBIA 4F88A 4OZAA 3V61A 2B2UA 5CORA 4CJ0B 1L6VA 2NN6H 5M3FG 4POFA 3G6EA 2L76A 1YHQA 1E10A 1VDZA 1N6ZA 2NBWB 4W9DA 1L7YA 2F0EA 4UP8A 4HIOA 3I72A 1PH5A 5DPTA 2B2TA 3KYHC 3QJYA 4L5TA 2K6DB 2FE8A 1ASYA 1GM5A 3HOXG 1QQRA 4ITKA 1D7QA 2K50A 3GTJH 2K8HA 1VRAB 3I4NB 3RNCC 3VVWB 1CKMA 2IL8A 3HG9A 3NVWA 2UUBQ 1Q12A 4X57B 1FO4A 2WXIA 3V05A 2HJ1A 1AZPA 3ZDTA 5A35A 1XO3A 2KWUB 1WXMA 3RNBC 4KSKC 1I5FA 1DOXA 3PUYA 5IYDH 3PO2G 1OXTA 3UDIA 2V4IB 5G5HA 3IBEA 5C44G 1I94Q 1G6ZA 3C3LA 2D3AA 1QCBD 4GDLB 4MGZE 2EELA 3URYA 2F0HA 4K14A 3G48A 3P75A 3CCJA 4A3LG 3S16H 1PV4A 2SAKA 3DPDA 5KNBA 2Z6BA 2JA7B 2Z6KC 4PV1C 3CCVA 2I0QA 1HCZA 1SNOA 2DNFA 4ANVA 4IM2A 3R8BA 1SNMA 1ILPA 4HPLB 4L8JA 2C5CA 2JQOA 4JI8Q 4DV5Q 5IYCH 1RWSA 1K51A 3DVGY 4AQ7A 4JI0L 4IWPA 4R9WA 5JJLA 4C80A 1LTID 1MKHA 2LXJA 3W2DA 2INPE 1F9PA 4UPAA 3HKZE 2R7ZH 4WFN3 2EJFC 1FR3A 2F0TA 4F1SA 1E3PA 1SBBB 2I5HA 4CYEA 5LMUL 3SK6A 5FO9B 1X3QA 3EECA 1SNPA 3L16A 4MZ9A 3KUZA 2MGSA 3A8JE 1PYSB 2MX2A 3G71A 3AU7A 4DXFA 1X55A 3IAS1 2AUKA 4WJQA 3BS1A 1AN8A 4RGNA 2SOBA 1R4NI 4LF5Q 1PTOC 2QCZA 2EJMA 1ONLA 1C1YB 3N1YC 1XEEA 2M17A 3PRPB 2H88B 3UF8A 2PE6B 4A6QA 3AMUA 3HOVH 2F4VL 1TKGA 1XLOA 1Q3LA 2F0NA 1YITA 5EQ0A 3CC2A 4JBMA 1PTOF 2WU5B 3TRZA 2GMIC 1LT3D 1IGCA 3UIOB 4GOPB 1FM0D 4YSXB 2UXCL 3CPWA 2XWBB 1VQAA 1MD2D 5C3EH 2NS5A 2N88A 5JAVA 2EY2A 2D3CA 4OIKA 1V49A 4DQOC 2R61A 2AL3A 4S17A 3ZO5B 3AEDB 1LFDA 2WXPA 3CRKC 3K5OA 3HZXA 2QDFA 3WAOA 5MPOA 4I6PA 3AE1B 1VQKA 5C4XB 1D2BA 1SIJA 5C3WA 4A3KG 1RYJA 1J0GA 1V1OA 2VB2X 3WOEA 3H91A 2YEPF 1K52A 1I4QA 4BXXH 3HIZA 1B44D 2LXKA 3ZQ4A 3OMGA 1S40A 2UXDL 2JYTA 3DBHI 3PIO3 2L1AA 2QIEB 1CM9A 1EUJA 3R7RA 1PFSA 1WCMH 5IGGA 1A3VA 3JAMi 2GI9A 2IO3B 4XX5A 2HT1A 1S1QB 5J1ZA 3U58A 4YWMA 4ZRIA 3T1YL 3PCOB 1U4AA 2KC2A 4LFBQ 4K6DA 5H1SE 3LYYA 1KOTA 3A5UA 2N9KA 1W3SA 2A6EC 2KMCA 2FFKB 1DD2A 1L2NA 2A19A 3P7JA 1I94L 4DAMA 2ICIA 1RTNA 2KQ4X 3R7QA 2CHZA 1VQIA 1WI5A 3H8HA 1N5XA 2WDQB 1O78A 1IP9A 3NVYA 1HQRD 1MJDA 4BXXG 1PA6A 1WJ4A 3W1SA 4PQXA 3ERSX 2B8GA 1J5EL 1NBFC 1FVIA 1HA5A 2MNAA 2LVPA 4GS3A 1JB3A 2AWNA 2ZJQA 3D31A 1GG3A 4JV5Q 2KYWA 1PRTF 4JI0Q 1V43A 3D0FA 4DUYL 1BCPD 3EBEA 3UQBA 3NSWA 1V86A 4USAA 4FO2A 1YX5B 3NTIA 1P9DU 1JCKB 2JYOA 3H7PA 5HG2A 4KMUC 3K7AH 3HOWH 1H9KA 1E6EB 4A3JH 4QUCA 1ZKOA 2XN9C 2E2HH 4HDQA 2UUAQ 4Q0FA 2G3QB 1YIWA 2NVQH 4TVAB 2WYQA 4G0NB 1Y8RC 4A76A 3KQ4A 1PMRA 4BBNC 2ZM6Q 1KH0A 2BVCA 1XJVA 2G1EA 3VYRA 3VUYA 4II2B 2XRQD 2LRWA 4OWTB 1SXTA 1JE5A 5IP4D 3SK5A 2W54A 1A3TA 1MBYA 2C60A 1KNEA 2KMMA 3AE9B 4ZUJA 1XLNA 5L83A 4JI8L 4M8NA 2CQAA 2WINB 4FF3A 4W9KA 4G7HC 1EFID 1EQQA 1AE3A 1OQYA 3CWIA 2H89B 4HROA 2HCCA 2RHSB 1GUOA 3UDFA 2L0TA 4P6VF 1HUNA 1YNJD 2K5PA 2MFIA 4N58A 5AZFA 1QG7A 3KUPA 3DHGC 5D94A 4A8XC 3TBLD 5J3BA 2F0OA 4C3JG 3M7GA 3KDFA 1EZ8A 2IZVB 2GBKA 2LJIA 1X3GA 1DOMA 1EEID 2B2VA 2WIIB 5E7NA 4JV5L 5IGBA 2R2OA 2I2YA 3TDQA 3IT4B 1YD8U 2BT6A 1GHKA 4NDXA 2K25A 4M01A 3ZJUA 4PMWA 5CBAE 1Q7YC 3ZRCA 1UE5A 3PSEB 3OPOA 4DHJD 1PGAA 1HZ5A 1LGRA 1E7UA 2FCMA 3OIQA 2FIFA 1UNSA 2OTLA 5HI1A 4EEWA 1FNVA 1S5DD 2EYPA 3S2AA 4C3JH 2MP2B 3QJZA 2CW0C 2RDGA 3TMEA 4C00A 1U4MA 2D2CC 2JVCA 4G11A 4N8FA 1L0WA 3SU8X 2F0WA 2B63H 2A69D 2EOTA 2RGFA 2HE7A 1IKLA 3RN5A 1N34L 3PF5A 1ZXIA 4G50A 2LFNA 4POGA 4GKJQ 2MJ8A 1N8RC 3M9BA 1VZ8A 3EUB2 2BS2B 1SN8A 1V81A 1B3AA 4IFDG 1WD0A 3TMPB 1WRIA 2KEDA 3KWLA 4JOIC 3Q8FA 4FVMA 2VZAA 4RHRA 4DV2Q 4B6WA 1SSNA 1E9MA 3IFWB 3EA6A 1CI3M 3W5VB 4WJPA 1HR0L 2A6ED 2OEOA 3S1RH 3CCMA 4FNFA 4A3KH 2DN8A 4CKBA 1Y1VG 4Y7NB 1RDPD 4B3ML 3A9KA 3AE8B 4GDKA 3VHTC 1LXDA 4II3B 3PF4A 2FAZA 1P16A 4CJ1B 3S2DB 1OXXK 4DV1Q 4RCOA 4LFBL 4FXCA 2KEEA 4TRDA 1SMYC 2E2JB 5LMNW 2KJ6A 3BIID 3DM1A 4I6LB 2E3TA 3W5UB 1STYA 4NPSA 1RCVD 2F0KA 4A3IH 1EF1A 1K50A 1YOVB 4EZJA 4ZQ3A 4BZAA 4DAYB 2LEKA 2V9HA 3UQAA 1Z47A 2Z6KA 3K5LA 2ZT9C 3D4RA 3R93A 1HXYD 1W6JA 2UXDQ 3AMZA 5I6YA 3VRBB 3MZ5A 3HOWB 1HTLD 3S17B 2JZPA 2R92H 2ALYB 5M3MH 2Q2UA 2MLBA 4FYDA 3GB1A 1PTOD 4XQNA 1SMXA 4RGTA 5KYIA 4ZAIA 3AV8A 5FLXE 3TEXA 2VS1A 3H7PB 1HA6A 1B1ZA 5IT9L 3TJPA 3QG1A 4LF4L 4DR7Q 1AARA 4XIGS 4AWJA 3BINA 4L6TB 3TP5A 2CJNA 1YMHE 3A33B 2OQ0A 4IWOA 1RIPA 1V80A 4IOCA 4IFDJ 2LMCA 2GBRA 4HCEA 4HLEA 2K6AA 4K0KL 4X3TA 4DK1A 3K9OB 4CO7A 1JALA 1V2YA 4MSMB 1NVID 3HFZB 4MH0E 1Q86C 2KECA 3EC8A 1M94A 4JI2Q 1TTNA 1GUWA 1NCVA 1WTRA 2FNJB 1BKBA 2CW0D 3QR8A 2PKOA 4MH8A 4FXGC 1G2SA 5IYDG 3DBHB 3E5SA 2KTFA 1OQRA 2MW5A 1RLFA 4JI5L 1KDAA 2OXPA 1RRBA 1KRHA 1OXSC 1F2ZA 5C5LA 2B63B 3ERQA 1UH6A 1V97A 2G4DB 2EYLA 4NXNL 4C2MB 1LTTD 4GIVA 4JBKA 1AH9A 5AEKB 3MEHA 2REXA 2Z1CA 5M5WH 3HK0A 1V8QA 1H9JA 4ODGA 5CV4A 4ZKCB 4OW0A 3SGIA 1WE7A 3AEVA 3ER0A 5DCNA 3MFYA 4CDCC 3E3XA 4KJNA 1QVGA 2NBVB 2Z0SA 2X6GA 1SFOB 4KKIA 3D4DA 3PUWA 1BCPC 1KNAA 3AYHB 4RGMA 3KBGA 4QIWB 1HH2P 3K80C 4UY8C 1D4BA 3HRZC 5IGCA 3GOEA 2EXDA 3APCA 2K03A 1TWAH 3PRZA 2KNBA 2HDEA 1UGJA 1EU3A 1STAA 4FF1A 3VFKA 3F2BA 1HZBA 1R4NB 2K1BA 1N33Q 5IP9H 1J19A 4V0BA 1Q8IA 2L52A 2VZKB 2H1EA 2PCFB 3S2HH 4KKJA 2MSED 3RMKC 2BGFA 4KN4C 5H8YE 1ZKHA 2DNCA 3Q6SA 3AQQA 1LQBA 1TKWB 2EQSA 2PQAA 3H15A 4X62L 4B95A 4EE2A 1FCCC 2DHZA 3O13A 3ND8A 4FA6A 2KN4A 1H95A 2KVZA 2R3ZA 3GTGB 4XZ4A 4JVZA 3AEEB 2M8SA 2V4DA 5E6PA 3VH4B 4KN7C 1CKOA 1PYWD 3NK9A 3T13A 2KJHB 1SNQA 2D10A 2DYMA 1ACCA 4DK3C 3V6CB 3DBRI 4UP9A 1X6OA 3NENA 1BBUA 2RMMA 3PSIA 4OO1H 1FCLA 1NE3A 3OTOQ 1ZXTA 4A3DB 1JC7A 4P72A 4EKUA 1XLQA 3ZXRA 5FLXc 1A0IA 1JWAD 1OGWA 1GVPA 1UWMA 2C7HA 2W82A 4IKGA 4IN3A 1KL9A 1VQJA 3J7YW 2HHHQ 4BY1H 2RQXA 4NKLA 1TWAB 4K3BA 5FR3A 3D8GA 4BBSB 3K5MA 2C9WB 2WXLA 4LNNA 5ELBA 3FAHA 4DR4L 2WV6D 5CGKA 1X3FA 2DENB 4JL9A 1DYQA 1M8AA 4KV6A 4IOAA 5JOBA 3NG0A 5J2RA 3FEWX 1SFOH 2KK8A 4S0RA 3AE4B 4L63B 5GXGB 5JEAH 2QC8A 1FNUA 3HOUH 1IBKQ 4JI4Q 4DKAC 1FGBD 2WFWA 2B2VC 1EYCA 3F8TA 1Y8NB 3C8YA 5E6OA 1ISNA 1PH2A 4ZDVA 1PZID 1VCBA 4B3SL 4MN3A 4A9AA 4PZ6A 5BMGA 2LVOA 1IL2A 3WDNA 5ELOA 4RHSA 1GPXA 3ZNHB 4HSPA 4XQQA 2G5DA 3EQLC 5M5XH 1TVXA 5K36G 1M1KC 4A93H 1EO6A 4LTUA 3DBSA 1WTXA 4G57A 2RBMA 1H4RA 4JOIA 2BB5A 4GNXB 5C44B 2QJLA 1EYDA 5D7GA 1DGJA 2LRUA 3UI2A 4ANXA 1PXUA 4WURA 2G4SA 2MBQA 4MTKA 4LJPB 3E56A 3LJ3A 1B9RA 3CRLC 2KLGA 5FR6A 3ZXVA 3RUIB 2M2LA 2IY5B 1A2TA 1AP0A 1LV9A 4NXNQ 2D2QA 4IM3A 4P75A 2E2IH 3OOCA 4XQJA 1YQ4B 5BYQA 1IYFA 1YNNC 2J42A 3NRZA 1PZKD 3Q69A 3A7AB 1GNUA 3RZWC 2DGYA 3W1GA 3QA8A 3I4MH 5JHBA 3A8KE 4DUZL 1RJTA 1EYAA 3TP6A 3OW2A 4PYZA 3J7AF 5DPWA 3MWYW 4CKEA 1TKYA 3W1BA 4UAIA 1Z7TA 5DEHA 2WP9B 1EWHA 3J80i 4IURA 1C9OA 5AJ3Q 4BWGB 2OJWA 1VQFA 4RKBA 2K6QA 2D62A 1G2TA 4BKGA 2PW5A 4ZYNA 3ICEA 5CHVC 2J4XA 1GXDC 2JA6B 1TIFA 4B9KA 1VMPA 4JBJA 1JJ2A 2X38A 3AH7A 2DZJA 3EFCA 1HFNA 2L83A 4QQBX 5AUKA 1TYGB 3HEJA 2V1CC 1XXGA 1HNWQ 4CJ2C 5JXVA 4JW0A 2LMCB 2NTTA 3CU7A 5C3EG 1BOSA 1U0LA 2A73B 3F2UA 1IBML 2UU9Q 2QMTA 2LASA 1SNCA 4IG7B 1ZYRC 3QWZB 3KK7A 3F1ZA 3H9DA 1LM0A 4G7OC 2VH2A 5DM63 3F2CA 5GMVA 1DM0B 4K6LA 4DDGD 1YN5A 3K8AA 1K28A 3RZOB 2HJ8A 4A3OA 4NW2A 3D3RA 3FILA 2M00A 1CT1D 3UIPB 1E1OA 2Z4HA 3UGBB 3HKSA 1XNQQ 4JGHB 3DBRB 4AJWA 5JPMC 2MBBB 1NMGA 2B2UC 2PQEA 4HCSA 3DOWA 2M1MA 4WQOB 1J8IA 4REZA 2W9NA 1HFGA 3MXUA 3PTFC 3BK2A 3OJ3A 4E74A 1QOHA 5ELDA 1BNZA 2EY1A 5C3XA 2J0MA 3PO3H 4QMGA 4JX1C 2L12A 1QE6A 4K8JA 5C4JH 2JSVX 4DV3L 4YTNB 4CKCA 1V9JA 2MBOA 1T9HA 2PZWA 3QCAA 1N34Q 5IT9c 4H7BA 2JQRB 3T51B 2BDNA 1MG8A 3DHIC 5EE1A 4IJLA 4LNOA 1EQVA 3K5NA 3BZDB 5ELEA 1STBA 2UUBL 3N52A 5KHQA 1NMFA 1U4PA 3SHQA 4EQNA 1N36L 1L2FA 1TWCB 2KD0A 2OWOA 2KHWB 1X1MA 1XQQA 4A55A 3P42A 3OW7A 2YU9H 3KUCB 3QIAA 4LNIA 3TBIB 4A3FG 2D0OA 3RLFA 3N20C 2MH7A 2BA0A 3PRMB 2JRIB 1JQ4A 2B8FA 3E6ZX 4W9CA 1E7PB 3SHLA 4HJ5A 1DONA 3F2DA 5KYLA 4A3JG 4ZLTF 3HS0C 1WXSA 3NOBA 3RULA 1G6JA 3S1MB 4YSYB 1CQFA 4JWSC 2PNRC 1YJJA 2EVBA 4J6IA 3HOUG 4LUZA 1VD2A 5CV7A 4LFAQ 2VXWA 5IOCA 5C0XG 3GTMH 3RPFC 3GTOH 1EWYC 1PZJD 1X65A 2XRSD 4KHZA 1WTQA 4MSQB 1WGYA 2IHFA 2WAQB 1J9OA 3L9AX 3NWTA 4ZRZA 5ISRA 3HKZB 4C3IH 1Q82C 1IPGA 2LS01 2M19A 1X56A 4YWLA 3H3VH 2QKIC 4J15A 3JW0X 3I7FA 4JWUC 5LLIA 3PV1A 5I9OA 4A3DH 4A93G 1XT9B 3DCGA 4JK1C 4RWSC 3TIXA 3TSSA 5JJIA 1DXMA 1ZGUB 3DQVA 5AZHA 1F77A 4ZHOA 4CGYB 4F8MA 2ZM6L 4AIMA 3J7A5 4OVZA 1Q46A 2EYOA 1MSHA 4JPSA 3RNGC 4ARCA 4DV3Q 3ZVVA 4B3RQ 2D5GA 2KOXA 5CV9A 4KDLB 4H13C 4I65A 2B76B 4DHJB 2MHJA 3ZGZA 2NN6G 2RCFA 3HOYG 3MC9A 1GUSA 4DUYQ 3KWVA 4LFCL 1CA5A 1BUVT 3HOZH 1NENB 4MDKE 5T8IA 2HD5B 4PMBA 3D6WA 3NXWA 4W9HA 4NQLB 4NY0A 4MJSA 1O7YA 3ULJA 4BY1B 2EDGA 1S3OA 2CH4A 2NB0A 4M1UB 4AYBG 4JI5Q 3IRBA 3RN2A 1NDDA 2KDIA 4A3LH 1J8CA 1L0XB 2VQFL 4MEMA 4F8CB 2CH4W 1B4OA 3CCRA 2BB6A 2LJ5A 5CYUA 4DPGA 3GTLB 2Z59B 2F0DA 3A5ZB 2QILA 4KK7A 1SB3C 1WXQA 2ZJDA 3U30A 3J81i 3Q22A 2M0AA 2XEWA 3R66C 3ZDMC 1EIYB 2WXRA 5C23A 1SLJA 2FUHB 3PGEA 4FJYA 1X3PA 3DUZA 4LK1C 1F1HA 1SDFA 2ZTDA 4H02A 4BOZB 1LTGD 2B39A 2WACA 4OELB 4GB9A 5AFWA 3U4ZA 1V9PA 4C3HH 1C0AA 5M3MB 3SE0A 3PZ8A 3BY4B 3GO5A 5CR3A 4DR3L 3KYDD 2XTIA 2Y0SB 3CSFA 2KDMA 2K52A 1GC7A 4L5QA 2Q2TA 2BBCA 4ZHPA 5ELCA 3PIP3 1E90A 3ZJYC 4A3GH 2AWOA 2YEPB 1STHA 4FDBA 4K7UA 5HKHA 5IGFA 5C4HA 2ES2A 1SSOA 5G55A 4R3DA 2DWQA 5EDSA 4XDDA 1FD6A 2CQOA 3WOFA 1VQCA 2B2WC 2L1BA 1OXUA 4J6HA 3N1XC 2BKFA 1CZGA 4R8NA 4FN2A 3L4PA 1B9MA 2FCQA 3HHMA 1QVCA 1TWCH 4X66L 2MP2A 1QVFA 3RFZB 2EMTA 4ZUIA 2HIXA 3GQBA 4DV7L 1UGMA 4GLVB 4PK1A 1GOZA 3APDA 3ULPA 3N32A 3VYTA 3WWVA 2N7EA 4AP4C 3MAQA 3STBD 3DEOA 2PI2A 3K0YA 2VQFQ 1KF6B 1D1IA 1SJED 1YNXA 2E75C 1OFFA 1YN3A 4GDLA 2KO3A 1RHPA 4IPHA 2KFJA 2J53A 2GN5A 1E2VA 1WGHA 4OO1I 3PVLA 3KF8B 3MA2B 1YJ9A 5M5WB 1BCPF 3FKIB 3BZCA 4NP5A 2A68C 3KLRA 4OX9Q 2DJFC 1YI2A 4AYBE 1RM6C 2D11A 4DR5L 4KI0A 1JB7A 3O65B 2F0MA 2IWHA 1WX9A 3L10B 3Q0AA 3DEPA 5BN4A 2C7NB 3G6JB 3ONSA 1PH7A 2N8NA 1SF0A 3PLUA 1II3A 2L5TA 2JK8A 3SDZA 3RLNA 1PUTA 2RPVA 1DOLA 3N3KB 1R4MB 4KVGB 3A74A 2JA6G 2J0JA 1A63A 4C56C 2KACA 1PVOA 2CR5A 1Z9FA 2PVOD 1V8CA 3S16B 3CMAA 4FHJA 4DNIA 4Q2JA 1Z6HA 3H09A 2IX1A 4C1NI 1MI0A 3M62B 4WORA 4JIOU 3PT2B 4KIKA 3SFDB 3I55A 5BYSA 4LNFA 5IP7H 3FPPA 1ZDVA 4TSSA 2YU9B 1NSNS 4RMAA 2ZNVC 2GVAA 4HN7A 1WJ6A 4C7ZA 1LLRD 2I1JA 4BBRB 2K75A 3I8ZA 1Q10A 2N3SA 3U2SC 4JI6L 4JYAL 5HHDG 5BR8L 1LTLA 2Y5CA 5DLQE 4HCNB 1JRUA 1OEYJ 1VQBA 2ZW0A 3AEFB 4RFBA 4E6IA 1A6XA 3TREA 4JQWC 3I4LA 4XYQA 1SE9A 1WTPA 2O2VB 2D07B 2E76C 2KCNA 4NXMQ 1H9SB 2L11A 4P16A 1T6BX 3A8IE 3GTMB 4AOFA 2PW9A 2DY8A 3MTNB 2QHOA 4FJVB 2JA5G 5AUIA 2MO0A 3SK8A 4TKOB 4GXBA 4M0WA 4QCLA 1NYQA 1KTKA 2MJEA 4MM3B 2J7ZA 4HIMA 4A75A 2AQ1B 1Q8KA 1I4PA 1E5WA 4LFAL 4A3CG 1U4RA 4NQKE 5J18A 1STGA 2E8GA 4JI2L 1H9MA 4BY7G 1AEXA 2K33A 2KJXA 2NVYH 3M4YA 3R2IA 4U68A 3N30A 3ZW3A 1BQQT 1EQTA 1SAPA 5C5MA 2R7ZG 1FMAD 2KDFB 1JWBD 3B2FA 4GNXC 4W9IA 4DR2Q 5KIXA 1FXAA 1KRSA 1PH3A 5EJWA 1Y1WB 1GAQB 4PMCA 3STBC 3SD5A 3VYSA 2BWFA 4LF5L 5C1ZA 2JU6X 3AE5B 3EFUA 2B2YA 2K7VA 2KUMA 4ILWA 3CCEA 1Y69U 1EL0A 2QW7A 1N60A 3PO0A 4ME5A 4IPCA 4JPBW 3SR6A 4EUTA 3ONAB 3CIRB 2ZXRA 1Z2MA 2KQSA 3DWQA 2WXQA 1FRRA 2C7MB 1C4CA 1QZGA 1ZXHA 3OMCA 2A74C 4O1NA 3J81c 1PH9A 1WF9A 1F9JA 1JR0D 4LF6L 3VR6A 4LDTD 1A8VA 2OF1A 4OONA 3HVDA 2OHFA 4IUUA 4YXDB 2O5JC 1TBEA 4GKJL 2DZKA 3LXFA 1L4DB 2AWTA 3DVGX 1HNXL 4A90A 3UDGA 3KW5B 1UWXA 2GB1A 1X54A 3P4SB 3V3XA 1HTQA 1T0SC 3AEBB 2L3ZA 3P4QB 3M7NA 4KGRA 2KHSA 2ZVOA 3ENEA 1LYLA 1C76A 1TS5A 1K8RB 4KY6A 5C0XJ 1TXYA 3CPFA 5K5PA 5BN3A 3H3VC 3CD6A 2XSCA 3PZDA 2DUDA 3WALA 4X64L 3GV6A 4BBSG 4JLCA 2GBJA 4TKNA 1B8AA 3U7DA 1EYGA 4KD3A 1CJEA 1RD9D 1N36Q 5M5YB 2X69A 4MM3A 1I50H 1GO3E 4LF7L 2BYEA 1IXRA 2K04A 3CF5A 4GU2A 3MFGA 2IX3A 2CKZB 4JC0A 3AE7B 1LTAD 2QA4A 3IFTA 3I5JC 3PPAA 2HIVA 2TMPA 3PO3B 3KLSA 3KUDB 2KT7A 1L1OB 2PTLA 3BDLA 3GZNB 1E0ZA 2WQYB 2ASBA 3KH0A 2LVQA 2KVMA 1HNWL 1B3QA 3E0JA 3JAME 3S15B 4IUQA 1HE8A 2PE9A 3X3NA 1EIHA 3AECB 1B53A 3J81j 3SK4A 1FJGL 1ET6A 1WYGA 2RSUA 2J7QB 1KDCA 1E24A 5GAGC 3S9WA 2K1FA 2JXTA 4CDEC 3IAM1 3HOZB 5DNFA 4X65L 5KNCA 3MHZA 3J80c 1TS3A 2JZZA 4GOCA 4IUMB 2J0TD 2F0UA 3LNNA 1QLBB 4TQ0A 4LCDE 4DR1L 1VQDA 2GBMA 4JI1Q 4TQUS 2UXBL 2QF7A 2LUEA 4RMFA 1SNDA 1HZ9A 3IG3A 3Q3NC 4ICUA 3GD7A 3HGBA 5LL6S 1CSPA 4AQYL 4AJYB 1VQ5A 3MXPA 3JSVB 1KLUD 4K5VA 2PLPA 4WJ4A 4N8X1 4PS7A 1FD7D 2DBYA 3VTWA 1E1TA 4RH6A 1VQ7A 4B0EA 4R4QA 4A3FH 4BA2I 1HHVA 2GRIA 3Q3JA 4G3XB 2ZXPA 3S1RB 1TZOA 1B50A 1SE4A 5FOBB 4P1BC 2Y5BB 2L55A 2B3GA 1C78A 1UEAB 5E3FA 4C1NK 1V1QA 1EY9A 3OWEB 5G3LF 3UE1A 2BWES 1TWFH 2JXXA 4KGTA 2ZEQA 5D3DA 2N7JA 2R92B 2GVBA 1WMHA 1O7ZA 1EF5A 4UP7A 3HOXH 3BK1A 3K58A 3LX0A 4HPMB 3GE8C 4K8IA 1V1PB 5M5YH 1WCMB 1TWHH 2PPHA 1IW7D 2NBFA 3ZTDA 3KLSX 2ZNVB 2DAJA 4PS8A 2K22A 2F0SA 1QZHA 1PH8A 4W9FA 2EY5A 4XXEA 2HD3A 2A68D 1VQOA 1HJPA 2F0JA 2IBIB 1ZYRD 1E7ZA 2UWQA 2WX1A 2M9VA 5HY6A 4M8MA 3GTKB 1R4QB 4K2LA 3V96A 3GDEA 2WXMA 4E3CA 3FHWA 2Z8LA 5I9PA 3S15H 1N32Q 1C79A 2N9XA 3J80E 2PMVA 3W5OA 1WTHA 1PH6A 2KXJA 3IVFA 2RA4A 1WD1A 2YTXA 1TT5B 4XYCA 4OL7A 5C0XI 2A5UA 3MTSA 5IYCG 4X3KA 1JE4A 3GTOB 3SDLC 1F9QA 2JY6A 2BDOA 1I3QB 3T3OA 4DWFA 4A3EH 5E6NA 4DR2L 1LABA 2RHQB 1BXTA 1AYFA 2E6XA 2HTME 3MP9A 1P8LA 2L15A 2E2DC 1J7AA 3L17A 1XNRL 1S5CD 2MJDA 1NR4A 4EZLA 4C3HB 5IWAL 2DYBA 3ZNGC 5KHOA 3GTQB 2A5HA 1YJIA 5GADC 4LW1A 1F2LA 4KGSA 1HUMA 3VR3A 1F2RI 4I7ZC 1Q1BA 2W3SA 3Q3OC 3V6EB 3KJOA 1FRDA 1NEKB 1ZUD2 3IKJA 1WRDB 1BO0A 2NN6I 4C3IB 1K8OA 1QZEA 5EE3A 4F7ZA 2YV5A 3I91A 2HUGA 3A55A 1E2WA 2AL6A 2GOWA 4IFDI 3P4PB 4J1MA 3AB5A 1M4VA 1LT6D 1TWFB 2JT4B 2XK5A 2K0PA 2L7RA 2CCZA 2LXAA 2VQEQ 4A3JB 3KF6A 1VS0A 4HJ8A 3M85A 2JWUA 3L54A 3U52E 5FLXL 1YJNA 2H4OA 4A3MH 3MJWA 1UBQA 4R4IA 5CHFA 1YHBA 3T53B 4LAAA 1G51A 2RD0A 2D5DA 3HKZG 1DGSA 2Z0EB 1WTOA 4HWIB 1IBMQ 2KTRA 3T4AC 4LLGM 4ZRKA 2QEXA 2JA7G 1E8WA 4KLKA 4KHPL 2RDFA 4N6EB 2F0PA 3CW2C 2N1VA 1NTGA 2Q2HA 4A93B 1YVCA 3RZOH 1CUKA 3T56B 4P2CB 2IX0A 4JI6Q 2KX3A 4DR6L 3P63A 2KN5A 4WRDA 1EY8A 1IKMA 3EGRA 1G6PA 1XNQL 4Y52H 3H0GG 3NUCA 3AM9A 1H9RA 3T9LA 1CTMA 2R7ZB 1TWHB 1T0YA 2JA8B 2MQJA 4JE3B 4X3UA 4XT1B 2B2YC 3VH3B 3J81L 1KLVA 2BPSA 3CAMA 1XMQL 1KDBA 2BE5C 3HOYB 4CDFC 1FIQA 4DAYA 3HM3A 4KD4A 4YY3Q 5JPNC 4US9A 4MNOA 4K2KA 5GQOA 4KZ0A 1NBWA 1EY7A 2XIWA 1TKEA 5IOIA 1RKNA 1LACA 2GA4B 4F7XA 1L0VB 1WGGA 2EKIA 5LNK1 2ZPYA 4LF9Q 2YYZA 4W9EA 3PIOA 1ENCA 2RPQA 3WAPA 4AYBB 5FJ8H 3A54A 3CCSA 3S1NB 4XDXA 4R1JA 3H7SA 2AUJD 2IPKD 2WXKA 2V3NA 3CMMB 1FFVA 3DBLI 1WMHB 4WWOA 1CA6A 4RF1A 1JWSD 3M95A 4EQ5A 1FXIA 2KDEB 1XD3B 2ZW1A 3C46A 1WR6E 4RAUC 3TS2A 4K5WA 2JA5H 1N62A 1A5RA 4KHPQ 3L0WB 4JBWA 2B29A 2FMCA 2J0KA 3VR4A 3NZUA 4GLAC 3PUVA 1K8GA 1DCZA 4OGQC 5IT9E 2E2JH 2UU9L 4DUZQ 1WXAA 1I7HA 1EM7A 4PNYA 3Q14C 4N59A 2K5HA 1PFMA 4CHTB 3EFXD 3PIPA 3NZ3A 4BKTA 4DK5A 3QK0A 4RCNA 3AULA 3ECIA 1C8CA 2MJ3A 4DR3Q 4A3KB 4K1RB 1U4LA 1S5ED 2NCNA 2Y5PA 3WANA 1NJIC 1RODA 2YTYA 2KWCA 3L08A 2BYTA 4FADA 2QDLA 4ZCKA 3WAMA 4RGOS 3GTQH 1A15A 1FJGQ 4K0KQ 4B0MA 1B9NA 3LWUA 4P71A 3Q6BA 4YCVA 2JA8H 2NBUA 1K83H 1O7IA 3BG3A 3RNUA 1KLGD 3W1SC 5E1FA 4LJOB 2NPTB 2JP1A 2IT1A 1ET9A 2NZOA 1K8AC 3OIPA 5GROA 5C3JB 3TEYA 3EIVA 1RAXA 1PTOH 3OWFA 1WZ0A 2DY7A 1D1KA 1JOOA 2KBNA 4P74A 5HGTA 3Q23A 1HRJA 4YCWA 1DOYA 2OOBB 3M3YH 1SRUA 3EN2A 2AEHA 5CC4A 1QOGA 2EMSA 4X64Q 5IKCM 4EQOA 4DV0L 5A2QL 2EYJA 2BH2A 1XMOQ 1WGKA 1VQ4A 1JOQA 1QOFA 4TQ1A 2IO2B 4L1BA 1Y8PB 3ZLZA 2B63G 2FCSA 3I3CA 3Q8BA 2WXJA 2NWGA 1XPUA 1PRTC 2EYFA 1KIXA 2VRRB 1HNXQ 2WDVB 2KDBA 4PZ8A 1F2YA 1BCPB 2IGHA 5AJ3L 1F0ZA 1N32L 1N61A 2BOSA 4A3EB 3AE6B 2WB1B 1WJNA 4D2KA 4EOYA 1BBWA 3CQZH 3KLWA 1WFQA 4KSLC 5EE9A 3FRPB 1HR0Q 4DV4L 2NVUI 1MHXA 4ID6A 4JCVE 3H3VI 4RF0A 1IBKL 3WA0A 4BBNF 3EROA 2J52A 5HGQA 1Y1WH 2WXOA 4QF4A 3JYUA 1Y1VH 4HAEA 3M4OH 1T5EA 3FVQA 5I2XA 1ASZA 3QB3A 2JA7H 3OSOA 1Y14B 4HKZE 2IY1B 5LL6X 1G91A 1PDQA 4DNRB 1N63A 4C3JB 2XWJB 4YHHL 2IJ0A 2JSOA 2YVCA 3GE3C 4NNJB 1QF6A 4K3CA 1PTOB 2K5NA 5ELFA 2C35B 2V0GA 2F0FA 1HTOA 3GZNI 3PMFA 2KX0A 4IUVA 4GGQA 3CP0A 2WP8J 1BDOA 1VZ7A 2C9OA 5LHY1 3VR2A 2BS4B 2K8BA 3AXCA 4JI3L 4NAWB 2JEBI 4K81A 4AS1A 2BH8A 3C1EA 4GN5A 2PQAB 1ZEQX 3LDZE 3PO2B 4WJOA 1PH4A 1EU4A 2ENBA 1XTCD 3TEHB 4TUUA 2UUCQ 2IY0B 2MBHA 1C48A 3B2GA 1IBXB 1AWDA 2IO1B 1WIAA 1GUTA 3BYTB 1FPYA 3M3YB 4MIUA 5JVG3 2AQ3B 4G7ZC 4LUVA 2E5LL 3VDYA 2O2LD 2F0IA 1YHAA 2F0QA 1SYBA 2MWSB 4I6NB 1JJCB 4RM8A 1VCIA 1I3QH 4DNTB 2ZVNA 2A1AA 4PG3A 1AZQA 2K5VA 3M63B 1XF5L 1F9SA 5JVH3 4V190 5BR8Q 3QOJA 3CQZB 1PHJA 2WXHA 1QILA 4QB4A 1ICFB 2K32A 3P2BA 2IYDB 3RLOA 2QDBA 1SIFA 5EKIA 3CCQA 4QJFA 4ZYSA 3S1QB 5LXHA 1VQLA 3VUWA 5JEAJ 1XNRQ 1JWUD 1M90C 5K36H 2ZCCA 1T5XD 3M4QA 1QKZA 2L4NA 4KJOA 3VA5A 2I07B 1KFYB 3D4WA 1Y1VB 1TY0A 3M4OB 2DLBA 2INCC 1JQYD 5IA7A 3M4PA 2OQKA 4FF4A 5CV5A 2CHWA 4WJNA 4DGZA 2FUG1 4FBJB 1GUGA 3C1FA 5I2YA 5LMNL 2O6VA 3I3TB 1FGUA 5LXIB 1SMYD 4R4TA 2AHOB 3R3OA 2ONQA 4DHZE 1YNND 1D5XC 1QNUA 5D3IB 1XPOA 3J81E 4L5SA 3H1UA 3HOVG 4OZCA 1WTWA 4HK2A 3HOWG 2IW3A 2I46A 5COYA 3U50C 2AKWB 2JXMB 2O5IC 4US8A 5GAHC 3PO2H 3AN1A 5IY0A 3TP8A 4HDOA 3UE0A 3P4RB 1LM8B 2Z4IA 4KKUA 1N33L 4NJ6A 1J7CA 3NBHB 4B08A 3J7ZC 4QAYA 2IGGA 4WJWA 2ZCBA 1MFWA 2FIDA 2LGDA 2L9HA 1YEZA 5HURA 3K59A 3ZRFA 2HTHA 2MQHA 4AUQC 1I42A 2VY3A 3BZKA 3ZIMA 1JRPA 2R7FA 2SEBD 3HP3A 3A9KB 1TU2B 5BMHA 4FULA 2Q2IA 5G2NA 3ZKJC 4OIJA 4Q5VA 1N5WA 5JJKA 1D6EC 1I4XA 1C7YA 3I2ZA 3RZDB 1YIJA 2R93B 1UBIA 2K39A 2KLCA 2WX0A 2WXNA 3X3MA 4BS9A 4DHZB 1WFYA 2FHTA 1B7YB 2HQEA 3E9SA 4DU9A 2F3IA 2NVQB 4HPPA 5CX3A 3QQ8B 5IO9A 3AI5A 4A4IA 2EXZA 2WDTB 1WM3A 2LHDA 4HKQA 3K0XA 3AFPA 2NVTB 3DM3A 3C19A 1IBLL 1JICA 5GAEC 1VF7A 1R4MI 4HJGE 1JMCA 5L95C 1TJEA 4BBSH 1V5OA 4GMVA 1ML0D 4WWPA 3KF8A 3I70A 3CMEA 4YCUA 2AYOB 5L37A 2Y0SE 1HZ6A 1IYVA 4M00A 5M3FH 5M5XB 2V3SA 2Q8IB 3W3AA 1MJCA 4WJ3M 1GKHA 5J22A 5JH5C 4BVUC 1WVLA 2QCPX 3EHVA 4IDIA 4ICVA 4BBRH 3PREA 1QUQA 4DR4Q 3VR5A 2MCNB 2BTEA 2R2QA 2NR2A 3N1ZC 3QHTA 4DDID 1GB4A 1UEBA 1NAPA 2BE5D 4A3BB 4B3TQ 4HRSA 1NY4A 1OO9B 4O2DA 4PZ7A 4PT5A 4RA8A 4BAXA 3RI7C 2EPBA 2N78A 2FMMA 1WE6A 5T1GA 2MBEA 1EZ6A 1TT2A 2R92G 4O42A 1CKNB 3K7UC 2KZRA 1C4PA 2M56B 2N9PC 4HVBA 1SE3A 4GSWA 1WCMG 4Z9CB 3KOJA 1UUPA 1MIUA 4DF7A 1NUCA 2XGTA 1IW7C 3NE5B 1OEYA 4XE0A 4HXDA 2DJGC 2INDC 1ICWA 2M4NA 1ILQA 3P1MA 3G7LA 4NXML 3S1QH 1XCTL 4HJKA 4ASWC 4XT3B 4IUTA 1HZAA 2ZTEA 1LTRD 4B9XA 2RCNA 1J6QA 2E74C 3OTOL 2I5MX 1BBXC 1IZ6A 1CK1A 4B3RL 3A7LA 4CDDC 1WX8A 4L23A 5G5GA 4HR7B 1I35A 4OEMB 5KEEA 4YHHQ 3PHWB 1PLFA 1TWGB 2C5LC 3V62A 1CHPD 2OT2A 4HSVA 3CXCA 1BF4A 4B3SQ 5EE0A 3ALBA 1OXVA 4GOPA 4W9JA 5E6JA 4BY7H 3OJ4B 4ABNA 2K4KA 2MHVA 4O0AA 5IYBG 3B08A 2NZ1D 4W9LA 3KBXA 1J7BA 2KWVB 2WB1G 4P7IA 3FMCA 3I4MG 3OLMD 2WKDA 5FK9C 3T3NA 4CQNA 2VUMB 3AEGB 1BT0A 2KQ7A 3FC4A 1ESFA 3A4RA 2BQQA 1EQRA 1WJUA 4X6AH 3L13A 2Q5WD 1SYDA 1WXVA 3TS0A 2LZ6A 1LUZA 2QSDA 3G4SA 1KQSA 2V1YA 2DZMA 2XBBC 4NJ7A 4XTCS 4HTHA 2BYFA 1UWVA 1A2UA 1NI2A 1YZ6A 5G3LD 2JWZA 3CKIB 4PYUA 5CBEE 2LGSA 4M0WB 4IUPA 3NHHA 5EBCA 2NMQA 2Z0DB 5CHWA 5C2TB 1VQ9A 3BDOA 4MELA 2F1MA 2WKCA 1PFDA 2JRHA 4M02A 4ARIA 1PGXA 2PMZB 3RZDH 2KOLA 2R93H 5C6AA 1E0BA 4QIWE 2PYKA 5BYRA 2EJGC 1SGHA 3K6OA 5EBDA 3EVQA 4LFCQ 1Y8OB 4DV4Q 4OZBA 3BU2A 4ME3A 1K8MA 3I57A 1K9MC 4JI7Q 2JZ3B 2PI2E 3ZTCA 2LKVA 4N9F4 2CFMA 2ZJPA 1XTDA 2RKSA 1NI3A 2WB1E 1I6VC 3NQIA 2L05A 1HQMC 1K53A 1CQVA 3U8ZA 5EKKA 2HHHL 1YJ1A 2LI5A 3J9CA 3K9PB 4DV0Q 1EY0A 3B0AA 1K3BC 4X66Q 1CSQA 3AE2B 2DNEA 5C0XH 1Q5WB 4X3SA 4A3IG 3A4SC 4YTPB 4XDCA 1IYUA 3NS1A 1K83B 3ZNID 3MVVA 4YT0B 2I1KA 1E8XA 2VL6A 4EQPA 3D32A 3VTUA 2NYZD 3H6NA 3RN9C 4C7YA 5FO8B 2NTSA 1ROEA 1OTCA 2G9HD 1UE6A 4A3BH 3FILB 3I73A 3VA7A 1UE1A 2K5DA 4P1CC 1L4ZB 3QO2A 2D3BA 3B1LX 3DMUA 3K7AB 4YY3L 1YNJC 3GTKH 3TZUA 1YQ3B 1KAWA 3DBLB 2W55A 4A3MG 3RMHA 4DK6C 3S14H 3TL5A 5IP9G 1VDVA 3E9HA 3KDFB 2L8JA 2K05A 2PW7A 2L32A 1O80A 1JWMD 1XLPA 2AX5A 2K28A 3RZFA 2O2VA 3NELA 3NHEB 3V2TA 2SNMA 2KENA 1STEA 4X65Q 2CKHB 2K8CA 3MC8A 1I50B 4PS3A 4HIKA 1KABA 1GHJA 1EWCA 1EY5A 2Z9HA 1TS4A 2EY6A 4QUFA 3AEAB 1A62A 3PQIA 2ID0A 1SYCA 4LF9L 1IUEA 5JEAG 2CU1A 2BF8B 1PH1A 2JF5A 4WWNA 1DOIA 3VRAB 2N4FA 2JPHA 3MC0B 1R7SA 1KAAA 2X6LA 4HMIA 1ZP0B 3ZJVA 1B70B 5T1IA 4HJAA 2WHIA 2DX5B 2PEAA 2HDLA 3MHSD 4NB3A 3A56A 3S2HB 2V4LA 5EGTA 4R8IA 1HNZL 4LF7Q 4IW0A 3BDCA 4YSZB 1KXLA 1MHHE 2KFKB 4K7WA 4DV5L 2EZVA 1VQMA 3PUZA 2MO1A 1IHZA 1RFKA 3NUHB 2CHBD 2IGDA 2F03A 3E0EA 2LWPA 2CWPA 4OHJA 4C4VB 2MUYA 1RF2D 2K3UA 3I63C 3WIMA 1Q1OA 3Q8EA 1XWEA 5CMDA 3DHHC 5IODA 4IJHA 2M0XA 2F3WA 1JROA 1TZ1A 3L7ZC 3NZSA 3BJUA 2UU7A 1YQBA 4OXPA 1QWYA 4A3GB 1ZDXA 4ANUA 5JJZA 4BOSC 1U5KA 3GTGH 1KJTA 3PHXB 1AFPA 3T16A 1WY8A 3JSVA 4GDKB 5IAAC 3GV3A 3HVZA 4AQYQ 2WAQE 1VQNA 3W9CB 4OWWB 4HEDA 3NPPA 1C4AA 5C44H 4DN4M 3R3MA 1K3RA 3VQIA 1YBYA 4A3FB 1PQSA 2NPTA 3KYCD 1ZE3D 3SEBA 3ETRA 1DJRD 1KRTA 3S14B 1XMQQ 2D9UA 2I5LX 3PUXA 3A1QA 3PS6A 2KMAA 2MEKA 5M3FB 3ML9A 5I6WA 1R9TB 1VR9A 1P0RA 5LMNQ 2FINB 2N9EB 3BVMA 3RD4A 4HJ7A 1WOCA 1A70A 3HOXB 2RDBC 3HOUB 2KANA 4NZLB 2MP1A 1NNXA
chains in the Genus database with same CATH topology
1PRTB 3EJIA 4KKTA 3NQTA 4KX6B 1JMLA 2RDHA 2A6HC 3IT6B 1VJKA 4RNAA 1STNA 1XCQL 2RVLA 3U9SA 1OQQA 3JAML 2LHEA 1TR5A 1BUIC 1ENFA 1T3QA 2NVXB 3TP7A 1AW7A 4LK0M 2EYMA 1C4QA 2INNE 1B2TA 1EOTA 4MHEA 4IFDH 4KY7A 2BS3B 4F87A 5FO7B 3SVMA 4ZRQA 5H92C 2E2HB 3K57A 3NTKA 1QNKA 2E2IB 5BMIA 2RSOA 5D14A 2KA7A 4H2AA 3UI3A 3P1HA 1CFMA 2L0CA 3ZJTA 1V1PA 1FEHA 1HPCA 1ESRA 1F2MA 5TSSA 1TQOA 1JORA 1MGSA 2PVGC 2K5QA 1P7EA 4YIJA 3RUZA 2WXGA 2A69C 1G291 2N0SB 2N55A 3SXHA 5F2DA 4KY5A 1IGDA 1TS2A 3D6CA 1HTPA 5C4ZA 5IGEA 2FJ2A 1DOKA 2LUMA 1BR9A 2NVYB 3AB9A 5NUCA 3DXJC 4KKSA 2WS3B 1FNWA 1WTVA 5I4DA 1IBXA 1SEBD 2WNMA 1R4PB 2Y3AA 1I6HB 2B2WA 4XWWA 1QT9A 4RKLA 5C3EB 2HCIA 5E4XA 2PZUA 2ZXOA 3I9V1 1PDXA 5CV8A 2Q8TA 4DK0A 4KHVA 1ZOYB 3B9JA 3PV0A 3HOVB 2K9XA 2AQ2B 4HEA1 3ITPA 4NAMA 2LY7A 3TN2A 2PO4A 1GJXA 1QOBA 2A6HD 1S5BD 5IIFA 3Q24A 2WDRB 3Q8AA 1GB1A 3MXNA 5CV6A 3Q8CA 5DAUA 2SDFA 3BYYB 3DWGC 1F9RA 4FF2A 1O7LA 1EY4A 2W3RA 3NVZA 2WU2B 5KGUA 3U9OA 4WAFA 3VR9B 1IL8A 3HUIA 2RSNA 3DHQA 5EKLA 2CU3A 2OEDA 1JOKA 2CJOA 4KTAA 4CBVA 3I90A 4H44C 1SE2A 1HEZE 3TUOA 4H0LC 4U673 1BMLC 1I4GA 4J3OD 3J80L 2PIAA 3J7AV 3R2TA 2V3PA 2I38A 1LT4D 3L3OC 3QWNA 4IQZA 1MI2A 4MACA 1GUNA 5IGDA 2KQ3A 2JX5A 2WXFA 3NTHA 1TY2A 3MJ5A 2Q8RE 1FFUA 4WWMA 1L6UA 5EPLA 3GS2A 2N9LA 2JA5B 1CZPA 3U4EG 3TEZA 2BA1A 1EEFD 1VLBA 3HRDD 2CVRA 3MXGA 1Q1EA 2F3VA 4ZRPA 5BN5A 4YWGG 1D5MC 1SJHD 3PZ7A 2LFIA 3NWSA 2PPBC 4OO1G 2TSSA 1S4ZA 2B2TC 5E4WC 4EVOA 4DAPA 2F4IA 2HDMA 3BVGA 4DFAA 4G4KA 4WH4A 3N9YC 1E2ZA 2JE6I 1MPEA 4BY7B 2JEAI 1YN4A 2KAJA 3LB8C 2XVSA 2XNAC 4J8QA 2K01A 2NUCA 3SR1A 3C2PA 4MT5A 3VR8B 4IALA 4FXDA 1VF5C 5HFYA 1L5PA 2BW2A 5C4JB 3IL8A 4IUNA 4IZ8A 3IAYA 1P7FA 3I4MB 4GZYC 4HMJA 3NVVA 1D5ZC 2WLBA 2R6GA 2JYEA 1SYFA 4GLSC 1ZPSA 1TIID 4B9WA 1G8ZD 1QB5D 3IFDA 4BA1I 1WWTA 4K5XA 2KCCA 2F0LA 5KNDA 3H0GB 2ON8A 4LMQD 4XYOA 1SYEA 1RTOA 3DWAA 1A3UA 5A2QE 1NYRA 2DYOA 1Y56A 3ABVB 4WQMA 1C9FA 1QJOA 3ZYYX 1ENAA 1W6KA 4DXGA 1UAPA 5KRUA 2VZKD 3QOLA 1C77A 1XYIA 1X32A 1EY6A 2VB3X 3FPUB 4YTMB 4L2YA 1PFBA 4A3IB 2PZTA 4DA2A 1QOAA 2ACZB 1NR2A 3SFEB 3VYUA 4FXKC 3BVZA 1MSGA 2IDYA 1EIGA 4UDUC 1S5FD 3U7ZA 1F2RC 2LGIA 2FBWB 3BWUD 4XWTA 4IOIE 4TMAB 2EYHA 4A3MB 1VZ6A 1LTSD 1CZWA 1SYGA 3TZDA 1YNTE 3WCQA 1LO5D 4M8AA 4ZK9B 5FKAC 4N9TA 4N9PA 5D65A 1JW9D 1PRTD 1WSPA 3NP8A 3GTJB 4DAVA 1PGBA 2F0GA 3LWEA 2EE1A 2BCOA 3GP7A 4EGVA 1PFNA 2SNSA 4S3SA 3AE3B 3P20A 3DWMA 4WIPA 1I4RA 1Q90A 1FYCA 2MPMA 3ND9A 1I4HA 3OHXC 1H9SA 5DM73 4ZOHC 3DWPA 2G9DA 1CHQD 3MHBA 3FDTA 3GTPB 3H94A 5J39A 4ZKBB 2VNUD 3IXSA 3NBHA 4LJZC 2KWDA 5M9OA 3TEWA 3N6RA 4FP5D 1MVKA 1L0YB 1VMCA 2F0VA 1U9RA 1LT5D 1DZ1A 4ULLA 2K5WA 2O4XA 3H6MA 1XX8A 4NMZA 3CHBD 5EPJA 1LTBD 4C3HG 4C3IG 5EPKA 2ICEC 4F88A 2QEJC 3NBIA 4OZAA 2B2UA 5CORA 4CJ0B 1L6VA 2NN6H 1E10A 1VDZA 2F0EA 3I72A 2B2TA 3QJYA 2FE8A 1QQRA 4ITKA 1VRAB 3I4NB 2IL8A 3HG9A 3NVWA 1Q12A 1FO4A 2WXIA 3V05A 1AZPA 5A35A 1XO3A 1DOXA 3PUYA 1OXTA 2V4IB 5G5HA 1G6ZA 4GDLB 3C3LA 1QCBD 2EELA 3URYA 2F0HA 3P75A 4K14A 2SAKA 5KNBA 2JA7B 4PV1C 1HCZA 1SNOA 3R8BA 1SNMA 1ILPA 4L8JA 2C5CA 1RWSA 1K51A 4AQ7A 4R9WA 4C80A 1LTID 3W2DA 2INPE 1F9PA 4WFN3 2EJFC 1FR3A 2F0TA 1SBBB 3SK6A 5FO9B 1X3QA 1SNPA 2MGSA 3A8JE 3AU7A 4DXFA 3IAS1 2AUKA 3BS1A 1AN8A 4RGNA 2SOBA 1PTOC 2EJMA 1ONLA 1XEEA 2H88B 4A6QA 3AMUA 1TKGA 1XLOA 1Q3LA 2F0NA 5EQ0A 1PTOF 2WU5B 1LT3D 1IGCA 4YSXB 1FM0D 2XWBB 1MD2D 2N88A 5JAVA 2EY2A 4OIKA 4DQOC 2R61A 3AEDB 2WXPA 3CRKC 3K5OA 3HZXA 5MPOA 3AE1B 1D2BA 5C4XB 1SIJA 5C3WA 1RYJA 1V1OA 2VB2X 3WOEA 3H91A 2YEPF 1K52A 1I4QA 3ZQ4A 1B44D 3OMGA 2JYTA 3PIO3 2L1AA 2QIEB 1CM9A 5IGGA 1A3VA 2GI9A 5J1ZA 4K6DA 3LYYA 2N9KA 2A6EC 2FFKB 1DD2A 3P7JA 2ICIA 1RTNA 2KQ4X 3H8HA 1N5XA 2WDQB 1O78A 3NVYA 1HQRD 3W1SA 4PQXA 2B8GA 1HA5A 1JB3A 2AWNA 3D31A 1PRTF 1V43A 1BCPD 3NSWA 4USAA 4FO2A 3NTIA 1JCKB 2JYOA 5HG2A 4KMUC 1H9KA 1E6EB 4QUCA 1ZKOA 2XN9C 4Q0FA 3KQ4A 1PMRA 1KH0A 2G1EA 3VYRA 2XRQD 1SXTA 3SK5A 2W54A 1A3TA 1MBYA 2KMMA 1KNEA 3AE9B 4ZUJA 1XLNA 2CQAA 2WINB 4FF3A 4G7HC 1EFID 3CWIA 2H89B 4HROA 2HCCA 1GUOA 4P6VF 1HUNA 1YNJD 2K5PA 4N58A 1QG7A 3KUPA 4A8XC 2F0OA 4C3JG 3M7GA 1EZ8A 2LJIA 1DOMA 1EEID 2B2VA 2WIIB 5IGBA 2I2YA 3TDQA 3IT4B 2BT6A 1GHKA 4NDXA 3ZJUA 4PMWA 5CBAE 3OPOA 1PGAA 1HZ5A 3OIQA 1UNSA 5HI1A 1FNVA 1S5DD 2EYPA 2CW0C 2RDGA 3TMEA 1U4MA 2D2CC 2F0WA 2A69D 2EOTA 1IKLA 1ZXIA 2LFNA 2MJ8A 1VZ8A 3EUB2 2BS2B 1B3AA 4IFDG 1WD0A 1WRIA 2KEDA 3KWLA 3Q8FA 4FVMA 4RHRA 1SSNA 1E9MA 3EA6A 1CI3M 3W5VB 2A6ED 2OEOA 4FNFA 2DN8A 4CKBA 4Y7NB 1RDPD 3AE8B 4CJ1B 3S2DB 1OXXK 4FXCA 4RCOA 2KEEA 4TRDA 1SMYC 2E2JB 3BIID 3DM1A 2E3TA 3W5UB 1STYA 1RCVD 2F0KA 1K50A 4ZQ3A 2LEKA 1Z47A 3K5LA 2ZT9C 3D4RA 3R93A 1HXYD 1W6JA 3AMZA 5I6YA 3VRBB 3MZ5A 3HOWB 1HTLD 3S17B 2JZPA 4FYDA 3GB1A 1PTOD 4XQNA 4RGTA 5KYIA 4ZAIA 3AV8A 5FLXE 3TEXA 1HA6A 1B1ZA 5IT9L 3QG1A 4XIGS 4L6TB 3TP5A 2CJNA 1YMHE 4IFDJ 2LMCA 4HCEA 2K6AA 4X3TA 4DK1A 1JALA 1NVID 2KECA 1GUWA 1NCVA 1WTRA 2CW0D 2PKOA 4MH8A 4FXGC 1G2SA 3E5SA 1OQRA 1KDAA 2OXPA 1KRHA 1OXSC 1F2ZA 5C5LA 2B63B 3ERQA 1V97A 2EYLA 4C2MB 1LTTD 3MEHA 2Z1CA 4OW0A 4ZKCB 1V8QA 1H9JA 4ODGA 5CV4A 3MFYA 4KJNA 2X6GA 1SFOB 4KKIA 3D4DA 3PUWA 1BCPC 1KNAA 4RGMA 3KBGA 4QIWB 1D4BA 3HRZC 5IGCA 2K03A 2HDEA 1UGJA 1EU3A 1STAA 4FF1A 2K1BA 4V0BA 1Q8IA 2L52A 2VZKB 2H1EA 2PCFB 4KKJA 4KN4C 5H8YE 2DNCA 3Q6SA 1TKWB 4EE2A 1FCCC 3O13A 3ND8A 2KN4A 2R3ZA 3GTGB 3AEEB 2V4DA 4KN7C 1PYWD 3NK9A 3T13A 1SNQA 2DYMA 1ACCA 2RMMA 4OO1H 1FCLA 1ZXTA 4A3DB 1JC7A 1XLQA 1JWAD 4IKGA 4NJCA 1UWMA 2W82A 4IN3A 3J7YW 2RQXA 4NKLA 1TWAB 5FR3A 3D8GA 4BBSB 3K5MA 2WXLA 5ELBA 3FAHA 2WV6D 5CGKA 1DYQA 1M8AA 4KV6A 5JOBA 3FEWX 3AE4B 4L63B 5GXGB 5JEAH 1FNUA 1FGBD 2B2VC 1EYCA 3C8YA 1Y8NB 1PZID 4MN3A 4A9AA 5BMGA 3WDNA 4RHSA 1GPXA 4HSPA 4XQQA 3EQLC 5K36G 1TVXA 4LTUA 1WTXA 4G57A 2RBMA 2BB5A 5C44B 2QJLA 1EYDA 5D7GA 1DGJA 3UI2A 1PXUA 4WURA 3E56A 1B9RA 3CRLC 2M2LA 1A2TA 1AP0A 1LV9A 3OOCA 4XQJA 1YQ4B 5BYQA 1YNNC 2J42A 3NRZA 1PZKD 3Q69A 3A7AB 3A8KE 3TP6A 1RJTA 1EYAA 3J7AF 3MWYW 4CKEA 1TKYA 4UAIA 1Z7TA 5DEHA 2WP9B 1EWHA 4IURA 4BWGB 4RKBA 2D62A 1G2TA 2PW5A 2J4XA 1GXDC 2JA6B 1VMPA 3AH7A 2X38A 1HFNA 2L83A 5AUKA 1TYGB 3HEJA 1XXGA 4CJ2C 5JXVA 2LMCB 2NTTA 3CU7A 1BOSA 2A73B 3F2UA 2QMTA 1SNCA 1ZYRC 3KK7A 4G7OC 5DM63 1DM0B 4K6LA 1YN5A 3RZOB 4NW2A 3D3RA 3FILA 2M00A 1CT1D 2Z4HA 5JPMC 2PQEA 2B2UC 4HCSA 1J8IA 4REZA 1HFGA 3MXUA 3BK2A 1QOHA 5ELDA 1BNZA 2EY1A 5C3XA 4JX1C 4QMGA 2L12A 1QE6A 4K8JA 2JSVX 4YTNB 4CKCA 2PZWA 4H7BA 2JQRB 3T51B 2BDNA 5EE1A 1EQVA 3K5NA 3BZDB 5ELEA 1STBA 3N52A 1U4PA 4EQNA 1TWCB 4A55A 3P42A 3OW7A 3QIAA 3TBIB 3RLFA 2MH7A 2BA0A 1JQ4A 2B8FA 3E6ZX 1E7PB 3SHLA 1DONA 5KYLA 4ZLTF 3HS0C 3S1MB 4YSYB 1CQFA 4JWSC 2PNRC 1YJJA 2EVBA 5CV7A 2VXWA 5IOCA 5C0XG 3RPFC 1EWYC 1PZJD 2XRSD 4KHZA 1WTQA 2WAQB 3L9AX 1J9OA 3NWTA 5ISRA 4ZRZA 3HKZB 2LS01 2M19A 2QKIC 4JWUC 5I9OA 4JK1C 4RWSC 3TSSA 1DXMA 1F77A 4ZHOA 4CGYB 4F8MA 4OVZA 2EYOA 1MSHA 4JPSA 4ARCA 2D5GA 5CV9A 4H13C 4I65A 2B76B 3ZGZA 2NN6G 1GUSA 3KWVA 1CA5A 1BUVT 1NENB 5T8IA 4PMBA 3D6WA 3NXWA 1O7YA 4BY1B 2EDGA 2NB0A 4M1UB 1L0XB 1B4OA 2BB6A 5CYUA 3GTLB 2F0DA 2QILA 4KK7A 1SB3C 1WXQA 2M0AA 3Q22A 2WXRA 1X3PA 3DUZA 4LK1C 1SDFA 1LTGD 2B39A 2WACA 5AFWA 5M3MB 3SE0A 3PZ8A 3GO5A 5CR3A 2Y0SB 2KDMA 2BBCA 4ZHPA 5ELCA 3PIP3 2AWOA 2YEPB 1STHA 5IGFA 5C4HA 1SSOA 4R3DA 2DWQA 4XDDA 1FD6A 3WOFA 2B2WC 2L1BA 1OXUA 4J6HA 1CZGA 4R8NA 3L4PA 1B9MA 3RFZB 4ZUIA 3GQBA 1GOZA 3VYTA 3MAQA 3DEOA 3K0YA 1KF6B 1D1IA 1SJED 1OFFA 2E75C 1YN3A 1RHPA 2J53A 1E2VA 4OO1I 3MA2B 5M5WB 1BCPF 3FKIB 4NP5A 2A68C 3KLRA 1RM6C 4KI0A 2F0MA 2IWHA 3Q0AA 3DEPA 5BN4A 3G6JB 1SF0A 1II3A 2L5TA 3SDZA 2RPVA 1PUTA 1DOLA 4C56C 2KACA 2PVOD 1V8CA 3S16B 4Q2JA 1Z6HA 3H09A 2IX1A 4C1NI 1MI0A 3SFDB 4WORA 5BYSA 3FPPA 1ZDVA 4TSSA 2YU9B 1NSNS 4C7ZA 4HN7A 1LLRD 4BBRB 3I8ZA 1Q10A 3U2SC 5HHDG 2Y5CA 2ZW0A 3AEFB 4RFBA 4E6IA 1A6XA 3I4LA 4XYQA 1WTPA 2E76C 2KCNA 1H9SB 2L11A 4P16A 1T6BX 3A8IE 3GTMB 2PW9A 2DY8A 5AUIA 3SK8A 4TKOB 4M0WA 4QCLA 1NYQA 1KTKA 2MJEA 4MM3B 2J7ZA 2AQ1B 1I4PA 1U4RA 1STGA 1H9MA 1AEXA 2K33A 2KJXA 3R2IA 3M4YA 4U68A 1SAPA 1EQTA 1BQQT 5C5MA 1FMAD 1JWBD 3B2FA 5KIXA 1FXAA 5EJWA 1Y1WB 1GAQB 4PMCA 3VYSA 2JU6X 3AE5B 2B2YA 2K7VA 2KUMA 1Y69U 4ILWA 1N60A 1EL0A 3PO0A 3SR6A 4ME5A 3ONAB 3CIRB 2ZXRA 3DWQA 2WXQA 1FRRA 1C4CA 1ZXHA 3OMCA 2A74C 4O1NA 1JR0D 3VR6A 2OF1A 3HVDA 2OHFA 4IUUA 4YXDB 2O5JC 3LXFA 1L4DB 4A90A 3P4SB 3V3XA 1UWXA 2GB1A 3AEBB 3P4QB 3M7NA 4KGRA 2KHSA 1C76A 1TS5A 4KY6A 5C0XJ 5K5PA 5BN3A 3H3VC 2XSCA 3GV6A 4KD3A 1CJEA 1RD9D 5M5YB 2X69A 2K04A 3MFGA 2IX3A 3AE7B 1LTAD 3IFTA 2TMPA 3PO3B 3KLSA 1E0ZA 2PTLA 3BDLA 2WQYB 2KVMA 3E0JA 3JAME 3S15B 4IUQA 3X3NA 1EIHA 3AECB 1B53A 3SK4A 1ET6A 1WYGA 1KDCA 3S9WA 2JXTA 3IAM1 3HOZB 5DNFA 5KNCA 3MHZA 1TS3A 2J0TD 2F0UA 3LNNA 1QLBB 4TQ0A 4TQUS 2QF7A 1SNDA 3GD7A 3HGBA 5LL6S 3MXPA 1KLUD 4K5VA 2PLPA 1FD7D 2DBYA 4RH6A 4B0EA 4BA2I 1HHVA 2GRIA 2ZXPA 3S1RB 1TZOA 1B50A 1SE4A 5FOBB 2L55A 1C78A 1UEAB 5E3FA 4C1NK 1EY9A 3OWEB 5G3LF 4KGTA 5D3DA 2N7JA 2R92B 1O7ZA 3BK1A 3K58A 3LX0A 4K8IA 1V1PB 1WCMB 1IW7D 2NBFA 3KLSX 2K22A 2F0SA 2EY5A 4XXEA 2A68D 2F0JA 1ZYRD 2M9VA 3GTKB 1R4QB 4K2LA 3V96A 2WXMA 2Z8LA 5I9PA 1C79A 3J80E 2PMVA 2RA4A 1WD1A 4OL7A 5C0XI 3MTSA 4X3KA 1JE4A 3GTOB 1F9QA 2BDOA 1I3QB 3T3OA 1AYFA 1LABA 2E6XA 1BXTA 2HTME 3MP9A 2E2DC 1J7AA 1S5CD 2MJDA 1NR4A 4C3HB 3GTQB 2A5HA 1YJIA 1F2LA 4KGSA 1HUMA 3VR3A 1F2RI 4I7ZC 1Q1BA 2W3SA 1FRDA 1NEKB 1ZUD2 3IKJA 1BO0A 2NN6I 4C3IB 1K8OA 5EE3A 3I91A 2HUGA 3A55A 1E2WA 4IFDI 3P4PB 4J1MA 3AB5A 1M4VA 1LT6D 1TWFB 2K0PA 4A3JB 3M85A 2JWUA 3U52E 5FLXL 2H4OA 3T53B 4LAAA 2D5DA 1WTOA 3T4AC 4LLGM 2RDFA 4N6EB 2F0PA 4A93B 3T56B 4P2CB 2IX0A 3P63A 4WRDA 1EY8A 1IKMA 3EGRA 3NUCA 3AM9A 1H9RA 1CTMA 2R7ZB 1TWHB 2JA8B 4JE3B 4X3UA 4XT1B 2B2YC 3J81L 3HOYB 1KDBA 2BE5C 1FIQA 4DAYA 4KD4A 5JPNC 4US9A 4K2KA 1EY7A 2XIWA 1TKEA 1RKNA 1LACA 2GA4B 4F7XA 1L0VB 2EKIA 5LNK1 2YYZA 1ENCA 4AYBB 3A54A 3S1NB 4XDXA 2AUJD 2IPKD 2WXKA 2V3NA 1FFVA 1CA6A 4RF1A 1JWSD 1FXIA 2ZW1A 3C46A 4RAUC 4K5WA 1N62A 4JBWA 2FMCA 3VR4A 3PUVA 1DCZA 4OGQC 5IT9E 4N59A 1I7HA 1EM7A 4PNYA 4CHTB 1PFMA 3NZ3A 3EFXD 4RCNA 1C8CA 2MJ3A 4A3KB 1U4LA 1S5ED 2Y5PA 1RODA 2BYTA 4RGOS 1A15A 4B0MA 1B9NA 3LWUA 3BG3A 1KLGD 5E1FA 2JP1A 2IT1A 1ET9A 5C3JB 3OIPA 3TEYA 1PTOH 3OWFA 2DY7A 1D1KA 1JOOA 3Q23A 5HGTA 1HRJA 1DOYA 5CC4A 1QOGA 4EQOA 5A2QL 2EYJA 1WGKA 1JOQA 1QOFA 4TQ1A 4L1BA 1Y8PB 3Q8BA 3I3CA 2WXJA 2NWGA 1PRTC 2EYFA 2WDVB 1F2YA 1BCPB 2IGHA 1F0ZA 1N61A 2BOSA 4A3EB 3AE6B 2WB1B 4D2KA 5EE9A 3FRPB 1MHXA 4ID6A 4RF0A 3EROA 2J52A 2WXOA 4QF4A 4HAEA 1T5EA 3FVQA 5I2XA 3QB3A 3OSOA 4HKZE 5LL6X 1G91A 1PDQA 4DNRB 1N63A 4C3JB 2XWJB 2IJ0A 2JSOA 1QF6A 1PTOB 5ELFA 2V0GA 2F0FA 3PMFA 4IUVA 2WP8J 1BDOA 1VZ7A 2C9OA 5LHY1 3VR2A 2BS4B 4NAWB 2JEBI 4AS1A 3C1EA 1ZEQX 3PO2B 1EU4A 2ENBA 1XTCD 1C48A 3B2GA 1IBXB 1AWDA 1GUTA 3BYTB 3M3YB 4MIUA 5JVG3 2AQ3B 4G7ZC 2O2LD 2F0IA 2F0QA 1SYBA 1VCIA 4DNTB 1AZQA 1XF5L 1F9SA 5JVH3 4V190 3QOJA 3CQZB 2WXHA 1QILA 4QB4A 2K32A 2QDBA 5EKIA 4ZYSA 3S1QB 5JEAJ 1JWUD 5K36H 1T5XD 1QKZA 2L4NA 4KJOA 3VA5A 2I07B 1KFYB 3D4WA 1Y1VB 1TY0A 3M4OB 2DLBA 1JQYD 4FF4A 5CV5A 4DGZA 2FUG1 1GUGA 3C1FA 5I2YA 1SMYD 3R3OA 2ONQA 1YNND 1D5XC 1QNUA 5D3IB 3J81E 4OZCA 1WTWA 2IW3A 2I46A 5COYA 2O5IC 2JXMB 4US8A 3AN1A 3TP8A 3P4RB 2Z4IA 4KKUA 1J7CA 4B08A 2IGGA 4WJWA 2L9HA 5HURA 3K59A 1JRPA 5BMHA 2SEBD 3HP3A 1TU2B 4OIJA 4Q5VA 1N5WA 1D6EC 1I4XA 3RZDB 2R93B 2WXNA 3X3MA 4BS9A 2FHTA 2HQEA 3E9SA 4DU9A 2NVQB 2EXZA 2LHDA 4HKQA 2NVTB 1JICA 1VF7A 4HJGE 1TJEA 1ML0D 3KF8A 3I70A 1HZ6A 1IYVA 5M5XB 2Q8IB 3W3AA 5J22A 1WVLA 2QCPX 4IDIA 3VR5A 2BTEA 1GB4A 1NAPA 2BE5D 4A3BB 4HRSA 1OO9B 4PT5A 4RA8A 2EPBA 2FMMA 5T1GA 1EZ6A 1TT2A 4O42A 1C4PA 2M56B 1SE3A 4Z9CB 1UUPA 4DF7A 1NUCA 1IW7C 3NE5B 4XE0A 1ICWA 1ILQA 3P1MA 3G7LA 1XCTL 4XT3B 4IUTA 1LTRD 4B9XA 2E74C 1BBXC 1CK1A 4L23A 5G5GA 3A7LA 4HR7B 5KEEA 1PLFA 1TWGB 1CHPD 2OT2A 4HSVA 1BF4A 5EE0A 1OXVA 5E6JA 4ABNA 2MHVA 2NZ1D 3KBXA 1J7BA 3FMCA 2WKDA 5FK9C 3T3NA 4CQNA 2VUMB 3AEGB 3FC4A 1ESFA 2Q5WD 1SYDA 2QSDA 4XTCS 4HTHA 1A2UA 5G3LD 3CKIB 5CBEE 4IUPA 3NHHA 5EBCA 2NMQA 5C2TB 3BDOA 2F1MA 2WKCA 1PFDA 4ARIA 1PGXA 2PMZB 2KOLA 5C6AA 1E0BA 2PYKA 5BYRA 2EJGC 3K6OA 5EBDA 3EVQA 1Y8OB 4OZBA 1K8MA 3I57A 2LKVA 1NI3A 2RKSA 1I6VC 3NQIA 1HQMC 1K53A 1CQVA 5EKKA 3J9CA 1EY0A 3AE2B 5C0XH 2DNEA 4YTPB 4X3SA 4XDCA 1IYUA 3NS1A 1K83B 3MVVA 4YT0B 4EQPA 2NYZD 4C7YA 5FO8B 2NTSA 1ROEA 2G9HD 3FILB 3I73A 3VA7A 2K5DA 1L4ZB 3QO2A 3DMUA 3K7AB 1YNJC 1YQ3B 3TZUA 2W55A 3RMHA 1VDVA 2K05A 2PW7A 2L32A 1O80A 1JWMD 1XLPA 2AX5A 2K28A 3V2TA 2SNMA 1STEA 1I50B 1KABA 1GHJA 1EWCA 1EY5A 1TS4A 2EY6A 4QUFA 3AEAB 2ID0A 1SYCA 1IUEA 5JEAG 1DOIA 3VRAB 3MC0B 1R7SA 1KAAA