2R61A

Crystal structure of the staphylococcal superantigen-like protein ssl5 in complex with sialyl-lewis x at ph 7.4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
197
structure length
195
Chain Sequence
ENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDAHQAFTRIQIFGKDIERLKARKNPGLDIFVVKEAENRTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 3
publication title Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 52
structure length 195
sequence length 197
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r61A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2r61A01
3BVZA 3KLSX 2XNAC 1TS4A 1PRTB 4RGNA 1FD7D 5ELBA 1EFID 1HTLD 4OHJA 1LTBD 1AW7A 5D3DA 1EU4A 3O13A 1HXYD 1YN4A 1SEBD 4NZLB 1EEID 1V1PA 2IPKD 1SBBB 1L0XB 1BCPC 2TSSA 3DWQA 1EU3A 1LO5D 1TS3A 1M4VA 1AN8A 2R61A 2O2LD 3OWEB 1UUPA 1TS2A 3DWPA 1B44D 1JWSD 3EFXD 1FNVA 4RGTA 4UDUC 5FKAC 3SEBA 3BZDB 4C56C 3TSSA 2G9HD 1SXTA 1PRTC 5ELEA 1JCKB 4RFBA 2CHBD 1TS5A 2ICIA 1LTGD 1PTOD 1S5DD 1PTOB 1SE4A 1SE2A 1EEFD 2XRSD 3BVGA 1B1ZA 1I4RA 3EA6A 1FNWA 4L6TB 3BYTB 1FGBD 4O1NA 1ET6A 1JR0D 1F77A 1SE3A 2J4XA 1S5CD 3V05A 1I4PA 1I4GA 4DXFA 1D5MC 3DWAA 1G8ZD 1LT3D 1BCPF 1ET9A 3BYYB 4RGMA 3MC0B 2Z8LA 2XRQD 4L63B 5D3IB 1PZJD 1I4HA 3MFGA 3R2TA 1PYWD 4DXGA 1LT5D 1I4XA 4RHRA 1LT6D 1PTOC 1T5XD 1LTSD 2IJ0A 3R2IA 1MD2D 1PRTF 1EWCA 1STEA 1S5ED 1LTTD 1I4QA 2WV6D 1QILA 4RH6A 1BCPD 5ELCA 4RGOS 1XXGA 1BCPB 1HQRD 1RD9D 5ELFA 5ELDA 2NTTA 4Z9CB 2QEJC 1PTOH 1CK1A 1SJHD 1CHQD 1LT4D 3URYA 2RDGA 1L0YB 1DYQA 2QILA 3GP7A 1UNSA 4ZYSA 1ENFA 1KLUD 1TY0A 1YN5A 1LTID 2RDHA 2SEBD 1PRTD 5TSSA 1PZKD 4BWGB 1YN3A 1S5FD 2XN9C 1BXTA 1LLRD 1KTKA 5FK9C 1CQVA 1ESFA 3BVMA 1JWUD 1DJRD 1KLGD 4K6LA 5I4DA 1V1PB 1CT1D 1GOZA 1XTCD 1RCVD 1RDPD 1D6EC 2NTSA 1V1OA 1PTOF 1SJED 1JWMD 2AQ1B 1TY2A 2AQ2B 1RF2D 4RHSA 1CHPD 4RCOA 1D5XC 2AQ3B 1JQYD 1S5BD 3CHBD 1FNUA 3R8BA 1LTRD 3W2DA 1PZID 1D5ZC 4TSSA 1HA5A 1LTAD
chains in the Genus database with same CATH superfamily
3NE5B 3U9OA 4A3JG 5GAHC 2K6DB 2GB1A 4APVA 1JE4A 5G5HA 5H92C 5EBDA 2KDIA 1E8ZA 3S1QB 2PNHA 3VYRA 4JL9A 3IHPC 2WACA 4EZJA 4DR5Q 5IN7A 2EZVA 2L4NA 3KUCB 2A68D 3ZRFA 1VDVA 4G0NB 4GOPB 2Z0DB 3GTGB 1A8VA 3T51B 1WOCA 1R4QB 3CIRB 3CF6E 4R3DA 3V3XA 4LNOA 3HVDA 4NMZA 5CMDA 1RAXA 4NKLA 5C3JB 1VS0A 1FNVA 2INPE 3A7LA 1QVFA 4ABNA 1IW7D 1SNMA 2WP8J 3PUWA 5KNDA 4C1NI 1NVID 3FKIB 3AFQA 3A8IE 1LTGD 2WX1A 3UINB 1EQQA 2L12A 2KWDA 5AZHA 1JC7A 4DAVA 4JBJA 4LNQA 2KJHB 1HZ5A 1U4PA 3F2CA 2IGHA 5GADC 1NMFA 4K8JA 5IYCG 4BA1I 1VCBA 2BE5D 4ZQ3A 2AL6A 5EBCA 1JJCB 4ALPA 1B70B 3HOXG 3TRZA 1IP9A 2AEHA 3SK6A 3IVFA 2ZNVB 4BY1G 3AV8A 2CS4A 2XVSA 4P1BC 5LHY1 1PXUA 4DV3Q 4BBSG 4KSKC 4X3TA 3NTIA 3VTUA 1WIAA 1N36L 4G57A 4YCUA 2HHHQ 4B0EA 3J81i 1TR5A 3WA0A 4WJWA 1SYEA 4YHHL 3CCUA 3D4DA 4HCPB 3E0EA 4A90A 3U7DA 1LTSD 1XPRA 1NUCA 1PRTF 5GXGB 1UE6A 3I4MB 4K2LA 2OOBB 1EF5A 1QZGA 1LTTD 5ELCA 1BVSA 2EYJA 1X6OA 4RGOS 3OW7A 2VW9A 4QB4A 4ULLA 2BYFA 1TQOA 3D4WA 2EXZA 5EE9A 2FINB 3GZNB 1EY0A 2XK5B 5M3MH 3S14H 3ULLA 4ZYSA 2F4IA 3FAHA 2OEDA 3QIAA 3ZNID 1TZ1A 4ICUA 2N49A 3ZUNA 2J53A 3ZXVA 1PYBA 3SK4A 4NAMA 4IOAA 3BVMA 1C9OA 3IAM1 4L2YA 5IGGA 3MHSD 4GKKQ 1IBXB 5I4DA 1V8CA 2NN6H 3NSWA 4DV4L 3AE6B 1KOTA 2JK8A 3HKZE 5G2NA 4XQJA 2KANA 3RLOA 4G3XB 2PQAB 2A19A 5BYSA 3KF6B 1N34L 1TXYA 4RAUC 4FLHA 2M8SA 4UY8C 4K14A 3J7A5 4PYUA 4OGQC 3AM9A 1Q5WB 2DJFC 1EYDA 4EE2A 1SYFA 1PLFA 1C78A 3TZDA 3MXUA 1DOMA 3RULA 1F9RA 4CDCC 4PZ7A 3CRKC 4Y52H 4DAYB 1QOGA 1ZW7A 4HIMA 1HZCA 2A8VA 4CBVA 2B8FA 4OHJA 2N78A 3N52A 3OYYA 1S4ZA 1D3ZA 4CDFC 2N8NA 1EF1A 3L13A 1JORA 4FF3A 2YV5A 1RRBA 1V9PA 1U4RA 3H0GH 3QG1A 1PH1A 1PGAA 1YOVB 2MA9B 1PA6A 1C7YA 4JI2L 1V1PA 2IHEA 1EU3A 4US8A 2FMMA 1CI3M 4IW0A 1K3RA 1NR2A 2I46A 3HUIA 4LWCA 5CV6A 3K9PB 3MP9A 1J5EQ 3PLUA 3WALA 4CHKA 1SNDA 1UELA 4KV2A 5BO4B 4A93G 4I6LB 4O42A 1LM8B 4F88A 2EKIA 5DLQE 1TYGB 3ECIA 3TS2A 1C4AA 4POGA 5C3EB 1TWAH 1RM6C 3Q69A 2QMTA 1B3AA 3PV0A 1PRTC 2A6HC 4G7ZC 2KK8A 3QCAA 2PNRC 1CFMA 1TT2A 5KNBA 3S2DH 4A3GH 3A9JB 5L83A 1YVCA 1FCLA 1K8RB 3W9CB 5LMUL 2GLSA 1NJIC 3DVGX 4DR1Q 4IN3A 1HZ6A 4PMBA 2GOWA 1KXLA 1RWSA 4KY5A 2JA6B 4ANXA 4ZRJA 1ZYRC 3S15B 2J4XA 2QF7A 3H3VH 2YEPF 1VQJA 1GUWA 3HOZH 3S1QH 3AE2B 2B63G 2K52A 4K8IA 1QLBB 1LACA 4DR3Q 3VQIA 1S1QB 3BYYB 4WRDA 4HK2A 2EYLA 4GXBA 3A74A 2KHIA 1LV9A 4JIOU 1KIXA 3GTGH 4N8X1 2QDBA 3K58A 4EKUA 2SOBA 3CRLC 3H8HA 2K9XA 3PREA 2WXKA 1E22A 1LT5D 4D2KA 4JI0L 1ASZA 4NXNQ 3T1HL 3T1YQ 4WWMA 3DVNU 4HROA 2KX3A 5CV9A 2LWPA 5EAYA 2FNJB 2IGGA 3R7QA 2X38A 5C6AA 4LF4Q 1R7SA 5C0XH 3RD2A 2D5GA 4PQXA 2PZWA 2JSOA 4LFBQ 3L3OC 3MWYW 2KTRA 4PG3A 4WJNA 2PMZE 4LF6Q 3RZOH 1KL9A 3U2SC 3VA5A 4G4KA 3NZSA 3Q8BA 3EC8A 1YN5A 3FPPA 1F1HA 3DOWA 2Y5CA 2IX3A 1LTID 3HM3A 4IJLA 3PO2G 4OVUA 1YN3A 3E0JA 1SFOH 4F1SA 3H94A 2NBUA 3Q8DA 4KD3A 2MH7A 3CMEA 2JA8G 5FK9C 2LGYA 3PLVA 1DJRD 1II3A 2Z0EB 4F7ZA 3HZXA 1A63A 3KYDD 1GOZA 4JW0A 2A5HA 4HCSA 5AJ3Q 3CKIB 1B9NA 1TY2A 2VL6A 4XYOA 4DK3C 2DZIA 3BS1A 1G91A 3PIOA 2PMVA 4DV0Q 1FXAA 4WIPA 2W3RA 1KRSA 1ICWA 3R8BA 1E1TA 2ACZB 3RR5A 1SLJA 1CA5A 2OJWA 1A3UA 4CDDC 3LYYA 1I3QB 1RODA 3M85A 3OTOQ 1Z2MA 1QQRA 1VF7A 3CQZH 1GD7A 3MEFA 3KLSA 3W5UB 3VR6A 2O2VB 1EOTA 2KFJA 2YLMA 5IGDA 2LVOA 2AUJD 1Y1VB 3GTKB 4DR6Q 1N62A 1TIID 1FEHA 5FJ8H 4GN4B 4ZLTF 2KBNA 1YIJA 4REZA 4RMAA 4IQZA 3P1MA 1K0RA 3SR6A 1N32Q 5EE3A 5AUKA 2JT4B 2L55A 4IG7B 4C1NK 4I7ZC 5AFWA 4HJAA 2Y0SE 2N9PC 2ON8A 3PT2B 5EKKA 2DGYA 4Q0FA 2EELA 2JA7G 1MHHE 3KWLA 1WF9A 3OWEB 4AYBB 2C9OA 1Q46A 4RGTA 1KFYB 3DCGA 4XWWA 4DV2Q 3ZGZA 4IJHA 2GBRA 4C3HH 2GBMA 1H9MA 3ZJYC 3NOBA 1NBWA 4P72A 3I3CA 5L37A 3M9BA 3TZUA 1V5TA 3J7AF 1PTOB 1SE4A 5ELOA 1ICFB 3P4PB 4CQNA 5J1ZA 2OWOA 2F1MA 4H2AA 2WXGA 1EWYC 4W9JA 3EA6A 1PHJA 4X62L 2CJOA 3ZDTA 1SRUA 3J7YW 1MHXA 2KACA 2VQFL 4OONA 1OXUA 1SE3A 2MSED 1I4GA 2PI2E 4HMIA 3F2BA 2BQQA 2EMTA 3NVVA 3WANA 1IBKQ 2UUBQ 2J0MA 2IHFA 5AZGA 3DWAA 4A3JB 4MT5A 2Q2TA 2ICEC 1Q3LA 1N9WA 3H15A 1X32A 5IKCM 3I70A 4TV3A 3CU7A 4HAEA 2DLBA 1YJIA 2H89B 4BBRG 4AJYB 2RHQB 4OL7A 4GNXC 2IJ0A 4Q5VA 2MQJA 1RJTA 1NCVA 4S3SA 1GM5A 4JI4L 3TP7A 5KHOA 3UE1A 2WV6D 5C3EH 1NSNS 2NYZD 2KFKB 2MEKA 2MJDA 2VZKD 4JLCA 1H9SB 4MM3B 1F9QA 2B2WA 3K7UC 2QGQA 1HNZL 4DXAB 4N9TA 4EQOA 5KYIA 2L7RA 2K8HA 1AARA 2DYMA 4DN4M 3NPPA 4ZRQA 3ZYYX 3V6CB 4CKCA 3NS1A 1YNTE 5CHFA 2VH2A 4MH0E 2WB1G 3RN2A 3S15H 2MBHA 2WXOA 3UDGA 5GQOA 3KF8A 4HCEA 4JI1L 2KUMA 3S2HB 1C48A 4R1JA 1P1AA 1SDFA 3DM3A 2KCTA 3CCJA 2LXAA 4GDKA 4MN3A 1ILQA 1J7AA 2BVCA 1L0WA 1E24A 3NBIA 2LVPA 3HOXB 2K22A 2RGFA 4BY1B 4HPMB 2FUG1 4X64Q 1SGHA 4HJGE 3IFWB 1G6JA 3V60A 4M00A 1VQAA 5E4XA 4WORA 1I50B 4MGIE 4RKLA 3H7PA 1JMCA 1PFSA 3TCAA 1J8CA 4BXXG 1LTAD 2B2VC 2A69C 2IO2B 4RNAA 4ME3A 5IWAL 1UGMA 5FLMH 3QAQA 4S0RA 4A3OA 1VQOA 2A6HD 1E90A 3VR5A 4FYDA 4OO1H 4GNXB 1CZGA 2HDEA 3QOJA 2JWZA 1YHQA 2JZZA 4TQ1A 4B9KA 2JJQA 3T4AC 2B2YA 1JMLA 4EUTA 4LJZC 5L95C 1J8IA 3IL8A 2LGIA 2K50A 4HVBA 4WQOB 3CC4A 4HKQA 4W9CA 2L9HA 2IGDA 4Q2JA 3ZIMA 3IXSA 2M4NA 2KCMA 5GROA 3IT4B 4A3EH 2CU3A 1IBMQ 1XQQA 4W9EA 3UIPB 2LFNA 2LGDA 4IFDJ 4DV7L 4LNKA 1KAAA 3O65B 3EIVA 4DK5A 2AX5A 5FO9B 3HOUG 1E2WA 1MIUA 1TWFB 1T6BX 3HOWH 1WJNA 2NS5A 1N33L 5G3LD 2EYMA 3R93A 3U4VA 4C3IG 4K1RB 4CYEA 3MTSA 1TS5A 2EJMA 1DOKA 5IYDH 1GUOA 1N5WA 1TWHB 3KFUA 4P2CB 4CKBA 2NVXH 2W55A 4KI0A 3EHVA 4LNFA 2XRSD 4ZCKA 1QNUA 3F2DA 1OEYA 1VRAB 3VH3B 3VUXA 4R4OA 4V0BA 2ZJRA 2OTJA 1NAPA 1EUVB 1UWXA 2Q2UA 1WI0A 2D3BA 2LUEA 1ET6A 2FBWB 1WY8A 3DHQA 1KNAA 1F9JA 5IP4D 4AQYL 2INNE 5BYQA 3I4LA 2KJ6A 1TBEA 3S2AA 2FUHB 2NUCA 1WJUA 5JPNC 3EFCA 4PZ8A 3UQBA 1G2TA 1H8CA 1GC7A 4L63B 2KECA 1ONLA 1BBUA 1STAA 2IX1A 4BY7G 3W5VB 4MACA 4LF5Q 4RHRA 3ZJVA 3ZKJC 3OPOA 4DR4L 1ACCA 5E7NA 2IWHA 3WDNA 3SVMA 2NZOA 1V80A 3GTJH 1IBLL 2Z0SA 1RFAA 1UGJA 2LZ6A 3NUHB 2L1BA 4A93B 4IWQA 2EJGC 2E2IH 1PTOH 1HUNA 4B08A 4P1CC 1SJHD 2K7VA 3URYA 2NBVB 3DWMA 3WAOA 1QCBD 4LK1C 4L5SA 4DFAA 1TKGA 5BMHA 3JAME 1K51A 3RCZA 4HCNB 2I38A 1Z6HA 1DOIA 4HPPA 3RZWC 1BXTA 1IW7C 1U5KA 2Z6KA 2IY1B 1OXSC 4A3JH 3NXWA 4GLXA 3S16H 1P3QU 3KBXA 1CT1D 1X65A 1EYGA 2B3GA 4K0KQ 2BDNA 1RDPD 1EIHA 1EIGA 2B63B 1CM9A 1FFUA 3AH7A 2AQ2B 1JT8A 4RHSA 1XNQQ 1MSHA 3APFA 3NVWA 3NZUA 3RNAC 2DYOA 2BE5C 2KKCA 3K7AH 3KQ4A 4DAPA 2JZ3B 3QQ8B 2EYFA 1N6ZA 3QO2A 1JQ4A 1GC6A 2VQEL 4JOIA 4A3CG 3JAML 5IE8A 1Q7YC 2QDLA 1J7CA 5KEEA 2O6VD 3E6ZX 3W5OA 1K73C 3PF4A 1XLQA 3PRMB 3PV1A 4EOYA 1PH3A 3P42A 1X3FA 1DCZA 2ATWA 2YVCA 1YQBA 3T1HQ 3DQVA 3L7ZC 1U4MA 3BJUA 1T5EA 3FP9A 1YJNA 4V190 4IFDG 4IM0A 3HS0C 2NR2A 2CKHB 2WU2B 5C44G 3IFDA 3N6RA 1C4QA 4QF4A 2RPVA 5CC4A 1Y1WH 1SEBD 1E7UA 2N9LA 3AULA 2ZM6Q 4KZCA 2KEDA 3D0FA 2MHVA 2AYOB 1IYUA 4LF9L 1GVPA 2WDTB 2PVGC 1M4VA 4J6HA 5IYCH 3PO2B 1JRPA 3A4SC 3DEOA 1PH5A 2LRUA 4XDCA 1UUPA 3HOXH 2E5LQ 1PH6A 2JA8B 3IBEA 1EY4A 3NTKA 2NBFA 2HDMA 1Y14B 1WTXA 3Q3OC 3T9LA 2X6LA 4CO7A 2Q5WD 2VB3X 2CHBD 5BR8Q 1I50H 1PH2A 5IYBG 1GUGA 3EUB2 2L0TA 1TU2B 2JF5A 1EQVA 3HP3A 1FFVA 1YJWA 4L1BA 3Q3MC 1DONA 2D3AA 4F87A 4WJPA 4KN7C 2WGSA 3DHIC 1KNEA 1CJEA 4A3MG 2CJNA 5BYRA 1HCZA 4PS8A 3VR3A 4DXFA 2JEBI 3KJOA 2JU6X 1TVXA 5E3FA 3SU8X 2K5QA 1JW9D 1NENB 3HIZA 4L8JA 3M7NA 5JZEB 5I9PA 3P75A 4DR2Q 3VR2A 1WTHA 2NVQB 4B3SQ 1E8YA 4LDTD 3EQLC 5FO8B 1IXRA 4JK1C 3G48A 4LFAQ 1E0ZA 1ZPSA 3M3YH 4A75A 4NXML 1T5XD 4YY3Q 2R7ZG 2DHZA 2RVLA 3A7AB 1K8OA 2WXMA 1CKOA 1I4QA 1I6VC 1TWFH 4G7HC 4IUNA 4DQOC 1I94Q 2JA7B 2K1FA 3WIMA 4R8NA 2UU9L 2F52A 1UE7A 1VQFA 1MI0A 2JQRB 1AZQA 4A4IA 2I5LX 1NI2A 3KBGA 1D1IA 1OQQA 2DNFA 2O5IC 1VQNA 1MGSA 1WD0A 4ASWC 3Q14C 2ZXRA 3OIQA 4JI3L 3TBLD 3VXWA 3PUYA 2K03A 4DUYQ 1XCQL 3E3XA 2IO0B 3J7AV 1WH3A 3G6EA 1Q1BA 2XIWA 2RD0A 3L54A 4KIKA 4OXPA 2WQYB 4C3JH 1JWUD 2I5MX 4DV1L 3C3LA 3RUZA 3WOEA 2ZJPA 5E6PA 2DY8A 1Q1OA 2VS1A 3T3OA 2I07B 3ONSA 3N1XC 2MUYA 3A4RA 4TKOB 3V2TA 2E76C 2LGXA 1JWMD 3FVQA 3ZXRA 1P0RA 2PPHA 2PTLA 2N88A 3BU2A 2BS2B 5DEHA 2WHIA 4FXDA 5MPOA 4KY7A 1OXVA 3E9HA 1S3SG 3RLNA 1ZXIA 1ZXHA 1QWYA 2WXNA 3R2IA 4BBRB 4ITKA 3P4QB 2M17A 4W9GA 1GXDC 3QJZA 4X66L 5ELBA 3SGIA 5E6JA 1EFID 2WKDA 1XF5L 4MGKE 1HNXQ 5M3FG 2BYTA 3HOVH 4MIUA 5JEAJ 2NVUI 2LVQA 2K5NA 5DPTA 4NAWB 1IL8A 2HIXA 2ID0A 4R4TA 1YI2A 2J52A 2D9UA 3C19A 3DBLI 4HXDA 2RQXA 5J3BA 3DMUA 2E2HB 1WRDB 5C4XH 3DBRB 1HTOA 1SBBB 2D5DA 2QC8A 1PDQA 2E74C 3CSFA 2PZUA 2WB1B 2EYHA 4IFDI 5GAGC 1L6UA 2EDGA 2DYBA 4K5VA 4KLKA 3R66C 1UE1A 3B6YA 5K36G 5CGKA 5K5PA 4KVGB 1PFNA 3JAMc 3QHTA 3CCQA 1WR6E 5CX3A 3ML8A 5AEKB 3NELA 4PS7A 1WTWA 1MJDA 1L1OA 2Z9HA 4JI1Q 3WAPA 3K9OB 2G4SA 2MBEA 1K9MC 1NMGA 1S5DD 1T0SC 1HHVA 1VJKA 2KT7A 2OJRA 1ENCA 3VYSA 2PIAA 2KC2A 1BBWA 1B1ZA 4WURA 4KTAA 3TDQA 2BB6A 2K0PA 1LABA 1PH8A 1XO3A 4N58A 2UXBL 1UAPA 1QE6A 4YWKA 1UH6A 2N3SA 2N1VA 2WXRA 4QIWB 4L23A 4JI7L 2BTEA 2L11A 4HEA1 1F2YA 2PE9A 4ARIA 1VQDA 4GDLA 1VQCA 2G9DA 1B9RA 4LF7L 2Z4IA 1LT3D 2F0SA 5FLXE 1YJ9A 1D4BA 3HOYH 5IWAQ 1E7VA 3QWNA 4K7UA 1RFKA 4AQ7A 4JG2A 2F0GA 4LF8L 2M9VA 5HGTA 4OW0A 3U4ZA 1OXTA 3MFGA 5IOIA 4RF1A 1SNOA 1XNRL 2B2UA 3BK1A 3I72A 4NW2A 1JJ2A 1C9FA 1EYAA 2UUAL 3AMZA 1JWAD 1KRHA 1VQGA 3F1ZA 1W6JA 4YSZB 3K5OA 2F0HA 1S40A 4JC0A 4WJ4A 2G45B 4K3BA 1XXGA 1B3QA 1HR0L 3MA2B 3NBHA 4ZRIA 1YITA 3X3MA 2BS4B 5IOCA 1LT4D 3QX1A 3CMAA 3HOUB 4HMJA 1WX9A 5AZFA 3S17H 4C3IB 2WIIB 2LRWA 4P73A 2KCCA 5C3XA 2SEBD 5FLXL 4DA2A 3IRBA 1KJTA 3D32A 3Q8AA 3ALBA 4KKUA 2PYKA 1IHZA 1KTKA 1NY4A 1VDZA 5CV8A 1L2FA 4PNYA 3S1MB 3DBSA 1V1PB 1BF4A 2HJ8A 2WDQB 4AS1A 1XTCD 3I4NH 3AI5A 1F0ZA 2N55A 1WE6A 3A9KA 5HURA 2D07B 4RG1A 5CHWA 2REXA 2RPQA 2WS3B 5J17A 1WJJA 4B3RQ 1KHIA 4A76A 3P1HA 1QG7A 4LNIA 4C7YA 3LX0A 5EPKA 4P75A 5JHAA 4ID6A 3VR9B 4MSQB 1KDAA 5JEAG 1YIWA 1DD2A 1EQRA 1UZXB 1U9RA 1MBYA 4BY7B 4KJOA 3TP5A 4JI6L 3PGZA 1LGRA 3L08A 1IYFA 2PKOA 3AEBB 4B9XA 1N61A 1TWGB 2BF8B 2XSCA 1TS4A 1V5OA 4IUQA 4POFA 2IO1B 4MGZE 1BR9A 2K75A 1FXTB 2Y3AA 4BFRA 1QVGA 2KHJA 3BDOA 4FNFA 3U8ZA 5IP7H 3PZ7A 3TEZA 1HZBA 1I5FA 1RL2A 1STBA 2HCIA 1OO9B 3LWUA 3OMCA 4OX9L 1TJEA 4MELA 2IDYA 2KMAA 5G3LF 4FA6A 3JAMi 1PUTA 3KDFB 1H4RA 2MJ3A 2K3UA 4ODGA 1L0XB 1VQLA 3JVZX 3MTNB 1VQHA 2CVRA 1UF0A 1VD2A 3N20C 3K81C 4NB3A 2RDBC 1WRIA 4B0MA 4XC2A 3EFXD 2VZAA 4LUVA 4BOSC 2AWTA 4UP7A 2Y5PA 4C56C 2EIFA 2RF4A 3TSSA 4XDXA 4HJKA 4RMFA 3ITPA 1WCMH 1BDOA 2E2JH 1GAQB 4J1MA 3PPAA 1WXVA 1XCTL 3NENA 3KWVA 4C4VB 2J0TD 2Q8TA 1AZPA 1SE2A 3TMEA 3GTMB 1CKNA 2CWAA 2KTRB 3ZO5B 1Y8OB 1FGBD 5CBEE 2EY6A 2IYDB 2NVYH 1XLNA 5M9OA 3LJ3A 4JPBW 3FDTA 4HJ7A 4GSWA 3V62A 1M8AA 2N7JA 4AIMA 3NWTA 3GTLB 5C1ZA 1RTOA 1OFFA 2R6GA 3KVFB 3DBHB 5I2YA 4HSPA 4YCVA 3DEPA 2VQEQ 4ANUA 2QKIC 4X3SA 2E2HH 3VA7A 1K8GA 4A3DG 1PZJD 1RLFA 3M3JA 1X54A 1BQQT 4QUFA 5C44B 2DJGC 5CORA 1CA6A 3PCOB 4YWLA 5CR3A 1A15A 2UXDQ 2R92G 4A3LG 1BNZA 4N9F4 1CTMA 5HGQA 1R9TB 1WGKA 2UUCL 1EWCA 5COYA 5LMNL 4JYAL 4KHPQ 1OQYA 2YTXA 5I9OA 4EQPA 1NNXA 2KXJA 3GS2A 4NPNA 5IO9A 2KMCA 1FGUA 4ZYNA 1QZEA 4GB9A 2Q8IB 4H0LC 2VZKB 3NK9A 1YX5B 2BYEA 4GLVB 1ZDXA 4MTKA 3B2GA 3EN2A 2NTTA 4M8AA 4X65Q 4NQLB 2FJ2A 2WAQG 4DNIA 2KOXA 4PS3A 4JI5Q 3I7FA 2INDC 2MFIA 1JOOA 1XX8A 4FJZA 1JJGA 1S5FD 4GU2A 4KJNA 2GRIA 2XN9C 1MHWC 1E2ZA 2R2OA 2F0IA 5AUIA 3U7ZA 5D65A 1KLGD 2EQSA 2KLGA 3ERQA 2B2WC 4A3MB 1ZOYB 4IPDA 4JCVE 4EZKA 3AB5A 1YX6B 1IBXA 2R7FA 3SK8A 3VYTA 3MEHA 3VHTC 3MC9A 3QJYA 2RHSB 4HIKA 4A3IG 4AH6A 4NJ7A 1O80A 1IZ6A 3FKIH 2CU1A 5CBAE 1IKLA 1O78A 2PQAA 3KLRA 5IGBA 4LFCQ 1HE8A 1WM3A 3PSIA 1IL2A 4JV5Q 2NCNA 1VQ4A 1LTRD 1SYBA 1EWHA 3KF6A 3AE8B 4NNJB 5M5WB 4TSSA 2LFIA 2F0JA 5EE1A 3HM6X 2DX5B 2BKFA 3I4OA 4KHVA 2DUDA 3MXNA 5FLXc 3L0OA 3LGJA 1V97A 3UF8A 3OIPA 1IKMA 2XNAC 3K80C 1PRTB 3RNUA 4DUZQ 2R7ZB 2W9NA 4YTMB 2X6GA 5JVG3 3HOUH 1P16A 3AEEB 3Q8EA 4C3IH 2Z59B 2WINB 1Y8PB 2MBQA 2M2LA 5EE0A 1F9PA 2DAJA 4GLAC 2F0OA 2VB2X 1HXYD 2J0JA 3ZNHB 2VY3A 1BUVT 3KW5B 3CPFA 2FAZA 2WXJA 4NZLB 2N9KA 2QW7A 3DWQA 3PVLA 2MCNB 2L83A 4K7SA 3B9JA 4ANWA 1XMQQ 3QARA 2R61A 5IP9H 2L32A 3LB8C 3I4MH 1SNQA 3CCVA 4HDOA 4ZUIA 1XMOL 4ZRZA 1I7HA 1TTNA 2H88B 1Q81C 3M62B 2B2YC 1YQ4B 3K6OA 4DV5L 1DGJA 1BOSA 3B08A 5NUCA 4K6DA 3KLWA 1FM0D 2K6QA 2AHOB 2VUMG 2JUOA 2ASBA 3TEYA 4BY7H 2L52A 4MJSA 1FNWA 2IO3B 1N60A 4K2KA 4A9AA 3PO3G 3T3NA 3BDCA 1YBYA 2VH1A 1DOLA 1FJGQ 3RMKC 4M0WA 2A6ED 1K83B 1AH9A 4L5RC 1HFNA 1T0RC 2LKVA 3U52E 5LLIA 5IGEA 3JSVA 4DV6L 5IGCA 2J42A 3U58A 4GN5A 4GDKB 2GVAA 1U4AA 1WMHA 5M3FB 3MVVA 5GMVA 2F0EA 1UD7A 1BO0A 1PYWD 2GBKA 4DXGA 1GUAB 3APCA 1F2LA 4MHEA 2Z6BA 2PLPA 1QOHA 4B3TL 4FXCA 2CHWA 2V4IB 2ZXOA 3CD6A 2J7QB 1S5ED 1WYWB 4XTCS 3OJ3A 4JE3B 5M3MG 4N8FA 3H7PB 2RSOA 3TP6A 1HQRD 3JC66 4M02A 2JA5B 1ILPA 3Q8FA 1WXMA 1STNA 4HIOA 4GKJL 3NQTA 4DR7Q 1CHQD 3QOLA 1WXAA 3GTMH 3A8JE 3PUXA 3T53B 1EIYB 2PI2A 3X3NA 3UI3A 5C0XJ 4HWIB 3V96A 3K5NA 3LNNA 3KUDB 4P74A 2E8GA 2NN6G 2FIFA 2R7DA 2KO3A 3HFZB 1LLRD 4A3KG 1HNWL 3ENEA 2OHFA 2W54A 1RYJA 2GI9A 3GTLH 4AOFA 2I1JA 2A1AA 2MBOA 5KIXA 1H95A 4OWXB 2F3VA 3RMHA 1ZGUB 4PT5A 2OQKA 4BKGA 3SR1A 2YEPB 4OZAA 2K6AA 1V1OA 3BDLA 1C8CA 2K5VA 1O7ZA 2D0OA 4BAXA 1Q1EA 4X3UA 4JI7Q 1CHPD 3P63A 1JWBD 2AKWB 2ZCBA 1SN8A 2C35B 5CV4A 1NE3A 3T16A 4HRSA 4KSLC 2ZTDA 1SYDA 2M00A 3W2DA 1WX8A 2K39A 3ZJTA 3VUYA 3MXGA 2Z6KC 1WJ6A 2RBMA 5EJWA 2D62A 2JA6H 1C4PA 2KZRA 4OEMB 4QL5A 2E3TA 5EGTA 2F0DA 2O6VB 4N6EB 3Q6BA 1V8QA 4IKGA 2N7DA 1HTLD 2EYOA 3H0GG 4FF4A 3ZTCA 1ZDVA 1NDDA 1CKMA 1XEEA 1QUQB 4BKSA 2QCZA 4W9LA 4QUCA 3M4OB 2A5UA 3M63B 2WXPA 4FADA 5IYBH 3PSEB 3D31A 1W2BA 3ONAB 3SHLA 4CJ0B 1H9KA 3D3RA 1VQBA 1WTPA 1Q90A 4YL8A 4YSYB 2NZHA 3ZDMC 3W3AA 4BBSB 1LO5D 4JOIC 1TS3A 2ZTEA 2F4VL 4G7OC 2V3PA 2KCNA 1V86A 2O2LD 2XWJB 1VQ8A 1TS2A 4UDUC 2B76B 1JWSD 1O7LA 4WAFA 1CSQA 1STYA 2R93G 3BZDB 1N36Q 1WTOA 4AYBE 4EX5A 3I9V1 1WTVA 1QT9A 2JYTA 4KD4A 1W3SA 4RFBA 4R8IA 2F0LA 4YHHQ 4ILWA 1VLBA 2V3NA 5EQ0A 1LXDA 3ZVVA 4FO2A 1IUEA 4DR5L 4W9FA 3HOZG 2H1EA 3HKZG 3PUVA 2QEXA 3DHGC 3ML9A 2G3QB 3Q24A 2HUGA 3NHHA 1WGHA 3VDZA 5BMGA 2UXCL 2R7ZH 4A3BG 2K32A 1S5CD 2FE8A 4NJCA 1QOFA 1ROEA 3CAMA 2KENA 1SIJA 3EFUA 3TIXA 1V1QA 1ET9A 3A1QA 1G2SA 4UHVA 3DM1A 3H9DA 4URKA 4RGMA 3CP0A 4LDTB 1A0IA 2EE1A 3GDEA 2BWFA 1OQRA 1TGZB 3K0YA 1VCIA 2PQEA 1VQ9A 2ZW1A 3BIID 1FD6A 4KZ0A 1WJ4A 2DZKA 4KKTA 4DV4Q 4OX9Q 1EL0A 1VQ6A 1I3QH 3MZ5A 4GS3A 4TMAB 1YJ1A 4RH6A 3U50C 2KJRA 2DN8A 1Q8IA 1LTLA 4BOZB 1FIQA 1N34Q 3IAS1 1WSPA 4C2MB 1FXIA 2IT1A 2L05A 2LJ5A 4CJ1B 3CC7A 1Y1VH 2QILA 3GTKH 1AWDA 3OMGA 1P98A 1TT5B 2INCC 1ENFA 4NP5A 4DV3L 1EY5A 4LTUA 5JVH3 2F0VA 2PW5A 4HSVA 4Y7NB 1VQPA 2V4LA 5TSSA 3I63C 2K8CA 1JB7A 2D0PA 4ICVA 4J8QA 1FCCC 2HHHL 2M19A 1B8AA 3CCEA 1EQTA 4J15A 4RM8A 1Y8RC 3GTOB 1WGGA 2F0TA 2JEAI 3PRPB 4DPGA 5D94A 3F2UA 2NMQA 4R4QA 3DXJC 3C46A 4KKJA 4GOCA 2HQLA 3F8TA 2F03A 5M3FH 4MZ9A 2NN6I 3I2ZA 2KWCA 2IX0A 5DNFA 1BT0A 4JI2Q 4QCLA 4M1UB 3FILA 5J18A 2AQ3B 2GVBA 3GTQB 3ND9A 3CHBD 4K3CA 1B7YB 1N5XA 1EOVA 1F9SA 2OXPA 1GPXA 3A0JA 1PZID 1TZOA 2JWUA 1JOKA 3SDZA 4EVOA 4KKIA 4US9A 4IUTA 3DWGC 2YYZA 1N63A 3H1UA 2R92B 3KLSX 1NYQA 1F2MA 5KNCA 3WAMA 2JA5H 2PW7A 5J22A 1YNJD 5FJ8G 3C2PA 2F0KA 1Q82C 3SFDB 1SMYC 2B2TA 2D11A 2HT1A 1P7FA 2PVOD 3ZNGC 3RFZB 1C1YB 5E1FA 5M5YB 5LMUQ 1CMXB 1DM0B 2W3SA 2EXDA 2GA4B 1YN4A 3AE9B 4DF7A 3DUZA 2AL3A 3LDZE 2WAQB 1RIPA 4FJYA 2EOTA 2M1MA 4TQ0A 4DNRB 2KYWA 3Q3JA 1YD8U 4C3HG 4FHKA 5JJKA 1T3QA 4A20A 4K81A 1E7ZA 4HN7A 2X8XX 1ZKOA 3A55A 5H1SE 1ISNA 3TMPB 1VZ8A 2LMCA 4BVUC 2BT6A 4B9WA 1ENAA 1EY9A 1Q0WB 2ICIA 5KRUA 4JI0Q 2KA7A 3A5UA 2JSVX 4WWOA 2HDLA 1EM7A 4BBNF 4E74A 3ZNZB 2CWPA 1UWMA 1FRRA 2VNUD 3ZJUA 4KN4C 4DNTB 2YU9B 1QVCA 4IPGA 3A8KE 1XWEA 3HRDD 2JYOA 3NY5A 1TKWB 3S2HH 2EKEC 1SAPA 3OOCA 3AE5B 1WGRA 4DHZB 1WM2A 1J5EL 4GGQA 4JGHB 2KQ3A 3PGEA 3OSOA 4PMWA 1ML0D 3H3VI 1UBQA 4KIKB 1L1OC 4JX1C 1ZEQX 1K50A 2LASA 2N4FA 2WLBA 1O7YA 1JICA 1WYGA 1WFYA 2RR9A 4BY1H 2KQ7A 1FRDA 4UAIA 4A6QA 1LUZA 1TIFA 2Y5BB 1ZXTA 2Q8RE 4BBSH 4DHJD 1TKEA 3HVZA 3Q8CA 4II2B 3P20A 2BA0A 4C7ZA 2HQEA 3VVWB 4JVZA 4DR1L 2Q2IA 2UYZB 1HPCA 1QILA 4GIVA 3NRZA 1A2UA 3S1RB 3NVYA 3SD5A 4I7AA 5BN3A 3MAQA 3CPWA 2ZPNA 1YNNC 2R2QA 1U4LA 2Y0SG 1L0YB 5C0XI 1KAWA 4DR3L 2ZEQA 1XMOQ 2K28A 1T0YA 2L0CA 2B2UC 2F0WA 2PW9A 4F8CB 4RKBA 4EQNA 5CV5A 2VUMB 1A62A 4P7IA 2I2YA 4RCNA 4EFOA 3MHZA 2V1YA 3AEGB 4IUPA 1K0SA 3PO3B 3RPFC 5A35A 3T1YL 4LJPB 1QOBA 3RZDB 2FIDA 3M4QA 1RCVD 1VMPA 1NI3A 2F0PA 4PMCA 1X1MA 4K7WA 3RNFC 1G291 2J0KA 3NZ3A 5CYUA 2Z4HA 1PVOA 2A73B 3I8ZA 4LF4L 2H4OA 2EVBA 3OG5A 2WKCA 3NS8A 4LFBL 1E7PB 2BWES 1V6EA 5FLMG 2MPMA 2MGSA 1TWHH 2CQAA 3W1SA 3U9SA 4LF6L 5EKIA 1D5ZC 4LW1A 3IAYA 1F52A 4LCDE 2ZW0A 3CW2C 1OEYJ 4UP9A 2B39A 2MRPA 4W9HA 2CHZA 2WYQA 4IM2A 4MEMA 1OTCA 2RCNA 3L16A 2K04A 2XEWA 3TUOA 4RGNA 4BBNC 1ESRA 4QQBX 1JROA 4C80A 2ZTCA 4C2MH 1L2NA 3FMCA 3Q6SA 3D4RA 1VMCA 5M3MB 1BBXC 3S14B 2KVMA 2MP1A 1EY8A 3KH0A 4GDLB 4X62Q 5AJ3L 4A3EG 1PDXA 2ASQA 1EZ6A 3AFPA 2M0AA 1R4MI 2VQFQ 2JPHA 3J7ZC 2KNBA 3U4EG 4I65A 3I57A 4L5TA 4DGZA 4DV0L 4GKJQ 2D3CA 3UQAA 2FCSA 2DZJA 3HOWG 5C5MA 2F3WA 3AE3B 3NWSA 3GQBA 2QDFA 4A8XC 2KAJA 4A3KB 2L1AA 4U68A 3OTOL 1ZKHA 3UDIA 2GMIC 3CWIA 3TJPA 1SXTA 1HNWQ 2KDFB 4A93H 3WOFA 3GTQH 2EY2A 3UIOB 3C1EA 3H3VC 4DK6C 2KC1A 4IUVA 1SSNA 2MP2A 2ZJQA 1EEFD 4DR6L 4E71A 1V49A 4JI4Q 1QKZA 3BVGA 3PHWB 2RCFA 4L6TB 1SNPA 3Q3FA 1E5WA 1PQSA 3UE0A 3HHMA 3SHQA 2JX5A 1I42A 2PPBC 1N32L 2OF1A 3N1ZC 4WH4A 1AE2A 1HTPA 3BY4B 3M95A 3PHXB 1HNZQ 3P2BA 5I6WA 1WGYA 1Q86C 2PCFB 1MG8A 5M5YH 2JYEA 3A54A 2MW5A 3K5LA 2JZPA 4DV2L 3TN2A 2B63H 3H0GB 4J3OD 3VFKA 3NUCA 2JN4A 2XTIA 4IM3A 5D3IB 4QAYA 4DDGD 1TWCB 4ANVA 1C0AA 1I4XA 5HY6A 1MJEA 1PV4A 5E6OA 1GHKA 5G55A 1GJXA 4OVZA 2EYPA 2NB0A 4KK7A 4R4CA 1WTRA 4HIDA 2QSDA 2ONQA 2WXFA 3PTFC 3AECB 5D7GA 5JJIA 4HTHA 1R4NI 3AU7A 4E3CA 4WWNA 3SE0A 2C7NB 2D10A 2WXHA 2DNCA 1NR4A 2HTME 3E56A 1IBKL 2R93B 2UUBL 2F0UA 2A74C 3S2DB 2W82A 2ZNVC 1YEZA 4WJQA 5M5XB 1DGSA 3NTHA 1KLUD 3DVGY 2YU9H 2BKRB 5HHDG 4DKAC 1SR3A 3MXPA 2CW0C 5IGFA 3AEAB 2LXCA 1SMYD 3HOZB 3HKZB 3PUZA 1HR0W 3RYTA 4LK0M 3PO2H 1I6HB 5H8YE 1Z47A 1YJJA 1F2RI 4KKSA 4A3BB 2KQ4X 2JA8H 1GKHA 1WFQA 1A3VA 3HGBA 2UXCQ 4R4IA 1JRUA 1CUKA 2OEOA 2BDOA 3HKSA 1D7QA 2WXLA 1BUIC 3U30A 4GLSC 3I56A 2L0FA 3IFTA 3PQIA 2K05A 2A6EC 2K4KA 1I35A 1GUTA 4B95A 1ZUD2 3C8YA 2NVTB 2JA9A 4DV7Q 4DK1A 2CCZA 1HA5A 4JWUC 5HFYA 2E6XA 3S1RH 1MVKA 3QB3A 4H7BA 3L2PA 4DWFA 1KM7A 1CKNB 2I0QA 1N33Q 3I3TB 5CHVC 1QJOA 1HZ9A 3AEVA 4ME5A 4M01A 4EEWA 3CC2A 3H09A 1Y1WG 2RMMA 2MJ8A 1QZHA 4HR7B 4OO1I 3RZOB 3PIP3 4F7XA 4KGRA 1HH2P 1LFDA 3O13A 5LL6X 4OELB 4PYZA 1BKBA 2AWOA 2NVQH 2DAFA 2VUMH 3APDA 1SFOB 4X64L 4R9WA 3I91A 3TREA 1EEID 2IPKD 2K1BA 2NPTA 1XPOA 4MGYE 4NAWA 4E6IA 4XZ4A 3PO3H 1NYRA 2N9EB 4AQYQ 1K8MA 3RZDH 1EFWA 1CSPA 3DWPA 2CH4A 2WB1E 2O4XA 2OT2A 4LMQD 5FKAC 1L4DB 3VRAB 2YTYA 1T9HA 2WXQA 4DU9A 2JA7H 4GMVA 2G9HD 4NQKE 3BZKA 1E10A 2WDVB 4N9PA 1FMAD 3M4YA 2QJLA 4K5XA 1A6XA 2N0SB 5IA7A 4DR4Q 2RSNA 4RM9A 3V6EB 1RKNA 5CTRC 2CH4W 4BA2I 3CQZB 1K53A 1IBLQ 2I5HA 3PMFA 5TR5A 3ZLZA 2DZMA 1U0LA 1JR0D 4TRDA 1L6VA 2FCQA 2NZ1D 2WWZA 1YNND 4A3FG 4A55A 4QIWE 1IBML 1W6KA 2ES2A 4HJ5A 4GOPA 1R4MB 4P16A 2DNEA 5JJZA 1F2ZA 4ZHOA 1E1OA 3N30A 2MQHA 2DBYA 1HTQA 1HZAA 2ZVOA 1I4HA 2LY7A 1M1KC 3CCLA 5KHQA 2HD3A 5D14A 4IC7B 2QIEB 2LS01 5HI1A 5LXHA 3G4SA 4A3KH 1YHBA 4CKEA 1P8LA 1KDCA 4BBRH 5IAAC 4C3HB 1BCPD 5JPMC 1E9MA 5ELFA 1YHAA 5ELDA 3QWZB 5GAEC 2QEJC 2PMZB 3MXNB 4BS9A 2KN4A 1F2RC 5BN4A 3Q3NC 3VTVA 2HE7A 2QHOA 1UNSA 1Q10A 3DBLB 3PZ8A 1A2TA 1S3OA 4C3JG 4HJ8A 3AMUA 3FPUB 5LMNW 3DLLA 2LHDA 2MO1A 1XTDA 5F2DA 1IGDA 3ETRA 1XT9B 1KABA 3I73A 4WJ3M 2KTFA 2ALYB 1CZPA 3IT6B 2FXQA 5C3WA 4LF5L 1KF6B 3RI7C 4OWWB 2JRIB 2LI5A 4RF0A 5E6NA 5JXVA 1MJCA 4KDLB 3RNCC 3TEHB 2KHWB 2PE6B 1D6EC 2NTSA 1PTOF 4ZUJA 1RHPA 2K8BA 3GB1A 4ZK9B 1TWCH 3S24A 1L0VB 3H6NA 1C76A 4RCOA 3MC8A 3RZFA 1C77A 1AEXA 1JQYD 1NTGA 1V2YA 4IUUA 4NY0A 4LF9Q 5DCNA 1M90C 3B2FA 2LEKA 2KWVB 4QMGA 1Z9FA 1R4NB 3ND8A 5J39A 1VR9A 4TUUA 5DPWA 3I90A 3HEJA 3AU5A 3PRZA 4XWTA 3HOVG 2HIVA 2ZT9C 1K28A 4MJSB 3CCRA 2XK5A 4JI8L 4NPSA 2K33A 4XX5A 2R93H 1MSGA 4BXXH 4LAAA 1LYLA 4ZRKA 5M5XH 3RN5A 3A56A 3CSTA 4M0WB 4KMUC 3G6JB 5C4XG 4OZBA 1SNCA 4K0KL 2CHXA 2K01A 1Y69U 1E8XA 2PEAA 2KDMA 3JSVB 5HKHA 2Y0SB 1EIFA 2KVZA 4HLEA 1XNQL 1MG4A 1PGXA 1WMHB 4M8MA 3ZW3A 2ZJDA 4ZOHC 1CQFA 2F3IA 1EWIA 1I6HH 1M94A 4OWTB 4A3PA 3KDFA 4B3ML 4A3BH 1EO6A 2L3ZA 2RDFA 4EZLA 1D1KA 3CCSA 1D8LA 2SNMA 2FFKB 3X0WA 3QK0A 5EDSA 1C79A 3PZDA 2WNMA 5ELEA 3QA8A 3VR4A 1DXMA 4LUOA 3AE1B 1KLVA 4YIJA 5BMIA 1KRTA 4NXMQ 3A33B 2NVTH 1E8WA 2J7ZA 2C7HA 4XQQA 4DAYA 1I4RA 1E2VA 4C4VA 3KYCD 4FULA 2ZM6L 2UU9Q 1UBIA 1H9RA 2KJXA 4KHZA 3HOYG 4G50A 5C4ZA 1T0QC 2LGSA 1E6EB 4OZCA 1N8RC 3S1MH 4X6AH 1PGBA 2JQOA 4IPCA 2BS3B 2I1KA 3QR8A 3STBC 3OHXC 1Q8KA 2IW3A 1FL0A 3J80E 2E5LL 5IODA 4JI3Q 5EPJA 3A5ZB 5I6YA 3MC0B 2CW0D 3Q22A 2KQSA 4H02A 1GUSA 1G6PA 2FCMA 1FPYA 4X57B 5BR8L 3J9CA 4GZYC 1YNJC 4DV1Q 4A3EB 1LT6D 1PTOC 3IKJA 4JBKA 5LL6S 1SSOA 2OTLA 2G5DA 3GD7A 3VRBB 3TL5A 4MTNA 3NP8A 4UP8A 4FVMA 3MHBA 3A9JA 1TWGH 2DWQA 3HOWB 4I6PA 3RUIB 2O5JC 2C60A 3UGBB 4Z9CB 4KGSA 4AUQC 1UEAB 3TS0A 1WYDA 1CK1A 2QCPX 2DY7A 1WZ0A 2K5HA 1HA6A 1E0BA 4BZAA 4DBGA 3G7LA 1DYQA 2NVXB 3GP7A 2C5LC 2AUKA 4JPSA 4KX6B 3KF8B 4IZ8A 4DR2L 3J80L 1PZKD 4B3SL 1GUNA 2JE6I 4X66Q 2BCOA 3I4NG 3K59A 4LFAL 1WWTA 2PJHA 2RSUA 3SXHA 1AP0A 4WAAA 3H6MA 3OLMD 4ZDVA 3AE7B 3UDXA 2V4DA 3W1YA 4YY3L 1KQSA 2IY5B 3QC8B 1MFWA 4YXDB 4G11A 5J2RA 4ZAIA 1WZ3A 1SJED 1SMXA 2AMCB 1I94L 3C0RB 3KOJA 1WVLA 2FCNA 4ARCA 5JHBA 4JQWC 3P7JA 3AB9A 3TQYA 3HRZC 4DK0A 3SDLC 4XDDA 2KDEB 1G51A 2BYVE 1HFGA 2L76A 4II3B 4B6WA 3B1LX 2RKSA 2MWSB 4H44C 2EJFC 1XD3B 4YCWA 3GO5A 5EPLA 5IP7G 3I55A 4DUYL 3CXCA 3GTJB 2ZZPB 4I6NB 4QY7A 2V0GA 2IY0B 2XWBB 3R3OA 5KYLA 4J6IA 2E2IB 2BBCA 4ZKBB 1LTBD 4A3CH 1B2TA 1NEKB 3R7RA 1AW7A 3WWVA 5I2XA 2D2QA 1XJVA 3G71A 5D3DA 2RA4A 3CCMA 4PK1A 4FF2A 2PZTA 3EGRA 2FMCA 2UXBQ 2P5ZX 2TMPA 3PIPA 2LUMA 1V43A 2C5CA 4IFDH 3A1QB 2TSSA 1KH0A 5E4WC 5C44H 2L00B 3ZQ4A 5JJLA 3S16B 1GG3A 4LF7Q 1R9TH 1WCMG 4LUZA 2QA4A 5HG2A 3ZTDA 4FXGC 1WGDA 5JH5C 1HQMC 2L5TA 4WQMA 2B2TC 4IALA 1PMRA 5DAUA 3Q0AA 1X3QA 4LF8Q 3AU4A 1J0GA 1K8AC 3AN1A 3GV6A 4ACFA 4FBJB 2XGTA 1XNRQ 1XLPA 5T1GA 3K7AB 1HNXL 2JXXA 2HD5B 4O0AA 4BKTA 2ZCCA 3W1GA 2UUAQ 3BWUD 2AWNA 2O2VA 1NBFC 4K5WA 5LNK1 1A3TA 1B50A 4FN2A 4DAMA 3KK7A 5A2QE 3V05A 1HR0Q 4LJOB 3EJIA 3RLFA 1QB5D 1L7YA 4USAA 1S72A 2N9XA 2D3GA 5IIFA 3UI2A 1JALA 3KYHC 4NJ6A 4A3MH 1YQ3B 1FVIA 4RA8A 3L4PA 1Y1WB 2N7EA 1DOYA 4A3GG 5C4JB 2Z8LA 2XRQD 1AYFA 3VTWA 1SROA 3DVNV 4MDKE 1GO3E 4DHJB 2LD9A 1JE5A 3GTPB 3S1NB 4HEDA 1MD2D 3R3MA 5BN5A 3FILB 5M5WH 3P4RB 4MH8A 4FHJA 1VQ7A 2VRRB 4FF1A 3E5SA 1G6ZA 1FR3A 1MKHA 3L10B 4CGYB 1RD9D 1GJZA 2F0FA 1GB1A 1WTQA 4RWSC 3V61A 1SE8A 4C00A 5A2QL 3EROA 4IUMB 4KY6A 1PH9A 3AEFB 1PFBA 4EQ5A 2MLBA 2JY6A 4HDQA 3J81j 4JI6Q 3KUPA 4AWJA 1WX7A 2H5XA 1PRTD 4H13C 2E2DC 4IPHA 3Q23A 3L9AX 3NJTA 2BPSA 2KEEA 1SE9A 3AXCA 4WFN3 4O2DA 4XQNA 4IWPA 3ICEA 2G4DB 3GV3A 4JWSC 3FKIG 5C0XG 5T1IA 2WFWA 3RNEC 1ZYRD 4A3FB 1FYCA 2AQ1B 2B29A 2KX0A 1EY6A 4M8NA 1VF5C 3NEMA 3MJ5A 5T8IA 1L5PA 2X69A 1D5XC 2NWGA 4TQUS 2G1EA 4UPAA 5CV7A 3K0XA 1KDBA 2LMCB 4EGVA 3M3YB 1SB3C 1FNUA 2EPBA 3CMMB 4IURA 2KFKA 4YT0B 2F0MA 5FR6A 4MM3A 2GBJA 1H9SA 4F8MA 1IYVA 2EY1A 1IYJB 3H7SA 1X3PA 3ERSX 3PF5A 3BINA 3J80c 2YTVA 3BVZA 4KV6A 2BB5A 1B9MA 2MJEA 3K5MA 1IGCA 4BKSD 1AE3A 2GN5A 4ZRPA 2V3SA 1UWVA 1K83H 2KWUB 3RT3B 3MJWA 3TBIB 1QF6A 5C23A 4YSXB 1L4ZB 1D2BA 2O6VA 3NQIA 4W9DA 1EU4A 4P71A 2BW2A 4FP5D 3J81E 4FJVB 4HPLB 3I5JC 1WE7A 4CJ2C 4B3RL 3EVQA 1PFDA 5IP9G 3W1SC 1CZWA 1QUQA 3I4MG 1H9JA 3QIJA 3HG9A 1YZ6A 2SDFA 1ASYA 4C3JB 4FDBA 3T56B 4YTNB 3STBD 1PH7A 4MNOA 1X3EA 1AN8A 4X3KA 2WDRB 3RNGC 3K8AA 1ZP0B 4HKZE 4QGUA 1Y8NB 4A3DB 3SEBA 3ULJA 1VZ6A 3RD4A 1JOQA 4L5QA 3NG0A 1A70A 2VXWA 1P7EA 2KN5A 3AYHB 5IT9E 2A4ZA 4XGAB 3FKYA 1JCKB 5K36H 1PTOD 1OXXK 2EY5A 1K3BC 1VQIA 1Z7TA 4AP4C 2PO4A 4GKKL 2UUCQ 2K5WA 4TKNA 3CF5A 5LMNQ 4ZKCB 4JYAQ 4KDIC 4GNXA 4WWPA 1X3GA 3EECA 1X55A 4WJOA 2Z1CA 2K5PA 2A68C 3J81L 3OW2A 4IOIE 2KD0A 1A5RA 2KLCA 2R3ZA 4YTPB 1J9OA 1D5MC 3HOVB 1K52A 2M0XA 2C7MB 2JXTA 1OTRB 1BCPF 1PFMA 3S9WA 2LXJA 1MPEA 1OGWA 5D2MB 4JI8Q 4HJ9A 3KJPA 3MFYA 5C4XB 3R2TA 2WX0A 4DDID 3DBRI 5IT9L 1Z5SB 3RN9C 1KC8C 2ENBA 2L8JA 2IZVB 3FHWA 4A3IB 1V81A 2LJIA 1XLOA 2MO0A 1PH4A 2Q2HA 1STHA 2B3AA 1TKYA 3VH4B 3UDFA 1WD1A 2EMSA 1J6QA 2JXMB 4B3MQ 2V9HA 4IWOA 3VR8B 1HUMA 3ULPA 3DPDA 2GBNA 1X9NA 2KVRA 3M4OH 4TVAB 1EYCA 3BK2A 2ZXPA 3M7GA 4IO9A 1VQKA 3HK0A 2N1WA 1XYIA 1PYSB 2B8GA 3M4PA 2OQ0A 5JOBA 1CQVA 2B2VA 2UXDL 4S17A 5DPRA 1GHJA 2LXKA 4K6LA 3N32A 5C3EG 4OIKA 5G5GA 5ELNA 2MNAA 4KHPL 5ISRA 3BZCA 3HOYB 4QJFA 1RTNA 4JBWA 3AE4B 1B53A 5C4JH 2CQOA 3J80i 2ZVNA 2HTHA 1RF2D 2V1CC 2UWQA 4KGTA 3NVZA 2K5DA 4X65L 1GB4A 3GTPH 3S1NH 3OWFA 2ZPYA 2K14A 2JA6G 1SIFA 4MSMB 2F0NA 4JI5L 3GOEA 2L15A 3VUWA 2BOSA 2MP2B 1J19A 3GE8C 4U673 3LWEA 4PV1C 2KDBA 2KMMA 1R4PB 5JEAH 5FR3A 2KHSA 5KGUA 1FD7D 4DV5Q 3N9YC 4NDXA 3D6CA 3AQQA 3ER0A 2OCEA 1BMLC 2HJ1A 5C5LA 4N59A 4W9IA 4NXNL 2JP1A 2FHTA 3S17B 5FOBB 2NBWB 1B4OA 1SYCA 3W1BA 3C1FA 2BA1A 3B0AA 4LNNA 1C3TA 5FO7B 3VAWA 2MHJA 1BCPC 3T13A 5C2TB 1YMHE 2WAQE 4LFCL 3TEXA 2WP9B 3DHHC 4JV5L 3LXFA 1HEZE 2F0QA 2KOLA 1E3PA 2BH8A 5DM63 1L1OB 4DV6Q 3I4NB 1B44D 1DZ1A 4OO1G 4A3FH 2IL8A 1DOXA 1WR1A 3E9IA 4DUZL 4GN1A 1EY7A 4JBMA 4B3TQ 2DENB 1UEBA 1SYGA 4XYQA 2WU5B 3GZNI 4Y7NH 3BYTB 3ABVB 2BH2A 4O1NA 2LSSA 5C4HA 1KD1C 3E9SA 3X23A 2SAKA 1V9JA 1F77A 1Y56A 1VQMA 1VZ7A 3N3KB 1I4PA 1QNKA 2WXIA 3GTOH 3PS6A 1C4CA 2SNSA 1IPGA 4IOCA 1XMQL 5LXIB 2HCCA 1G8ZD 2A69D 4CHTB 3AEDB 1WXSA 4DHZE 1STGA 1AFPA 5IYDG 4ZHPA 1WXQA 1XPUA 3GE3C 4YWMA 3KUZA 4P6VF 1HRJA 3DDCB 2E75C 5DPSA 3OJ4B 3TEWA 3FEWX 4GN3B 3L0WB 1ZE3D 1UE5A 3Q2AC 2JRHA 2C9WB 2JVCA 1STEA 4XT1B 3NBHB 4A3DH 1GNUA 3OAWA 4XIGS 3FRPB 1LQBA 3IG3A 3JW0X 3JYUA 1X56A 1HJPA 1VQEA 1J7BA 2R92H 1Y1VG 4A3LH 1FJGL 4OVVA 1JB3A 4FXKC 1BCPB 3D8GA 3J81c 3K57A 1WCMB 4GOPC 1VQ5A 2XBBC 2CFMA 2E2JB 3D6WA 3FC4A 3TP8A 3L17A 3PO0A 1O7IA 3VDYA 2M56B 1P9DU 5JAVA 2UU7A 1YNXA 2RDGA 3N1YC 5D6JB 2MX2A 1EZ8A 1TY0A 3H91A 2D2CC 2RDHA 4BWGB 4XT3B 3SFEB 1Q12A 1MI2A 2NVYB 4XE0A 4YWGG 4AYBG 1FO4A 4CDEC 3A9KB 1ESFA 3NHEB 5IT9c 3WCQA 2NPTB 5DM73 4OIJA 3VYUA 1LM0A 4LLGM 1WI5A 3PIO3 3BG3A 1SF0A 2LHEA 3SK5A 3DBHI 5EKLA 2K25A 2BGFA 2IBIB 1TWAB 2CR5A 4IDIA 3ZRCA 1S5BD 2CKZB 1QOAA 5IY0A 4DR7L 3EBEA 2F4VQ 3T8MA 4A3GB 4AJWA 2JA5G 1EUJA 4A3IH 4XXEA 3P4SB 4W9KA 3RNBC 4PZ6A 4XYCA 2MBBB
chains in the Genus database with same CATH topology
3NE5B 3U9OA 2GB1A 1JE4A 5G5HA 5H92C 5EBDA 3S1QB 3VYRA 2WACA 2EZVA 2L4NA 2A68D 1VDVA 3GTGB 3T51B 1R4QB 3CIRB 4R3DA 3V3XA 3HVDA 4NMZA 5CMDA 4NKLA 5C3JB 1FNVA 2INPE 3A7LA 4ABNA 1IW7D 1SNMA 2WP8J 3PUWA 5KNDA 4C1NI 1NVID 3FKIB 3A8IE 1LTGD 2L12A 2KWDA 1JC7A 4DAVA 1HZ5A 1U4PA 2IGHA 4K8JA 4BA1I 2BE5D 4ZQ3A 5EBCA 3SK6A 3AV8A 2XVSA 5LHY1 1PXUA 4X3TA 3NTIA 4G57A 4B0EA 1TR5A 4WJWA 1SYEA 3D4DA 4A90A 1LTSD 1NUCA 1PRTF 5GXGB 3I4MB 4K2LA 1LTTD 5ELCA 2EYJA 4RGOS 3OW7A 4QB4A 4ULLA 1TQOA 3D4WA 2EXZA 5EE9A 2FINB 1EY0A 4ZYSA 2F4IA 3FAHA 2OEDA 3QIAA 2J53A 3SK4A 4NAMA 3BVMA 3IAM1 4L2YA 5IGGA 1IBXB 5I4DA 1V8CA 2NN6H 3NSWA 3AE6B 4XQJA 5BYSA 4RAUC 4K14A 4OGQC 3AM9A 1EYDA 4EE2A 1SYFA 1PLFA 1C78A 3TZDA 3MXUA 1DOMA 1F9RA 3CRKC 1QOGA 4CBVA 2B8FA 4OHJA 3N52A 1S4ZA 1JORA 4FF3A 1U4RA 3QG1A 1PGAA 1V1PA 1EU3A 4US8A 2FMMA 1CI3M 4ARCA 1NR2A 2I46A 3HUIA 5CV6A 3MP9A 1SNDA 4O42A 2EKIA 4F88A 1TYGB 1C4AA 5C3EB 1RM6C 3Q69A 2QMTA 1B3AA 3PV0A 1PRTC 2A6HC 4G7ZC 2PNRC 1CFMA 1TT2A 5KNBA 1FCLA 3W9CB 4IN3A 1HZ6A 4PMBA 1RWSA 4KY5A 2JA6B 1ZYRC 3S15B 2J4XA 2QF7A 2YEPF 1GUWA 3AE2B 4K8IA 1QLBB 1LACA 3VQIA 3BYYB 4WRDA 2EYLA 1LV9A 3K58A 2QDBA 2SOBA 3CRLC 3H8HA 2K9XA 2WXKA 1LT5D 4D2KA 4WWMA 4HROA 5CV9A 2IGGA 2X38A 5C6AA 1R7SA 5C0XH 2D5GA 4PQXA 2PZWA 2JSOA 3L3OC 3MWYW 3U2SC 3VA5A 4G4KA 3Q8BA 1YN5A 3FPPA 2Y5CA 2IX3A 1LTID 1YN3A 3E0JA 3H94A 4KD3A 2MH7A 5FK9C 1DJRD 1II3A 3HZXA 1GOZA 2A5HA 4HCSA 3CKIB 1B9NA 1TY2A 4XYOA 3BS1A 1G91A 2PMVA 4WIPA 1FXAA 2W3RA 1ICWA 3R8BA 2ACZB 1CA5A 3LYYA 1A3UA 1I3QB 1RODA 3M85A 1QQRA 1VF7A 3KLSA 3W5UB 3VR6A 1EOTA 5IGDA 2AUJD 1Y1VB 3GTKB 1N62A 1TIID 1FEHA 4ZLTF 4REZA 4IQZA 3P1MA 3SR6A 5EE3A 5AUKA 2L55A 4C1NK 4I7ZC 5AFWA 2ON8A 5EKKA 4Q0FA 2EELA 3KWLA 1MHHE 3OWEB 4AYBB 2C9OA 1KFYB 4RGTA 4XWWA 3ZGZA 1H9MA 3I3CA 3TZUA 3J7AF 1PTOB 1SE4A 3P4PB 4CQNA 5J1ZA 2F1MA 4H2AA 2WXGA 1EWYC 3EA6A 2CJOA 3J7YW 1MHXA 2KACA 1OXUA 1SE3A 1I4GA 4HMIA 3NVVA 3DWAA 4A3JB 4MT5A 2ICEC 1Q3LA 1X32A 3I70A 3CU7A 4HAEA 2DLBA 1YJIA 2H89B 4OL7A 2IJ0A 4Q5VA 1RJTA 1NCVA 4S3SA 3TP7A 2WV6D 2VZKD 1NSNS 2NYZD 2MEKA 2MJDA 4MM3B 1H9SB 1F9QA 2B2WA 4N9TA 4EQOA 5KYIA 2DYMA 4DN4M 3NPPA 4ZRQA 3ZYYX 4CKCA 3NS1A 1YNTE 2WXOA 4HCEA 3KF8A 2KUMA 3S2HB 1C48A 1SDFA 4MN3A 1ILQA 1J7AA 3NBIA 3HOXB 2K22A 4BY1B 2FUG1 4HJGE 5E4XA 4WORA 1I50B 4RKLA 1LTAD 2B2VC 2A69C 4RNAA 2A6HD 3VR5A 4FYDA 4OO1H 1CZGA 2HDEA 3QOJA 4TQ1A 3T4AC 2B2YA 1JMLA 4LJZC 1J8IA 3IL8A 2LGIA 4HKQA 2L9HA 2IGDA 4Q2JA 3IXSA 3IT4B 2CU3A 2LFNA 4IFDJ 1KAAA 2AX5A 5FO9B 1E2WA 1T6BX 1TWFB 1B9RA 5G3LD 2EYMA 3R93A 4C3IG 3MTSA 1TS5A 2EJMA 1DOKA 1GUOA 1N5WA 1TWHB 4P2CB 4CKBA 2W55A 4KI0A 2XRSD 1QNUA 1VRAB 4V0BA 1NAPA 1UWXA 1ET6A 2FBWB 3DHQA 1KNAA 2INNE 5BYQA 3I4LA 2NUCA 5JPNC 1G2TA 4L63B 2KECA 1ONLA 1STAA 2IX1A 3W5VB 4MACA 4RHRA 3ZJVA 3OPOA 1ACCA 2IWHA 3WDNA 3SVMA 3NUHB 1UGJA 2L1BA 4A93B 2EJGC 1PTOH 1HUNA 4B08A 1SJHD 2K7VA 3URYA 3DWMA 1QCBD 4LK1C 4DFAA 1TKGA 5BMHA 3JAME 1K51A 2I38A 1Z6HA 1DOIA 1BXTA 1IW7C 1OXSC 3NXWA 3KBXA 1CT1D 2BDNA 1RDPD 1EIHA 1EIGA 2B63B 1CM9A 1FFUA 3AH7A 2AQ2B 4RHSA 1MSHA 3NVWA 2DYOA 2BE5C 3KQ4A 4DAPA 2EYFA 3QO2A 1JQ4A 3JAML 1J7CA 5KEEA 3E6ZX 1XLQA 3P42A 1DCZA 3L7ZC 1U4MA 1T5EA 4V190 4IFDG 3HS0C 2WU2B 3IFDA 3N6RA 1C4QA 4QF4A 2RPVA 5CC4A 1SEBD 2N9LA 2KEDA 2MHVA 1IYUA 2PVGC 1M4VA 4J6HA 3PO2B 1JRPA 3DEOA 4XDCA 1UUPA 2JA8B 1EY4A 3NTKA 2NBFA 2HDMA 1WTXA 2X6LA 2Q5WD 2VB3X 2CHBD 1GUGA 3EUB2 1TU2B 1EQVA 3HP3A 1FFVA 4L1BA 1DONA 4F87A 4KN7C 1KNEA 1CJEA 5BYRA 2CJNA 1HCZA 3VR3A 4DXFA 2JEBI 2JU6X 1TVXA 5E3FA 2K5QA 1JW9D 1NENB 4L8JA 3M7NA 5I9PA 3P75A 2NVQB 3VR2A 3EQLC 5FO8B 4JK1C 1E0ZA 1ZPSA 1T5XD 2RVLA 3A7AB 1K8OA 2WXMA 1I4QA 4DQOC 1I6VC 4G7HC 4IUNA 2JA7B 4R8NA 1MI0A 2JQRB 1AZQA 3KBGA 1D1IA 1OQQA 2O5IC 1MGSA 1WD0A 2ZXRA 3OIQA 3PUYA 2K03A 1XCQL 3J7AV 1Q1BA 2XIWA 2WQYB 1JWUD 3C3LA 3RUZA 3WOEA 2DY8A 3T3OA 2I07B 2MUYA 4TKOB 3V2TA 2E76C 1JWMD 3FVQA 2PTLA 2N88A 2BS2B 5DEHA 4FXDA 5MPOA 4KY7A 1OXVA 1ZXIA 1ZXHA 1QWYA 2WXNA 4BBRB 3R2IA 4ITKA 3P4QB 1GXDC 5ELBA 5E6JA 1EFID 2WKDA 1XF5L 2BYTA 4MIUA 5JEAJ 4NAWB 1IL8A 2ID0A 2J52A 2D9UA 2RQXA 2E2HB 3DMUA 1SBBB 2D5DA 1PDQA 2E74C 2PZUA 2WB1B 2EYHA 4IFDI 1L6UA 2EDGA 4K5VA 5K36G 5CGKA 5K5PA 1PFNA 1WTWA 1S5DD 1HHVA 1VJKA 1ENCA 3VYSA 2PIAA 1B1ZA 4WURA 4KTAA 3TDQA 2BB6A 2K0PA 1LABA 1XO3A 4N58A 1UAPA 1QE6A 2WXRA 4L23A 4QIWB 2BTEA 2L11A 4HEA1 1F2YA 4ARIA 2G9DA 2Z4IA 1LT3D 2F0SA 5FLXE 1D4BA 4AQ7A 3QWNA 1RFKA 2F0GA 2M9VA 5HGTA 4OW0A 1OXTA 3MFGA 4RF1A 1SNOA 2B2UA 3BK1A 3I72A 4NW2A 1C9FA 1EYAA 3AMZA 1JWAD 1KRHA 4YSZB 1W6JA 3K5OA 2F0HA 1XXGA 3MA2B 3NBHA 3X3MA 2BS4B 5IOCA 1LT4D 3HOUB 4HMJA 4C3IB 2WIIB 2KCCA 5C3XA 2SEBD 5FLXL 4DA2A 3Q8AA 4KKUA 2PYKA 1IHZA 1KTKA 1VDZA 5CV8A 3S1MB 4PNYA 1V1PB 1BF4A 2WDQB 4AS1A 1XTCD 1F0ZA 2N55A 5HURA 2WS3B 1QG7A 3P1HA 3LX0A 5EPKA 4ID6A 3VR9B 1KDAA 5JEAG 1DD2A 1U9RA 1MBYA 4BY7B 4KJOA 3TP5A 2PKOA 3AEBB 4B9XA 1N61A 1TWGB 2XSCA 1TS4A 4IUQA 1BR9A 2Y3AA 3BDOA 4FNFA 3PZ7A 3TEZA 1STBA 3LWUA 2HCIA 1OO9B 3OMCA 1TJEA 2IDYA 5G3LF 1PUTA 2MJ3A 2K3UA 4ODGA 1L0XB 2CVRA 1WRIA 4B0MA 3EFXD 2Y5PA 4C56C 3TSSA 4XDXA 3ITPA 1BDOA 1GAQB 4J1MA 1XCTL 3KWVA 2J0TD 2Q8TA 1AZPA 1SE2A 3TMEA 3GTMB 1Y8OB 1FGBD 5CBEE 2EY6A 1XLNA 5M9OA 3FDTA 1M8AA 2N7JA 3NWTA 3GTLB 1RTOA 1OFFA 2R6GA 5I2YA 4HSPA 3DEPA 2QKIC 4X3SA 3VA7A 1PZJD 1BQQT 4QUFA 5C44B 1CA6A 5CORA 5CR3A 1A15A 1BNZA 1CTMA 1R9TB 1WGKA 1EWCA 5COYA 5I9OA 4EQPA 3GS2A 2Q8IB 4H0LC 2VZKB 3NK9A 1ZDXA 3B2GA 2NTTA 4M8AA 2FJ2A 1JOOA 1XX8A 1S5FD 4KJNA 2GRIA 2XN9C 1E2ZA 2F0IA 5AUIA 3U7ZA 5D65A 1KLGD 3ERQA 2B2WC 4A3MB 1ZOYB 3AB5A 1IBXA 3SK8A 3VYTA 3MEHA 3QJYA 1O80A 5CBAE 1IKLA 1O78A 3KLRA 5IGBA 1LTRD 1SYBA 1EWHA 3AE8B 5M5WB 4TSSA 2LFIA 2F0JA 5EE1A 4KHVA 3MXNA 1V97A 3OIPA 1IKMA 2XNAC 1PRTB 2R7ZB 4YTMB 2X6GA 5JVG3 3AEEB 3Q8EA 5EE0A 2WINB 1Y8PB 2M2LA 1F9PA 2F0OA 2VB2X 1HXYD 1BUVT 2WXJA 4NZLB 2N9KA 3DWQA 2L83A 3B9JA 2R61A 2L32A 3LB8C 1SNQA 4ZUIA 4ZRZA 1I7HA 2H88B 2B2YC 1YQ4B 3K6OA 1DGJA 1BOSA 5NUCA 4K6DA 1FM0D 3TEYA 2L52A 1FNWA 1N60A 4K2KA 3T3NA 3BDCA 1DOLA 4M0WA 2A6ED 1K83B 1HFNA 2LKVA 3U52E 5IGEA 5IGCA 2J42A 4GDKB 5M3FB 3MVVA 2F0EA 1BO0A 1PYWD 4DXGA 1F2LA 4MHEA 2PLPA 1QOHA 4FXCA 2V4IB 2ZXOA 1S5ED 4XTCS 4JE3B 2RSOA 3TP6A 1HQRD 2JA5B 1ILPA 3Q8FA 1STNA 3NQTA 1CHQD 3QOLA 3A8JE 3PUXA 3T53B 3X3NA 3UI3A 5C0XJ 3V96A 3K5NA 3LNNA 2NN6G 1LLRD 2OHFA 2W54A 1RYJA 2GI9A 5KIXA 3RMHA 2F3VA 4PT5A 3SR1A 2YEPB 4OZAA 2K6AA 1V1OA 3BDLA 1C8CA 1O7ZA 1Q1EA 4X3UA 1CHPD 3P63A 1JWBD 5CV4A 4HRSA 1SYDA 2M00A 3W2DA 3ZJTA 3MXGA 2RBMA 5EJWA 2D62A 1C4PA 2E3TA 5EGTA 2F0DA 4N6EB 1V8QA 4IKGA 1HTLD 2EYOA 4FF4A 1ZDVA 1XEEA 4QUCA 3M4OB 2WXPA 3D31A 3ONAB 3SHLA 4CJ0B 1H9KA 3D3RA 1WTPA 1Q90A 4YSYB 3W3AA 4BBSB 1LO5D 4G7OC 1TS3A 2V3PA 2KCNA 2O2LD 2XWJB 1TS2A 4UDUC 2B76B 1JWSD 1O7LA 4WAFA 1STYA 3BZDB 1WTOA 3I9V1 1WTVA 1QT9A 2JYTA 4KD4A 4RFBA 4R8IA 2F0LA 4ILWA 1VLBA 2V3NA 5EQ0A 4FO2A 1IUEA 2H1EA 3PUVA 3Q24A 2HUGA 3NHHA 5BMGA 2K32A 1S5CD 2FE8A 4NJCA 1QOFA 1ROEA 1SIJA 1ET9A 1G2SA 3DM1A 4RGMA 2EE1A 1OQRA 3BIID 3K0YA 1VCIA 2PQEA 1FD6A 2ZW1A 4KKTA 1EL0A 3MZ5A 4TMAB 4RH6A 2DN8A 1Q8IA 1FIQA 3IAS1 1WSPA 4C2MB 1FXIA 2IT1A 4CJ1B 2QILA 1AWDA 3OMGA 1ENFA 4NP5A 1EY5A 4LTUA 5JVH3 2F0VA 2PW5A 4HSVA 4Y7NB 4YT0B 5TSSA 4J8QA 1FCCC 2M19A 1EQTA 3GTOB 2F0TA 2JEAI 3F2UA 2NMQA 3DXJC 3C46A 4KKJA 2F03A 2NN6I 2IX0A 5DNFA 4QCLA 4M1UB 3FILA 2AQ3B 3GTQB 3ND9A 3CHBD 1N5XA 1F9SA 2OXPA 1GPXA 1PZID 1TZOA 2JWUA 1JOKA 3SDZA 4EVOA 4KKIA 4US9A 4IUTA 3DWGC 2YYZA 1N63A 2R92B 3KLSX 1NYQA 1F2MA 5KNCA 2PW7A 5J22A 1YNJD 3C2PA 2F0KA 3SFDB 1SMYC 2B2TA 1P7FA 2PVOD 3RFZB 5E1FA 5M5YB 1DM0B 2W3SA 2GA4B 1YN4A 3AE9B 4DF7A 3DUZA 2WAQB 2EOTA 4TQ0A 4DNRB 4C3HG 1T3QA 4HN7A 1ZKOA 3A55A 1VZ8A 2LMCA 2BT6A 4B9WA 1ENAA 1EY9A 2ICIA 5KRUA 2KA7A 2JSVX 2HDLA 1EM7A 1UWMA 1FRRA 2VNUD 3ZJUA 4KN4C 4DNTB 2YU9B 3A8KE 1XWEA 3HRDD 2JYOA 1TKWB 1SAPA 3OOCA 3AE5B 2KQ3A 3OSOA 4PMWA 1ML0D 4JX1C 1ZEQX 1K50A 2WLBA 1O7YA 1JICA 1WYGA 1FRDA 4UAIA 4A6QA 1ZXTA 2Q8RE 1TKEA 3HVZA 3Q8CA 3P20A 2BA0A 4C7ZA 2HQEA 1HPCA 1QILA 3NRZA 1A2UA 3S1RB 3NVYA 5BN3A 3MAQA 1YNNC 1U4LA 5C0XI 1L0YB 2K28A 2L0CA 2B2UC 2F0WA 2PW9A 4RKBA 4EQNA 5CV5A 2VUMB 2I2YA 4RCNA 3MHZA 3AEGB 4IUPA 3PO3B 3RPFC 5A35A 1QOBA 3RZDB 1RCVD 1VMPA 1NI3A 2F0PA 4PMCA 1G291 3NZ3A 5CYUA 2Z4HA 2A73B 3I8ZA 2H4OA 2EVBA 2WKCA 1E7PB 2MGSA 2MPMA 2CQAA 3W1SA 3U9SA 5EKIA 1D5ZC 3IAYA 2ZW0A 2B39A 3TUOA 4C80A 2K04A 4RGNA 1ESRA 1JROA 3FMCA 3Q6SA 3D4RA 1VMCA 5M3MB 1BBXC 3S14B 2KVMA 2MP1A 1EY8A 4GDLB 1PDXA 1EZ6A 2M0AA 3U4EG 4I65A 3I57A 4DGZA 5C5MA 2F3WA 3AE3B 3NWSA 3GQBA 4A8XC 2KAJA 4A3KB 2L1AA 4U68A 3CWIA 1SXTA 3WOFA 2EY2A 3C1EA 3H3VC 4IUVA 1SSNA 1EEFD 1QKZA 3BVGA 4L6TB 1SNPA 2JX5A 2PPBC 2OF1A 4WH4A 1HTPA 5I6WA 2PCFB 2JYEA 3A54A 3K5LA 2JZPA 3TN2A 3H0GB 4J3OD 3NUCA 5D3IB 1TWCB 1I4XA 1GHKA 1GJXA 4OVZA 2EYPA 2NB0A 4KK7A 1WTRA 2QSDA 2WXFA 2ONQA 3AECB 5D7GA 4HTHA 3AU7A 3SE0A 3E56A 2WXHA 2DNCA 1NR4A 2HTME 2R93B 3S2DB 2F0UA 2A74C 2W82A 5M5XB 3NTHA 1KLUD 5HHDG 3MXPA 2CW0C 5IGFA 3AEAB 1SMYD 3HOZB 3HKZB 3PUZA 4LK0M 1I6HB 5H8YE 1Z47A 1YJJA 1F2RI 4KKSA 4A3BB 2KQ4X 1A3VA 3HGBA 2WXLA 2OEOA 2BDOA 1BUIC 4GLSC 3IFTA 2K05A 2A6EC 1GUTA 1ZUD2 3C8YA 2NVTB 4DK1A 1HA5A 4JWUC 5HFYA 2E6XA 1MVKA 3QB3A 4H7BA 1QJOA 4ME5A 3H09A 2RMMA 2MJ8A 4HR7B 4OO1I 3RZOB 3PIP3 4F7XA 4KGRA 3O13A 5LL6X 2AWOA 1SFOB 4R9WA 3I91A 1EEID 2IPKD 2K1BA 4E6IA 1NYRA 1K8MA 3DWPA 2O4XA 2OT2A 4LMQD 5FKAC 1L4DB 3VRAB 2WXQA 4DU9A 2G9HD 1E10A 2WDVB 4N9PA 1FMAD 3M4YA 2QJLA 4K5XA 1A6XA 2N0SB 2RSNA 1RKNA 4BA2I 3CQZB 1K53A 3PMFA 4TRDA 1JR0D 1L6VA 2NZ1D 1YNND 4A55A 1W6KA 4P16A 2DNEA 5JJZA 1F2ZA 4ZHOA 2DBYA 1I4HA 2LY7A 5D14A 5HI1A 2QIEB 2LS01 4CKEA 1KDCA 4C3HB 1BCPD 5JPMC 1E9MA 5ELFA 5ELDA 2QEJC 2PMZB 4BS9A 2KN4A 1F2RC 5BN4A 1UNSA 1Q10A 3PZ8A 1A2TA 4C3JG 3AMUA 3FPUB 2LHDA 5F2DA 1IGDA 3ETRA 1KABA 3I73A 1CZPA 4A9AA 3IT6B 5C3WA 1KF6B 4RF0A 5JXVA 1D6EC 2NTSA 1PTOF 4ZUJA 1RHPA 3GB1A 4ZK9B 1L0VB 1C76A 4RCOA 1C77A 1AEXA 1JQYD 4IUUA 3B2FA 2LEKA 4QMGA 3ND8A 5J39A 1VR9A 3I90A 3HEJA 4XWTA 2ZT9C 2K33A 1MSGA 4LAAA 3A56A 4KMUC 3G6JB 4OZBA 1SNCA 2K01A 1Y69U 2KDMA 2Y0SB 1PGXA 4ZOHC 1CQFA 2RDFA 1D1KA 2SNMA 2FFKB 1C79A 2WNMA 5ELEA 3VR4A 1DXMA 3AE1B 4YIJA 5BMIA 2J7ZA 4XQQA 4DAYA 1I4RA 1E2VA 1H9RA 2KJXA 4KHZA 5C4ZA 1E6EB 4OZCA 1PGBA 2BS3B 3OHXC 2IW3A 3J80E 5IODA 5EPJA 5I6YA 3MC0B 2CW0D 3Q22A 1GUSA 3J9CA 4GZYC 1YNJC 4A3EB 1LT6D 1PTOC 3IKJA 5LL6S 1SSOA 3VRBB 3GD7A 3NP8A 4FVMA 3MHBA 2DWQA 3HOWB 2O5JC 4Z9CB 4KGSA 1UEAB 1CK1A 2QCPX 2DY7A 1HA6A 1E0BA 3G7LA 1DYQA 2NVXB 3GP7A 2AUKA 4JPSA 4KX6B 4IZ8A 3J80L 1PZKD 1GUNA 2JE6I 2BCOA 3K59A 1WWTA 3SXHA 1AP0A 3H6MA 3AE7B 2V4DA 4YXDB 4ZAIA 1SJED 1WVLA 3P7JA 3AB9A 4DK0A 3HRZC 4XDDA 1HFGA 2RKSA 4H44C 2EJFC 4C7YA 3GO5A 5EPLA 3GTJB 2V0GA 2XWBB 3R3OA 5KYLA 2E2IB 2BBCA 4ZKBB 1LTBD 1B2TA 1NEKB 1AW7A 5I2XA 5D3DA 2RA4A 4FF2A 2PZTA 3EGRA 2FMCA 2TMPA 2LUMA 1V43A 2C5CA 4IFDH 2TSSA 1KH0A 5E4WC 3ZQ4A 3S16B 5HG2A 4FXGC 1HQMC 2L5TA 4WQMA 2B2TC 4IALA 1PMRA 5DAUA 3Q0AA 1X3QA 3AN1A 3GV6A 1XLPA 5T1GA 3K7AB 3BWUD 2AWNA 4K5WA 5LNK1 1A3TA 1B50A 3KK7A 5A2QE 3V05A 3EJIA 3RLFA 1QB5D 4USAA 5IIFA 3UI2A 1JALA 1YQ3B 4RA8A 3L4PA 1Y1WB 1DOYA 5C4JB 2Z8LA 2XRQD 1AYFA 3GTPB 3S1NB 4HEDA 1MD2D 5BN5A 3FILB 3P4RB 4MH8A 4FF1A 3E5SA 1G6ZA 1FR3A 4CGYB 1RD9D 2F0FA 1GB1A 1WTQA 4RWSC 5A2QL 3EROA 4KY6A 3AEFB 1PFBA 3KUPA 1PRTD 4H13C 2E2DC 3Q23A 3L9AX 2KEEA 4WFN3 4XQNA 4JWSC 3GV3A 5C0XG 5T1IA 1ZYRD 4A3FB 1FYCA 2AQ1B 1EY6A 1VF5C 3MJ5A 5T8IA 1L5PA 2X69A 1D5XC 2NWGA 4TQUS 2G1EA 4EGVA 5CV7A 3M3YB 1KDBA 2LMCB 1SB3C 1FNUA 2EPBA 4IURA 2F0MA 1H9SA 4F8MA 1IYVA 2EY1A 1X3PA 3BVZA 4KV6A 2BB5A 1B9MA 2MJEA 3K5MA 1IGCA 4ZRPA 3TBIB 1QF6A 4YSXB 1L4ZB 1D2BA 3NQIA 1EU4A 2BW2A 4FP5D 3J81E 4CJ2C 3EVQA 1PFDA 1CZWA 1H9JA 3HG9A 4YTNB 2SDFA 4C3JB 3T56B 1AN8A 4X3KA 2WDRB 1ZP0B 4HKZE 1Y8NB 4A3DB 3SEBA 1VZ6A 3RD4A 1JOQA 1A70A 2VXWA 1P7EA 5IT9E 1JCKB 5K36H 1PTOD 1OXXK 2EY5A 1Z7TA 2PO4A 2K5WA 4ZKCB 2Z1CA 2K5PA 2A68C 3J81L 4IOIE 2R3ZA 4YTPB 1J9OA 1D5MC 3HOVB 1K52A 2JXTA 1BCPF 1PFMA 3S9WA 1MPEA 3MFYA 5C4XB 3R2TA 5IT9L 2ENBA 4A3IB 2LJIA 1XLOA 1STHA 1TKYA 1WD1A 2JXMB 3VR8B 1HUMA 1EYCA 3BK2A 2ZXPA 3M7GA 1XYIA 2B8GA 5JOBA 1CQVA 2B2VA 1GHJA 4K6LA 4OIKA 5G5GA 5ISRA 3HOYB 1RTNA 4JBWA 3AE4B 1B53A 1RF2D 4KGTA 3NVZA 2K5DA 1GB4A 3OWFA 2F0NA 2BOSA 4U673 3LWEA 4PV1C 2KMMA 1R4PB 5JEAH 5FR3A 2KHSA 5KGUA 1FD7D 3N9YC 4NDXA 3D6CA 1BMLC 5C5LA 4N59A 2JP1A 2FHTA 3S17B 5FOBB 1B4OA 1SYCA 3C1FA 2BA1A 5FO7B 1BCPC 3T13A 5C2TB 1YMHE 3TEXA 2WP9B 3LXFA 1HEZE 2F0QA 2KOLA 5DM63 3I4NB 1B44D 1DZ1A 4OO1G 2IL8A 1DOXA 1EY7A 1SYGA 4XYQA 2WU5B 3BYTB 3ABVB 4O1NA 5C4HA 3E9SA 2SAKA 1F77A 1Y56A 1VZ7A 1I4PA 1QNKA 2WXIA 1C4CA 2SNSA