2R61A

Crystal structure of the staphylococcal superantigen-like protein ssl5 in complex with sialyl-lewis x at ph 7.4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
197
structure length
195
Chain Sequence
ENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDAHQAFTRIQIFGKDIERLKARKNPGLDIFVVKEAENRTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 3
publication title Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 52
structure length 195
sequence length 197
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r61A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2r61A01
2QEJC 1FNWA 1CK1A 4K6LA 1FD7D 1XXGA 3BVZA 2RDHA 5I4DA 1HXYD 1PRTD 4O1NA 5D3IB 1KLUD 1ET9A 4RH6A 3BVGA 1HQRD 1XTCD 2RDGA 1TS5A 1SJHD 1LT3D 1EU4A 3R8BA 3V05A 1L0YB 2CHBD 2Z8LA 1I4XA 2R61A 1RCVD 2XNAC 1YN5A 3O13A 1CQVA 1ET6A 5ELFA 3MFGA 3EA6A 1PRTF 1PTOC 1UUPA 1BCPD 4DXGA 1EEID 1I4PA 2IJ0A 4L63B 2AQ3B 1KLGD 4TSSA 1CHQD 2SEBD 2WV6D 1M4VA 1AN8A 2IPKD 5ELBA 3TSSA 3DWQA 1FNUA 1S5BD 3R2TA 1LTBD 1JWMD 1FGBD 1L0XB 1S5CD 1V1PA 2XN9C 3OWEB 3BYYB 1RD9D 1SXTA 1RDPD 1GOZA 1LO5D 1LT4D 1PZKD 1SBBB 3BZDB 2AQ1B 1F77A 1S5ED 3URYA 2XRSD 3BVMA 1D5MC 1B1ZA 1PTOD 2NTTA 1FNVA 1I4RA 5D3DA 5ELEA 1BCPF 1PZID 1YN4A 1EEFD 1I4GA 3GP7A 3EFXD 1LTSD 1LTRD 1JWSD 2AQ2B 3SEBA 1BXTA 1RF2D 4OHJA 1D5XC 5TSSA 1LTGD 1QILA 1JQYD 2QILA 4C56C 2NTSA 4NZLB 1JR0D 1PRTB 1D5ZC 1LTAD 1S5FD 1SE2A 3R2IA 4RGTA 1SJED 1I4HA 4DXFA 1MD2D 4RGOS 2O2LD 4UDUC 1EFID 5FKAC 1LT5D 1LTID 2XRQD 5ELCA 1JWUD 1PTOF 3DWPA 1LTTD 5ELDA 1AW7A 1I4QA 2TSSA 3BYTB 1UNSA 3DWAA 1KTKA 1T5XD 1PTOH 3CHBD 1PZJD 1TS2A 2J4XA 4RCOA 4L6TB 1LT6D 1DJRD 1S5DD 1BCPB 1TS4A 4RHSA 1EWCA 1STEA 1TY0A 1V1OA 1BCPC 1DYQA 1SEBD 3KLSX 1D6EC 1HA5A 3W2DA 2ICIA 1CT1D 2G9HD 1PRTC 1HTLD 4RFBA 1EU3A 1SE4A 3MC0B 4RGMA 4BWGB 1TY2A 1YN3A 4Z9CB 1PYWD 1SE3A 1B44D 1G8ZD 1CHPD 4RGNA 1PTOB 4ZYSA 1TS3A 5FK9C 4RHRA 1JCKB 1V1PB 1ENFA 1ESFA 1LLRD
chains in the Genus database with same CATH superfamily
1WM3A 3SK8A 2G9DA 4RAUC 3J81c 2UXCL 1F1HA 4GDLB 3T13A 4IWOA 1E1TA 1B9MA 3GDEA 3MXNB 3B2FA 3PIO3 5LXHA 2AEHA 5GQOA 4H0LC 3U52E 1E24A 4J3OD 3S1RH 4RH6A 2DWQA 3BVGA 3F2UA 5J22A 1R9TB 1ICWA 4POGA 1GJZA 2KD0A 2QC8A 4GLSC 3HFZB 3NWSA 4OL7A 1N61A 2MNAA 1N32Q 2KEDA 4BBSG 1L0YB 3CWIA 4K7WA 2CHBD 4AQYL 2IY5B 2EYJA 5EPJA 2M1MA 1SNMA 2WQYB 1HTQA 3GTKB 1HUMA 4A3DB 1CQVA 4IJHA 2D3CA 4ZQ3A 4DXAB 2DY7A 2L4NA 1UUPA 4R4QA 4EGVA 1I4PA 1B7YB 4TSSA 2KDIA 5G55A 3SHQA 2KANA 1JOOA 4ZKBB 2HT1A 1C79A 3N20C 4MGZE 5IO9A 4JI5Q 4LF6L 1XLOA 3VRAB 2BYTA 2HD5B 2K6DB 5G3LD 3HKZB 1S5CD 2LRUA 2FHTA 3EFUA 2VXWA 5IYCH 1F2ZA 5GAGC 3AE1B 4HSPA 2D0PA 4KI0A 3TZDA 2AQ1B 3ZTCA 4JV5Q 1QZGA 3FHWA 5EE1A 4P71A 5EE3A 4DHJB 1C78A 1MVKA 5C4XH 2Q2IA 5LMNQ 1XNQL 4JI8Q 2ZXRA 5JJLA 1LGRA 2D9UA 2E75C 3F8TA 5CV5A 1UEBA 4PMBA 2XK5A 4BKGA 1JOQA 2JYTA 5E6OA 4ILWA 3OAWA 3Q8BA 1YD8U 1JR0D 4CKCA 3GTMH 1LM8B 1LTAD 4MJSB 1B9RA 2CS4A 4IM3A 5IA7A 3KFUA 4C1NK 4FNFA 3L54A 2N78A 1LT5D 3M3JA 4NNJB 2E2DC 3VH3B 3QO2A 2R6GA 4AOFA 3KBXA 3MXGA 1XLNA 1W6KA 3CF5A 5J18A 1MI2A 5JPNC 2R7DA 3W1BA 3BYTB 4K3CA 1Q90A 2KWUB 3QOJA 1Z9FA 3VVWB 5IAAC 3CKIB 1GC6A 1Y1WB 2KBNA 1EUJA 5I2XA 4ZRQA 3U4EG 1L6VA 1NYQA 2NVUI 2UU9Q 2ZVNA 4GN1A 1Z5SB 1SRUA 1STAA 4DFAA 2F4VQ 2MJDA 3IFDA 3HS0C 1EQVA 1CKMA 2HHHQ 2WIIB 4KDIC 4XTCS 3HOXB 5DCNA 1E1OA 1YNNC 2MH7A 1NAPA 4A3CH 4HSVA 1YZ6A 3P75A 3STBC 2C5LC 2NBVB 5D2MB 4C7ZA 5A35A 1C48A 1GVPA 5COYA 4JI1L 1X3GA 3V6CB 3P4QB 3PZ7A 1PGXA 1TQOA 3QG1A 4ICVA 1R9TH 2RSUA 2V9HA 2DBYA 2L11A 2VH2A 5IIFA 4G4KA 1YBYA 4RCNA 4DN4M 4LNNA 2E5LL 4BS9A 4CHTB 2K5VA 2CHWA 3DBHI 2QGQA 3HZXA 2WXKA 4C4VA 3GTKH 3CCRA 4OO1G 2E6XA 1NUCA 4NQLB 3DM1A 1HE8A 2MBBB 4HJ8A 2N9PC 2NUCA 3FKIB 1F0ZA 1PYBA 3T8MA 1CZWA 2GVAA 2F1MA 3WIMA 4IUMB 5ELNA 1FO4A 1IYVA 4LNIA 3P7JA 3G6JB 2PCFB 2NMQA 1FD6A 3CP0A 4A9AA 4LDTD 2KK8A 1BO0A 4AWJA 1EL0A 3CPFA 5HURA 1YX5B 2KWCA 3DWMA 1JWAD 2LVQA 1PMRA 1DOIA 4FULA 2CW0D 2Y0SE 4JC0A 3TP5A 3PPAA 5IP7H 1D8LA 4ULLA 5ELFA 3PF5A 4EOYA 4A3PA 3PO3G 1K8RB 1HRJA 3PZ8A 3GZNB 1YOVB 4DV4Q 5JPMC 3BK2A 4JV5L 1EEID 2I1KA 5DEHA 2HQLA 3U4ZA 3G4SA 1TBEA 2W54A 2JEBI 2KYWA 3GE8C 2X6LA 4LW1A 1K8OA 3HOYG 4IOAA 1ZEQX 4FJVB 3PHWB 2AWNA 1EUVB 3RMHA 4TV3A 3P20A 2QDBA 3WAPA 1PZKD 1WXMA 3B1LX 4WAFA 1AZQA 4PZ8A 4M8MA 4OWXB 1NI3A 1E6EB 1FNVA 1SDFA 1XTDA 4XQNA 1Y1WH 1ACCA 1LTRD 2FXQA 5C0XH 3OW2A 4B3TQ 3BS1A 4BBNC 1QOFA 1F9SA 3QWNA 1NE3A 2J0JA 2CH4A 5TSSA 4A3FG 2EYOA 3NVWA 3V6EB 1K3RA 2VQFQ 3IAYA 3HOXH 1SB3C 1PFBA 4HIOA 3NBHB 1LQBA 2WB1B 1I4HA 1JB3A 5M3FG 2BYVE 3CCSA 2L83A 4KGTA 1WWTA 2DYBA 3MJ5A 1F2LA 3L16A 2A6HC 3A55A 2NN6G 3AN1A 3PVLA 2AWOA 1SYEA 4YCUA 1ZXHA 3NPPA 3PO2G 1KL9A 2YV5A 1EY5A 3DLLA 1L2FA 2JXXA 1EM7A 4ZAIA 1HZ6A 1PZJD 1G91A 3JC66 2O6VD 5KYLA 4DV0Q 2WAQB 3P42A 4KDLB 1SNPA 1LT6D 2J7ZA 3PSIA 5G5GA 2JA5G 3D8GA 1TU2B 1VF5C 1STEA 4IOCA 4I6PA 1LTLA 2KMAA 5JHAA 3FKIH 1VZ8A 4PNYA 1YJIA 2L32A 2G9HD 4WQMA 1NNXA 1P7EA 2ACZB 3TJPA 4DV3Q 5E6NA 4HJGE 1EU3A 2DN8A 1HZ5A 4V0BA 4LFCQ 1XCQL 2QEXA 1ZKOA 3OLMD 2RCFA 2FAZA 3VYTA 5I9PA 2JA8H 3EVQA 1K53A 5GADC 4DAYA 3HOWB 1UZXB 1U4MA 3ETRA 2CQAA 3T1YL 4JBMA 1ENFA 1B9NA 1LLRD 3PV0A 3SEBA 1R4MI 3NG0A 4AJWA 5J17A 4JI0Q 1J8CA 3GQBA 1A3UA 3SK6A 5LMUL 1CK1A 1ZXTA 2IWHA 4OVVA 2KZRA 2L3ZA 3UIOB 4EQPA 5KHQA 1D3ZA 1HNZL 4P74A 3TBIB 4JG2A 1AWDA 5CHFA 4A75A 4LUVA 3IXSA 3DHQA 3ULLA 1LYLA 4R4TA 1UE7A 1RAXA 1Q5WB 4NDXA 1DGJA 1K51A 2BYFA 4S17A 1FVIA 1LFDA 1U4RA 3S2AA 2JWUA 4TQ0A 2KFKB 4G0NB 1ENAA 3KBGA 2VUMB 2WXHA 2DJFC 5EBDA 3TZUA 1I4XA 4A3EB 4DR1Q 2K6QA 1A3TA 4XXEA 2XEWA 2YU9B 1M94A 5IYBH 1VMPA 2BGFA 1P0RA 2X6GA 2ZNVC 3S1QB 5KNCA 1L5PA 4ARIA 2JA7B 2EVBA 4AYBG 3HIZA 4F7XA 3ZTDA 2NVQB 1FXIA 4YY3L 2B2YC 4X66L 2IZVB 2MWSB 3S16H 2WXRA 2KJHB 4WJ3M 2XVSA 2KC1A 3I3TB 1QOBA 1YHAA 4KJOA 1EYCA 3W3AA 2ES2A 3Q3JA 3KYDD 4ANWA 1H9MA 4LFAQ 3OPOA 4B9WA 3WALA 5IP4D 1NI2A 2VNUD 1KQSA 3WWVA 2WFWA 4MGKE 3M4PA 2JF5A 4EQNA 4OO1I 3LX0A 4J8QA 1I4RA 2ENBA 1U5KA 5F2DA 2ZVOA 3AEAB 3LB8C 2HIXA 2JRIB 3AECB 3EFXD 3DXJC 2MLBA 4LK1C 5IGCA 1MFWA 1G6PA 2OEOA 3SFEB 1IBLQ 1RF2D 2WXFA 5DPRA 4JOIC 3E5SA 5C23A 3Q24A 4K1RB 1OXXK 4A90A 3RI7C 2LUMA 5AFWA 2F0PA 3C3LA 3R2IA 1SLJA 2D0OA 4DR7L 3KUZA 3N3KB 3IAS1 3H8HA 2AUJD 1UWMA 1STGA 2DX5B 2EZVA 1U4LA 2JYOA 3ERSX 4TMAB 3NE5B 1LTTD 3RLFA 2K1BA 1E2VA 2KCTA 2CWAA 2N9XA 3DUZA 1GUOA 2Z4HA 1OEYJ 1TKEA 4BOSC 2INNE 4B9KA 1Y1VG 5CC4A 4S0RA 1HPCA 1HNWL 1J7AA 1DOYA 3HOWH 2K9XA 4K14A 1EY7A 2JK8A 3ZRCA 4I6LB 3TBLD 2M2LA 3IRBA 2LXCA 4PG3A 2UUAL 1Z6HA 1AE3A 3WDNA 1KNEA 4F87A 4KK7A 1GXDC 3T9LA 2SNMA 1V8CA 4OEMB 3I4NB 3HOZB 1PH8A 2UUBL 3R3OA 3R93A 4P1CC 1VQBA 2QCZA 1CFMA 1WRIA 3V60A 4JI7Q 4GU2A 3MC0B 3P1HA 2B76B 4DV1L 3UE1A 2DHZA 3TEHB 1X65A 1O78A 5C6AA 2F0JA 1ASYA 2F0IA 1AH9A 4JL9A 3EIVA 5KIXA 1NTGA 4I7AA 2D2QA 3MC8A 1HFGA 2VUMH 1VQ8A 4FJYA 2B39A 3X0WA 4B08A 5IWAQ 4KY5A 2D5GA 4A3EH 2WB1E 2BBCA 2A8VA 2YU9H 3A4RA 4IPDA 3S1QH 2BE5D 4K6LA 2LXAA 3Q8DA 2JA7H 1EWYC 1FJGL 5T1IA 2NVQH 3PHXB 1WM2A 2FCNA 2NN6I 3E56A 1VQ6A 2LVOA 2X69A 1XF5L 4PS7A 1GUNA 3WA0A 1NR4A 2KHSA 1PUTA 2ZJRA 2IY0B 4AIMA 2KQSA 1XNRQ 2K25A 4NAMA 5AEKB 4GDLA 2FNJB 3VFKA 1IKLA 1XEEA 2WAQE 2PE9A 2K6AA 3VR5A 2C9WB 1NR2A 5D65A 3N30A 2GBNA 2MJ3A 3MXNA 3K57A 1MG4A 1X1MA 2H89B 3VTUA 4DR4Q 2LI5A 2CVRA 2Y5CA 3A33B 1V8QA 1ML0D 1V9PA 3G48A 2A1AA 4ME5A 1WE7A 3KLWA 1Q46A 1VQIA 3TN2A 5L37A 4A20A 3Q69A 1C76A 4GN3B 1BCPD 3Q23A 1WR1A 2IJ0A 2B2WC 1G51A 4OVZA 1HCZA 1SYFA 3VA5A 1X3EA 4LNQA 5JZEB 4C3JG 5C44B 5M5WB 4US8A 3MTNB 1VQLA 4RA8A 3L3OC 3G7LA 4OX9L 2EYMA 1JJCB 2PE6B 4C00A 2UUCQ 2WDRB 1B8AA 1B3AA 3U9OA 1WZ3A 2Y5PA 2ZZPB 3DBRI 3A0JA 1IBLL 3QWZB 1IP9A 4XIGS 3PS6A 1DOMA 2AUKA 1E8YA 3DEOA 2FCQA 3URYA 3BVMA 1N36L 4PS3A 3VR6A 3S17B 2JN4A 3RN5A 1C9OA 3ND8A 4A3DG 1EEFD 3I57A 3Q2AC 3GE3C 4KV2A 2GMIC 2LFIA 4BAXA 3RD4A 3I8ZA 1NBFC 1QKZA 1WGRA 2KTFA 2KOXA 4ZRJA 4N9PA 1WGKA 1F2RI 3C1EA 3MTSA 4YHHQ 1MKHA 1C4QA 3OYYA 2KDBA 1S5FD 1GAQB 4L8JA 3I4NH 4GB9A 3HOZH 3U58A 4JBKA 3HOVG 4EFOA 3CAMA 4HCNB 2K05A 4H2AA 2PNRC 3DWPA 2E2JB 3B0AA 4MJSA 3TEZA 1N9WA 4XGAB 1HR0L 3ECIA 2V3PA 1BDOA 4QIWB 1EFWA 1RLFA 2ZCCA 4FP5D 1KTKA 4MM3B 4QB4A 3AB9A 2J4XA 4R8NA 2IY1B 4L6TB 4AJYB 1TWFB 1JE4A 3A9JB 1S5DD 1F2MA 3ZGZA 1X3QA 1MJDA 3RFZB 1BCPC 4ACFA 1SEBD 1FFUA 1OEYA 2MBHA 4OIJA 4JI4Q 1NVID 1E7ZA 4N6EB 3D4RA 3I4MB 1K0SA 4ME3A 4A3KB 2NBFA 4FXKC 5C1ZA 4KGRA 3LWEA 4MZ9A 4XC2A 2BW2A 4JE3B 5CORA 5CGKA 2AHOB 2PI2E 3TDQA 4DV7Q 3FILB 5IGFA 3QC8B 2JZ3B 2W82A 3QJZA 4ZDVA 4GKJL 4DDGD 4DR2Q 3ML9A 1UGMA 1HZ9A 2A6ED 1LV9A 1N63A 1YJNA 3KF8B 4YIJA 2D07B 1IYJB 4DV2L 3VXWA 2LGSA 4A55A 2VZKB 2WXGA 2L00B 3U7ZA 4N59A 2WXLA 5C44H 1EZ6A 5M5WH 1XMOL 1JJ2A 1PH5A 2WU5B 5BO4B 1I6HB 4P6VF 2OT2A 4R1JA 2JYEA 4KSLC 3A8KE 3PLVA 4BKTA 1SGHA 2UU7A 3U50C 4W9DA 4UP8A 1EU4A 3CF6E 4IUUA 4N9TA 4B95A 1QCBD 2LY7A 4L2YA 3S17H 1RCVD 1K73C 2EXZA 3I9V1 3OW7A 2NVYB 1SMYC 2O5IC 2PPHA 2L0CA 3PV1A 3UINB 2YYZA 5BYRA 1OQRA 3L0OA 2B2TC 1WGYA 2GBRA 1O7IA 3MHZA 2YEPF 1UEAB 4WFN3 3MFYA 1KLGD 4CGYB 5HY6A 4NAWB 3FKIG 2QIEB 3TSSA 1QG7A 3MAQA 2VY3A 5JVG3 4BVUC 4KY7A 1UD7A 2QDLA 2IGGA 4ANVA 1ASZA 4Q2JA 4ANXA 2XN9C 3HRDD 1IYFA 3MWYW 2WGSA 3M9BA 3GTGB 4KKSA 1IYUA 5IE8A 1GOZA 1IBKQ 4LF7L 4LF9Q 3F2DA 2MCNB 5IGBA 2E2JH 2RPVA 2XRSD 5DM63 5BN4A 1FR3A 1GNUA 4GMVA 1H9SB 4C3IG 2K5PA 1PZID 3UDGA 1CZPA 3Q8EA 4BKSD 4H44C 2AMCB 2F03A 4A3OA 4X6AH 4KJNA 3M3YB 4WJOA 3VUYA 3HKSA 3FMCA 4OHJA 3RYTA 3DVNU 1E0ZA 1TWFH 2ID0A 1J7CA 4REZA 4NZLB 5IKCM 5H92C 1RIPA 1D5ZC 4P16A 1Y14B 5IYDG 1Z7TA 4QAYA 3B6YA 2K52A 3MVVA 3I4MH 2C5CA 4A3KH 1E9MA 1F2RC 4N8X1 3NQTA 1RM6C 2G3QB 2GN5A 1KDAA 4BY7G 1M1KC 3RNBC 2OHFA 1KABA 1RJTA 2BOSA 2LEKA 1T5XD 5J2RA 4L23A 2RGFA 1PFMA 4CKBA 2Q8RE 4QCLA 3AEFB 3QIJA 1S40A 4US9A 2F0HA 1XMQQ 2BTEA 3RT3B 1BKBA 1ZXIA 1KM7A 4AUQC 4ZRZA 3H6NA 3ONAB 3TP7A 3U8ZA 3LJ3A 3IT6B 2WB1G 1C0AA 1FIQA 4NXNQ 3I7FA 1CT1D 1MJEA 3NOBA 1ZYRD 1Q86C 3KUDB 4XX5A 5KRUA 1I6HH 4ALPA 2M0XA 3M63B 1STYA 1LACA 2ZTEA 4LK0M 4HIMA 3OIPA 3C2PA 1WX9A 2RDBC 4X62L 4DK0A 3CQZB 4HMIA 5CMDA 1NMFA 4GKKL 2ZM6Q 3PGEA 4J6HA 2R93G 1WH3A 1OXTA 3AM9A 2B29A 1A2TA 3ZW3A 1I6VC 2A69D 1F9QA 1I7HA 4II3B 3LNNA 2NVYH 2KVRA 1DD2A 2QEJC 3K8AA 3QOLA 3VUXA 2CR5A 3DQVA 4HMJA 4X3SA 1QVFA 1RFKA 4FN2A 1TWCB 2EY6A 2QW7A 2PZWA 1PRTD 3K0XA 3K7UC 2NWGA 3P4SB 3ZO5B 3KH0A 1I42A 1ZKHA 2V1YA 5FO7B 2J53A 2B2YA 1HNXQ 4LF5L 1GPXA 1UE5A 2VW9A 2LGIA 1QVCA 5M3MG 1TS5A 1YNXA 3GTGH 3MA2B 2IX1A 1B4OA 3V62A 4RM8A 4EZKA 4K0KQ 4OIKA 3DPDA 1KOTA 3T1HL 4A3MB 3VTWA 3Q14C 1UGJA 4LF4L 1KFYB 3FP9A 1AARA 3CMAA 3M3YH 2KFKA 3DBLB 2WV6D 2Z1CA 3SU8X 1T5EA 3EBEA 3ZUNA 1LTBD 1FGBD 3PGZA 2PQAB 3TREA 4DK3C 3AE4B 2WINB 3AFPA 3K7AB 4IPGA 1KAWA 4K7UA 1SYBA 2N7DA 3HHMA 2EYFA 1I94L 1YJ1A 3L10B 1CSQA 1AYFA 1PTOD 5JH5C 2HD3A 2N3SA 4S3SA 2EPBA 4FO2A 2XGTA 1UF0A 1YIWA 2KNBA 2KXJA 1GO3E 3NHEB 1HZCA 4MGYE 3E9SA 2R7ZG 3B2GA 2LMCB 4USAA 1PFNA 1EQQA 2BS3B 1WYGA 2ICEC 1MGSA 4X57B 1QILA 2H5XA 4V190 4ZRIA 4APVA 2KWDA 2IO2B 2OJRA 1M90C 4LF8Q 1F9RA 5JHBA 1N33Q 1MD2D 4RGOS 4ANUA 3PUWA 3S24A 2J42A 2BWFA 1A62A 1IUEA 4A6QA 5CV9A 2BH2A 4II2B 2PI2A 3NZUA 1N8RC 1GUAB 3CQZH 3R3MA 1QWYA 2F0TA 3AQQA 3Q0AA 3A5UA 3M62B 2DGYA 4QF4A 1E8XA 3OG5A 4TUUA 3CCMA 1KNAA 2INDC 1N6ZA 5JJKA 1ILQA 4DPGA 2IX3A 1S3SG 2Y5BB 3NZ3A 3KLSX 3A74A 4GZYC 3TEYA 1TWCH 1WYWB 2ZTCA 4LFBL 1F2YA 1YMHE 4IDIA 1WTVA 5DNFA 4B3SL 3ONSA 3A7AB 2WX1A 3HM3A 1HTLD 3D3RA 1TJEA 3I55A 2ZXPA 3RR5A 4CJ2C 1N5XA 3VDZA 4B6WA 2MQJA 4BXXG 4B0EA 2QF7A 4BBNF 4G50A 3BDLA 2VB3X 4HR7B 2JA6B 4B3MQ 1XLPA 3EC8A 1WGHA 3QARA 4L1BA 1D4BA 4PMCA 3K5LA 5ELCA 3E9IA 5L83A 4DR3Q 4FVMA 4GN4B 4A3MH 1JT8A 5E7NA 3TUOA 1CA6A 3Q3NC 4M0WB 3Q8CA 4JPSA 2EOTA 5NUCA 5LMNW 3M7GA 2IO1B 4A3JG 4HKZE 4W9KA 1MIUA 3OOCA 3NELA 1Z2MA 5FJ8H 3GB1A 4TKNA 4WJNA 1QZEA 2JX5A 3RUIB 2NS5A 5HGTA 3HOUB 4C3HG 4P7IA 2B2WA 1XJVA 3P2BA 1ZW7A 1V6EA 2EY5A 3J81i 4WJ4A 1DONA 1WXSA 2RDGA 2JWZA 3K7AH 5FLMH 2J0KA 1SNQA 4KHPQ 4A3GG 3KVFB 1EWHA 4BBRB 1XO3A 2OWOA 3SDLC 4FHJA 3LGJA 3M85A 1Q8IA 1UAPA 2ALYB 2R61A 3JAML 1BUIC 1VQOA 1JICA 2MGSA 3AU7A 1LXDA 3U7DA 2LHEA 1B2TA 1OXVA 1GUWA 2KCMA 1NBWA 2MP2B 4DR5Q 2D2CC 2QCPX 2HCIA 2NR2A 3X3MA 2EYHA 3VYRA 2INCC 4XYOA 1R4NI 3U2SC 2F0EA 5ELBA 1N32L 5JEAG 3A1QB 3K58A 4C80A 3D32A 1GG3A 3NK9A 4DF7A 3HVDA 4L5QA 3OIQA 2EYLA 2PW7A 5JAVA 1K8AC 2J0MA 5CHVC 5BMHA 2LGYA 2BS2B 3NY5A 1X3PA 5J39A 2W9NA 3NUCA 1RDPD 1LT4D 1A70A 3IL8A 3CCUA 1YI2A 4ZYNA 1VQ5A 2HUGA 2JA8B 5AUKA 1AZPA 3E9HA 5EKLA 5ELEA 4JI5L 3DWGC 2HTME 4FF4A 4J1MA 1DZ1A 4IW0A 1IPGA 2EJGC 5C5LA 2N1WA 3NVYA 5T1GA 1AEXA 4X65Q 2M4NA 1PYSB 1D5XC 1NMGA 2RA4A 1Y8OB 4O42A 4PQXA 1P98A 4K81A 3P4PB 4KIKB 2F3VA 3AE3B 1W2BA 2GRIA 3PIOA 1WTOA 1SE2A 2PMZB 4I7ZC 1VDVA 5LMNL 5D7GA 3J7ZC 4JWUC 1NJIC 4B0MA 4JI8L 1EFID 2B3AA 4E71A 3D6WA 4RKLA 4G3XB 1N5WA 3VUWA 2RDFA 1LM0A 3H0GG 4LDTB 1K83B 1STBA 1FCLA 2I5LX 2DZJA 5AJ3Q 2ASQA 2JA6H 2EMSA 2B2VC 3EGRA 2KACA 3S2DB 1UBQA 2K75A 2L55A 2M56B 3IKJA 3A4SC 4A93G 2MJEA 5C3JB 5C5MA 4A76A 4IFDH 5CX3A 4RMFA 5K36H 3QA8A 2VZAA 2O5JC 4DHZB 4A3IG 2A68D 1EWCA 1TY0A 3S16B 4CDFC 2MRPA 2JXTA 4MM3A 1V5OA 4A3LH 3NS8A 3W2DA 2QMTA 2UU9L 1UH6A 4M01A 3RUZA 3BY4B 3DHGC 1BQQT 2F4VL 3L9AX 3HOUH 2ZPNA 2B63B 4LJPB 3A9JA 1SFOB 2D3BA 2HHHL 1TT5B 2G5DA 3SR1A 1V80A 1V2YA 3J80i 2GBJA 3Q8FA 1GUGA 1PDQA 1B44D 5EPKA 3UI2A 4BBRH 2PPBC 3T3NA 1TS3A 3ZYYX 5IP9G 1CUKA 1K8GA 2CW0C 2FMMA 1EIHA 1JRUA 1D1KA 3E6ZX 4IUVA 4LAAA 5LHY1 2D3AA 2N4FA 1I5FA 4N9F4 3HKZE 3P4RB 4EEWA 3M4QA 5MPOA 4KKUA 2I0QA 2UXDQ 3DBHB 3I70A 3BG3A 2RDHA 3KF6B 2MHJA 4K7SA 2Q2HA 3CC2A 1QZHA 2C60A 2C35B 1TYGB 5C2TB 1RHPA 1UWXA 2Z9HA 1T0SC 4OW0A 2B2TA 4K2LA 1VZ7A 5C3EB 5FLXL 1R4NB 2JRHA 3H3VI 2EXDA 2Z6BA 1D2BA 2AL6A 1E22A 3MEFA 4DUYQ 3KF8A 2R92G 2WXOA 2FJ2A 3AFQA 4BY1B 1WMHB 3K0YA 2ZJPA 2DYOA 1KRHA 3AE8B 1Q8KA 2CCZA 3NVZA 2NZOA 3ERQA 4MTNA 3APFA 2EYPA 4WJPA 1VR9A 3RPFC 1BBUA 1X9NA 3I63C 5JVH3 2HTHA 4EE2A 1YN5A 2ZNVB 1IW7D 2L1BA 4M00A 2O6VB 2F3WA 4KTAA 5C4JB 1WD1A 2ASBA 1EIFA 3SE0A 4YL8A 1B70B 1K28A 3N1YC 3L08A 1M4VA 2PEAA 1EZ8A 3NWTA 3AE9B 1G291 3SXHA 2N9KA 3C8YA 4OELB 2KMMA 2M00A 2X38A 3TP6A 3T56B 2G4DB 4XE0A 2ZT9C 1E3PA 4YWKA 2BS4B 1EY9A 3I3CA 4DV4L 1M8AA 1TWAB 3CU7A 1WCMB 2IT1A 1JJGA 3B08A 4IUNA 4NAWA 2HQEA 3CC4A 2G45B 1K83H 4ABNA 2L52A 4DUZQ 3T3OA 4X3TA 5LL6X 3PUXA 3PUYA 1PH3A 1ILPA 2K7VA 3S2DH 2ZPYA 3VYSA 2MBOA 2Q8TA 3T51B 1WRDB 2VL6A 3NTIA 3BJUA 4MH0E 5J3BA 1JQYD 1WXVA 4KZ0A 4UAIA 3RN2A 1HTOA 4M8NA 2KQ4X 1MG8A 4DXFA 3PQIA 1YNJD 1O7YA 3NTKA 2VH1A 2IBIB 3H6MA 1SYCA 4B3TL 3TP8A 1VQ4A 1KRSA 4DAMA 4HJ5A 4O2DA 5AZFA 4M8AA 4YXDB 2R3ZA 2REXA 2B63H 3AH7A 4DQOC 1SFOH 3JAME 1EF5A 4R9WA 2VQFL 1VQJA 4BBSB 4FLHA 3S2HB 1L1OB 1IHZA 2UWQA 1SYDA 4K5VA 3ZDTA 5CV7A 3KJOA 4P1BC 3WOFA 1XYIA 4GLAC 4YTPB 3K80C 2BWES 3AXCA 1Q82C 1DJRD 3J81j 3EN2A 3CD6A 1V1OA 3V2TA 3U4VA 4GLXA 3CW2C 1WFYA 3RCZA 3NP8A 3OTOQ 2K50A 3HK0A 1ZDXA 5IN7A 3VHTC 5C3EH 2L0TA 4DV0L 1H4RA 4KN4C 3TMEA 3CMEA 1W3SA 4HPMB 5KYIA 4I6NB 5JJIA 2WXIA 4AQ7A 4HRSA 4BY1H 1CKNB 1NYRA 4RGNA 4IFDJ 2FINB 3GV6A 4ZYSA 5C0XJ 2VS1A 2PMZE 4HCSA 4UHVA 4JI3Q 4DV3L 3FPPA 5EE0A 1CKOA 1L1OC 4DNIA 2KENA 2O4XA 4KMUC 5C4JH 4LFCL 4HPLB 3LWUA 1NENB 5DM73 1QOGA 5I4DA 1QB5D 3RZFA 5EJWA 3J80L 1NCVA 3L17A 1R4MB 3VQIA 3X3NA 1XPUA 2LZ6A 1ZDVA 1WTPA 1T0QC 3AI5A 1C9FA 1II3A 2KA7A 1ET9A 5C3WA 3PIPA 5IYCG 4YT0B 1PA6A 4JI0L 5KGUA 3VR2A 2LWPA 4FXGC 1E8ZA 5EGTA 3MZ5A 3GTOB 1BMLC 1YNTE 1TWAH 1WTWA 1WCMH 2GLSA 2KTRA 2KT7A 2L7RA 3R7QA 1LT3D 2F0NA 3TRZA 2KHWB 1TWGB 1HFNA 4WORA 1VF7A 2WDVB 3IBEA 5C4XG 3U30A 4DHZE 2KO3A 2KC2A 1SIFA 4GIVA 3MXPA 2CHZA 3PUVA 2DUDA 1G6ZA 1H95A 2MBQA 3O13A 3LYYA 3QX1A 1XD3B 1WJ6A 4J15A 4A3BH 3KYHC 4M1UB 2NBWB 2MEKA 3J9CA 5EE9A 3KK7A 2UXBQ 4DXGA 2HDLA 2DZIA 4HXDA 1UE6A 4DUZL 2Y0SG 3DVNV 1Q7YC 4DR6Q 1L7YA 1FNUA 4DR1L 3G71A 3VYUA 1VQPA 1JWMD 4ASWC 3Q22A 1V1PA 3KOJA 4NJ7A 2A5UA 3IHPC 2JU6X 4JI6Q 1L2NA 1A3VA 2K8CA 5M5YB 4L5RC 3AYHB 5GAHC 1GC7A 4F1SA 4EVOA 2KLCA 3QK0A 2K8BA 1J5EQ 4BBSH 2DNFA 3S2HH 3KQ4A 2PQAA 1BR9A 4LFAL 2KWVB 2JA9A 1X3FA 3FPUB 4HJAA 3S1NB 1QUQB 2PNHA 2TMPA 3VR4A 3OHXC 2FIFA 2JQOA 3F1ZA 4JWSC 1KLVA 3IG3A 2K04A 2HJ8A 2BB6A 2QILA 2DNCA 4C1NI 5FLXE 3PSEB 1PGAA 1WIAA 2Z0EB 5D94A 3TCAA 2RSNA 4A3CG 1CQFA 4TVAB 1HH2P 4UP9A 2BPSA 4C4VB 1LTID 4ODGA 4HDOA 2LMCA 2W55A 1JWUD 2Z0DB 1L4DB 2ZEQA 1F9PA 2C7MB 2NPTB 2LRWA 1S3OA 2I5MX 3UDFA 5KEEA 4W9JA 1ISNA 4P75A 3MEHA 1H9RA 2DZMA 3NQIA 1F9JA 4MSQB 3S14B 2WU2B 3PO3B 3UQBA 4IALA 4WWPA 5BR8Q 1PVOA 2KECA 3I72A 4A8XC 1DOLA 3HEJA 1TKGA 1ZE3D 3ZJUA 1BCPB 1KDBA 3R7RA 3C1FA 1IGDA 1PFDA 2KMCA 3N32A 4PT5A 2BE5C 1J9OA 2F0KA 4DA2A 3AMUA 5DPSA 1VDZA 3BINA 3FDTA 3APDA 3HOYB 4ID6A 2MQHA 3HKZG 1PH4A 4B3RQ 4DU9A 1Q1OA 4KGSA 1MBYA 5C4HA 3GTQB 3VR8B 2PVGC 5LLIA 2DLBA 4CBVA 4BZAA 1HJPA 4UP7A 3HM6X 3GTOH 1EIGA 1GD7A 1WJ4A 1EWIA 1SE3A 3AMZA 3ZKJC 2N55A 1CHPD 1TWGH 5IP7G 1WX8A 5FK9C 1HA6A 4GS3A 1YIJA 4JI7L 2MW5A 1ET6A 3P63A 2KX3A 2WP9B 4LJOB 1U4AA 1MHHE 4A3FB 4OGQC 2F0MA 1HZAA 1HXYD 1V49A 1ZP0B 1UELA 2R2QA 3N1ZC 2XIWA 5IWAL 4DNRB 5M3FB 5CR3A 3DHHC 4XYCA 1OQYA 3ZLZA 3I4OA 1NEKB 4DV6Q 1KF6B 2DAFA 1JRPA 4DDID 1Z47A 2K5QA 4G7ZC 2E2IB 1Q0WB 4EUTA 5IT9L 1V5TA 5G2NA 1P3QU 3QJYA 3FVQA 5M5YH 2FCMA 2MPMA 3HG9A 1J8IA 2K4KA 2MA9B 3LXFA 1Y1WG 3K59A 4IFDG 4XDXA 1P7FA 2K1FA 5C0XG 2V4IB 4JW0A 3F2CA 1XNRL 5DPTA 2EIFA 3S1NH 1OO9B 4OO1H 4O0AA 5GAEC 3DVGY 2JA5B 2WNMA 3HOXG 1CHQD 2IPKD 1QNKA 4DR4L 3MP9A 4KKTA 2OXPA 3HVZA 3AEEB 2VQEQ 1U4PA 2MP2A 2ZW0A 3RNCC 2EKEC 3JYUA 3MHSD 2OQKA 2NBUA 2RF4A 2C7NB 3DEPA 1SXTA 1L0WA 1LO5D 4X64Q 1XWEA 2Z6KC 3BZDB 1N34Q 4Y7NB 1SSNA 2DYMA 1JWBD 1TWHB 3A1QA 4W9FA 3DBRB 2PVOD 1B1ZA 1CZGA 3I2ZA 2VRRB 4OWWB 2QJLA 2C9OA 4K2KA 5IGDA 1YN4A 2MHVA 2NB0A 2UUCL 5CTRC 3NZSA 1JWSD 4W9CA 2KAJA 3J80E 3S14H 3PO3H 2B8FA 2B2VA 3CCEA 1OTCA 3TEXA 3K5MA 1ROEA 2I1JA 3DCGA 2IX0A 3QHTA 1E8WA 2GOWA 5HI1A 1JC7A 3K6OA 4RGTA 4JI2Q 4LCDE 4EQOA 3FKYA 4ZRKA 2MO0A 4NPSA 3WANA 3HOYH 1N60A 2XRQD 1WR6E 4NMZA 4R4OA 1K9MC 1H9JA 3GTQH 2QKIC 1Q1EA 3VR3A 1VQMA 2DAJA 5KNBA 4KIKA 1AW7A 2JA8G 1HEZE 1I4QA 2DNEA 2C7HA 1KAAA 4YHHL 2F0LA 2BKRB 1KXLA 1Q12A 3JAMc 2D5DA 3KJPA 2K22A 4NY0A 1MPEA 4F8CB 1ZPSA 3RZDB 3Q3OC 1IXRA 2BVCA 4NJ6A 3ZJVA 2WXPA 1VQ7A 3A8IE 4AYBB 2E8GA 1VD2A 4DWFA 2A6EC 4JPBW 3JSVB 4A3FH 4JQWC 2HIVA 3SK4A 5JOBA 3IAM1 4GOPB 2KN4A 2L1AA 4KHZA 2MO1A 3EROA 2HJ1A 2KN5A 4NB3A 3ZXRA 2ICIA 1EYGA 2GI9A 5M3FH 2NYZD 4ZUIA 2UXCQ 2N7JA 3ABVB 2NN6H 2E2IH 4FF1A 4CDDC 4B9XA 4JGHB 3ZVVA 1I3QB 4Z9CB 1PYWD 2DZKA 2RMMA 1TTNA 4JI4L 3KUCB 4RF1A 4HKQA 1PLFA 1KRTA 3NBHA 5I9OA 2JE6I 5IYBG 1O80A 3K81C 4K8IA 4RHRA 2I38A 3AEDB 5BYQA 1TGZB 1RKNA 2LXKA 2IDYA 2JY6A 1WTXA 1Q10A 2LFNA 4GNXB 3ALBA 3ZQ4A 3BZCA 4ARCA 3NS1A 1FD7D 1XXGA 3CC7A 5I2YA 2ZW1A 2BH8A 3BIID 3T4AC 2CJNA 4LJZC 2JA5H 4DV7L 2K0PA 3NEMA 1C4AA 4HLEA 1WTHA 4AQYQ 3CCJA 4WJWA 1EQTA 3RNGC 4DR2L 1KLUD 4GOPC 1Q3LA 5FOBB 1GJXA 1WYDA 3L13A 3VTVA 4IUPA 3ZNHB 2PLPA 2UYZB 5JXVA 3C0RB 1AP0A 1X6OA 4K3BA 3ZJTA 4IZ8A 3V05A 4Y7NH 4W9IA 1I35A 3EUB2 1TWHH 3PMFA 1HHVA 1Y1VB 5I6YA 4XWTA 4LF6Q 2B3GA 2N9EB 3C19A 1C7YA 2WLBA 1STHA 2WAQG 1FFVA 3CXCA 1WMHA 2WXNA 2BYEA 4GN5A 1EQRA 1SN8A 2FFKB 3V3XA 4GNXC 4P72A 1AN8A 1OQQA 3FAHA 1K50A 4IM2A 3KYCD 2N88A 1PXUA 4K5WA 1L0XB 1XNQQ 2O6VA 2KQ7A 4QIWE 3OMGA 1IZ6A 3I73A 4JIOU 3W9CB 4MTKA 4R4IA 4MH8A 1E90A 3QIAA 4HIDA 1J7BA 2CKHB 2JP1A 1CMXB 1E2ZA 4DBGA 4HEDA 3VAWA 1CJEA 2NTTA 1A6XA 4IG7B 3HOWG 4RKBA 2KDFB 1SSOA 5AZGA 1TKYA 3FRPB 4GOCA 5IODA 2KVMA 2KHJA 3RZDH 4LF9L 1IBKL 1WJNA 5LXIB 3QQ8B 2OTLA 3ZNZB 4ZRPA 1HQMC 5G3LF 1Y69U 1STNA 4HEA1 4C56C 2PYKA 2LJIA 5CBEE 3J7YW 1WX7A 1PRTB 5EDSA 4YCVA 4OZCA 2WYQA 4XQJA 5FLXc 4MEMA 5IT9E 4H02A 3H15A 4JOIA 4DNTB 4PYZA 1QQRA 3ICEA 3NVVA 1CSPA 5IY0A 2LUEA 1UBIA 1ZYRC 3D0FA 1E7VA 1XCTL 2FIDA 4KKJA 5IOIA 3X23A 1IL2A 3VDYA 1UWVA 1I3QH 1SF0A 2VUMG 3APCA 3DDCB 4G11A 4IKGA 2WACA 3TEWA 2D62A 1GHJA 5CV8A 5CYUA 3TQYA 4A3EG 1YQBA 5H1SE 4PS8A 4DK5A 5E6JA 1VCIA 2A69C 1RL2A 4JI1Q 2JA7G 1V1QA 1RRBA 5JJZA 3OMCA 4A4IA 2O2VB 1PHJA 2BKFA 1EOTA 1LUZA 3P1MA 1ENCA 3TIXA 4C3JB 2DENB 5FR6A 3J7AF 1L1OA 1J19A 2E5LQ 3JVZX 3W1SC 3ZRFA 1H8CA 1MSHA 4LMQD 1PRTC 3V96A 5E1FA 1ESRA 3PO0A 4MIUA 2LD9A 1XMQL 1IL8A 1WJUA 1IGCA 2LASA 4TQUS 3IFWB 4DHJD 4YCWA 2F0OA 5L95C 5BN5A 1VLBA 1SMXA 1WOCA 4NXNL 1PTOB 2KJ6A 1Y1VH 1F52A 2KKCA 2KVZA 3SFDB 1A5RA 2IHFA 3NSWA 5FO8B 4OWTB 4HJ9A 2ATWA 3E0JA 1WI0A 4POFA 4YWMA 1QVGA 1YNND 1CKNA 1GUTA 4F8MA 2XSCA 2LVPA 1SR3A 3STBD 2ZM6L 2F0DA 2L0FA 4YSYB 1BF4A 1SNOA 4O1NA 2L9HA 3A56A 1DGSA 2AL3A 1WVLA 2JJQA 4YWLA 2OTJA 3HOVB 1JMCA 2L15A 3WAOA 3OJ4B 3VA7A 4AYBE 4IC7B 3GZNI 2V3NA 2MUYA 4QMGA 2MJ8A 4EKUA 1TR5A 3GV3A 3H91A 4KX6B 1L0VB 3MFGA 1HNXL 4MT5A 1G2SA 3EA6A 4FYDA 1PTOC 1FRRA 4PYUA 4N58A 3V61A 4NW2A 4LNKA 2EQSA 4CKEA 4LNFA 5H8YE 1S4ZA 1C8CA 1P1AA 3SVMA 3MC9A 5CV4A 3I4NG 4K0KL 2RHQB 3HOZG 3R2TA 2PJHA 1FGUA 2WXMA 4ZUJA 1NDDA 2PZTA 5CV6A 2PKOA 1RD9D 4RWSC 2KCCA 4HCEA 1SBBB 1Q81C 2NVXB 4LWCA 2QHOA 2EY2A 5IGGA 3UI3A 3CPWA 1SROA 3TS0A 3K9OB 1YEZA 1BXTA 1E7UA 1VQKA 4IPCA 2KLGA 2A74C 5EAYA 2NCNA 2M19A 3H7PB 3E0EA 2F4IA 3WAMA 1LTGD 2YTXA 1EOVA 2AKWB 2H4OA 2EE1A 3J80c 3AV8A 3MXUA 4FJZA 2Q8IB 4YSXB 4C3JH 1TIID 2Z0SA 3C46A 1P8LA 1SJED 1U0LA 2CQOA 5K5PA 2JEAI 1JW9D 1QUQA 1CM9A 2BDOA 3QCAA 4WRDA 4HJ7A 3GOEA 5ELDA 1DM0B 3ML8A 2KFJA 1U9RA 1K3BC 1B3QA 2SOBA 4JYAQ 4EZLA 3DHIC 3OWFA 1W6JA 4LF8L 1I50B 2JPHA 3BWUD 2KX0A 5KHOA 1N33L 4UY8C 4K6DA 2ZCBA 2KUMA 4JVZA 1PTOH 3GTPB 4A3DH 3CHBD 5D6JB 3QR8A 4RCOA 4FXCA 5GXGB 3FC4A 1N62A 2BA1A 4KLKA 4QJFA 4RG1A 4XDDA 1AE2A 3E3XA 2IO3B 3KDFB 2NPTA 1QOHA 2K28A 2F52A 1DYQA 4QY7A 5C44G 5G5HA 4JLCA 1XQQA 4LTUA 2D10A 4CQNA 4WH4A 4D2KA 2PO4A 2A6HD 4FDBA 4N8FA 4YSZB 1TKWB 3T1YQ 2KQ3A 4C2MB 3AEBB 4URKA 2L5TA 2HE7A 2YTYA 3HOVH 3DVGX 4J6IA 3TL5A 5LMUQ 1KHIA 1YQ3B 3SDZA 5A2QL 3AE5B 4MSMB 1HNZQ 2B2UC 1IBXB 3SD5A 1G8ZD 2SAKA 4LUOA 4C3IB 4TKOB 2WDTB 3VH4B 3Q3MC 1JCKB 2IL8A 3UIPB 5ELOA 1FNWA 2J0TD 2BT6A 2JVCA 2XBBC 5DPWA 3NBIA 4B3ML 2RD0A 1WY8A 2GBKA 2I46A 1DXMA 1K52A 2V4DA 5EKIA 1QT9A 3GD7A 5D3IB 1R4QB 3ULJA 3CCQA 4DR3L 4QUCA 1LABA 1VS0A 2LKVA 1R7SA 1EF1A 2Q2TA 4YY3Q 1BT0A 4X66Q 4DAPA 1FMAD 3SGIA 2NVXH 4BY7B 2D11A 1GUSA 1VQCA 2Z8LA 3AULA 2Y3AA 2OOBB 4E74A 3WOEA 2DY8A 2N7EA 3A9KB 2Z6KA 1C4CA 4GDKB 1A63A 3AE2B 3A8JE 3IVFA 1XPOA 4HDQA 4KHPL 1PFSA 3KW5B 1C3TA 4L63B 3A7LA 1H9KA 2A19A 2RHSB 2SEBD 4QL5A 4EX5A 1ZGUB 3CSFA 1SE8A 3FILA 3M95A 3ULPA 1BOSA 3IFTA 4JBJA 1S72A 1WJJA 1GB1A 3I4MG 1QE6A 3PIP3 4A3KG 4FXDA 4DR5L 4G7HC 2EDGA 3BDCA 1JMLA 3D6CA 4QGUA 3AU5A 2PQEA 1WE6A 1VQEA 4MNOA 4FADA 2R93B 3K5NA 4ICUA 3CMMB 3Q8AA 2K33A 1YHQA 1I50H 5LL6S 4DR7Q 1RWSA 1VZ6A 1FL0A 1RTNA 1LTSD 3GTPH 3BDOA 2OF1A 1BBXC 1L4ZB 1B53A 3J81L 3S15B 4L5TA 4JYAL 1TZOA 1XT9B 3AEGB 4WJQA 4XDCA 4E3CA 2E3TA 4CJ1B 2CKZB 2G4SA 2NTSA 1RFAA 2IYDB 2V0GA 5E3FA 1YJWA 2CHXA 4OZAA 2IHEA 2A68C 1HNWQ 4GSWA 1JORA 3ZIMA 4C2MH 2KCNA 4KSKC 4X65L 2WXJA 5M3MB 4EZJA 4R4CA 2UUAQ 3HGBA 5IT9c 3DMUA 4FF3A 5DLQE 5KNDA 1PV4A 4FF2A 4XZ4A 1JE5A 1EYAA 2HDMA 3RLNA 1WSPA 2UUBQ 4C3IH 4HWIB 1KIXA 1WF9A 4A3BB 1SAPA 4LLGM 3RZWC 1V43A 1KDCA 4PMWA 2BDNA 3NENA 4DV1Q 1T9HA 3DOWA 3ZDMC 1Y8RC 2LHDA 5AJ3L 4IPHA 2E76C 2M0AA 3HUIA 4NJCA 4C7YA 4WURA 1H9SA 4WWMA 3S1MB 5E6PA 3RMKC 3KLSA 1RTOA 2MBEA 4ZCKA 2CU3A 2FMCA 5IYDH 4LNOA 3H09A 2CU1A 4RNAA 1SE4A 1KC8C 4BA2I 2R7FA 1P9DU 1XLQA 3JSVA 4ZKCB 2D3GA 4WWNA 1FJGQ 4GOPA 4CHKA 1DCZA 4WQOB 1B50A 4FBJB 2ZJQA 2WXQA 3CRLC 4BY7H 2FCSA 4PZ6A 3RNEC 5C4ZA 3CSTA 3UDIA 3W1YA 2YTVA 2R7ZB 1IKMA 3L7ZC 2KDEB 4CO7A 2E2HB 2H88B 1IW7C 3OSOA 4IUTA 4HTHA 1CI3M 3H9DA 1HUNA 2V4LA 1X55A 2SDFA 5M5XB 1O7LA 1JROA 4BKSA 5HHDG 1WD0A 5HGQA 3AU4A 4K5XA 3ENEA 3W5VB 2MP1A 4GNXA 2K03A 4QUFA 3PREA 2OJWA 2UXDL 1PH1A 3A54A 1MSGA 2GA4B 3UF8A 1O7ZA 4BA1I 4FHKA 2R93H 2BA0A 5EQ0A 2XNAC 4JK1C 5AZHA 1CA5A 1D1IA 3I56A 4OX9Q 4KVGB 3S9WA 1RODA 4OVUA 4DUYL 2JUOA 1QNUA 4MN3A 3T53B 2K32A 3PTFC 3S15H 3MHBA 2N8NA 5CHWA 1KD1C 2JSOA 2Z4IA 1N36Q 2NVTB 2PTLA 2FUHB 3DWQA 4X3KA 4W9EA 1GKHA 3PZDA 3ZNGC 1L6UA 4IO9A 4HROA 3I91A 2IO0B 3TS2A 3L2PA 5A2QE 3DBSA 3I90A 3M4YA 3PCOB 4RF0A 1MJCA 3RZOB 3ZNID 1VQNA 3RD2A 1HTPA 2LSSA 1YNJC 5TR5A 1NSNS 4DKAC 2WKDA 5M3MH 1OXSC 2K14A 2Q5WD 1TXYA 1S5ED 1X54A 2K3UA 2XK5B 3I5JC 1YJJA 3PF4A 1FEHA 2K5HA 4NPNA 2IW3A 1Y8PB 2YLMA 1BCPF 1RYJA 3H3VC 1XPRA 4X3UA 4ZLTF 3RN9C 2AQ2B 4E6IA 2QDFA 3H7SA 4A3JB 2GVBA 1HR0Q 4XQQA 4HK2A 4MELA 4YWGG 1GB4A 2BF8B 4F88A 4Q5VA 4NXMQ 3VR9B 3L0WB 2EJFC 3S1MH 1KH0A 3ER0A 2KJXA 4C3HB 1R4PB 4KD4A 1WI5A 3UE0A 1A8VA 1JOKA 1Y56A 3GS2A 3RLOA 3W1SA 1PGBA 4A3GB 4WIPA 1S1QB 4ITKA 4MHEA 2AWTA 2RCNA 1UNSA 3PRPB 2PW5A 1EO6A 3DWAA 2F0FA 3J7A5 3PRZA 2V1CC 4IOIE 3EECA 1VMCA 5D14A 4AH6A 2M17A 2JZPA 2B8GA 1TS2A 3W5OA 4A3MG 2DJGC 2OEDA 3AB5A 4XWWA 2ZJDA 2RR9A 4R3DA 3CIRB 4KV6A 2R7ZH 1TIFA 3CRKC 2PW9A 3EFCA 2IGHA 2E2HH 2K01A 3LDZE 2KEEA 1EIYB 4UPAA 3K9PB 4RHSA 3NHHA 4AP4C 5FJ8G 2INPE 1ZOYB 2CH4W 2PIAA 4ZHPA 1HZBA 2F3IA 1HA5A 5M5XH 2JT4B 3I4LA 4W9HA 1BNZA 4GKJQ 3O65B 1C77A 3R66C 2WX0A 4RFBA 3VRBB 1V97A 2K5DA 5FLMG 1BUVT 2ZXOA 1HR0W 1QOAA 4HJKA 4RM9A 2O2VA 5BYSA 4GXBA 4DV2Q 1T0YA 2BB5A 2H1EA 2F0UA 4IN3A 3K5OA 1IBMQ 3ND9A 1BVSA 3H3VH 4G7OC 1G2TA 3OTOL 1MHWC 3J81E 4H13C 1XMOQ 1WZ0A 1ESFA 3ITPA 3BU2A 2R2OA 2KOLA 3HRZC 1Q1BA 3BVZA 1VJKA 4DK6C 1VRAB 2OQ0A 2LJ5A 4HVBA 4HAEA 4GLVB 4Q0FA 3H1UA 5E4XA 5IOCA 2WKCA 3M7NA 2LS01 2NVTH 1DOKA 1SE9A 4CYEA 1Y8NB 4JI3L 2L76A 1VQGA 3SHLA 1SYGA 2CFMA 1HQRD 1XTCD 2MX2A 2N9LA 3RZOH 2QSDA 3GTLB 4BXXH 3H0GB 2J7QB 2RQXA 4YTNB 1PQSA 3R8BA 5IGEA 1VCBA 3NXWA 2K5WA 1JALA 1VQDA 1A2UA 5I6WA 4A93B 4KY6A 2NZHA 1E7PB 3DM3A 1TZ1A 1WGGA 4LF7Q 3D31A 1OFFA 2IGDA 4A3IB 2AQ3B 3UQAA 4NP5A 1T3QA 4CDCC 4IURA 4JCVE 4A3JH 4KZCA 3QAQA 3D4WA 3PT2B 2I07B 4DAVA 1FPYA 3H94A 3OWEB 1FCCC 2FUG1 2Z59B 4FA6A 4C3HH 3BZKA 2JSVX 5CBAE 1OXUA 2UXBL 1YQ4B 4HPPA 4M0WA 1J0GA 3TMPB 3PLUA 1F77A 2JA6G 4JX1C 3CCVA 1SMYD 3D4DA 4DGZA 4A3GH 1C1YB 1K0RA 4DR6L 2HDEA 2X8XX 3PO2B 4ZHOA 4NXML 5D3DA 4MGIE 1SNCA 1I4GA 3GP7A 1VQAA 1EY4A 1X56A 2XTIA 5K36G 4P2CB 4JI6L 1OGWA 2RSOA 2GBMA 3FEWX 4DV5Q 4WWOA 2VZKD 3U9SA 2P5ZX 2N0SB 1PH6A 1T6BX 5E4WC 4L5SA 4KN7C 5HG2A 1EY8A 1J5EL 4A3LG 5JEAH 1FM0D 1AFPA 1ONLA 2QA4A 3NTHA 2O2LD 4I65A 1OTRB 3AE6B 3HOUG 2M9VA 5BMIA 1V81A 2R92B 1MHXA 4GGQA 3H7PA 4CJ0B 1SNDA 3N1XC 4YTMB 1XX8A 3UDXA 4BBRG 3KWVA 2L8JA 2WP8J 3ZJYC 1JB7A 2ON8A 3L4PA 3N9YC 4RMAA 1K8MA 2A5HA 2F0GA 1G6JA 1KJTA 2KHIA 1WXAA 2B2UA 3NRZA 5HFYA 3SK5A 2OCEA 3CCLA 3PUZA 1E10A 1QLBB 2K39A 3IT4B 1TS4A 3MJWA 3HP3A 1IBML 4TQ1A 4X62Q 4XYQA 5EPLA 4GKKQ 4LUZA 2W3RA 1A15A 1VQ9A 2KDMA 1D6EC 3Q3FA 4DAYB 3AE7B 5BR8L 4KKIA 3SR6A 2K5NA 4RGMA 2FE8A 4NKLA 2JZZA 3JW0X 3KDFA 1TY2A 3GTLH 1YN3A 2J52A 1WFQA 3H0GH 4BFRA 5FO9B 3GTJB 2ONQA 3M4OB 2A73B 2L05A 4B3RL 3RULA 4KHVA 1PH2A 4IQZA 4A93H 1WXQA 4XT1B 4LF5Q 3PRMB 4AS1A 4PK1A 1IBXA 1ICFB 1CTMA 2L12A 2MFIA 1FXTB 4R8IA 1A0IA 4A3IH 1EY6A 4H7BA 1EY0A 2ZTDA 3Q6SA 5BMGA 4WAAA 1YJ9A 1FXAA 2CJOA 2RBMA 5GMVA 2I2YA 1D7QA 2PZUA 1PH7A 2Q2UA 5T8IA 3T1HQ 1YVCA 2M8SA 4LF4Q 2EKIA 3RNAC 2CWPA 1SJHD 3G6EA 1VQHA 2KJRA 4DK1A 4OZBA 5AUIA 2E74C 2W3SA 1X32A 4U673 3PO2H 3F2BA 3DBLI 1PH9A 3J7AV 4G57A 4NQKE 1YITA 4DV6L 3WCQA 1E2WA 4PV1C 5IP9H 1PRTF 1V86A 2GB1A 2F0SA 3B9JA 2JQRB 5ISRA 4U68A 1YX6B 5FR3A 1C4PA 3UGBB 4IM0A 1FRDA 3EHVA 1V9JA 2NZ1D 1I94Q 1YHBA 4IUQA 5HKHA 1S5BD 1FYCA 3A9KA 3RNFC 3S1RB 3KLRA 4GDKA 2BQQA 1WTRA 4HCPB 1ZUD2 1EYDA 5GROA 3EJIA 3QB3A 2JXMB 3BYYB 2RKSA 4CDEC 4DV5L 2B63G 1WGDA 3NUHB 2R92H 2MSED 2A4ZA 4TRDA 5DAUA 3W1GA 2LGDA 3KF6A 3AEVA 3RNUA 1D5MC 3EQLC 1PDXA 1MI0A 2PMVA 2VQEL 3ZXVA 5BN3A 3NJTA 2AYOB 2FBWB 2XWBB 4X64L 2WS3B 1N34L 2EY1A 4IJLA 2N1VA 4P73A 4W9GA 3T16A 1GM5A 1UE1A 2N49A 1BBWA 1J6QA 2BCOA 4QQBX 5M9OA 2G1EA 4Y52H 2YEPB 4UDUC 5C3EG 4IWPA 2F0WA 1GHKA 5FKAC 3KWLA 2VB2X 1QF6A 1PTOF 4BY1G 4OXPA 1T0RC 2EMTA 2F0VA 2TSSA 2LGXA 4HN7A 2EELA 5C4XB 4XT3B 3A5ZB 4JI2L 4LFBQ 3N52A 3GTJH 4B3SQ 3M4OH 2I5HA 2YVCA 1QJOA 4BOZB 4MACA 4IWQA 4ZOHC 1SIJA 5JEAJ 5LNK1 2KTRB 3Q6BA 3KUPA 4F7ZA 2RVLA 2Y0SB 3N6RA 4JBWA 3GTMB 3JAMi 3BK1A 2HCCA 2WHIA 4W9LA 3W5UB 1TT2A 1JQ4A 1TVXA 5EKKA 4HIKA 1WTQA 4EQ5A 1NY4A 5EBCA 5C3XA 2EJMA 3OJ3A 2XWJB 2WWZA 4MDKE 4ZK9B 1WCMG 2K8HA 4BWGB 4IFDI 2V3SA 5C0XI 2RPQA 2F0QA 2WDQB 1DOXA 1P16A 2SNSA 2AX5A 1E0BA 1VQFA 2LXJA 4M02A 3GO5A 4A3BG 4OONA 1E5WA 1V1PB 4PZ7A 4KD3A 4K8JA 5J1ZA
chains in the Genus database with same CATH topology
3SK8A 2G9DA 4RAUC 4GDLB 3T13A 1B9MA 3B2FA 3PIO3 4H0LC 3U52E 4J3OD 4RH6A 2DWQA 3BVGA 3F2UA 5J22A 1R9TB 1ICWA 4GLSC 3NWSA 4OL7A 1N61A 2KEDA 1L0YB 3CWIA 2CHBD 2EYJA 5EPJA 2WQYB 1SNMA 3GTKB 1HUMA 4A3DB 1CQVA 4ZQ3A 2DY7A 2L4NA 1UUPA 4EGVA 1I4PA 4TSSA 1JOOA 4ZKBB 1C79A 2BYTA 1XLOA 3VRAB 5G3LD 3HKZB 1S5CD 2FHTA 2VXWA 1F2ZA 3AE1B 4HSPA 4KI0A 3TZDA 2AQ1B 5EE1A 5EE3A 1C78A 1MVKA 2ZXRA 2D9UA 2E75C 5CV5A 4PMBA 1JOQA 2JYTA 4ILWA 3Q8BA 1JR0D 4CKCA 1B9RA 1LTAD 4C1NK 4FNFA 1LT5D 2E2DC 3QO2A 2R6GA 3KBXA 3MXGA 1XLNA 1W6KA 1MI2A 5JPNC 3BYTB 1Q90A 3QOJA 3CKIB 1Y1WB 5I2XA 4ZRQA 3U4EG 1L6VA 1NYQA 1STAA 4DFAA 2MJDA 3IFDA 3HS0C 1EQVA 2WIIB 4XTCS 3HOXB 1YNNC 2MH7A 1NAPA 4C7ZA 4HSVA 3P75A 5A35A 1C48A 5COYA 3P4QB 3PZ7A 1PGXA 1TQOA 3QG1A 2DBYA 2L11A 5IIFA 4G4KA 4RCNA 4DN4M 4BS9A 4CHTB 3HZXA 2WXKA 4OO1G 2E6XA 1NUCA 3DM1A 2NUCA 3FKIB 1F0ZA 1CZWA 2F1MA 1FO4A 1IYVA 3P7JA 3G6JB 2PCFB 2NMQA 1FD6A 4A9AA 1BO0A 1EL0A 5HURA 3DWMA 1JWAD 1PMRA 1DOIA 2CW0D 3TP5A 4ULLA 5ELFA 1HRJA 3PZ8A 5JPMC 3BK2A 1EEID 5DEHA 2W54A 2JEBI 2X6LA 1K8OA 1ZEQX 2AWNA 3RMHA 3P20A 2QDBA 1PZKD 4WAFA 1AZQA 1NI3A 1E6EB 1FNVA 1SDFA 4XQNA 1ACCA 1LTRD 5C0XH 3BS1A 1QOFA 1F9SA 3QWNA 5TSSA 2EYOA 3NVWA 3IAYA 1SB3C 1PFBA 2WB1B 1I4HA 1JB3A 2L83A 4KGTA 1WWTA 3MJ5A 1F2LA 2A6HC 3A55A 2NN6G 3AN1A 2AWOA 1SYEA 1ZXHA 3NPPA 1EY5A 1EM7A 4ZAIA 1HZ6A 1PZJD 1G91A 5KYLA 3P42A 2WAQB 1SNPA 1LT6D 2J7ZA 5G5GA 3D8GA 1TU2B 1VF5C 1STEA 1VZ8A 1YJIA 4PNYA 2L32A 2G9HD 4WQMA 1P7EA 2ACZB 4HJGE 1EU3A 2DN8A 1HZ5A 4V0BA 1XCQL 1ZKOA 3VYTA 5I9PA 3EVQA 1K53A 4DAYA 3HOWB 3ETRA 1U4MA 2CQAA 3SEBA 1B9NA 1LLRD 1ENFA 3PV0A 3GQBA 1A3UA 3SK6A 1CK1A 1ZXTA 2IWHA 4EQPA 3TBIB 1AWDA 3IXSA 3DHQA 4NDXA 1DGJA 1K51A 1U4RA 2JWUA 4TQ0A 1ENAA 3KBGA 2VUMB 2WXHA 5EBDA 3TZUA 1I4XA 4A3EB 1A3TA 4XXEA 2YU9B 1VMPA 2X6GA 3S1QB 5KNCA 1L5PA 4ARIA 2JA7B 2EVBA 4F7XA 2NVQB 1FXIA 2B2YC 2WXRA 2XVSA 1QOBA 4KJOA 1EYCA 3W3AA 1H9MA 4B9WA 3OPOA 2VNUD 4EQNA 4OO1I 3LX0A 4J8QA 1I4RA 2ENBA 3LB8C 5F2DA 3AEAB 3AECB 3EFXD 3DXJC 4LK1C 5IGCA 2OEOA 3SFEB 1RF2D 2WXFA 3E5SA 3Q24A 1OXXK 4A90A 2LUMA 5AFWA 2F0PA 3C3LA 3R2IA 3IAS1 3H8HA 2AUJD 1UWMA 1STGA 2EZVA 1U4LA 2JYOA 4TMAB 3NE5B 1LTTD 3RLFA 2K1BA 1E2VA 3DUZA 1GUOA 2Z4HA 1TKEA 2INNE 5CC4A 1HPCA 1J7AA 1DOYA 2K9XA 4K14A 1EY7A 2M2LA 3WDNA 1Z6HA 4F87A 1KNEA 4KK7A 1GXDC 2SNMA 1V8CA 3I4NB 3HOZB 3R3OA 3R93A 1CFMA 1WRIA 3MC0B 3P1HA 2B76B 1O78A 5C6AA 2F0JA 2F0IA 5KIXA 1HFGA 2B39A 4B08A 2D5GA 4KY5A 2BBCA 2BE5D 4K6LA 1EWYC 5T1IA 2NN6I 3E56A 2X69A 1XF5L 1GUNA 1NR4A 2KHSA 1PUTA 4NAMA 1IKLA 1XEEA 2K6AA 3VR5A 1NR2A 5D65A 2MJ3A 3MXNA 3K57A 2H89B 2CVRA 2Y5CA 1V8QA 1ML0D 4ME5A 3TN2A 3Q69A 1C76A 3Q23A 1BCPD 2IJ0A 2B2WC 4OVZA 1HCZA 1SYFA 3VA5A 4C3JG 5C44B 5M5WB 4US8A 4RA8A 3L3OC 3G7LA 2EYMA 2WDRB 3U9OA 1B3AA 2Y5PA 4XIGS 1DOMA 2AUKA 3DEOA 3URYA 3BVMA 3VR6A 3S17B 3ND8A 1EEFD 3I57A 2LFIA 3RD4A 3I8ZA 1QKZA 4N9PA 1WGKA 1F2RI 3C1EA 3MTSA 1C4QA 1S5FD 1GAQB 4L8JA 2K05A 4H2AA 2PNRC 3DWPA 2E2JB 3TEZA 2V3PA 1BDOA 4QIWB 4FP5D 1KTKA 4MM3B 4QB4A 3AB9A 2J4XA 4R8NA 4L6TB 1TWFB 1JE4A 1S5DD 1F2MA 3ZGZA 1X3QA 3RFZB 1BCPC 1SEBD 1FFUA 4OIJA 1NVID 4N6EB 3D4RA 3I4MB 4A3KB 2NBFA 4FXKC 4KGRA 3LWEA 2BW2A 4JE3B 5CORA 5CGKA 3TDQA 3FILB 5IGFA 2W82A 2A6ED 1LV9A 1N63A 4YIJA 4A55A 2VZKB 2WXGA 3U7ZA 4N59A 2WXLA 1EZ6A 2WU5B 1I6HB 4P6VF 2OT2A 2JYEA 3A8KE 1EU4A 4IUUA 4N9TA 1QCBD 2LY7A 4L2YA 3I9V1 1RCVD 3ZJTA 2EXZA 3OW7A 2NVYB 1SMYC 2O5IC 2L0CA 2YYZA 5BYRA 1OQRA 3MHZA 2B2TC 2YEPF 1UEAB 4WFN3 3MFYA 1KLGD 4CGYB 4NAWB 2QIEB 3TSSA 1QG7A 3MAQA 5JVG3 4KY7A 2IGGA 4Q2JA 2XN9C 3HRDD 3MWYW 3GTGB 4KKSA 1IYUA 1GOZA 5IGBA 2RPVA 2XRSD 5DM63 5BN4A 1FR3A 1H9SB 4C3IG 2K5PA 1PZID 1CZPA 3Q8EA 4H44C 2F03A 4KJNA 3M3YB 3FMCA 4OHJA 1E0ZA 2ID0A 1J7CA 4REZA 4NZLB 5H92C 1D5ZC 4P16A 1Z7TA 3MVVA 2C5CA 1E9MA 1F2RC 1RM6C 3NQTA 1KDAA 2OHFA 1KABA 1RJTA 2BOSA 2LEKA 1T5XD 4L23A 1PFMA 4CKBA 2Q8RE 4QCLA 3AEFB 4US9A 2F0HA 2BTEA 1ZXIA 4ZRZA 3ONAB 3TP7A 3IT6B 1FIQA 1CT1D 1ZYRD 5KRUA 1STYA 1LACA 4LK0M 3OIPA 3C2PA 4DK0A 3CQZB 4HMIA 5CMDA 4J6HA 1OXTA 3AM9A 1A2TA 1I6VC 2A69D 1F9QA 1I7HA 3LNNA 1DD2A 2QEJC 3QOLA 4HMJA 4X3SA 1RFKA 1TWCB 2EY6A 2PZWA 1PRTD 2NWGA 3P4SB 5FO7B 2J53A 2B2YA 1GPXA 2LGIA 1TS5A 3MA2B 2IX1A 1B4OA 4OIKA 4A3MB 1UGJA 1KFYB 2WV6D 2Z1CA 1T5EA 1LTBD 1FGBD 3AE4B 2WINB 3K7AB 1SYBA 2EYFA 1AYFA 1PTOD 4S3SA 2EPBA 4FO2A 3E9SA 3B2GA 2LMCB 4USAA 1PFNA 2BS3B 1WYGA 2ICEC 1MGSA 1QILA 4V190 2KWDA 1F9RA 1MD2D 4RGOS 3PUWA 2J42A 1IUEA 4A6QA 5CV9A 1QWYA 2F0TA 3Q0AA 4QF4A 1KNAA 1ILQA 2IX3A 3NZ3A 3KLSX 4GZYC 3TEYA 1F2YA 1YMHE 4IDIA 1WTVA 5DNFA 3A7AB 1HTLD 3D3RA 1TJEA 2ZXPA 4CJ2C 1N5XA 4B0EA 2QF7A 3BDLA 2VB3X 4HR7B 2JA6B 1XLPA 4L1BA 1D4BA 4PMCA 3K5LA 5ELCA 4FVMA 3TUOA 1CA6A 3Q8CA 4JPSA 2EOTA 5NUCA 3M7GA 4HKZE 3OOCA 3GB1A 2JX5A 5HGTA 3HOUB 4C3HG 2B2WA 2EY5A 1DONA 2RDGA 1SNQA 1EWHA 4BBRB 1XO3A 3M85A 1Q8IA 1UAPA 1BUIC 2R61A 3JAML 1JICA 2MGSA 3AU7A 2LHEA 1B2TA 1OXVA 1GUWA 2D2CC 2QCPX 2HCIA 3X3MA 2EYHA 3VYRA 4XYOA 3U2SC 2F0EA 5ELBA 5JEAG 3K58A 4C80A 3NK9A 4DF7A 3HVDA 3OIQA 5JAVA 2EYLA 2PW7A 5BMHA 2BS2B 1X3PA 5J39A 3NUCA 1RDPD 1LT4D 1A70A 3IL8A 2HUGA 2JA8B 5AUKA 1AZPA 5EKLA 5ELEA 3DWGC 2HTME 4FF4A 4J1MA 1DZ1A 2EJGC 5C5LA 3NVYA 5T1GA 1AEXA 1D5XC 2RA4A 4O42A 1Y8OB 4PQXA 3P4PB 2F3VA 3AE3B 2GRIA 1WTOA 1SE2A 2PMZB 4I7ZC 1VDVA 5D7GA 4JWUC 4B0MA 1EFID 3D6WA 4RKLA 1N5WA 2RDFA 1K83B 1STBA 1FCLA 3EGRA 2B2VC 2KACA 3S2DB 2M56B 2L55A 3IKJA 2MJEA 5C3JB 5C5MA 4IFDH 5K36H 2O5JC 2A68D 1EWCA 1TY0A 3S16B 2JXTA 3W2DA 2QMTA 3RUZA 1BQQT 3L9AX 2B63B 1SFOB 3SR1A 3Q8FA 1GUGA 1PDQA 1B44D 5EPKA 3UI2A 2PPBC 3T3NA 1TS3A 3ZYYX 2CW0C 2FMMA 1EIHA 1D1KA 3E6ZX 4IUVA 4LAAA 5LHY1 1E10A 5MPOA 3P4RB 4KKUA 3I70A 2RDHA 3BG3A 1TYGB 5C2TB 1RHPA 1UWXA 4OW0A 2B2TA 4K2LA 1VZ7A 5C3EB 5FLXL 1D2BA 2WXOA 3KF8A 2FJ2A 4BY1B 3K0YA 2DYOA 1KRHA 3AE8B 3NVZA 3ERQA 3RPFC 2EYPA 1VR9A 5JVH3 4EE2A 1YN5A 1IW7D 2L1BA 2F3WA 4KTAA 5C4JB 1WD1A 3SE0A 1M4VA 1EZ8A 3NWTA 3AE9B 1G291 3SXHA 2N9KA 3C8YA 2KMMA 2M00A 2X38A 3TP6A 3T56B 4XE0A 2ZT9C 2BS4B 1EY9A 3I3CA 1M8AA 1TWAB 3CU7A 1WCMB 2IT1A 4IUNA 2HQEA 4ABNA 2L52A 3T3OA 4X3TA 5LL6X 3PUXA 3PUYA 1ILPA 2K7VA 3VYSA 2Q8TA 3T51B 3NTIA 1JQYD 4UAIA 2KQ4X 4DXFA 1YNJD 1O7YA 3NTKA 3H6MA 1SYCA 3TP8A 4M8AA 4YXDB 2R3ZA 3AH7A 4DQOC 3JAME 4R9WA 4BBSB 3S2HB 1IHZA 1SYDA 4K5VA 5CV7A 3WOFA 1XYIA 4YTPB 1DJRD 1V1OA 3V2TA 3NP8A 1ZDXA 4KN4C 3TMEA 5KYIA 2WXIA 4AQ7A 4HRSA 1NYRA 4RGNA 4IFDJ 2FINB 3GV6A 4ZYSA 5C0XJ 4HCSA 3FPPA 5EE0A 4KMUC 2O4XA 3LWUA 1NENB 5DM73 1QOGA 5I4DA 1QB5D 5EJWA 3J80L 1NCVA 3VQIA 3X3NA 1ZDVA 1WTPA 1C9FA 1II3A 2KA7A 1ET9A 5C3WA 4YT0B 5KGUA 3VR2A 4FXGC 5EGTA 3MZ5A 3GTOB 1BMLC 1YNTE 1WTWA 1LT3D 2F0NA 1TWGB 1HFNA 4WORA 1VF7A 2WDVB 3MXPA 3LYYA 3PUVA 1G6ZA 3O13A 4M1UB 2MEKA 3J9CA 5EE9A 3KK7A 4DXGA 2HDLA 1FNUA 3VYUA 1JWMD 3Q22A 1V1PA 2JU6X 1A3VA 5M5YB 4EVOA 3KQ4A 1BR9A 3FPUB 3S1NB 2TMPA 3VR4A 3OHXC 4JWSC 2K04A 2BB6A 2QILA 2DNCA 4C1NI 5FLXE 1PGAA 2RSNA 1CQFA 1LTID 4ODGA 2LMCA 2W55A 1JWUD 1L4DB 1F9PA 5KEEA 3MEHA 1H9RA 3NQIA 3S14B 2WU2B 3PO3B 4IALA 4A8XC 2KECA 3I72A 1DOLA 3HEJA 1TKGA 1ZE3D 3ZJUA 1BCPB 1KDBA 3C1FA 1IGDA 1PFDA 4PT5A 2BE5C 1J9OA 2F0KA 4DA2A 3AMUA 1VDZA 3FDTA 3HOYB 4ID6A 4DU9A 4KGSA 1MBYA 5C4HA 3GTQB 3VR8B 2PVGC 2DLBA 4CBVA 1EIGA 1SE3A 3AMZA 2N55A 1CHPD 5FK9C 1HA6A 1ET6A 3P63A 2WP9B 1MHHE 4A3FB 4OGQC 2F0MA 1HXYD 1ZP0B 2XIWA 4DNRB 5M3FB 5CR3A 1NEKB 1KF6B 1JRPA 1Z47A 2K5QA 4G7ZC 2E2IB 5IT9L 3QJYA 3FVQA 2MPMA 3HG9A 1J8IA 3LXFA 3K59A 4IFDG 4XDXA 1P7FA 5C0XG 2V4IB 1OO9B 4OO1H 2JA5B 2WNMA 1CHQD 2IPKD 1QNKA 3MP9A 4KKTA 2OXPA 3HVZA 3AEEB 1U4PA 2ZW0A 1SXTA 3DEPA 1LO5D 1XWEA 3BZDB 2DYMA 4Y7NB 1SSNA 1JWBD 1TWHB 2PVOD 1B1ZA 1CZGA 2QJLA 2C9OA 4K2KA 5IGDA 1YN4A 2MHVA 2NB0A 1JWSD 2KAJA 3J80E 2B8FA 2B2VA 3TEXA 3K5MA 1ROEA 2IX0A 5HI1A 1JC7A 3K6OA 4RGTA 4EQOA 1N60A 2XRQD 4NMZA 1H9JA 2QKIC 1Q1EA 3VR3A 5KNBA 1AW7A 1HEZE 1I4QA 2DNEA 1KAAA 2F0LA 1Q12A 2D5DA 2K22A 1MPEA 1ZPSA 3RZDB 3ZJVA 2WXPA 3A8IE 4AYBB 2A6EC 3SK4A 5JOBA 3IAM1 2KN4A 2L1AA 4KHZA 3EROA 2ICIA 2GI9A 2NYZD 4ZUIA 2N7JA 3ABVB 2NN6H 4FF1A 4B9XA 1I3QB 4Z9CB 1PYWD 2RMMA 4RF1A 4HKQA 1PLFA 3NBHA 5I9OA 2JE6I 3AEDB 1O80A 4K8IA 4RHRA 2I38A 5BYQA 1RKNA 2IDYA 1WTXA 1Q10A 2LFNA 3ZQ4A 3NS1A 1FD7D 1XXGA 2ZW1A 5I2YA 3BIID 3T4AC 2CJNA 4LJZC 2K0PA 1C4AA 4WJWA 1EQTA 1KLUD 1GJXA 1Q3LA 5FOBB 4IUPA 2PLPA 5JXVA 1AP0A 4IZ8A 3V05A 3EUB2 3PMFA 1HHVA 1Y1VB 5I6YA 4XWTA 2WLBA 1STHA 1FFVA 2WXNA 2FFKB 1AN8A 1OQQA 3FAHA 1K50A 2N88A 1PXUA 4K5WA 1L0XB 3OMGA 3W9CB 3I73A 4MH8A 3QIAA 1J7BA 2JP1A 1E2ZA 4HEDA 1CJEA 2NTTA 1A6XA 4RKBA 1SSOA 1TKYA 3FRPB 5IODA 2KVMA 4ZRPA 1HQMC 5G3LF 1Y69U 1STNA 4HEA1 4C56C 2PYKA 2LJIA 5CBEE 3J7YW 1PRTB 4OZCA 4XQJA 5IT9E 4DNTB 1QQRA 3NVVA 4KKJA 1ZYRC 1XCTL 1SF0A 4IKGA 2WACA 3TEWA 2D62A 1GHJA 5CV8A 5CYUA 5E6JA 1VCIA 2A69C 5JJZA 3OMCA 1EOTA 3P1MA 1ENCA 4C3JB 3J7AF 1MSHA 4LMQD 1PRTC 3V96A 5E1FA 1ESRA 3PO0A 4MIUA 1IL8A 1IGCA 4TQUS 2F0OA 5BN5A 1VLBA 1PTOB 3SFDB 3NSWA 5FO8B 3E0JA 1YNND 1GUTA 4F8MA 2XSCA 2F0DA 4YSYB 1BF4A 1SNOA 4O1NA 2L9HA 3A56A 1WVLA 3HOVB 3VA7A 2V3NA 2MUYA 4QMGA 2MJ8A 1TR5A 3GV3A 3H91A 4KX6B 1L0VB 3MFGA 4MT5A 1G2SA 3EA6A 4FYDA 1PTOC 1FRRA 4N58A 4NW2A 4CKEA 5H8YE 1S4ZA 1C8CA 3SVMA 5CV4A 3R2TA 2WXMA 4ZUJA 2PZTA 5CV6A 2PKOA 1RD9D 4RWSC 2KCCA 4HCEA 1SBBB 2NVXB 2EY2A 5IGGA 3UI3A 1BXTA 2A74C 2M19A 2F4IA 1LTGD 2H4OA 2EE1A 3AV8A 3MXUA 4YSXB 2Q8IB 1TIID 3C46A 1SJED 5K5PA 2JEAI 1JW9D 1CM9A 2BDOA 4WRDA 5ELDA 1DM0B 1U9RA 2SOBA 3OWFA 1W6JA 1I50B 3BWUD 4K6DA 2KUMA 1PTOH 3GTPB 3CHBD 4RCOA 4FXCA 5GXGB 3FC4A 1N62A 2BA1A 4XDDA 1QOHA 2K28A 1DYQA 5G5HA 4LTUA 4CQNA 4WH4A 4D2KA 2PO4A 2A6HD 4YSZB 1TKWB 2KQ3A 4C2MB 3AEBB 2L5TA 1YQ3B 3SDZA 5A2QL 3AE5B 1IBXB 2B2UC 1G8ZD 2SAKA 4C3IB 4TKOB 1JCKB 2IL8A 1FNWA 2J0TD 2BT6A 3NBIA 2I46A 1DXMA 1K52A 2V4DA 5EKIA 1QT9A 3GD7A 5D3IB 1R4QB 4QUCA 1LABA 2LKVA 1R7SA 4DAPA 1FMAD 4BY7B 1GUSA 2Z8LA 2Y3AA 3WOEA 2DY8A 1C4CA 4GDKB 3AE2B 3A8JE 4L63B 3A7LA 1H9KA 2SEBD 3FILA 1BOSA 3IFTA 1GB1A 1QE6A 3PIP3 4FXDA 4G7HC 2EDGA 3BDCA 1JMLA 3D6CA 2PQEA 2R93B 3K5NA 3Q8AA 2K33A 1RWSA 5LL6S 1VZ6A 1RTNA 1LTSD 3BDOA 2OF1A 1BBXC 1L4ZB 1B53A 3J81L 3S15B 1TZOA 3AEGB 4ARCA 4XDCA 2E3TA 4CJ1B 2NTSA 2V0GA 5E3FA 4OZAA 2A68C 1JORA 2KCNA 2WXJA 5M3MB 3HGBA 4FF2A 3DMUA 4FF3A 5KNDA 1EYAA 2HDMA 1WSPA 4A3BB 1SAPA 4LLGM 1V43A 1KDCA 4PMWA 2BDNA 2LHDA 2E76C 2M0AA 3HUIA 4NJCA 4C7YA 4WURA 1H9SA 4WWMA 3S1MB 3KLSA 1RTOA 2CU3A 2FMCA 3H09A 4RNAA 1SE4A 4BA2I 1XLQA 4ZKCB 1DCZA 1B50A 2WXQA 3CRLC 5C4ZA 2R7ZB 1IKMA 3L7ZC 2E2HB 2H88B 1IW7C 3OSOA 4IUTA 4HTHA 1CI3M 1HUNA 2SDFA 5M5XB 1O7LA 1JROA 5HHDG 1WD0A 4K5XA 3W5VB 2MP1A 2K03A 4QUFA 3A54A 1MSGA 2GA4B 1O7ZA 4BA1I 2BA0A 5EQ0A 2XNAC 4JK1C 1CA5A 1D1IA 3S9WA 1RODA 1QNUA 4MN3A 3T53B 2K32A 3MHBA 2JSOA 2Z4IA 2NVTB 2PTLA 3DWQA 4X3KA 1L6UA 4HROA 3I91A 4RF0A 5A2QE 3I90A 3M4YA 3RZOB 1HTPA 1YNJC 1NSNS 2WKDA 1OXSC 2Q5WD 2K3UA 1S5ED 1YJJA 1FEHA 2IW3A 1Y8PB 1BCPF 1RYJA 3H3VC 4X3UA 4ZLTF 2AQ2B 4E6IA 4A3JB 4XQQA 4YWGG 1GB4A 4F88A 4Q5VA 3VR9B 2EJFC 1KH0A 4C3HB 2KJXA 1R4PB 4KD4A 1JOKA 1Y56A 3GS2A 3W1SA 1PGBA 4A3GB 4WIPA 4ITKA 4MHEA 1UNSA 2PW5A 3DWAA 2F0FA 4IOIE 1VMCA 5D14A 2JZPA 2B8GA 1TS2A 2OEDA 3AB5A 4XWWA 4R3DA 3CIRB 4KV6A 3CRKC 2PW9A 3V3XA 2IGHA 2K01A 2KEEA 4RHSA 3NHHA 2INPE 1ZOYB 2PIAA 4ZHPA 1HA5A 3I4LA 3VRBB 1BNZA 1C77A 4RFBA 1V97A 2K5DA 1BUVT 2ZXOA 1QOAA 5BYSA 2BB5A 2H1EA 2F0UA 4IN3A 3K5OA 3ND9A 4G7OC 1G2TA 3J81E 4H13C 1ESFA 3ITPA 2KOLA 3HRZC 1Q1BA 3BVZA 1VJKA 1VRAB 4HAEA 4Q0FA 5E4XA 5IOCA 2WKCA 3M7NA 2LS01 1DOKA 1Y8NB 3SHLA 1SYGA 1HQRD 1XTCD 2N9LA 2QSDA 3GTLB 3H0GB 2RQXA 4YTNB 3R8BA 5IGEA 3NXWA 2K5WA 1JALA 1A2UA 5I6WA 4A93B 4KY6A 1E7PB 3D31A 1OFFA 2IGDA 4A3IB 2AQ3B 4NP5A 1T3QA 4IURA 3D4WA 2I07B 4DAVA 3H94A 3OWEB 1FCCC 2FUG1 2JSVX 5CBAE 1OXUA 1YQ4B 4M0WA 1F77A 4JX1C 1SMYD 3D4DA 4DGZA 2HDEA 4ZHOA 3PO2B 5D3DA 1SNCA 1I4GA 3GP7A 1EY4A 5K36G 4P2CB 2RSOA 3FEWX 2VZKD 3U9SA 2N0SB 1T6BX 5E4WC 4KN7C 5HG2A 1EY8A 5JEAH 1FM0D 1AFPA 1ONLA 3NTHA 2O2LD 4I65A 3AE6B 2M9VA 5BMIA 2R92B 1MHXA 4CJ0B 1SNDA 4YTMB 1XX8A 3KWVA 2WP8J 2ON8A 3L4PA 3N9YC 1K8MA 2A5HA 2F0GA 2B2UA 3NRZA 5HFYA 3SK5A 3PUZA 1QLBB 3IT4B 1TS4A 3HP3A 4TQ1A 4XYQA 5EPLA 2W3RA 1A15A 2KDMA 1D6EC 3AE7B 4KKIA 3SR6A 4RGMA 2FE8A 4NKLA 1TY2A 1YN3A 2J52A 5FO9B 3GTJB 2ONQA 3M4OB 2A73B 4KHVA 4IQZA 1WXQA 4XT1B 4AS1A 1IBXA 2L12A 1CTMA 4R8IA 1EY6A 4H7BA 1EY0A 3Q6SA 5BMGA 1FXAA 2CJOA 2RBMA 2I2YA 2PZUA 5T8IA 2EKIA 1SJHD 5AUIA 4DK1A 4OZBA 2E74C 2W3SA 1X32A 4U673 3J7AV 4G57A 3WCQA 1E2WA 4PV1C 1PRTF 2GB1A 2F0SA 3B9JA 2JQRB 5ISRA 4U68A 5FR3A 1C4PA 1FRDA 2NZ1D 4IUQA 1S5BD 1FYCA 3S1RB 3KLRA 1WTRA 1ZUD2 1EYDA 3EJIA 3QB3A 2JXMB 3BYYB 2RKSA 3NUHB 4TRDA 5DAUA 1D5MC