2R63A

Structural role of a buried salt bridge in the 434 repressor dna-binding domain, nmr, 20 structures
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
63
structure length
63
Chain Sequence
SISSRVKSKMIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural role of a buried salt bridge in the 434 repressor DNA-binding domain.
pubmed doi rcsb
source organism Phage 434
molecule tags Gene regulating protein
molecule keywords REPRESSOR PROTEIN FROM BACTERIOPHAGE 434
total genus 22
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1996-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2r63A00
2HINA 1ZVVA 1O4XA 4X4BA 3D1NI 1QQAA 4FBIA 3BD1A 2AXUA 3GN5A 4Z5HA 2PIJA 1LLIA 2R63A 1LMB3 1QP0A 4X4GA 3F6WA 2R1JL 1RZSA 4JCXA 4X4FA 1UXDA 2XIUA 4YBAA 2LYPA 1NERA 4PU7A 3BDNA 2LYKA 1VPWA 1IC8A 2BNMA 1UTXA 1RZRD 2IV1A 1Y9QA 1POUA 4GHJA 3GN5B 4J1WA 4OB4A 2O4AA 1QPZA 2HSGA 2GZUA 3MLFA 3OQMA 2O38A 1LQCA 1ZUGA 4MCTA 2PUGA 1QP4A 2ICPA 3CLCA 1RIOA 2H8RA 3FYAA 2LYQA 4NDWA 1EFAA 3JXCL 2OR1L 1ADRA 2PUAA 3EUSA 2PE5A 1X2LA 3U3WA 3QWGA 2KEIA 3GBFA 2MEZA 3UFDA 3SCGA 2GRMA 3H5TA 2PUCA 4O8BA 3F52A 3VK0A 4I8TA 1XWRA 2CSFA 2LYJA 2KEJA 1ZZ8A 5A7LA 1R69A 2OFYA 2EWTA 4YG4A 4X4CA 1JWLA 2IVQA 4FN3A 1JFSA 1LCDA 3OQNA 1CJGA 2IU7A 4PU3C 3ZHMA 2LYSA 1HF0A 1ZPQA 3RZZA 3OP9A 4Z58A 1R63A 2WIUB 3G5GA 3S8QA 2EF8A 2IVBA 2GRLA 4X4HA 3ZKCA 1GT0C 4I6RA 4IWRA 3KZ3A 2KZ8A 1L1MA 1PERL 2WUSR 5K98B 1BDIA 3FMYA 3QQ6A 3SCHA 4Z5DA 1PNRA 3HZIB 4PU8A 4X4EA 3BS3A 4X4IA 2LYRA 1PRVA 4PU4C 4Y42A 4YG7B 2XJ3A 1Y7YA 2L8NA 1ZS4A 2ICTA 1WIZA 1ZZ9A 2IUOA 1ZZBA 4MCXA 2BJCA 4J1XA 4JQDA 3JXDL 1X57A 4YARA 1LCCA 1ZZ6A 1BDHA 2AUWA 3KXAA 2AXVA 2KEKA 1OCTC 1ZZCA 4IVZA 1SQ8A 3FYMA 1UXCA 2XCJA 1DWKA 2PPXA 2A6CA 2KPJA 1RZRA 3R1FA 1CQTA 1S7EA 2LYLA 2PUFA 1WH8A 4I6TA 1E3OC 3ZHIA 1PRUA 2FJRA 3O9XA 2IVGA 1PRAA 4F8DA 3L1PA 2PUEA 1B0NA 3F51A 1YSEA 4I6UA 4X4DA 2PUDA 2LCVA 2JVLA 2AW6A 2CROA 2EBYA 2B5AA 4Z5CA 3KJXA 1QQBA 1QP7A 1DW9A 2JCGA 4Z59A 2XSDC 1WETA 2XI8A 1RPEL 2AWIA 1NEQA 2MQKA 3JXBC 3G7DA 4GQMA 2D5VA 1ZZ7A 2BNNA 3OQOA 2L49A 4IA8A 1JFTA 3CROL 3LFPA 3PXPA 3CECA 4YG1A 3QF3A 2PUBA 1JH9A 2AXZA 1ZAYA 3QYXA 3B7HA 3LISA 3SCFA 3DNVB 1AU7A 2O49A 3IVPA 1WH6A 4JCYA 3OMTA 2BNOA 1OSLA 3TRBA
chains in the Genus database with same CATH superfamily
2HINA 1ZVVA 2M4HA 3D1NI 4FBIA 3GN5A 2MXDA 1QP0A 4X4GA 3F6WA 2R1JL 4JCXA 1UXDA 1VPWA 1IC8A 2J7WA 2PXVA 1MFQC 1QPZA 2PUGA 4DE9A 3LQXA 4DE8A 3CLCA 2LYQA 1QB2A 3JXCL 2PE5A 2J7UA 2PUCA 3H5TA 1DULA 3VK0A 4ER6A 5A7LA 4X4CA 2IVQA 3NXHA 3RZZA 4Z58A 3PE5A 2EF8A 2HCSA 2KZ8A 1PERL 3FMYA 3QQ6A 4Z5DA 3QOXA 1PNRA 2PXBA 4PU8A 4X4EA 3BS3A 3ZPXA 4EKGA 4EZIA 1ZS4A 2PXDA 1ZZBA 1LCCA 1ZZ6A 2AXVA 3TEPA 2KEKA 1OCTC 2XCJA 1RZRA 2KPJA 3R1FA 1CQTA 2IVGA 1PRAA 4I6UA 1YSEA 4X4DA 2PUDA 3KL4A 3KJXA 1QQBA 3GUUA 2VEOA 1WETA 3G7DA 2YBDA 3SX0A 3CECA 3QOWA 1JH9A 1ZAYA 3B7HA 1AU7A 1O4XA 4X4BA 3BD1A 2AXUA 3GZDC 1LMB3 4YBAA 1NERA 3BDNA 2LYKA 1RZRD 4GHJA 3GN5B 4OB4A 4Q2JA 3MLFA 3OQMA 1LQCA 1ZUGA 3NZLA 3FYAA 4NDWA 2OR1L 3NROA 2PXUA 1X2LA 3QWGA 3SCGA 3MEJA 3F52A 3ME5A 2CSFA 2LYJA 2KEJA 1HQ1A 2OFYA 2EWTA 1JWLA 2IU7A 3ZHMA 2LYSA 3UWPA 3S8QA 2IVBA 2GRLA 4X4HA 3ZKCA 4WVLA 4IWRA 5K98B 1NW3A 2XXQA 4X4IA 4YG7B 1PRVA 1Y7YA 2BJCA 4MCXA 4J1XA 4EQZA 5GAGi 1BDHA 2PXQA 3NDBB 1ZZCA 4ER0A 1SQ8A 5JUWA 1DWKA 2PPXA 3SR4A 1WH8A 3R09A 3M9LA 2B5AA 1DW9A 2XSDC 5DT2A 2AWIA 1NEQA 2MQKA 2ODRD 5DTRA 2D5VA 1ZZ7A 2BNNA 3OQOA 1JFTA 2L49A 2PUBA 2AXZA 3QYXA 3LISA 2PXEA 4JCYA 2BNOA 3TELA 4Z5HA 2PIJA 4ER5A 2XIUA 2LYPA 4PU7A 1UTXA 1Y9QA 3GZDA 2O4AA 4ER3A 2O38A 4MCTA 1RIOA 2H8RA 2LLVA 1ADRA 3U3WA 2MEZA 2GRMA 4O8BA 1XWRA 3TFLA 4FN3A 1LCDA 3OQNA 3OP9A 1R63A 3G5GA 3OWQA 2HFZA 3KZ3A 2WUSR 1U2ZA 1BDIA 3SCHA 2PXFA 2LYRA 2XJ3A 3VWSA 2ICTA 1WIZA 3JXDL 5GAHi 2AUWA 3FYMA 1UXCA 1S7EA 2LYLA 4I6TA 1E3OC 3ZHIA 1PRUA 2FJRA 4OBMA 4F8DA 2JVLA 2AW6A 2CROA 2EBYA 4Z5CA 2XXPA 1QP7A 2JQEA 2XI8A 3OKZA 1RPEL 3A9YA 4EKIA 3JXBC 3CROL 4IA8A 3PXPA 4YG1A 3QF3A 3SCFA 3DNVB 5DRTA 1QQAA 2LLWA 1LLIA 2R63A 1RZSA 4X4FA 2BNMA 3A9XA 2IV1A 1POUA 2PXKA 4J1WA 3GZCA 2HSGA 2GZUA 1QP4A 2ICPA 1EFAA 5DSXA 2PXPA 2PUAA 3EUSA 2KEIA 3GBFA 3UFDA 3G0TA 4I8TA 1ZZ8A 1R69A 4ER7A 4YG4A 2LNMA 1JFSA 1CJGA 4PU3C 1HF0A 1ZPQA 2WIUB 2L1PA 3A9ZA 1GT0C 4I6RA 1L1MA 3HZIB 4PU4C 4Y42A 2L8NA 5DTQA 4EK9A 2PXTA 1ZZ9A 2IUOA 1QZXA 2PXLA 4JQDA 1X57A 4YARA 3KXAA 2FFHA 4IVZA 2V3CC 3QFIA 2A6CA 5DTMA 2PUFA 5DRYA 3O9XA 3L1PA 2PUEA 1B0NA 3F51A 2LCVA 2HCNA 2JCGA 4Z59A 4GQMA 3LFPA 2XXAA 4HRAA 2O49A 3DM5A 3IVPA 1WH6A 3OMTA 1OSLA 3TRBA
chains in the Genus database with same CATH topology
2HINA 1ZVVA 1O4XA 4X4BA 3D1NI 1QQAA 4FBIA 3BD1A 2AXUA 3GN5A 4Z5HA 2PIJA 1LLIA 2R63A 1LMB3 1QP0A 4X4GA 3F6WA 2R1JL 1RZSA 4JCXA 4X4FA 1UXDA 2XIUA 4YBAA 2LYPA 1NERA 4PU7A 3BDNA 2LYKA 1VPWA 1IC8A 2BNMA 1UTXA 1RZRD 2IV1A 1Y9QA 1POUA 4GHJA 3GN5B 4J1WA 4OB4A 2O4AA 1QPZA 2HSGA 2GZUA 3MLFA 3OQMA 2O38A 1LQCA 1ZUGA 4MCTA 2PUGA 1QP4A 2ICPA 3CLCA 1RIOA 2H8RA 3FYAA 2LYQA 4NDWA 1EFAA 3JXCL 2OR1L 1ADRA 2PUAA 3EUSA 2PE5A 1X2LA 3U3WA 3QWGA 2KEIA 3GBFA 2MEZA 3UFDA 3SCGA 2GRMA 3H5TA 2PUCA 4O8BA 3F52A 3VK0A 4I8TA 1XWRA 2CSFA 2LYJA 2KEJA 1ZZ8A 5A7LA 1R69A 2OFYA 2EWTA 4YG4A 4X4CA 1JWLA 2IVQA 4FN3A 1JFSA 1LCDA 3OQNA 1CJGA 2IU7A 4PU3C 3ZHMA 2LYSA 1HF0A 1ZPQA 3RZZA 3OP9A 4Z58A 1R63A 2WIUB 3G5GA 3S8QA 2EF8A 2IVBA 2GRLA 4X4HA 3ZKCA 1GT0C 4I6RA 4IWRA 3KZ3A 2KZ8A 1L1MA 1PERL 2WUSR 5K98B 1BDIA 3FMYA 3QQ6A 3SCHA 4Z5DA 1PNRA 3HZIB 4PU8A 4X4EA 3BS3A 4X4IA 2LYRA 1PRVA 4PU4C 4Y42A 4YG7B 2XJ3A 1Y7YA 2L8NA 1ZS4A 2ICTA 1WIZA 1ZZ9A 2IUOA 1ZZBA 4MCXA 2BJCA 4J1XA 4JQDA 3JXDL 1X57A 4YARA 1LCCA 1ZZ6A 1BDHA 2AUWA 3KXAA 2AXVA 2KEKA 1OCTC 1ZZCA 4IVZA 1SQ8A 3FYMA 1UXCA 2XCJA 1DWKA 2PPXA 2A6CA 2KPJA 1RZRA 3R1FA 1CQTA 1S7EA 2LYLA 2PUFA 1WH8A 4I6TA 1E3OC 3ZHIA 1PRUA 2FJRA 3O9XA 2IVGA 1PRAA 4F8DA 3L1PA 2PUEA 1B0NA 3F51A 1YSEA 4I6UA 4X4DA 2PUDA 2LCVA 2JVLA 2AW6A 2CROA 2EBYA 2B5AA 4Z5CA 3KJXA 1QQBA 1QP7A 1DW9A 2JCGA 4Z59A 2XSDC 1WETA 2XI8A 1RPEL 2AWIA 1NEQA 2MQKA 3JXBC 3G7DA 4GQMA 2D5VA 1ZZ7A 2BNNA 3OQOA 2L49A 4IA8A 1JFTA 3CROL 3LFPA 3PXPA 3CECA 4YG1A 3QF3A 2PUBA 1JH9A 2AXZA 1ZAYA 3QYXA 3B7HA 3LISA 3SCFA 3DNVB 1AU7A 2O49A 3IVPA 1WH6A 4JCYA 3OMTA 2BNOA 1OSLA 3TRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIN A;  1ZVV A;  1O4X A;  4X4B A;  3D1N I;  1QQA A;  4FBI A;  3BD1 A;  2AXU A;  3GN5 A;  4Z5H A;  2PIJ A;  1LLI A;  2R63 A;  1LMB 3;  1QP0 A;  4X4G A;  3F6W A;  2R1J L;  1RZS A;  4JCX A;  4X4F A;  1UXD A;  2XIU A;  4YBA A;  2LYP A;  1NER A;  4PU7 A;  3BDN A;  2LYK A;  1VPW A;  1IC8 A;  2BNM A;  1UTX A;  1RZR D;  2IV1 A;  1Y9Q A;  1POU A;  4GHJ A;  3GN5 B;  4J1W A;  4OB4 A;  2O4A A;  1QPZ A;  2HSG A;  2GZU A;  3MLF A;  3OQM A;  2O38 A;  1LQC A;  1ZUG A;  4MCT A;  2PUG A;  1QP4 A;  2ICP A;  3CLC A;  1RIO A;  2H8R A;  3FYA A;  2LYQ A;  4NDW A;  1EFA A;  3JXC L;  2OR1 L;  1ADR A;  2PUA A;  3EUS A;  2PE5 A;  1X2L A;  3U3W A;  3QWG A;  2KEI A;  3GBF A;  2MEZ A;  3UFD A;  3SCG A;  2GRM A;  3H5T A;  2PUC A;  4O8B A;  3F52 A;  3VK0 A;  4I8T A;  1XWR A;  2CSF A;  2LYJ A;  2KEJ A;  1ZZ8 A;  5A7L A;  1R69 A;  2OFY A;  2EWT A;  4YG4 A;  4X4C A;  1JWL A;  2IVQ A;  4FN3 A;  1JFS A;  1LCD A;  3OQN A;  1CJG A;  2IU7 A;  4PU3 C;  3ZHM A;  2LYS A;  1HF0 A;  1ZPQ A;  3RZZ A;  3OP9 A;  4Z58 A;  1R63 A;  2WIU B;  3G5G A;  3S8Q A;  2EF8 A;  2IVB A;  2GRL A;  4X4H A;  3ZKC A;  1GT0 C;  4I6R A;  4IWR A;  3KZ3 A;  2KZ8 A;  1L1M A;  1PER L;  2WUS R;  5K98 B;  1BDI A;  3FMY A;  3QQ6 A;  3SCH A;  4Z5D A;  1PNR A;  3HZI B;  4PU8 A;  4X4E A;  3BS3 A;  4X4I A;  2LYR A;  1PRV A;  4PU4 C;  4Y42 A;  4YG7 B;  2XJ3 A;  1Y7Y A;  2L8N A;  1ZS4 A;  2ICT A;  1WIZ A;  1ZZ9 A;  2IUO A;  1ZZB A;  4MCX A;  2BJC A;  4J1X A;  4JQD A;  3JXD L;  1X57 A;  4YAR A;  1LCC A;  1ZZ6 A;  1BDH A;  2AUW A;  3KXA A;  2AXV A;  2KEK A;  1OCT C;  1ZZC A;  4IVZ A;  1SQ8 A;  3FYM A;  1UXC A;  2XCJ A;  1DWK A;  2PPX A;  2A6C A;  2KPJ A;  1RZR A;  3R1F A;  1CQT A;  1S7E A;  2LYL A;  2PUF A;  1WH8 A;  4I6T A;  1E3O C;  3ZHI A;  1PRU A;  2FJR A;  3O9X A;  2IVG A;  1PRA A;  4F8D A;  3L1P A;  2PUE A;  1B0N A;  3F51 A;  1YSE A;  4I6U A;  4X4D A;  2PUD A;  2LCV A;  2JVL A;  2AW6 A;  2CRO A;  2EBY A;  2B5A A;  4Z5C A;  3KJX A;  1QQB A;  1QP7 A;  1DW9 A;  2JCG A;  4Z59 A;  2XSD C;  1WET A;  2XI8 A;  1RPE L;  2AWI A;  1NEQ A;  2MQK A;  3JXB C;  3G7D A;  4GQM A;  2D5V A;  1ZZ7 A;  2BNN A;  3OQO A;  2L49 A;  4IA8 A;  1JFT A;  3CRO L;  3LFP A;  3PXP A;  3CEC A;  4YG1 A;  3QF3 A;  2PUB A;  1JH9 A;  2AXZ A;  1ZAY A;  3QYX A;  3B7H A;  3LIS A;  3SCF A;  3DNV B;  1AU7 A;  2O49 A;  3IVP A;  1WH6 A;  4JCY A;  3OMT A;  2BNO A;  1OSL A;  3TRB A; 
#chains in the Genus database with same CATH topology
 2HIN A;  1ZVV A;  2M4H A;  3D1N I;  4FBI A;  3GN5 A;  2MXD A;  1QP0 A;  4X4G A;  3F6W A;  2R1J L;  4JCX A;  1UXD A;  1VPW A;  1IC8 A;  2J7W A;  2PXV A;  1MFQ C;  1QPZ A;  2PUG A;  4DE9 A;  3LQX A;  4DE8 A;  3CLC A;  2LYQ A;  1QB2 A;  3JXC L;  2PE5 A;  2J7U A;  2PUC A;  3H5T A;  1DUL A;  3VK0 A;  4ER6 A;  5A7L A;  4X4C A;  2IVQ A;  3NXH A;  3RZZ A;  4Z58 A;  3PE5 A;  2EF8 A;  2HCS A;  2KZ8 A;  1PER L;  3FMY A;  3QQ6 A;  4Z5D A;  3QOX A;  1PNR A;  2PXB A;  4PU8 A;  4X4E A;  3BS3 A;  3ZPX A;  4EKG A;  4EZI A;  1ZS4 A;  2PXD A;  1ZZB A;  1LCC A;  1ZZ6 A;  2AXV A;  3TEP A;  2KEK A;  1OCT C;  2XCJ A;  1RZR A;  2KPJ A;  3R1F A;  1CQT A;  2IVG A;  1PRA A;  4I6U A;  1YSE A;  4X4D A;  2PUD A;  3KL4 A;  3KJX A;  1QQB A;  3GUU A;  2VEO A;  1WET A;  3G7D A;  2YBD A;  3SX0 A;  3CEC A;  3QOW A;  1JH9 A;  1ZAY A;  3B7H A;  1AU7 A;  1O4X A;  4X4B A;  3BD1 A;  2AXU A;  3GZD C;  1LMB 3;  4YBA A;  1NER A;  3BDN A;  2LYK A;  1RZR D;  4GHJ A;  3GN5 B;  4OB4 A;  4Q2J A;  3MLF A;  3OQM A;  1LQC A;  1ZUG A;  3NZL A;  3FYA A;  4NDW A;  2OR1 L;  3NRO A;  2PXU A;  1X2L A;  3QWG A;  3SCG A;  3MEJ A;  3F52 A;  3ME5 A;  2CSF A;  2LYJ A;  2KEJ A;  1HQ1 A;  2OFY A;  2EWT A;  1JWL A;  2IU7 A;  3ZHM A;  2LYS A;  3UWP A;  3S8Q A;  2IVB A;  2GRL A;  4X4H A;  3ZKC A;  4WVL A;  4IWR A;  5K98 B;  1NW3 A;  2XXQ A;  4X4I A;  4YG7 B;  1PRV A;  1Y7Y A;  2BJC A;  4MCX A;  4J1X A;  4EQZ A;  5GAG i;  1BDH A;  2PXQ A;  3NDB B;  1ZZC A;  4ER0 A;  1SQ8 A;  5JUW A;  1DWK A;  2PPX A;  3SR4 A;  1WH8 A;  3R09 A;  3M9L A;  2B5A A;  1DW9 A;  2XSD C;  5DT2 A;  2AWI A;  1NEQ A;  2MQK A;  2ODR D;  5DTR A;  2D5V A;  1ZZ7 A;  2BNN A;  3OQO A;  1JFT A;  2L49 A;  2PUB A;  2AXZ A;  3QYX A;  3LIS A;  2PXE A;  4JCY A;  2BNO A;  3TEL A;  4Z5H A;  2PIJ A;  4ER5 A;  2XIU A;  2LYP A;  4PU7 A;  1UTX A;  1Y9Q A;  3GZD A;  2O4A A;  4ER3 A;  2O38 A;  4MCT A;  1RIO A;  2H8R A;  2LLV A;  1ADR A;  3U3W A;  2MEZ A;  2GRM A;  4O8B A;  1XWR A;  3TFL A;  4FN3 A;  1LCD A;  3OQN A;  3OP9 A;  1R63 A;  3G5G A;  3OWQ A;  2HFZ A;  3KZ3 A;  2WUS R;  1U2Z A;  1BDI A;  3SCH A;  2PXF A;  2LYR A;  2XJ3 A;  3VWS A;  2ICT A;  1WIZ A;  3JXD L;  5GAH i;  2AUW A;  3FYM A;  1UXC A;  1S7E A;  2LYL A;  4I6T A;  1E3O C;  3ZHI A;  1PRU A;  2FJR A;  4OBM A;  4F8D A;  2JVL A;  2AW6 A;  2CRO A;  2EBY A;  4Z5C A;  2XXP A;  1QP7 A;  2JQE A;  2XI8 A;  3OKZ A;  1RPE L;  3A9Y A;  4EKI A;  3JXB C;  3CRO L;  4IA8 A;  3PXP A;  4YG1 A;  3QF3 A;  3SCF A;  3DNV B;  5DRT A;  1QQA A;  2LLW A;  1LLI A;  2R63 A;  1RZS A;  4X4F A;  2BNM A;  3A9X A;  2IV1 A;  1POU A;  2PXK A;  4J1W A;  3GZC A;  2HSG A;  2GZU A;  1QP4 A;  2ICP A;  1EFA A;  5DSX A;  2PXP A;  2PUA A;  3EUS A;  2KEI A;  3GBF A;  3UFD A;  3G0T A;  4I8T A;  1ZZ8 A;  1R69 A;  4ER7 A;  4YG4 A;  2LNM A;  1JFS A;  1CJG A;  4PU3 C;  1HF0 A;  1ZPQ A;  2WIU B;  2L1P A;  3A9Z A;  1GT0 C;  4I6R A;  1L1M A;  3HZI B;  4PU4 C;  4Y42 A;  2L8N A;  5DTQ A;  4EK9 A;  2PXT A;  1ZZ9 A;  2IUO A;  1QZX A;  2PXL A;  4JQD A;  1X57 A;  4YAR A;  3KXA A;  2FFH A;  4IVZ A;  2V3C C;  3QFI A;  2A6C A;  5DTM A;  2PUF A;  5DRY A;  3O9X A;  3L1P A;  2PUE A;  1B0N A;  3F51 A;  2LCV A;  2HCN A;  2JCG A;  4Z59 A;  4GQM A;  3LFP A;  2XXA A;  4HRA A;  2O49 A;  3DM5 A;  3IVP A;  1WH6 A;  3OMT A;  1OSL A;  3TRB A; 
#chains in the Genus database with same CATH homology
 2HIN A;  1ZVV A;  1O4X A;  4X4B A;  3D1N I;  1QQA A;  4FBI A;  3BD1 A;  2AXU A;  3GN5 A;  4Z5H A;  2PIJ A;  1LLI A;  2R63 A;  1LMB 3;  1QP0 A;  4X4G A;  3F6W A;  2R1J L;  1RZS A;  4JCX A;  4X4F A;  1UXD A;  2XIU A;  4YBA A;  2LYP A;  1NER A;  4PU7 A;  3BDN A;  2LYK A;  1VPW A;  1IC8 A;  2BNM A;  1UTX A;  1RZR D;  2IV1 A;  1Y9Q A;  1POU A;  4GHJ A;  3GN5 B;  4J1W A;  4OB4 A;  2O4A A;  1QPZ A;  2HSG A;  2GZU A;  3MLF A;  3OQM A;  2O38 A;  1LQC A;  1ZUG A;  4MCT A;  2PUG A;  1QP4 A;  2ICP A;  3CLC A;  1RIO A;  2H8R A;  3FYA A;  2LYQ A;  4NDW A;  1EFA A;  3JXC L;  2OR1 L;  1ADR A;  2PUA A;  3EUS A;  2PE5 A;  1X2L A;  3U3W A;  3QWG A;  2KEI A;  3GBF A;  2MEZ A;  3UFD A;  3SCG A;  2GRM A;  3H5T A;  2PUC A;  4O8B A;  3F52 A;  3VK0 A;  4I8T A;  1XWR A;  2CSF A;  2LYJ A;  2KEJ A;  1ZZ8 A;  5A7L A;  1R69 A;  2OFY A;  2EWT A;  4YG4 A;  4X4C A;  1JWL A;  2IVQ A;  4FN3 A;  1JFS A;  1LCD A;  3OQN A;  1CJG A;  2IU7 A;  4PU3 C;  3ZHM A;  2LYS A;  1HF0 A;  1ZPQ A;  3RZZ A;  3OP9 A;  4Z58 A;  1R63 A;  2WIU B;  3G5G A;  3S8Q A;  2EF8 A;  2IVB A;  2GRL A;  4X4H A;  3ZKC A;  1GT0 C;  4I6R A;  4IWR A;  3KZ3 A;  2KZ8 A;  1L1M A;  1PER L;  2WUS R;  5K98 B;  1BDI A;  3FMY A;  3QQ6 A;  3SCH A;  4Z5D A;  1PNR A;  3HZI B;  4PU8 A;  4X4E A;  3BS3 A;  4X4I A;  2LYR A;  1PRV A;  4PU4 C;  4Y42 A;  4YG7 B;  2XJ3 A;  1Y7Y A;  2L8N A;  1ZS4 A;  2ICT A;  1WIZ A;  1ZZ9 A;  2IUO A;  1ZZB A;  4MCX A;  2BJC A;  4J1X A;  4JQD A;  3JXD L;  1X57 A;  4YAR A;  1LCC A;  1ZZ6 A;  1BDH A;  2AUW A;  3KXA A;  2AXV A;  2KEK A;  1OCT C;  1ZZC A;  4IVZ A;  1SQ8 A;  3FYM A;  1UXC A;  2XCJ A;  1DWK A;  2PPX A;  2A6C A;  2KPJ A;  1RZR A;  3R1F A;  1CQT A;  1S7E A;  2LYL A;  2PUF A;  1WH8 A;  4I6T A;  1E3O C;  3ZHI A;  1PRU A;  2FJR A;  3O9X A;  2IVG A;  1PRA A;  4F8D A;  3L1P A;  2PUE A;  1B0N A;  3F51 A;  1YSE A;  4I6U A;  4X4D A;  2PUD A;  2LCV A;  2JVL A;  2AW6 A;  2CRO A;  2EBY A;  2B5A A;  4Z5C A;  3KJX A;  1QQB A;  1QP7 A;  1DW9 A;  2JCG A;  4Z59 A;  2XSD C;  1WET A;  2XI8 A;  1RPE L;  2AWI A;  1NEQ A;  2MQK A;  3JXB C;  3G7D A;  4GQM A;  2D5V A;  1ZZ7 A;  2BNN A;  3OQO A;  2L49 A;  4IA8 A;  1JFT A;  3CRO L;  3LFP A;  3PXP A;  3CEC A;  4YG1 A;  3QF3 A;  2PUB A;  1JH9 A;  2AXZ A;  1ZAY A;  3QYX A;  3B7H A;  3LIS A;  3SCF A;  3DNV B;  1AU7 A;  2O49 A;  3IVP A;  1WH6 A;  4JCY A;  3OMT A;  2BNO A;  1OSL A;  3TRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...