2R69A

Crystal structure of fab 1a1d-2 complexed with e-diii of dengue virus at 3.8 angstrom resolution
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
97
structure length
97
Chain Sequence
SYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of a neutralizing antibody to dengue virus alters the arrangement of surface glycoproteins.
pubmed doi rcsb
source organism Dengue virus 2 thailand/16681/84
molecule tags Viral protein/immune system
molecule keywords Major envelope protein E
total genus 6
structure length 97
sequence length 97
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2r69A00
5IREA 2R69A 5GZOA 5LCVA 3UYPB 5KVEE 5GZNA 4FFZA 3N43F 5LBSA 2JV6A 3UZEC 4UTBA 2GG1A 1PJWA 1Z3RA 3WE1A 4FG0A 2ALAA 3UZQB 5KVDE 5KVFE 5B1CA 5AAMC 3VTTA 3N42F 4GSXA 5AAWC 4UT6A 4L5FE 3J27A 1UZGA 4ALAC 1OK8A 3IRCA 5IZ7A 4FFYA 5JHMA 3J2PA 3MUUA 5JHLA 1URZA 3C6EA 4GT0A 2JSFA 1OKEA 1SVBA 2JQMA 2R29A 3G7TA 4UTAA 5LBVA 1RERA 1Z66A 3N41F 3N44F 5KVGE 3UAJA 4AM0Q 2P5PA 4X42A 3UZVA 4AL8C 4BZ1A 4UT9A 2I69A 2V33A 3N40F 3C5XA 3P54A 2H0PA 1ZTXE 4UTCA 2HG0A 1OANA 5H37A 1S6NA 4BZ2A 1TG8A
chains in the Genus database with same CATH superfamily
2JKWA 3UYRL 5CS7A 4YZFF 2D31A 5IQ7H 3WEXA 4XNUH 2IGFH 4XPBL 5E2WH 5EOCJ 5FM5M 3NP3A 4GKNA 5CP7A 3N50A 3EBGA 4XXWC 5GS1A 1P1ZA 2XFGB 2YJLA 4PHZA 4CVZA 4OLWL 5B1CA 1JN6A 1X4ZA 1DCLA 2W1NA 3DV4B 1FYTD 5GGSA 4ENZA 4KH9A 1N0LB 3CXHJ 3DV6B 3EUDA 3QIWB 4U7MA 5ESAA 2EEFA 5C6WH 3K6SB 1EGJL 3GLEA 3QEHB 1BJMA 2X6CA 3O9WD 5I76B 4X98A 1E27B 3R7QA 1GOHA 1JV2B 3CFCL 1DDHA 5TE4L 1SZNA 2W60A 4CGUB 1IVTA 3ABZA 2YGPA 1NAMH 4ODWB 2GCYA 5IBLD 3Q0HA 5CZVH 4U1IA 4DVBA 5IJVB 4F58L 2B4CH 1AP2B 1KBKA 2Z93A 3CZFB 3BQVA 2R15A 1ETZA 4XXDB 4ODSL 4L8BB 1FFPA 4QOKA 2V2XB 5LQBH 1BHGA 5JW4M 4TRPH 4RAVB 4L8DB 4Y2OB 1QFUL 3LAFA 3IWUA 3OQRA 4RGMB 1KNOB 4L48A 3LKNA 4BXSV 5H94A 4WI0B 2HT4D 3IRCA 4UAOB 5E5RB 2Y36L 2E9BA 2FECI 3SN6N 1IARB 5MENA 1KEMH 1QWNA 2GW5A 3GMPB 1WDAA 4PJFF 1LWHA 4WY7H 1IEAB 3EOTH 4OU3A 3DO7B 3ETSA 2IANB 1AIFB 3H2PA 3INOA 3CLFL 4XP4L 3RURA 5HGDA 3STLA 1OE2A 3NA9L 2OMUB 5I18H 2QKSA 3TTYA 5AG9A 3CDZA 4FFZA 1Q38A 1LK2B 3HE7C 4DO4A 1PY4A 2E7BA 1XF1A 4BUHA 2CG9X 1FYTE 1YEKH 5BQ7A 5CEZL 1HQRB 5FB8A 3WY3A 3HVNA 3IKCB 1CD0A 2DKSA 3VXNB 3QUML 2QZQA 3NPZB 4R26H 4M1CC 2CK0L 2NUPB 1PZSA 1PNCA 3JBG7 4POZD 3UROR 3GKZA 3DIFB 2X2JA 3MBXH 3L3OB 2VR6A 4K71C 4AM0A 4G43B 5ALBL 3UAAA 4GKLA 4X9FA 1YAIA 4LASH 2WYHA 2CXKA 1H3PH 2ITCA 3KXFD 3HMWH 3TZVD 3OC5A 3S3CB 1OLZA 1J1XL 1IFHH 1YQVH 3RWJA 3MROA 5IJBC 2BS9A 3IMVA 4E9TA 1KTKE 2YKLL 3F7YB 4Z5RA 3K74B 4R3SB 2NY0C 1RZKL 2IADB 2DYPB 3DTXA 4Z95L 3ATEA 3J2PA 5FYJE 1JV5A 4IS6A 3ME0A 1E4KC 1EPFA 3MV7E 3GUTB 4ZX4A 3QIBC 4JM4L 1ZJAA 1U8HA 1B4JH 3DUSA 1YMMD 4RAUB 1HAUA 4Z3IA 1KWKA 4DOHE 1VA9A 3T77A 4GS7C 1OY3B 1BVKA 2X0VA 3BPNC 2EVIA 4G8GD 2PYEA 5HHNA 2Z4TA 1WZAA 1KWGA 1IIKA 3L2LA 1OTTC 1K8IA 1BWMA 1KLGA 5CEXB 3EYFA 4HEPG 2YBRA 4FKHA 3KPSB 1RU9H 4M7JL 2B59B 4LQFH 1NGXB 3QUZA 4HXBH 3LZOA 1P7QD 3P73A 1H19A 4M7ZC 5DMGD 2I69A 2FT7A 3Q5TA 5I24A 2B9BA 4ZMAT 4UIMB 1ZANH 4DKEH 3SGEI 1EO8H 5DRWB 5FUZL 5I2IA 2VLJD 1DYZA 2YUVA 3V4PB 5DFVD 3O3DB 2HFEB 4AQEB 4BH8B 4EN3B 1A6AA 3MLRL 5DUMH 2X4SA 3QUZB 2I07B 2XN1A 2LLLA 1NANH 2YSSA 3DROA 1S7TA 4LEXH 3RIAK 4BSVB 3GMOB 3H7BA 4O2EB 2EP6A 4KJPD 3DOHA 5C9JB 1DQQA 3V9EA 1JRHL 4L9DA 4X5LA 2EDEA 4BK4A 4MAYB 4Z7UF 4OUOA 4X7DC 5C0BA 2OZ4H 3AROA 4MMYB 3VD5A 4PRAA 4LEXL 1WQVT 1XL6A 2PABA 5IB3B 1Z5HA 1FORH 2ZCLL 4G9FE 1SVCP 4PJ5D 3GUTA 1MFAH 1QZNA 3C9NA 3MUZ1 4MCNA 4Y19A 3WUWG 4HG4J 2GB2A 1CDUA 4I3SH 2AXWA 3IDUA 5T5FA 2IPKA 4P23B 2WLLA 7FABH 4HU2A 2HAZA 1OTUC 3G5YA 5CLWA 1L0XA 2ZOKB 2YD8A 4IJ3B 1IQWL 5FOBA 4NKQB 2WYIA 1AE6H 2JJTA 4M7KL 5DD0H 1F2QA 4DAGH 2XC8A 4KNUA 2BNQA 5DS8B 4YWGL 3A6CH 1GHFL 2WQXA 4L1HA 4OLYL 2E47A 3U2SA 1NGQH 2H8PB 1GPOH 3I6LE 4HWBL 4PSPA 3FU7B 5C0AD 2G5RA 2VDPL 3ZDXE 3CDFA 3Q43A 2XNAA 2UWEA 3ARTA 1D6EB 1MJJA 3BAYA 4AMKH 4QHNA 1KC5L 2OX5A 5SWQA 3IKCA 3H9SA 3SQRA 1MW0A 1E28B 3RTQD 2GSIB 1T7VA 3NIDF 4LRNH 1JHLL 2Z7UA 3NIGF 4GRMA 3QRGH 1YN7B 3V2AR 1ONQB 2WP3T 3MLSL 3FU0A 4UINL 4XCFH 5A2BA 3CC5A 4JHWL 3WL9A 3LNEA 5E8PB 3QJUB 5DJDA 4WJG3 2JMRA 4PWIA 4QTFA 1CGUA 2X4PB 2ZPKH 3RWCB 3L4VA 4HWBH 4Y1AE 3EW3B 4GKNB 4MXQD 4APXB 1F2XK 2HLFD 2SEBA 4LVHB 3BAXA 3QQ3A 4LVNC 3V0WL 1S7XA 2MTPA 2Q76B 3NJKA 4PP2B 4B9ZA 3MGAA 1GYCA 2GABA 2A9MH 2VSKB 4PJBE 4UT6L 4KY1H 1JF1B 3DX4A 3B3IB 1I3GL 3FQ4A 1Y18A 1MDAA 1Z9SA 5F93C 1G1CA 1MVUB 1USQA 3IMUA 5F96H 3FHQA 3DYMA 1S7SA 2R2EA 3RKDD 3CN4A 3OTTA 4WI9A 3QXVA 3IDMB 1J88A 1LE9A 1P5VA 4OZIF 5BZDA 3V4VA 2EXSA 5CBAB 4GP8B 2BP8B 3PP3K 1IAOB 5I76A 2IEPA 3NABL 3U0TB 2UZXB 1ZVSA 4YAQA 1AE6L 4FZEH 2ZCKL 4JO1L 1JZJA 1S2EA 4R7VA 3ZTJH 3P3SA 3PL6B 1E3XA 4JL2A 4NZJA 3TF4A 2IAAC 1ZT1B 1SNRA 2OTUA 2L8AA 3BC9A 1KCUL 1FZJA 1I8KA 4CVXA 1KTLA 1U8NA 4LBAA 3Q8EA 4YQXH 5KANG 3CZLA 3MV9A 3MODL 4ZFZB 1NEZB 5DZVA 4E36A 1E4KA 1ZWIB 1I31A 2EH7L 3BUDA 3IS0X 4PUBL 5DHDA 1W8NA 4XCEB 3PDGA 4P2CG 1MRCH 3T4AA 3G5XB 4Y89A 2C7UB 1KGUA 3V4UL 1EZSA 4IYKA 4OF0A 1TETH 3PXLA 3AVEA 3HS0A 4G8FB 3TV3L 3RWGA 3NABH 3NIGE 5F1NB 2RHEA 1J8RA 3QZMA 4L1SA 3B2MA 5F7NC 3I50L 2C9AA 2HH0L 3BSZA 3GK8H 1A64A 4JM0A 1OAZH 3BPLC 3CCHB 4LQ1A 1BG9A 1EBAA 1O7SA 3F2LA 4FP8H 4UQ3B 4Z8FL 3IDGB 4MJIA 4B0MB 5IR1A 1V7MH 5D5MA 5A2KH 1FH2A 2KPNA 3KH3A 3MA9H 4W93A 3FCSA 2AEWA 4NNYA 4JRYB 1ZLEA 1ZOXA 4JM4H 4UT6H 3PPEA 1JZEA 4B9YA 2CO7A 4FI7A 4LKXA 2W5PA 2UV3A 2NY0D 5D2LB 5B39A 5CCKL 4ZW5A 1SXCA 1WE5A 2Z31A 3FK3A 4LLUB 1CQYA 2R29A 4L18A 5IGXH 5BJTB 3KW7A 4G70B 3ZR5A 1D5IL 1DBBH 1G9NH 4RAUA 2J5WA 3Q2NA 4N6QA 2UZPA 1FE8H 1AO7A 3RJDA 1E50A 4FQXD 4CN6A 3BN9C 1T66C 3ZE2F 4LRNL 5KJ4A 5JHLH 3PWUB 3UZEA 4GT7A 3QIUA 1QSFD 4I0PB 4JY4A 1KSRA 3Q6FA 4C59B 4X7EC 3OAWA 4YHOH 4NWTH 2VQ1B 3CFTA 1A3ZA 1NGWA 2W59A 5D1QB 3ARBB 3K2UL 2XVBA 4K8RH 4WU5B 5J8OA 1FJ1A 3HE7D 4Q89A 5JXAL 4KPHH 4AM0B 5FGRA 1KTDA 5LXGL 4O2CB 4FGMA 3J7HA 1OB0A 1G9ML 1BCIA 4U6YA 1H0DA 1V55B 3EO0A 4OJEH 2HTLC 5C8JA 1NCCL 5A2LH 3VFNB 3R1GL 4XMKH 5GRJH 1RK1A 4D9RD 2VQ4A 4FULA 1EJOH 2Y7QB 1KJ3L 2F19L 2MEJB 4KOBA 4MJHA 4Y16C 2HT4C 3Q2CA 1SPDA 1QEWA 3QUMH 1RAMA 1GTNA 4XN5A 3KPNB 3D0VB 1FFOA 4U31A 5JHMA 2ZKYA 4MJ5B 4TV3A 3B1UA 2WMPA 2CUAA 1XCWA 3T0WA 2B1AH 3VGDA 1XGTB 2FT6A 4ODXA 1AXIB 1OIOA 3VXOB 1ZPLA 1JGUH 1QEWB 4ZTOH 2LABA 3FU9A 3KR3H 2Z31B 3MPCA 3C9NB 4Y19B 4WY7L 4W6WB 3HG4A 4WNJA 1TQBB 4EPSA 4Z0XB 3GNML 4DGYL 2ODIA 1LP9A 2IXQB 4K2UL 4D0BA 1AQKL 3VXRD 1BQHG 2MOGA 4EIZC 2X4TA 5B3JE 1JF6A 4W6XB 1OQXA 3IDJB 4WO4C 4XP1L 3VQ1C 1YEGL 5EN2B 4NRYA 2B4CL 2C1OA 3X14A 5IREA 4QWWC 5F7BA 3I6KB 3A24A 5JHBA 2J4WH 2NNFA 5C0FA 4QPEA 1JDDA 4OM0H 3EYVB 3G5VA 4PREB 2ZXWB 4HMCA 1TQVA 1LO3H 3IF1B 5HYJD 5GS2H 3IETA 3MRLA 3N0AA 4R0LA 2Y5QA 3C12A 5E99L 4BELD 2MMXA 2NYZA 1HL4A 3GI9L 2NY5C 4WFED 4AL8C 4OKDA 5IM7B 2AF2A 2ZX8A 4AXWA 4ZZFA 1NFDA 4P4KD 4HX1B 3RTQB 1GGYA 4Q7DA 3UTPE 5KSBF 2Y6TE 4QRQA 2ISDA 5IUCA 4YS4A 3AS1A 4KX8A 4PJGA 4GO9A 4KDTC 3I02A 2MQGA 4C56D 4EI0A 4EZMA 5TPWL 2DYSB 4XP9L 1KIUA 4HUWA 2OMWB 1HI6A 3DGDA 1BWWA 4ZNEA 3FTWA 1IGIH 1CTNA 4NOFA 5TGBB 2AQ3A 4L2YA 4NSKB 5CBEA 5HGHA 1ZK5A 3DA0A 2B77A 1MUJA 1S9YA 1AGDB 4WUUB 5IB2B 5C09E 5I5IA 1JPTL 1OOWA 2P3YA 1A6UH 4H8UA 1NL0H 4AMXA 2M1KA 2OMVB 2VLRA 3A5VA 4AH2B 5A6MA 3L9RA 3PGFH 4G8GE 2Y2YA 1QFHA 3T0ED 3F6JA 4LSQH 1CXFA 3H8NA 4CC4A 3HW7A 3N9GH 4OZGF 1IC4L 1ZXQA 4FFVD 3E8UH 3SE8L 4KRPD 2NY0B 1PZCA 5DZAA 1HT6A 3KVDD 1WGVA 5DO8A 3FTSA 5BO1H 3E38A 1A0QH 1GW6A 2M83A 3NSXA 5E2VL 2FQGA 2IG2H 2R2BA 2KBGA 1KXHA 2R1YA 4XE0A 4A68A 4RETB 5BVPH 4TNWF 1RZFL 2X9ZA 5CCGE 1XF3B 5D6CA 2HSIA 2Y72A 3G3LA 4TL5A 3P11H 3PGCB 4G7VH 4F7TB 5JW4Q 3TO4C 3HUJE 2OP4L 2ATKB 4BQBA 3ARFB 4PMFA 2HVKB 3HMXL 4MMXC 4WV1C 3HLAA 3TNMA 4Y16B 3IXAA 1A66A 4KI5E 2DIAA 4UBDD 5E9NA 3RDTB 1BZ7A 1EEYA 1U3NA 1BFVH 3SDXB 4UV7L 3RRQA 1M6OA 3N1PC 2VUKA 3ROOB 2O6EA 3M46A 3MLXH 1TSHA 3K71B 2Q8BH 4M7ZB 2ZKMX 5I1HL 2WNGA 4JN1L 4GRLD 3JSSA 3SOBL 4S1RL 1Y1DA 2K3TA 2R9HC 2BSBA 5I6KA 5J1TC 1VIWA 4I8DA 1CT8A 3MLYH 3SGKA 1CG9B 3FU3A 1F4YH 4WEUD 4N26A 5SV4A 4RMRA 4JS7A 4G7RB 4PMEA 5INDB 3V6ZB 2FB4L 4LNRA 3MRCA 4ONFH 1WS7A 1XGYH 2VO5A 4WF7A 3C5SB 1JVLA 1IGIL 2JKLA 4PVBA 5EN2A 4K5PA 1OQOA 2Y6SC 2OMVA 1DQKA 1I1AA 1OGSA 4PEEA 2NNAA 1AR1C 3LN5B 5HDBE 4OZFG 4RGNC 2HTKD 2CDEB 4KRNA 1CC3A 4LU5H 3REWA 4MCZA 1A4JB 1Z66A 4YZWA 3VFSB 4NXSA 5ANMB 1I1AC 3QCUL 4HJJL 3QFJB 1WBZB 4FTVD 1N64L 2ARWA 5LN4A 4BE5A 1PJ9A 5C0AE 5B38B 4L4VB 5EIIB 3ZYOA 2PP7A 4QYOA 4DH2A 2W9DH 3TP4A 5T1LD 3FF8A 1T0MA 4JJOA 3F01A 4NP4H 3H42H 1U8MB 3Q13A 3ENEA 5FKPA 5KSUA 2OULB 1JNLL 4N0YH 4NIKB 5HHMB 4Y2DC 1ZSDB 5FYJU 2LAAA 1TFHA 2MCPH 4QY8A 3B9DA 1IQDB 1UQSB 2H6OA 4QMEA 1L7TH 4GW5A 1SXNA 4OZGA 4DPAX 5C0NC 1RZ7L 3PY9A 2Z91A 3CSTA 3RVVC 4DP9X 1IBHA 2Q3ZA 2J7LA 1S9VB 1GOGA 4QT5B 3AMKA 4U2ZA 4HT1H 4OT1H 5JOFB 2IQ9L 4MMZA 2APFA 2OJEA 1T22B 1INQB 2PR4L 4J2XA 3A4AA 1A4KB 1KMGA 3MXWL 1AI1L 3IGAB 3P3TA 3KJ6H 1SEBB 1S9XB 4C4KO 2VJXA 2C4FU 4OCXH 2GI7A 2VL4A 1BM3L 1DANT 3QDMA 5TQ2L 1YNLH 4PPTA 5IIEA 1A7PL 1S7QB 4N8PA 3I6SA 5HD8C 4GRWH 4H88L 2QL1A 1IAII 3VI3E 2FAUA 5FXCH 2ARJB 5I1DB 4FAAB 4WIQA 4NN5B 1QFOA 5T3ZH 3N42F 1HEZA 4WUUE 2TAAA 1MSPA 1X9RA 1OCOB 1R3HB 1P7KA 1KB3A 3TWYA 2TRHA 5FKPB 4WV1B 2WJ5A 2AQSA 4GW1B 4J4PC 3QJVB 3UBXI 1ZA3A 4FFYL 2X42A 1SHXA 3SY6A 1NDGA 1INDL 4ZMWA 3IPFA 4U7SA 5L6YL 3CDGB 1X4XA 1QA9A 5AKTA 3T65A 1WAAA 1WIPA 4OJCA 2NXZB 3PL6C 4WSGA 4D3CH 4OZHE 3OJVC 4R96A 1DFXA 2QPDB 4DN3H 4GSXA 2FNBA 1G7JB 5F6IB 1CD1B 4P5TC 5CGTA 5A7BA 1W8EA 1TJIL 2BSTB 1ZHNB 1QX1A 4JRFA 3SOTA 4HIJB 5C6TH 1YYMH 3IFOA 1FO0L 2W94A 1YJDH 1XD0A 5HHMD 1FNLA 1IC7L 5FEBA 1RPUA 3L9YA 4KZDL 2FBRA 3BAJA 4IOFD 3NIFF 4TSBH 1CGSL 1AS6A 1PW3A 3IFNH 3GBEA 4M7LL 2B9AA 1OM3L 1A14H 1E4WH 3PXHA 1F90H 3RUGE 2VR4A 1ZK9A 1FL3B 2XWDA 4JPIB 4WUUD 2CCLA 2LLNA 15C8L 4KRMB 1SYVB 3D25A 5BXFA 3P9LA 4Y4FD 3WUWB 2IVFC 3F62A 3BSHA 2UWEE 1CFVH 3GUFA 4I0PD 3D0LB 4JM2A 4PH8A 1FG2A 3MJ6A 1OAZL 1JHKH 3MVSA 2BHFA 3U6XA 4NZTL 5E23A 2IBBA 4PWJA 5TD4A 4BFGA 4JANA 2VW7A 1UB5A 5KSBA 3E7JA 5FO8B 1LEKB 3BIKA 3BN3B 5F88A 5C0IA 1RPKA 3WSQL 1GYVA 4OLXL 5EUOE 1KJVB 3UJTL 2Z91B 5LG6A 2XV0A 4AKQA 3C60C 1Y6MR 2R2BB 1EVTC 1W72H 2PYFB 3SBPA 4OBRA 1E3ZA 3VI4A 5JDSB 2VIRB 3P73B 4Y1AA 2YPKA 1P5UA 2B5IB 3D5OF 1FA4A 3I6GB 5KSAA 5GS0C 5EZLA 1JPSH 2EADA 3PWJA 4A37A 4JKNA 3U30B 1N68A 1ZT7A 5IVXF 2LHAA 5CAYB 4Z18A 1MPAL 1LNUB 4PTUA 3IJEB 1JZ6A 1O0VA 3MLUH 1WZ1H 3NCCB 3CFBB 3S96B 3DURA 2ZONA 3PP4H 4QXUL 1GAFL 3SKMB 2Y1VA 3IEAA 5JORA 3MLZL 5BUPA 4DK5A 3N91A 3ESMA 3FAXA 4KXZH 2QGEA 3TIEA 3QDGD 4R7NA 5MEOB 2WD0A 5LBVA 2ZOUA 3KPPA 5LWYL 3L3GB 4HK3N 1YEHL 4QHKJ 3QZWA 2AHIA 4BBWA 4JVWA 2W95A 2Y24A 3IMSA 3WI9A 1OD7A 2ID5A 3P4OB 3LH2H 5EU4A 4B5ZA 3L9EA 1K6QH 3Q5YA 4JO4L 2CR6A 4ZW7A 5BUGA 5EU7C 5CBAA 4ZW3A 3WFCL 4KY1L 4DUVA 4HHAB 2BSEA 4ZODA 1NAMA 2ZQKA 1JGVH 1HHHA 4ERSL 2YD9A 5CLYA 1R3KA 3FH8A 3QUMB 3PPSA 3QIBA 5DHMC 2R27A 3PL6D 2HLEB 3SKJH 4Q2ZB 5AYTA 2PYEE 2BC4B 4FYQA 4K7PY 4Y19E 4NO3B 5D7IF 1NDMA 1DJZA 4OFYD 3PHSA 4KU1A 1EAJA 2GJ6B 5ID0A 4XN8A 3Q5OA 1PNDA 2VLLA 4G59C 4KTGA 3MJ8A 1DN2A 2F58L 1LQBC 3UXFA 1T6WA 3CAFA 1KCWA 3X3FH 5KS9E 3IJHA 4K8RD 2J12B 5EUOA 4LPCA 4A39A 1F00I 4ZPVA 1CD8A 1UD2A 43CAA 3C6SB 5J4MA 4LSTH 3SYCA 2F6AA 4YGAB 4JPVH 3HPLB 3MOAH 4R7LA 5E7FA 5F7YC 3FT3A 3ZDZE 4OLEA 4ODHH 2ESVB 4UOW1 2DQJL 1LHZA 4MWFB 2VB5A 1QSED 2VZOA 3CZUB 4ZYKB 2WB1A 5CN2A 3UERA 3VU1A 4P48A 1TO4A 3NZUA 5MERA 1KOAA 4HULB 2VMEA 8PAZA 5EO9A 3IFPA 4JEGB 1BZEA 1OHQA 1JPFA 2ETWA 1R3IL 2C8NA 4JFYA 4HHWA 2QPFA 5C2BH 4WU7B 1A7QL 4B3VA 5HI3D 5CINH 4NUPA 3KDMB 5JHDA 1EWHA 4PRPB 4WWPA 1KGCE 1TJGL 4PP1C 5C08A 4GKZB 3EJZC 4OIIH 5FA3A 3CXHK 3QEQD 1BX2B 3V4PH 4WHYH 5E8DL 4OCSH 2AJYL 1OAUH 4CVWA 4HJJH 1RUPL 2WNXA 4HFUH 3WGUB 1RK0B 5DDHA 4JO3L 1SYSA 1WUZA 2VJ8A 3GZQA 4DK3A 4KAQH 1YYCA 2J1KA 3EH3B 5A6LA 3PWUA 1PPIA 1NDMB 3QWRA 3MRGA 3DTUB 2VDMH 3QUXD 4KK8C 4ZD3L 4MNQB 5CD5C 5A1AA 2ZD0A 2JVUA 1OSPH 1OGAD 3KPMA 2BP5M 1AZUA 4UQBA 5F9OH 1CXKA 4MXWH 5ICZB 5GRYA 2BPBA 2NX5A 5EO0B 5HJGA 4MYPA 1O9WA 3K6DA 4HHGA 4P23C 4S11A 1CDCA 3P1VA 2EIBA 4W9DC 5C7XH 4NC0B 3DX0A 4XO4A 2XKSA 1TTCA 3MLYL 4IIZA 3QHTC 4R5VA 4NT6B 2OS7A 4PGEA 5T3XE 2HTKC 4XVJH 1HSBA 3QG7L 3D18A 3ML9A 3NESA 4LSSL 1CLOL 3WIFB 2GY7B 2GTQA 2R1WB 2F15A 4S1DC 4AYBA 1BFVL 2KLTA 3N3EA 1Q94B 3K4ZA 3FT1A 5FHAH 3WNPA 4AZUA 2ENPA 1S7VA 4LPWA 4NWUH 1PKQB 3Q2WA 4B95C 2FCBA 4B6ZA 2YN3A 2ZXQA 3RWDB 4U1GB 5I17B 3CK0H 2JJSC 4M5ZL 3DX2A 4WU7A 1NFDB 3HG1E 3NJXA 4GSQA 4U4BA 5EOTA 3P4LA 2X2UA 1Q94A 2BC4A 4NZRH 1RZKH 1V54B 4YHZH 4Z95H 4OCWH 1X5LA 2E27H 5EF0A 3FFCE 4L1LA 1YC7A 1PYWB 4JKLA 1CFQA 4TUKH 3TCTA 4Q9BA 4B41A 1EH9A 5I26A 3UAJD 3JTTA 3V55A 1S7TB 3QDAA 4WW2F 1FH5H 4LSQL 3K4DA 4KFMA 4AEIH 4PRDB 1IIIA 1TVDA 3D1MC 3WEBA 2RIKA 1I1YB 3PHQA 2NZ9D 4Y4HB 1JWMA 4OJYA 4HKJA 5C09B 2FYVA 5C2UB 1MZYA 1RZIB 5EIVA 3WS6A 3KL5A 2HXAA 1OE3A 4FXKC 4XX5A 2EIEA 4CAGA 1JRHI 4N8VB 4DK6A 2ZUTA 1JI1A 1HJBC 4Z0XA 4TVPD 1YEWA 3PUUA 5TFSH 2DJMA 4YJZL 1FWXA 1ZHBB 3FBQA 4NERA 2H9GB 3RNKA 1KENL 4TLKA 3WTWA 1TTAA 4IU3A 4NO0B 3T3PB 4RX4A 1I8MB 1HZLA 3A22A 1FAKT 2AEQH 4FFTA 5EZLB 5DS2A 3TOPA 2ALWA 3GSNL 4ZDHB 4I18B 5DUPL 5KSVA 2XVKA 3OSVA 3HN5A 4WWKB 2R83A 4I5BB 4PG9B 1AO7E 5DC0A 4P9HH 3B5TA 3KHOA 4R97B 5FA4B 3T6XA 5FFLA 1E5UI 1JZHA 2EDFA 3B7RL 1L6ZA 1U8IA 4G6ML 1J5OH 5L2JA 5L7XL 1G7QB 1VCBC 4JPWL 3ZMRA 1MUJB 2O5NA 4IKNA 4PGBA 4FN0A 2VDQB 4MNQA 1CURA 1SJXA 4K7PH 1BREA 2VXQH 2FNWA 2K9FB 5D1QD 1ES0B 2YQGA 3BKCH 2JLPA 2XKUA 3R0MA 3S35X 3MRNA 3ULUE 4QHUA 5ADPH 3ILPB 5DDHB 2P5WE 4LMQI 1RP8A 1SBSL 5DVLA 1T04A 2R7EA 3EYQC 5IQ9A 1T7WA 3LQAH 5M7QA 4JFSA 2QADD 3IJSA 4ZMTA 2EDWA 2KZWA 2WSPA 4PJ9D 4ELDA 1OK8A 4O4YL 4YMPA 4FG2A 1T20B 3OKLB 3UYRH 2ZUQB 4ODUB 2N7AA 3MV01 3W39B 2B1OA 2VWEC 3E6HB 3ECWA 5D8JH 2EE0A 1IB5A 3IU3B 3GSQA 1TENA 3P0VH 3B2DC 4JFZL 2BSED 4ZT1A 3W9EA 4HWNA 4LSDA 3VD0A 2NLJB 2WTRA 4WW2A 3F5WA 1I8MA 4OB5L 4WAFA 1KTDB 1OAYH 3DX9A 3BIBX 4LNVA 1F58L 4NHCL 4P2OA 3ARSA 3RL1B 1SDYA 3OWRA 4LXFA 3GRWH 5IMKA 5AWNL 1BAGA 3GSRB 2ED7A 5AAWC 5IJVA 5E8NB 1P9MC 4CKQA 5K1NA 2B8OT 5LKNA 1IKNC 4NO2B 3RZWA 4NAJA 3FUNA 4N9GB 4TQEH 4QXVA 4R2GB 5ECJE 5JA8B 4HXAH 5J1SC 5IB1A 1G7LB 3FB6B 4PRDA 4KV5F 3LPFA 2B08A 3QDHA 5K1VA 1IVLA 2I9TB 2A99A 5CJ8A 1NBZA 5EU3B 5HHOD 3BWAB 3FFOA 4HW6A 2WTOA 3NACH 4PJFB 4UIMA 3TCLA 4JFXA 1HZKA 5EU5A 3FSOA 4JCWA 4NHCH 3WO4C 3RFZC 3Q8AA 2NUTA 2D2OA 4YHLH 3FTZA 1A3RL 2DBLL 3EYOB 3FH7A 1OW0A 1VB9A 3QDMB 5MHSE 2ZKWA 4JG1H 4WEEA 4N6RB 5D7LE 1Z5LA 2A74C 2NOYA 3WNNA 4OCRH 3EXLA 3FMGL 3SE9H 5ES4B 1A2YA 1VADA 3ZRFC 1KJ2B 2AVFA 2I60L 3PREA 4JE0A 4WFGE 2YPLE 2WBJB 4OIBA 4U3SB 2NNAB 3K4AA 4NJ9H 5DRNB 5IBUB 4AE0A 1Y6NR 1D5BB 4MAYD 5EOCH 3PNRB 1MHPH 1WHOA 1HDMB 3OX8A 2VGLM 2X1PA 1BXXA 1CLOH 3D4GA 2C9UA 4FQHA 4JUSA 1HYSC 1HQ4B 3UZEC 4OJDH 3F7YA 1R6VA 4OZHF 4HKZA 3HI6L 5IMOA 1ETA1 1INEL 1RLWA 3OG4B 2X0UA 1UWEH 3QGVA 3ME0B 1RXLA 5C7XL 4AEEA 4X4YA 1U8IB 5DHVB 1GJIA 1NMCC 1UWYA 4N1EA 5T5FL 4M6OL 2WBXA 1HN1A 4BKTC 3MBEA 1TJHL 1JMXA 2J6WA 1YYLL 2OFQA 1ZXKA 3A6BL 2EEXA 5D7KE 4ABWA 4JKMA 1N6QL 5C7ZA 1PBYA 3TBYA 2ZT9C 5FX3A 1T0NA 1Y0LB 4JZNB 1HNFA 3R4RA 5BMFL 4WKZB 3FTUA 2AEIT 4M8QA 3EDDA 3RY6C 1T2QH 2J1WA 3D2UB 3MV7B 4QT5A 1G7MA 1E28A 3ZRCC 4K3EL 4QCIA 2FJGA 1DO6A 2ITFA 2VL5B 3TBSA 2CK2A 4C8XA 5JXEC 2N0KA 4XMVA 4Y9GA 5J6GB 2NPLX 3FOMA 3MRJB 3R0NA 5K59F 2X89D 1R33A 3L8QA 3Q01A 5EOQH 3TEXA 4NOBA 4Z3EA 2HCZX 2Q86A 3REVB 4OIIL 3FONB 1WFUA 2A9BA 1PZ2A 2DJUA 1KYFA 1A9EA 1G6RB 1MXGA 1TTGA 3Q44A 5GRWA 3QQ3B 4R9HA 4APXA 3BPCB 5D4QA 1AG6A 3ECBB 4WTZA 3O3BB 2XN2A 3U1PA 4PY7B 1DE4B 1S78C 1HDMA 3OX8B 4UQDA 1KDJA 2A6DA 1CU4L 1MCJA 3BGAA 1CGSH 4TNFA 3ZHNA 1F1DA 1MVFA 5IZ7A 3ARVA 2WM0A 2O5ZL 3IAQA 2E7CA 2OMTA 3SCMD 2IOIA 1BF5A 5CFHA 3FUKA 3HE6D 1FNGB 5HGAA 5IJKA 3H1ZA 5B1JA 1U4FA 1MLCB 3RKDC 3MYZA 2VLJE 4HIHA 4P2QD 3A67H 2H4EA 2OJ1A 1JOIA 2XHNA 2VUYA 4N2KA 3F6IA 3UPCA 1KBGL 4WKXA 4AQOA 3NH7H 3BT2H 1YEDA 2BVUA 1T0NB 4KUCD 5AAPA 3W5MA 3UAJC 3QIWA 3TYGL 2EEDA 4WGWB 2SODB 8FABA 1G1KA 4N5UA 3TBTA 4OCMC 4OZHA 4ZFOB 3VWKC 5I1KH 3K8MA 2H6UA 4YUEH 5ISZE 3BAKA 1BXUA 1QD0A 1BVLB 1K8DB 5G4MA 4MDIA 4NQEB 1VERA 4PRIB 5D1ZA 1K9TA 5B4MD 2FGWL 2VZSA 2EJ1A 2O5XL 2LE9A 5LGHH 5DJAB 1BVZA 4RMBA 1F02I 3UG4A 1BEYH 1HZHL 4CMHB 3VRIA 1ONQA 1M2OA 3D39E 4L1DA 4UNUA 2CHWA 3MRNB 1T1XA 3D3VA 3IJ9A 2BDNL 3KWVA 4GG6B 2VE6A 4ZXBB 3KMDA 2JQMA 4PRHE 1DLFL 2MHAB 4EZJA 2LR4A 1FCGA 1NOLA 3PWJB 1MJUL 4GB9A 3B83A 2ZSWA 3FTYA 1BLNB 2CU9A 2YAHA 3IU3A 5HYEA 1QZ1A 1WS8A 3JXAA 4HV8B 3CDZB 4QXUH 1C9SA 2OMTB 1KYAA 3WYRA 5DQ9B 1VZHA 4JKPH 2VDLH 1RIVH 4JMNA 3F85A 4X4YB 1QTPA 1HOEA 1LO4H 5I1JL 3BP4B 2XA8H 3CG8A 1OWRM 4HGWB 1OGPA 2KZKA 2BNQE 3NFNA 5HPOA 4DKEL 4ZFOL 2FBJL 2FH8A 2VN5A 3HUJF 4R5TA 2YXMA 3VFUB 1FAIL 4OLUL 3DPBA 1DJHA 1A7RL 1GIGH 4WDIB 1QRNB 3BVXA 2QHLA 2DDQH 1HX0A 4OZ4A 3W0WE 2DRUA 1M2VB 2E7MA 4LQFL 3QCTH 3FB6A 3JWDC 1DSFL 2BY1A 3GMLB 4XXCA 2MNUA 1NGWB 5D1QA 5EF3A 1N8ZB 5ICXA 1XX9C 3FOMB 4NP4L 1H8NA 5DD3H 4ZX6A 1SYVA 1C5CL 1E4HA 1VHPA 5E6IA 4JQIA 2WINA 1MCOH 3RGVC 2OW6A 5AB2A 5ENWB 2VDLL 2V8LA 3FL7A 3LEVH 4KVPA 1FN4A 2RJMA 5C0BE 1G1OA 2X40A 4OD3H 5FO9B 4J1UB 4M93B 4ZFFA 1ZTXL 1I1RA 4HCIA 1H3WM 2PXYD 4LVOB 5JIDA 4WW2B 4HUVA 3QXAA 5EU5B 2OQJB 1RLBA 2QMJA 3V6OA 2IH1B 1NJ9A 2X70B 2E56A 3GXIA 1FN4B 3VW3H 2QR0B 3VD1A 3FDWA 4H5SA 3W11D 2A73A 2VRAA 2XN9D 5JW4R 1MFCL 4XOEA 3KPMB 3FSAA 5GHWH 3IXTB 5CKAA 4XMPH 4KI5C 1LYQA 4DSYA 1CXHA 2YWYA 3MLVL 5CGBA 4ELME 3ULVH 3QIUD 2XWEA 2PWEA 3OSKA 3EADA 2A5UA 3H56A 4S1RH 1S7UA 2ZXDA 2WGNB 4D3CL 3M7FB 4XBMA 2ATAA 1GKOA 5AZUA 1NKGA 3QR1A 4ZI8A 3L1OL 5B8CC 2GJ6D 3F7LA 5MEPB 4H0HB 4H88H 5IW1A 3DUHA 4IRZA 4FFYH 1IX2A 5KEZA 2NXZC 3P3RA 4PRPA 1B4RA 2IBZY 3LRKA 1KFAL 4RWYL 1WPCA 3HRZC 3UX9B 5GGVL 5JIQA 1X4YA 5IMLB 1MW3A 4G8IA 3PWVA 2XN9A 4FLQA 1UCTA 3D34A 4CN4A 3EYOA 1IRAY 3HZMA 4ZPTA 1SHWA 3RVTD 3O11B 3ULUD 2PW2B 4L3FA 4KRLB 3JV0A 3DRTA 4UOW0 3QUZC 3UAEA 1WAAE 3IETB 2WBKA 3MRLB 3QJRB 1HEHC 2ITCB 4NQDA 3O6LL 2IQ9H 3QUGA 1C5CH 4JZJA 2VDKB 2H41A 4YHPB 1VFMA 2H3KA 3RLSA 1C5BL 5CEZE 4P23A 3MBED 3WY4A 4GQ9L 3WKYA 1HSAA 1LO5B 4IEFA 2R8SH 1UZGA 5H2BA 3SD5A 2QKIB 4HZ1A 1KJMA 1BZ8A 1Z32X 2UZXA 2EDJA 1S46A 1YZZA 4XOCA 1ACZA 2ED6A 3D85A 1DO5A 2FUQA 2H26B 4XPGL 5EA0L 2X12A 4WI3A 5I75C 2BNUA 2BRRH 3BESR 5DFTA 4K3JH 4OFQA 3MOBL 1NGYA 1WBXB 4ONGH 1FPTH 1MWAH 2XA8L 4M4RB 4GW5B 4M61B 4RRPA 4I9WD 5LBSL 3IN0A 2MIZA 4L4TB 1RZQA 1IGJA 2LFGA 5DD5L 3DPBB 1FFNB 5DMKB 3CBJB 3PYCA 5FDYA 1B0RB 3WNLA 4LSUL 2NR6A 3WEAA 4IDJL 3HI5H 4ZOCA 3IJEA 1CGXA 4OZIB 2YA2A 2UYLA 3HNVH 4Z7QB 2YZ1A 3VMOA 1DLHB 5DJCB 1F90L 1FSKC 3EHBB 4GXUN 2Y1AA 1J05A 2XN0A 5AVYB 3RILA 5DD6B 4QHLA 4N0UB 4O2FB 5I2IB 3KPTA 1CD1A 2X89A 2JJTC 4IBTA 3Q2VA 3ZOAA 3PHOA 1HWHB 2ZYIA 4W9EC 5EMYA 1AVAA 1ZHNA 3NUKA 1D7FA 2O6DA 2N59A 1RZJL 3RNQA 1TFPA 3RWHA 2AXFB 3M1OA 4U1NB 1ET7A 3WIFA 4P99A 1P2CA 5T5FH 3FO1A 1TJIH 4B53A 4O2FA 4DHLA 3GJFA 1N5AA 4M6ML 4FQIH 3RJOA 4PJEE 1L5GA 2FH6A 3SJVD 4I1NB 5LGHL 1RUQL 1Q1JH 3BYYA 2KH2B 3EJUA 4Z7QF 4QR7A 4I3RH 4G6MH 2JCCE 4Y4HA 4JFDB 1ACXA 2Q8BL 3TTSA 2DQTH 3WJMB 1QATA 4Y5YC 3ARWA 2GBUA 4R2GD 3JWNE 3AQXA 5GSVA 4HUVB 3E0GA 4PJXA 2WO4A 1NC4A 1CBVL 2ZP9A 3L2MA 2WXKA 5TTRA 5LDUA 4OFIA 2Y2TA 4MAYC 1WV7T 1XF5A 2RTTA 4Z76A 5J6SA 2H3NA 4MJ4A 4R7DB 5EO0A 1FNAA 4CA4A 1T1ZA 2FJFA 5JNYB 3TA3D 2FWUA 1NUGA 4JO8A 4WEMB 1KJVA 1RZFH 2DM7A 4H1LH 5AOIA 1JFQH 2ERJC 5J3HC 3BEWA 4NXKA 1BQKA 5DK0A 5D7LA 3OD3A 3LRHA 3BCDA 3FUFA 3E8UL 4F27A 2GAZB 3AT0A 3NJGA 3B9KB 4N20A 5BZXA 4X6DA 2BVPA 5EBLA 5I8OL 3PLYA 1M9SA 3TBCA 4PJ9B 1D9KA 3LCYA 1P5UC 1AG0A 3BLPX 3C5ZD 1G9MH 5LGYA 2OK0H 1KY6A 1WWAX 5LXGH 2Q6WB 1BJ1H 2OJZL 2P8LA 5LXVA 2FHCA 3L3IB 3N1MC 4E0RB 3QUYC 1EGJA 3AS3A 5JOPD 1A7OL 1QFWM 2A4EA 5H37A 5HGDB 1S9YB 3DVFA 1NTDA 5KVEE 1Y1UA 3QORA 3T6VA 5I73C 3VI4F 1DZBA 1F3JB 4QRUB 4OGAD 3WKPA 1PCXA 5D70H 1IL1B 4XBPA 5EEXA 1U21A 2H7WA 1OAYL 4GG6A 3ERXA 2EKSA 3QS3A 4KKCC 3ZUCA 5H37G 2GSMB 4TYUA 4N4YB 4RWHA 4LCYB 5KVEH 2Q0ZX 2XVGA 5DI8B 3ULVC 3BZ4B 1GMEA 3TBWB 3VXUB 5E2JA 2VQUA 3ASWA 1IKFH 4H1LA 4P2OC 4XVSH 1T4KB 4QRAA 3VFRB 4PJAB 2DLIA 4UNIA 3I6GA 1ZT4A 3D2UA 3MV7A 2BHZA 5AVXB 4U6HA 1ZVSB 4MAUL 2HUHA 4CU7A 2IWKA 2QSCL 3FFCD 3IVKB 3C8KB 5LDSA 2HKHH 3AXLA 1YN6B 4Y2DD 1JNNL 1VPOL 2QV2A 4CC1A 1XEDA 2YAQA 3ARDC 1E4XL 3QE5A 2DL2A 4Q2ZA 3SQOH 4JDTL 3US1A 1MI5E 4X4KA 2KLRA 3IBEA 3LQZA 2GIXA 4OGQC 2EDLA 1L9OA 1G7LA 1WT5A 4X9BA 1I7ZA 1CT8B 1QTSA 5EOCL 4ZK8A 3WIIL 1TLMA 2WBJD 1TZHA 1RCYA 4POYA 3ABLB 5LCVL 4H8WL 1OP3H 1WIOA 1YEGH 2P5EA 5HHNB 2I60H 2EH7H 3UC0H 3LX9A 3HE7B 2BVOB 2MKLC 1CFSA 1U93B 2CA4A 5DEGA 5FS5A 3SDAA 1URZA 3II2A 3WE6B 2GKIA 2OA9A 1AQKH 2NY7H 1OCZB 1E67A 4RMVA 3VXPB 3VU2A 4YC2B 5DXWA 2HN7B 4OM1L 5EZOH 4LLWB 3BP5A 4CSPA 5CZXD 4QOKD 3HG0A 3V4VL 4PRBB 4GG6E 1EJOL 4LESA 4UDTA 2YMOA 3V4PA 4BH8A 4GKZA 3MJ9L 4PJCF 4FZEL 1XHHA 1TQCB 1PJWA 4DEPB 1KENH 1I8LA 5TDOA 1EBPA 2VNCA 3AB0C 1ZCRA 4E9XA 2Y0SA 3PS6A 1QFWI 4PS7A 4WHCA 3RPKA 5FYKL 3H9YA 4RSYA 4LARH 2XFXB 3QWNA 1G7PA 3ETBF 4PJ9A 5IROD 2KT6A 4L3EB 1RFDL 1KJ3H 2F19H 3MRQA 2ZICA 5GS0L 3FTGA 1K4CA 4TNVF 1E9PA 2A77L 2NQDA 1A4KA 4NQCB 3V9CA 1OW0C 1NBVL 3NRPA 3BAIA 4PJ7B 4Y4HC 4FFWC 5DURD 2H1PL 1A6UL 2MKWA 2AQPA 3BHBB 4NENA 2HRHA 3G9AB 2NX5D 1S9VA 4XN4A 5D2NC 1PKQE 3EJJX 1K3IA 2YPVA 4Q0XH 4AGQA 4UQ2A 1E5CA 1OGAA 1SJEB 2DWTA 7PCYA 4EBQH 2C9XA 2GEQA 2GTZB 3RY6A 4NWTL 3DGGA 4HZAA 5I66A 2LQRA 4EVNB 4MBRA 2FTAA 4M00A 1TCRA 5T1DL 2WSDA 2PO6C 3W5NA 1HL8A 2H8PA 2VAAA 2JI1A 3KEHA 4PRNA 3CXDH 1PCSA 4OW6A 5DJYA 4HBCL 1ZTMA 3KWXA 5IHWA 3LY6A 1UB6B 2CO6A 1V10A 5KUKA 4YVNA 1B6UA 1NBZB 5EU3A 5HI5C 3GI9H 3K72A 2YA0A 1HIML 1SYSB 1TCRB 2DBJA 2WWNA 3BQUD 3EZ8A 5FHBL 3BZEA 5IGXL 1FO0A 2DQHL 2IOMA 4QRTA 1QLFA 4F1SA 3KYOA 4KO7A 4D2NA 3CDGA 4S1SH 4XC1H 2GC4C 1V8HA 3LNFA 3V8OA 3GM8A 2FEJA 3TV3H 3LV3B 4YVUA 3MLZH 4DNLA 4KK5D 2CM6A 3V4UH 5C86A 1U30A 2YRZA 3VRLF 3QYMA 3PQYE 5D7HA 4L4JA 2BIQA 3OKMA 5MEOA 3RGVB 4LCWA 2Y06L 2P47B 3Q06A 5C0GB 2DIJA 4EDWL 4B60A 3JTBA 4PN6A 2Q8AL 2HH0H 3QZWG 5F70A 4CBPA 1TTRA 2R0WL 5AFAA 5C0CA 1G4RA 3DWTA 5I1AB 5DFAA 2C26A 3GNMH 5KSUB 2NT0A 3O4OC 1SVBA 5B3SB 1MWAA 5CU9A 5FYLH 4X5QA 4YHNA 4WW2C 3DK2A 4GQZA 1DVUA 3PWPA 2QQNH 3JZ7A 2NQ3A 2YD5A 1X5XA 3QO0B 2DWXA 5FF6B 1JPGA 5K9KA 2V5SA 1PG7W 4MJIE 1D7DA 2EUXA 2XPGA 4EIBA 4HLZH 4HPYL 2VMDA 4E5XG 4PRBA 5DQDL 3N06B 2EXWC 3O9WB 4HZLB 4PYGA 3MTRA 1AD9B 4QI3A 2O26U 1HYSD 2W9EL 1KT2A 2R0KL 1AMYA 3PL6A 4P4KB 4AYSA 1EO8L 2EE2A 2GPZA 2BP0A 4JGMA 3KVQA 5CUSL 3B9KA 3FT9A 3MCG1 3R06A 4BFEA 32C2A 1HH9B 4A04A 5FLUA 2WHVA 1RU9L 4KK6D 2BX5A 1GGTA 1AAJA 2WCPA 4M7JH 5B8CB 4JDEB 2MPVA 4EZKA 2ADJB 4XN1A 1E90A 4FQ2H 4JRYE 5K9OB 2OBGA 3HRZB 4MMXA 4KKAC 4EN3C 3ES6A 2WQRA 5DUBA 3RFRA 1OP5H 3VFPB 1QSEA 2E27L 5DJ8B 2HTLD 2XWTA 1UD8A 2W80C 3G6JB 4DT2A 2DKMA 5DHXB 4WUUA 2FIRT 4ZUWA 2OM5A 3VWJB 3BRFA 3PWNA 2GHZA 4FQQA 3CV5A 2C9VA 4WI0A 2I7OA 2OL3A 2GUYA 4GKOA 5F6HJ 2O5YH 5TK4A 4KKLC 3ETTA 4X4ME 4NO0A 5DZJA 3TN0B 3VG9B 3G04B 1JZ2A 5EEYA 2D3VA 1LD9A 3ZYJA 3ARQA 4YN3A 4TQHA 1X5IA 1MQKL 5D5MB 4AQZA 3QI9C 3U46B 4UOZA 5F1SA 3DX6A 2Z8WC 3QA3A 3EOAA 4FQ2L 3TONA 1CL7L 2V0AA 1U8LA 1H3PL 1LP9B 2IXQA 3TJHC 4NYLB 4NKIL 2JTDA 3T2PA 3GZKA 3GSXA 4JY5H 5I1CH 2PLTA 3WFCH 5EU6D 1LD9B 1R3JB 3O4LD 4NO5A 3O41B 1WSST 3UCQA 5I1IL 2XZAL 1RFDH 2XJLA 2VOTA 2X9XA 2D0GA 3WHXA 2ILLA 4F9LA 4QRPB 2E9WA 4TUJB 5CGMA 1YEHH 4JDZA 5IBUG 2FX7L 3GK8L 3MNVB 3F58H 2BIIA 4YHIB 3SDXA 1S3KL 1U41A 2VM3A 4KXDA 4UMGA 2GUOA 2KZBA 4YWGH 3QARA 4C55A 1BLIA 2C4XA 2QTVA 3BGMA 5J6HA 3QPXH 1LM8V 4L0ZA 1G5AA 1DTUA 2IGTA 5ALCL 1LP9F 3C6EA 3O0LA 3FFDA 3QDME 1D5RA 2IH9A 4MMXB 5G4OA 3TNNA 4ANWA 5DI8A 3QWRD 5I15H 1O5DT 2DWDA 2IC2A 3V4PL 3D25B 2VXUL 2C5DC 1THCA 4QRQB 4X6DE 3HG3A 3LEYL 3MODH 4OBSA 3M45A 5T5NF 2DI8A 4ANUA 1DDHB 2R0LH 3BPOC 5HHQA 1TOXA 1TYJA 4ORGA 4PS8A 1ZANL 4U1SB 1O6SA 2Y22A 5JTWA 2J8HA 4LBEB 4M56A 3VYOA 3JVFC 1X7QB 1W0WB 4KK5C 4ODBD 2G4EA 2YD2A 1YEEH 4Y9CA 2FO1A 1G0YR 4ZBJA 4ZAKC 1NAKH 4PY8I 5AZEH 2EDOA 2F18A 2WMPB 4MCYB 5LUMA 2VXSL 2VABB 2JIXA 1ED3B 3DVNB 3K1KC 4K7PX 4W9IC 2DWYA 4ZSOA 4M8UA 2QLYA 4FNLH 3F7PC 2H6PB 3MOAL 1NGXA 4ZMZA 4JPVL 1LTXA 4B3EA 1FZKB 5IT2H 1DFBH 2XIBA 3ABMB 4WHTA 1WZLA 3FQTB 4X7FC 4NS0A 5IY5B 3GXUB 3G9VA 1H5BB 4S0TD 5D1XB 1P7HL 3EGSB 2LTQC 5T1KD 4QNPE 1E4WL 5AOKA 4X0KA 3VXRA 3KPLA 1J1PH 1OZTG 3GHBH 1BQ5A 4JM2D 4MLIA 3W1ZA 3QXDA 4GBXB 4B9PA 4FADA 5KAQF 3LXCA 2FL5B 4YHMH 4PRHA 3ZDWA 1GH7A 5MEQB 2WNWA 1YQ2A 4JZJC 4PBVC 2Z4QB 5C09D 4MMZC 2X9YA 2IWFA 4ADIA 2J5LB 4QLWA 2JELH 3AM8A 3VXRB 2FATH 3VWJA 2AV1B 4Y4HD 3CFKA 1KB5A 2WB7A 1A4BA 1DJYA 5D5ME 5E00B 5ALBH 4AYGA 2FLBT 2V5RA 3VFPA 3VXQA 3BZEB 1NSNH 3U7AA 4MXQC 3ZMNA 3OB0K 3MACL 2CAKA 4GQRA 4FTVE 2AVGA 3TPUB 1UD6A 1TTFA 5KVGE 1EHLL 3BVNB 3Q7JA 3KS0J 4JFDA 4UT9A 4JANB 4AL8L 2NY5L 4ZTPL 2AEOA 4H26A 3GSXB 5H4YA 3B2XA 3GD1C 4AG4H 3M1BA 4Z23A 4BFBD 4YO0B 2BS71 4Z78A 2V9UA 2W81C 1UVQB 1E5YA 4CBZA 1T03H 3QDJE 4AEHL 4C83B 4W9JC 1MWOA 5CD3B 3B56A 1FZOB 4UQ2B 3QQ9C 3QDGA 4RH4A 2FWOA 2FE0A 3CCHA 2OMBA 3OKDA 4IIQC 1SLVA 3MV9E 5E8PA 3QH3A 1GSKA 2VZTA 4LFHG 2B4CC 3KLAA 1ECYA 2GUOB 4XWOC 1IE5A 1DQLL 1MJ7L 3ARDA 3TFKC 4JR9H 5DQDH 3AUWB 4CVUA 5KVDH 1OANA 1GL4B 3CFJB 4HAGA 4I2XE 2Y9RT 4R5XA 4QRPA 4X99B 1T5XB 1ZRUA 1OCWH 3CZKA 4Q6YA 3S36H 4P5KB 2BWQA 4LLUA 3ROLB 2CGZA 3KJ6L 5BRPA 1RD6A 3SPJA 4LE8A 2CSPA 3ZE2E 1X7TA 4YSTA 1KB5H 1A6AB 1WHPA 2ZP8A 2X1QA 1XF2B 2BOLA 4B5EA 1MHHA 1HOCA 2AABL 1KBVA 4D8OA 1KIQB 3IB4A 4WWID 5F3BA 2P5WA 1AACA 3IDJA 4ANXA 2BVEA 5BS0D 4MD0A 3IGUA 5E8OB 3OJMB 3D0AA 1U8QB 3UGXA 4KK8D 3WMSA 5CD5D 4XWGL 5SWSA 2PTVA 5F1IA 5AW7B 5HBBA 2KI6A 3PGDB 4JFPA 3V4LA 4CVZB 1LWRA 3H9HB 5EZIH 3IDMA 2G3NA 1L9NA 4DEWA 5HSFA 1HH6A 1HJCA 4JRXA 3P9LB 2KQNA 5DFVC 3S5LG 3U82B 1SMDA 3EJZD 5ERWA 1G9MC 1P4BL 1XIWD 4XTRD 2ZUXA 1CPUA 2DPKA 1A4AA 4FNRA 1MFMA 3ULVE 4M4RA 4TOYL 4FXLA 1JV5B 4L8SB 2FO4A 3ATDA 1CGVA 2X5PA 4JAMB 3SO3C 1CE6B 1RPQA 4P3WA 3VQMA 2F0CA 4FXKA 5DD5H 4ZNCD 3S8WA 4OV5B 1AR1D 3QRLA 5ESVA 2BP0B 1TTBA 1TJXA 1E42A 1ZS8B 1L7IH 4HALA 2AITA 4OF7A 5BRQA 1IM9D 3REWB 3BWZA 4XCCH 1UM6H 5JO5A 1NCBL 2AMUA 1KXQE 2QJDA 2E5EA 3MUHL 4OZFH 3F6LA 3HMWL 3DYPA 5D7JB 1X7SA 2YBRB 4JRYD 5CFAA 1XF2A 3LDBB 5LHDA 3EOBB 5D2NB 1JPFB 4DN4H 4DEUA 1D5XA 3AXHA 3W0WA 1TU2A 1XB6A 5BQ7B 1AR2A 1L3NA 5CSZB 5ACZB 1NCUA 3VFUA 4KJYB 1KBBA 1TUPA 3RL2B 1PD0A 2VISA 4NQED 4AENA 3BGMB 3BI9X 5J6HB 5E94B 2BWDA 4G42B 3RZCA 1AO7B 5CEZH 3CHPA 1WLHA 1P4LB 4X4ZA 4Q9RH 1R5WA 2Y7OA 4C56A 3HS8A 2OP4H 2DH3A 4AENB 5J7CC 4TF4A 4POZC 3WLBA 5E94A 4HS3A 2GQHA 5AVZB 5I6PA 1ZMYA 4DTGL 4XNQA 1L9MA 1V05A 2JLLA 2CO3A 1QACA 3H3BC 1CBVH 3MFGB 5ICXB 1KEML 4RDQG 5JXAH 3K5RA 4NNPH 4PJIF 3V4VB 3RTQA 4QYAA 1FO0B 2NXYD 3B9EA 5HP5A 3MR9B 2VL5A 3TBSB 5JR1L 1UCBL 3JWNC 5T3XH 2NY4B 4CSZA 2QDVA 3UABA 1F4XH 2EE3A 3GDCA 1UTDA 2L4OA 2VQ1A 5LNDA 2PCPA 3P0YL 1PG7H 5ESVB 5JLZA 2OYLA 5L2KA 4XPTH 3EFOA 1B2WH 2ZKHH 4HEMA 2UZIH 3ET9F 3MRPB 2YAOA 4KQ0A 3IVKA 4NQCE 2WXOA 3HE6A 1U2YA 1FV1B 4XBEL 3J27A 1BIIA 4L5FL 2JNZA 4N2MA 4FE9A 4FJYA 4HU8A 2N4IA 3ZRSA 3EJPA 5JXED 5GGSY 1MWAB 1CGTA 2ROYA 4LLWA 4YL9A 4YXHL 1RK7A 4JM2F 3RWEA 2Q7YB 4B9CA 5E4EC 3QJHB 4MVBD 3PAVA 1KNOA 3O8XC 1Q0YL 3GXMA 3LZPA 3O9WC 1Q9LB 5K9QG 5BO0D 4P4KC 2EIJB 2JXMB 3BD3A 3QXDB 4GBXA 3KCWA 3SGJC 4UYQA 5I1GH 1EFXA 3VQLA 5KN5B 4LDEB 1OCCB 2ITEA 3U6XS 4UQ3A 2IFFL 4Y4FB 3QAZB 1KT2B 1PX4A 1Z9MA 1F8TL 4P4KA 2VT0A 4ONFL 2KERA 5C08B 3LN4B 4NZUL 1DEEA 4M9PA 4CC4C 2XY2A 4DP0X 2V9QA 1LDSA 2ZUWA 3T4YA 4L8SC 2W0KA 3F05A 5TDNA 1TQSA 2H6PA 3CVHH 3OGCB 1PQZA 1T7YA 1JK9A 3S36L 5FGBC 1Y18B 1H3TA 4JN1H 4FQJH 8FABB 1MNUL 4FG6C 1TEGA 4QO1B 3U36A 1LO4L 3GTNA 4XZUB 2F8VA 2O6FA 4H8WC 5HPMB 1CI3M 3QUZD 5JLZB 4A1RA 2VXUH 3BKYH 4U1KA 3X12A 1Z9LA 4EKJA 5KYYB 2FYYB 1JWSA 2EIDA 3N43B 3BXNB 4IRZL 4EVNA 1CF8L 2W0FB 3V8CA 4E9RA 4JFEB 2W07B 4AEHH 3QFGA 3KZ8A 3EDKA 5DEFA 4TLSA 2R69A 5GZOA 3KPRB 3P69A 1KFAH 1N5YH 4LP8A 2YFNA 2D7TL 3MNMA 4PJDF 3EUUA 4I1RA 4EAEA 3I2CL 4K23H 1CLZL 4QHNB 2W07A 3GMRB 3AC0A 1MW2A 1XCTA 1U92B 2LOEA 2V6HA 4FFZH 4NQVB 5EO1B 3SDYL 1DBKH 2ICCA 5LAXA 3SEPA 4AUJA 2V2TB 3KPSE 4M8RA 5HYSB 2AK4B 4Y2DB 2A6KA 3QIUC 3BH8A 3VXRE 1A22B 3BVNA 3IJYA 4IOIB 5MENB 3QUKB 4KBPA 4N0CC 5GSRA 4Y7MA 4ELMA 4X0NA 2OCCB 4XX1E 3ULVL 1G6RH 5HJ3B 4ZS6D 4XP6H 5FUCE 4XNXH 5KBDA 3O6FA 1L5GB 2WLIA 2ZNWA 1VGEL 2HFEA 4AQEA 3LB6D 1JZDC 2YSTA 4LCWB 3A23A 2N7SA 4WSKA 5I6LA 5T3XD 3C6LD 2H0JA 1FRGH 3Q05A 3US9A 2ENQA 2WQSA 3AQZA 2NY4C 3O4LE 3EG9B 3L48A 5HI4C 2ZKXA 1ZE3C 3HLAB 4JKKA 4NUJB 1A7NL 1CLYH 4P46B 4U3SA 4FQQB 1N6VA 3P4NA 5F9JA 1LMKA 1NC2A 2E7LA 4LPYA 1I9EA 3CLEL 4MYWB 2F53A 2A6JB 2CHZA 3VJ6A 4YSSA 3E80A 1QWUA 1KIRB 3T3MF 3VFGL 3OMAB 2D7PA 4Y5YB 3VQ2C 3GBDA 4C47A 2P4AB 1VEOA 2WN2A 3S5LB 5KWYC 1H8OA 4L1BA 1HWWA 1MFDH 3OC8A 4V1DA 1NA8A 4A6YL 4HWUA 3HC0A 2DYPA 3CHQA 4WEBH 5EBMA 2OTUB 1QLRA 2QPEB 2VERN 1HL5A 3MBWA 5F44A 1HH9A 1DBAL 2IH1A 1WD8A 2IPUK 4PREA 2H2SD 2BZ7A 2G60L 2G2RB 1LXMA 1DQDH 3S4SG 2B5IC 3LPOA 4FNLL 4L4VD 1SEQH 3MLWL 4L8CB 5KSBB 1TVHB 2FIKB 2P7TB 3NMEA 4WU5A 4GI9A 3UDWC 2DMKA 2X53A 5HDRA 2KKQA 4AJ0A 2WXLA 2D7QA 2PXYA 4KK9D 4ELKA 3TEZA 3KLQA 4Z7AA 4QRPE 4ZO8A 1JHTB 1TZAA 2J88H 5K9JH 3A3YB 1NUFA 1R5IA 1MCBA 3O2WL 1TYEB 3ARGC 2RFXB 3FOLA 1FL5A 4F7MB 4N90E 4N6RA 1S3KH 1BQLH 2UY6B 2R0LL 1HINL 4TNEA 1AKJD 4YBLB 4Z3JA 2BDNH 2K7QA 4POUB 4P3CH 4PJ5E 5E9DE 4GI8A 4PJ6A 5JMRA 5GRXG 3FQXB 4Y4KC 5GJSH 1ID2A 3U36B 5J13C 1J9CT 2XN9B 1URLA 1ZKAA 2FWLB 3RFZB 2FX8L 2EDNA 3KLDA 3OHMB 4KVCH 5EIQA 3AREA 1RZJC 2CDGA 3SPVA 1T20A 2XCMC 1IO4C 1R3JA 1FVEA 4KTDH 1WO2A 2W60B 3KM1A 4MA7L 3QYNA 2GSGA 1IEHA 1KPVA 1PY0A 4E42B 4ZQTA 5AYUL 5D2NA 2QKIA 5IQMA 1LO5A 4UQ9A 1KUMA 3BLBA 1IAOA 3OMIB 2C9QA 1X5FA 2E4TA 2V5MA 3DX9B 3OPUA 3QA3B 1P7QA 4LLMA 4PGDA 4TQPA 4HAFA 5JHLL 2WVSA 2BFGA 1P69B 5HDQL 2IIJA 4P2RB 2Z92A 4JK0D 4A2DA 2BWIA 1UB6A 2CO6B 5FYJL 3DYOA 3ARED 2OQJA 1RSFA 1VFBA 3HKZA 3M8OL 3U7YL 5DMKA 1MOEA 1PFOA 1W0VA 2DBLH 5CZRA 4B9FA 1JERA 4TKWA 3HG5A 4FQCL 4BQCA 5ADOL 2FEEL 5GIRA 4FFVC 3I85A 2E76C 5CEZD 1S7QA 4GSDL 3ZHFA 3RUGF 2A77H 3HZKA 2Y7QA 2GHWB 3OLEA 2EUWA 1R3LA 3CH1B 1WFOA 4RFNB 5EN3A 2DI7A 2VN3A 4QF1B 1XZ0A 2WQUA 5MENE 3DNKA 4U6YB 1CK0H 5LB1A 1HXKA 5I6XB 1MCOL 2YMTA 1K3ZA 5ICYA 3HN3A 2EYSB 3OAZH 5HHPA 2ZOWA 1H8LA 2A7BA 1P6AB 2NCEA 3QO1B 1URIA 2J1ZA 4WI7A 5C07D 5C70A 1ZHLA 4GUPA 4HIIB 2E6JA 3N04A 1IQWH 3WJLC 1ZGLA 3C87A 3CFEB 4A7GF 2FX8H 3NCMA 2GSGB 3WO4B 3APNA 4H7VA 4PCTA 4E9QA 3J07A 4X6CF 3GLDA 1JPGB 5K9KB 1K85A 2APXA 4K9EL 4JFHE 4A55A 1BFSA 2GYSA 5IV2B 1RIUH 1RERA 1ITCA 1ZDSA 1AIZA 2QSQA 2ZX5A 3T1WA 1ADQA 4GBXD 1AIFA 1NLBL 2KQMA 3LEYH 4PD4J 3GJEB 2WXGA 4O00A 3T8XB 5IW6B 3HMXA 1HQ4A 4APQC 4F91B 5I15L 3MRDB 2IGLA 1LO2L 1QNZH 2EE6A 3QUXB 2EVFA 1T5XA 4FYTA 2D73A 3VXPA 2F5BL 4Y5VB 4JG5A 2ZCKH 4JO1H 2ZJSL 3O3AA 1U4EA 1G4MA 5D1XA 4ODTH 5GJTL 2KDGA 4DUWA 3HB3B 5DA0B 5EBGA 2UXGA 4JY6B 4XC3H 3QZLA 1SDDA 1FL3A 5D1ZB 3BUIA 5D93B 2CBMA 3T6ZA 4G8EB 4M8QB 3IF1A 4KKCD 1S5IH 2DQCH 1I3GH 4IOSD 3T0AA 3RWJB 5GS1B 2RD0A 4GAFB 1FVCB 4NKIH 5L7XH 3DV4A 2YRLA 5IHUH 1X7QA 4DOHB 4NN6C 1N2RA 3T04D 3FUEA 4G8EA 3WCYA 5I5JA 4F92B 1CBJA 3DECA 3JWDL 1F6AA 3QULB 2H2PC 2VTFA 1W2KT 2JKIS 1FFNA 5JQIB 2NZ1A 2A83A 5L4FA 5ERWB 5FR3A 2P42B 2BY2A 1BBJB 1RZ8A 3QUYD 4Z7WE 3RUGB 5I19H 2V33A 4EF3A 4DF9A 4PJIE 4PJIB 1SJEA 3BT2L 1H9DA 4GXVH 3EO1A 4TSCH 1JYVA 5BPPA 3FO1B 3UEQA 4U0QB 1C1EL 3MJWA 1BBDL 1KLFB 4ZUUB 4YEFA 3AXIA 1XTLA 2PYEB 5T1DH 4MJ6B 2XWZA 1EX0A 1SMOA 3KPPB 3LRSA 2OXGA 4E41D 3PHOB 3VD7A 2M8XA 3T3PF 3BAEL 4N28A 1DVXA 4KVNH 4A63A 5A2IH 5BNXD 3MNVA 4YZFE 1HHKB 3CIQA 4Y5VA 4GAJL 3TFBA 4MFHA 4U1MA 2OK0L 3NGBB 2H45A 1ZDQA 2JH2A 5A3IC 3AADB 4LPUA 3GSQB 1KELL 1OCRB 5D4IA 2QVTA 3HAEB 1BXAA 4JN2B 3BVUA 3KW8A 3RWFB 2GJZA 1D5XB 2JWYA 1J0IA 4KHTL 3W0WB 1M7IB 4PWEA 3T9WA 4PI2A 2HJKA 2K70A 5E1IA 3ULSB 3MRFA 2WANA 1ANUA 2CBOA 3K81A 2OKMA 3KG5A 1NGPH 3HFMH 1OP3K 3DX1A 4UQIM 3QJZA 3L13A 2ADFL 2BP3A 4NZRL 5KJRL 4OLVL 5ANME 1FZMB 1Q72H 4QHMA 1CFNA 4K3DL 2XWJB 1H6TA 4H8WH 4XP4H 4IEFB 4WKZA 2ICES 3DXAA 1VAHA 2YN5A 1ZLUK 4DO5A 5IB1B 3KGRA 5DJAA 2YAFA 3NEXA 4G72B 4PJEF 4CN1A 3PAYA 3I02B 4NQCD 4NWUL 4M1DL 3V0HA 2D3JA 1CFSB 1HS6A 4ZUTA 3AG4B 2PCFB 4N87A 4F5CA 3I74A 5AW0B 3FQUB 1EXGA 4YXKH 4UZSA 1A3LH 1QW9A 3IXTA 3B3BA 2J6EA 5EZJA 4X6EB 4ECNA 3QXUA 4ADGA 2C9RA 3IM1A 5LQBL 4LHUA 3S8GB 1UXWB 2AI0L 4NPKA 2A9CA 3MFFB 1T83C 3LJ3A 1FGNL 1GC1L 5GS3A 4K7PL 5CZVL 5LAPA 2EO7A 3D6GA 1B2YA 1SJMA 2ZUQC 3OVUB 1UJ3B 4I77H 3BOVA 1JUFA 2X05A 1TQBC 3ILQD 3LIZA 4WK2B 4JHAH 3ZJAA 1UG9A 2F53E 3WAJA 4DERA 4B9JA 1FFPB 4OLZH 4OF6A 4QOKB 3WD5H 4DW2L 3O2DH 1T3FA 1TJMA 1ERNA 2AW2A 1BX2A 4HMDA 1HYRC 3NFSH 5DRNA 1E4XH 1ACYL 3IJSB 1ZJBA 3K6NA 5FWRA 2AK1L 5FV1L 4J3OF 3D50A 5IHLB 4KTEL 2GK0A 3FQ1A 1T3FB 3WIAA 1MLBA 3JV4A 4UM9D 4KKPA 5E9DD 2NY2B 2R69L 2LGNA 4WDIA 2X9WA 3HFFA 4HS3B 3QRBA 3ZVVA 2HT2C 3OKNB 1E9OA 3T0DA 4YL4A 3FMGH 2ZOLB 2NNXA 4JKWA 2AAVA 3IFLH 3IDNA 1PZ3A 4F3FB 3WIHA 1MCKA 5KVFL 3B8SA 1VF5C 2CDGB 5E5MB 3SPVB 5AB0A 2X6UA 2LV4A 3LZFH 3BVVA 4G42A 5D70L 1DJIA 4MB5A 1OHZA 4WWKA 4LB8A 3WFZA 5TDNB 1B0GA 4JHUA 3RPIB 2DQJH 3L4YA 4XO3A 3QDGB 5D7IB 3SDXF 1W0WA 3NJLA 3VDCA 4G9FA 5KYWA 3F83A 3SPGA 4NP9A 3U0TA 1E27A 1BM7A 3RWDA 4BUGA 3HZYB 5F7EH 3HR6A 3KPSD 3MRJA 4AYFA 2R59A 4BDVA 1K5WA 1S7WB 4BK5C 5DHEA 2JCCA 4XMXA 1N0LA 1LO0H 1ORSA 1G7IA 3Q1SL 3N55A 4X4XB 5EV7A 2V7HA 5I8OH 1L9SA 3MJ9H 3MRFB 3GS4A 4RNRB 3QJHA 1J9QA 3WY2A 2OCJA 3IN2A 3NJIA 5C0AB 1MIEL 4Q56A 3ZO0A 1J5IA 1XCXA 4HMEA 3M6DA 4J39A 2UUDK 1UZ6E 1QBBA 1UASA 4PBXA 4V2BA 3DBXA 5D8JL 3DDFA 3Q9PA 4JCMA 2DWSA 1MCCA 2R2HA 1QI5A 5MERB 3FN3A 1KGIA 4XE5B 2IWGA 2BSTA 2FSDA 1YN7A 3GHEH 1I7RA 1NAML 1GCYA 4L05A 1U8MA 1PZ5A 4PJ7A 4R4FL 1CO1A 5JORB 3OJDB 2HP4A 3MJ7B 3MRIB 2GK2A 3RVVD 5F7KC 5IESH 2M26A 3RGVD 4ZO6A 3W38A 1I7RB 3AZUA 3DOIA 1Q1JL 4KDTA 1M1XA 1VKXA 2Y3AA 3MV11 1XR8A 3TS8A 1OT4A 4ZG1A 2NY2D 1PEWA 5GGQL 2O6CA 3GIZL 4OCSL 3AG3B 2WQWA 3NDYE 1MPAH 3K8KA 3MREB 3THMH 1IC5H 4KJPC 5A2JH 3FUDA 3O4LB 5A2FA 1ESOA 3BWUC 3CHOA 3A21A 3KBHE 2V7HB 2BRRL 4R84A 2VDRB 3PJLA 4BGDA 4AGPA 2AV7A 4LCIL 4HIQA 4PJAF 5ETUA 4QDGA 4PJEB 1QPXA 2G3MA 3T2QA 2R29L 3IGKA 1WK0A 2W0FA 3VMPA 5IEHB 3L1FA 4FNUA 4G8GB 3KYAA 4QRRA 3AAZA 4OFVA 3L3HB 1OTTD 4XAWH 2RH0A 4YIQA 5E6RB 4ZSOE 3F84A 1I9RH 3T4AC 1RIVL 4OQTL 4JFUA 5B39G 5F6IC 4K8RC 5F71A 1G7HA 3MUY1 5KYXA 3MO1B 2MPAL 3OHXC 5MI0B 3STZB 2P5WB 1IEAA 2JQAA 2W38A 5TF0A 1FSKB 4JFDD 5E5MA 5FO2A 4XP5H 3WDHA 2CIIA 1EUTA 3LPPA 4C54A 3GYRA 5DZPA 4LT7A 3BT0A 1IQDA 1DEEB 5I1EL 1PYWA 4PJ8D 3X1EA 1D6VL 3HZMB 3WN5B 3ZGHA 2VKXA 3L5JA 2Q76A 1KEGH 3B2UD 3LHPH 3WXVH 1OAXL 3U7YH 3BUYB 4JZOA 1V27A 1FVDA 1YYML 3P30H 5L88L 5GISL 1KIRA 4FI8A 1IILE 2X4PA 1SMAA 4U0RC 3FSVA 2CO4A 3RIFK 3QZWB 1OEZW 4JVUA 1A1NA 3BVTA 3U9UB 3HZYA 2YXWA 3D2TA 2L0DA 2Z31C 3H9HA 1U33A 2WLKA 3RQ3A 3K6FA 4M03A 4FKEA 2XETA 1Y0LA 4HS6B 1DHKA 5CZKA 3HC4H 4BWUA 3BD5A 1CTOA 5CF3A 1NKRA 4M43H 3WFEL 5C0CD 2GIMA 5D4JA 2PCYA 2GJRA 1BVLA 1K8DA 3S3BB 1QBMH 5ETUB 3ZHKA 4JNXA 2B0SH 3ES6B 4L3CA 4NN5C 3NH7L 3ZL1A 3P9MA 4AKPA 1FNEA 1PX3A 1OTSD 2E9IA 2J21A 2NY3D 4FQIL 4H5SB 2JIXB 2WOYA 2G3ZA 1CDIA 2OI9B 4XMPL 5ID1A 1QLEB 3DARA 3QHFH 4I5BA 3HRPA 5GGTH 5D72L 3S98A 4HIPA 3ZYIA 1D9KD 1BAFL 2ZXEB 5FYKE 4NQXB 2X4UA 4F8LA 2KHAA 1QW8A 2P43B 4BV1A 3SSGA 2J8OA 2V9RA 5CP3H 4IBLT 6TAAA 1J1PL 1PKQA 2CKNA 2PR9A 2WIIB 4D0DA 4UU9A 3EJYC 3UO1H 2EYTB 4U6XB 5IVZB 2VLRD 1DVFC 5IUSA 4HF5H 2I32A 3VXMB 1X9LA 5DO2D 5JW3H 4JG0L 2IANA 3MJGX 4WWKD 4YC2C 1X5JA 3N41B 3RWGB 2JKRM 2CM5A 4UTAA 3HG2A 3BKMH 4X6FA 3STBA 4DFIA 1JXGA 4L0PB 1RJCA 4AOFA 2R29H 3FB8A 2VXSH 3S8FB 2DQEH 4G80A 4IRJB 4YHIA 1EA9C 5JW3L 4PJFE 1IZKA 1TZGL 1WEJL 1XT5A 2FJSA 3OZ9L 1A7RH 1GIGL 3E1ZA 4HDIB 5LCVA 5BV7L 5BRZB 4JPSA 2BVQA 5GXBB 4WO4D 3AB0B 4X6FB 5DRZA 4X6CE 5G5DB 5HYQB 4X6CB 4JREB 3O6KL 1KF9B 3C8KA 3CSYB 3L3KB 4GAYA 4GQ9H 4WI6A 3K8LA 3TVMD 2GCYB 1AGBA 2NW2A 4AT6B 4UM9A 5E9DA 3EYUL 2VCOA 1SLUA 2ICEC 1E8YA 4Z7VF 4ZTEA 4ZOAA 2OW7A 2H32A 2YFOA 1YEJL 5CSZA 5IK3A 3ZKND 4NUMA 5HYJA 3N41F 3D39A 1IT9H 2HVBA 4JG0H 3EOYG 1YNTA 4C83A 1JGDA 4H0LC 1J87A 1TT6A 2Y25A 3SKNB 3MJ8B 1ZHBA 4PJIA 4NPJA 3OHXB 5MI0C 3LKOB 1ACCA 1I3RB 2O5XH 5C0DA 1BZDA 1UOVA 3D3VB 2P28B 2WLZA 2F58H 3MI6A 4AC4A 4F15B 2WUCH 4AV4A 3HI6H 2QVMA 2G4GA 3NDZE 4TTDD 2Q7YA 3SDAC 3F58L 3RDTD 3SZ6A 3CSBA 1BAFH 1T1YA 1CDHA 3BYTA 4UQCA 4YX2L 2D0HA 3IE4A 4XBGA 3FCTB 3NP4A 3TT3L 1WITA 5E4IA 3OPZL 1K2DA 2Y7SA 2I27N 2XZAH 1TNNA 2IALB 4GMTL 1S9WA 2FZ3A 1ZLDA 2X87A 3TBBA 4Y4KA 2QQQA 1T1YB 2HA1A 4YGVB 5I30L 1TZIA 1TDQA 5I16B 3U7WH 4IRSA 1OL0A 4F9PA 3VXTA 4IKJA 3CVHA 1I7UA 1QRND 4KKAD 5AB9A 3U9UA 1U8JA 2BMKA 4HCRL 3ILPA 4RVBA 5F7WC 4CMMA 4JG1L 1C7SA 2D7TH 2D3NA 1VADB 1K72A 5LWYH 4E9LA 4W9FC 1ETJA 4AVKA 1EAQA 1W72A 2O5YL 1G7PB 5KZCB 2PP9A 3RE0A 1E4XI 2ZIDA 5SWSB 2QKIC 4JFYB 2ENJA 5A2AA 1I9JH 5FCUH 3TJPA 3H9SE 3EIFA 4P59H 1P4UA 2H32B 3TO2A 2AQQA 1I8IA 4P57B 5GISH 4P2QA 3LEVL 1KN2H 3BKYL 4HLZG 1JPSL 3KGSA 2XTJE 3B2VL 3H85A 4J1UA 5AOZA 5C0ND 4RRPM 4PLOB 3UADA 5I1EH 4AQ1C 5DMIH 5AVUB 3RVWC 3UZVA 3H0TB 3AY4A 4FMFA 4JQVA 4Q6IC 2DMBA 5DWUL 1UM5L 2DM4A 3WELA 3OZKA 2FT8A 1KV7A 5F9WB 5CD3A 2ZSVB 4Y5XA 3GFUA 1MFBH 3TO4B 3QC6X 2GY5A 1BZ7B 1TZHB 4LAQL 1IM3D 5H37H 1PD6A 2YR3A 4HX1A 2NYYC 4KJWC 4XX1G 3AM8C 4JB9L 4KITB 3CFUA 3A6BH 4HK0B 3BVDB 4I48B 1XGUA 1OP9A 2N1KA 3L3OC 1U3HB 3X1GA 4TLTA 3NSCA 1FZMA 2M2DA 3N44F 4QHMB 4O4YH 4TSAL 3QRFM 5GGSB 2YSSB 3CWGA 3DROB 3QORC 5KSAB 2WTPA 2ZZUT 2A4CA 1CUOA 1OM3H 1QBLH 3ARGB 5C07A 5AAMA 5E1AA 1FFOB 3MGTA 3VGGA 3QDJD 3C5ZB 3S6CA 4RGNE 3VE0B 3QYCA 1SBSH 3PJNA 1ETB1 1O6VA 4OM0L 5D72H 5DVNA 4TLUA 5GGTL 1WC7A 2EABA 1BEYL 1HZHH 3P4MA 3GIZH 5C0JA 2HKAA 3QVAA 4Z7OF 4KJQD 5DVOA 5DZ9A 3I84A 2R7EB 2VDOH 1RUKL 1IBFA 3LNHA 5CO1A 3KNBB 5JPNC 1BW8A 1QKZH 3IYLW 5DZOA 5DMYA 1JWMB 1AO7D 4OGXL 1A6PA 3U0WH 1BG1A 4QTHB 4BSWA 1F97A 2P26A 3ZTJG 5CR8A 5C0JB 4M6AA 4WTZG 5E2UH 4UBDC 5H2BB 5M95B 3HCVA 4RRPG 4GSUA 1HXMB 3D87B 4M43L 3NFPA 3QJFB 1AD9A 3AW5A 4PLNC 1T0PB 4DUXA 1UADC 1V7NL 3KNBA 4XODA 4HIEA 4YGVA 3FU6A 5AVQB 5GIRB 4PVMA 4RAHA 2OAAA 2XV2A 2L3BA 2DQIL 4NO3A 4Z7NF 5T3ZL 1IAIH 2HFFB 4N8VG 3KPQB 2X2YA 4PCSA 3EHBC 5DU7A 5SX4I 4IBVA 4UT9H 2ADJA 1V3LA 4KMQA 4JDEA 3DHPA 5KBKA 4OCRL 4WNSA 5DJYB 1A1MA 1FL5B 1ZHKA 4WUKL 4ZFFB 3SE8H 4LDOB 3N9GL 3EJQA 3PWPE 4N2AA 1I8KB 4CVXB 1KIPB 1J8HA 43CAB 2I85A 3WUWA 3L95A 4X8XA 2EZ0D 1B4TA 5DF0A 1U93A 5T1MA 5KS9B 3F7VA 4OD2A 5CZXC 1BD2E 3LH9A 1FZOA 2B1HH 3CU7A 2QQLH 4GRLA 4GRWB 4IMLA 2CD0A 4RIRB 5F7EL 1MCFA 5I9QC 5I8EB 1EDHA 1P84K 1T1WA 1KIPA 2ITDB 3TCXA 5AAWA 1QSFA 2VLKE 4G8FA 1OD9A 2Y3NA 3MBWB 3TA4D 4K4KA 4AGOA 2E6PA 5TK2A 1FCCA 4FA7B 4RDQF 4IDLA 3EJSA 3MHZA 3VXSB 2Z8RA 2VMFA 1IGMH 2PWFA 4GFTB 2XOTA 4F9PC 2E7HA 3GRGA 3QPQC 1XMEB 4HCFA 1X5GA 4MA1B 4N0FB 4ODUA 3VRJB 2A4ZA 4YLQT 4P23D 5FHAL 2APVA 3H4FA 1U95A 1WA0X 1SQ2N 4L4VA 4QHKI 3H42L 2VITA 3T65B 1D5MB 5CNHA 1RURL 4LDCA 5HTSA 1RY7B 2FR4B 3VFRA 4ISVB 1FNGA 4YHKH 3LMJH 5E6SB 1SDDB 5IK3B 2X4TB 1SY6H 3QUXC 3CSFA 2KMWA 3TVMC 3S9DB 3D3VD 1V7ML 3GMLA 1FGNH 1GC1H 4MSWA 1XV8A 3CSPA 4EUPA 4EDXA 1CVSC 4PJXE 5DA4A 3DUUB 3G5XA 2JFCA 1FNSH 3Q6GH 4BRJA 3P4MB 2N01B 3O2DL 1EMTL 1ET8A 1YPZF 1JG9A 4LOUC 3ZQ9A 5ADPL 2VDML 4B96A 5HYFA 2D3LA 4FMVA 2VC2H 2EVHA 2D9QB 3QB7C 1CJYA 4KOCA 5AVRB 1TETL 2A6KB 2N0MA 5LJYH 4JGJA 4N85A 2AEQL 3G5WA 2IALA 1AXTH 1NGYB 1WBXA 4N2EA 1OAUL 4KDWA 3K71A 2WVUA 1T83A 4JDVB 1VACB 1J8HD 4L9LA 1S9XA 3ISWA 1QR4A 1IKFL 3EJYD 4XVSL 3PFUA 2ZNXA 5AL0A 3CFEA 2C3HA 2YMXH 3TH2T 4P9HL 3SE9L 1CCZA 2ENSA 3QS2A 4U0RB 5CIPB 5JQ6H 1KCUH 8CGTA 3QO1A 2BNRB 4V33A 1L4IA 3H9ZA 2VE6B 3HOGA 2Q10A 4X5WB 3A4DA 4AQ8C 1QNIA 3MRKA 4AYFB 5AAMC 1MCLA 3P2BA 3C09B 4G6JL 5KANI 4NNXA 4KDVA 1I3VA 1M3IA 3HNSH 4OLVH 4FHKA 3O2VH 5E5UB 4FFYA 4ZW8A 3LPWA 4H1LG 3TM6A 2NY5H 4KROB 4ZTPH 2W88A 4AJWA 1KB9K 4FD0A 4B7IA 5FF6A 4KHTH 1UT1A 1HCYA 4JFTA 4U3XA 5D1XC 1DBMH 1G7HB 1YMMA 3DVIA 4W68A 2F53D 1JWUB 4TSCL 1ZSDA 4N0UE 4FJ6A 3CPUA 2ITDA 2Z31D 1J8HE 4EI6B 2Z8SA 3HN8A 1IU1A 4RZCA 1AHWB 3HHRB 3AT8A 5KVFH 4NNYB 3BMVA 5T1MB 1SN2A 4K94C 3VRLE 4IJTA 2IAMA 3TYFA 2WUBL 4NHUA 4LSSH 4HWZB 1ZTXE 2WXJA 3BDYH 4X6DB 5EBLB 3OJ2C 1A8JH 3E2HB 3QULA 1C12A 1VJSA 3G6AB 3BP7A 4R0LB 3WNKA 3UGEA 4JO4H 1HHGA 3BEWB 1XF4B 1X5YA 3OKYA 3UTTB 4N1CA 1GYAA 1OVZA 1YSOA 3RTLA 2ZOKA 5FW6A 3T0VA 5FOBB 4IS6B 2AJ3B 5FM4A 5JMOC 3X1FA 3U4EA 1UUNA 2XWTB 3B5HA 4DGVH 1XEUA 3WKMH 3I50H 1MVUA 2WZ5A 4A2FA 4BIKA 2O30A 3H2QA 1R19A 1RL1A 2IDUA 3MNZB 3CN2A 3DX8A 1PG7X 4RFEA 4Z7UB 3BKCL 3WTYA 5DEZA 4XMLH 5F9AC 3UYPB 3C8DA 5FDWB 5CBEB 3GSUA 5TGBA 5JW4N 1O75A 3HCVB 1MRCL 2FD6L 4OQ1A 4ETYA 1T04B 4AJYV 1AC6A 1JDAA 4AZ8A 3DHMA 1E43A 4AW7A 2E75C 2AQNA 3FO0L 4MXWL 1QP1A 3DURB 2HRGA 1VGKB 1N70A 3LYRA 3RY5A 1A02N 4BA8A 12E8H 1A7QH 4N2DA 2YO3A 1QBLL 1JCVA 5E8OA 4DETA 3NK4A 5CGYC 2K8MA 3QZPA 1CVRA 2QQKH 3WHXB 1QNZL 3VE0A 2R1YB 2EIKB 5E70A 5DJ0B 4PG9A 4ZTOL 1VENA 2AQ1A 2C7FA 1M3JA 3ZUNC 1E9QB 3V5DB 1V3MA 1QUNA 4OY9A 1AHMA 2PCXA 3BKML 4MD4B 4IOFC