2R69A

Crystal structure of fab 1a1d-2 complexed with e-diii of dengue virus at 3.8 angstrom resolution
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
97
structure length
97
Chain Sequence
SYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major envelope protein E
publication title Binding of a neutralizing antibody to dengue virus alters the arrangement of surface glycoproteins.
pubmed doi rcsb
source organism Dengue virus 2 thailand/16681/84
molecule tags Viral protein/immune system
total genus 6
structure length 97
sequence length 97
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2r69A00
1URZA 1OKEA 1ZTXE 3UZEC 4BZ1A 2JQMA 4BZ2A 4AM0Q 4FFYA 3J27A 3C5XA 2ALAA 1Z3RA 2H0PA 4L5FE 5KVDE 4UTBA 5JHMA 3N44F 2HG0A 5KVEE 3IRCA 4AL8C 1S6NA 1PJWA 5KVGE 3N42F 1OK8A 3VTTA 4GT0A 5GZNA 4X42A 4ALAC 5AAWC 3UZVA 3P54A 5IZ7A 2JV6A 4GSXA 5B1CA 4FG0A 3J2PA 5LBVA 5GZOA 2I69A 3G7TA 4UTAA 1TG8A 1Z66A 1RERA 5H37A 5KVFE 2R29A 5JHLA 4UT6A 3WE1A 3C6EA 3N43F 3N40F 2JSFA 1UZGA 5LCVA 2V33A 3MUUA 4UTCA 5AAMC 3UAJA 5LBSA 3UZQB 1OANA 5IREA 3N41F 4UT9A 2GG1A 1SVBA 2R69A 3UYPB 4FFZA 2P5PA
chains in the Genus database with same CATH superfamily
4Y4KA 5AYUL 3V0IA 1W72H 3LIZA 2W80C 3ATAA 2IGTA 4MHHG 3HCVA 1GGUA 3EOBA 1ETB1 1U8JB 1CD1B 4J27A 4XXDA 4XAKE 1M05A 1FDLH 4J3BA 3U4KA 3HZ3A 2XXMB 1WFJA 4O2EA 2WVTA 2DM4A 4OFYA 3BD5A 4G72B 4QGTA 3FYEB 4ZD3L 5F8RC 3ZTJG 5A43C 2IH1A 3VXPB 2Z0BA 5LDSA 4ZFFA 2KZKA 1ZV9A 4JKLA 1ZHNA 5DK2A 4ZS6C 1WBXA 4FYSA 4D3CL 4DFIA 1QQDB 3E7JA 4CL7A 4L8CA 1XF5B 1P2CB 2OMUB 1RXLA 1SQ2N 1U8NA 4D9QE 1A4AA 2YQ2A 2XFXA 4L3ED 3S3PA 1KYOJ 3ARDC 1LTXA 2JIXD 1WS8A 1QBAA 2APSA 4N5ED 3KPMA 2CZNA 4NRXB 2RMNA 1UQSB 5D2LE 4P48A 1XF2A 3VACA 3CMOH 1J5CA 4B9PA 7TAAA 2GITB 3CHPA 3I6GA 3ZLQC 4AVIA 1MF2L 3ATFA 4ZAKD 1JGUH 1U3HC 4UT9H 1A4BA 3FCTB 4FXTA 2IAND 2LLGA 4C4UA 2J73A 3QUMA 1ZA6B 1ZKAA 3OB8A 4PB0H 3H7BA 4H1LA 5IB3B 4FTVA 1DQKA 2NNAA 2P26A 1XR8A 2JCCE 5TGBA 3O11B 1RK0A 2NY5H 3A6OA 4G6AD 1VADA 3H9HB 3T4AB 3AT9A 5EUOB 2HJLA 3TBTB 4YXHL 3IK2A 1JN6A 5DQDL 1MVYA 3FT2A 4XMLL 5DYFA 3C5SB 1UWGH 1QACA 5ID1B 2ZOWA 4LCUB 2AQNA 2CR6A 3EYQD 2C4FU 4I77L 3UTTE 2VZOA 1M9WA 3BZ4B 3JZ7A 5CXPA 1AYRA 5F0JB 3WIIH 5CU9A 2AABH 4HXBH 4XB7A 4EUPB 2BNUA 1D3CA 5ELIA 3UX9B 2ADFL 1A6UL 1QATA 5IVOA 3VG0H 3VDCA 3PDOB 4PVLA 1YMMA 3LZFH 5EWIH 3ATBA 2OAAA 4EDXA 2VWEC 4JY6B 4K94L 4OT1H 5AVVB 3MCLH 4L8SA 1G7LB 1VA9A 2FEEI 4N25A 5D8JH 3U4EA 1Y7VA 3GC3A 1H15A 4JZJB 5K5YA 4DN4H 2OX5A 1F4WL 5JZ7D 1CFNA 3KYKH 1AG6A 4M1DH 4A67A 1XGRA 1X4ZA 5JW4R 4YHMH 3Q13A 2I9LA 4P5TB 1O75A 3ECBA 1NIEA 1II4E 1U36A 4JKWA 3ESUF 4JM0A 4NN6B 2Z93B 4EKXA 3RZCD 2CHZA 1JXDA 3LKNA 3CPUA 2X9WA 4OTXL 1RSFA 1SF3A 2GI0A 2OSWA 4AKOA 5M95B 4NENA 1P5UA 3FAXA 3KPLA 1IEAA 1XX9C 1E40A 3SDCB 3BVDB 4BE6A 3FB7A 4IK7A 3QORC 2OYLA 4I1RA 4NO0B 2PO6A 3U0WH 3OXSB 5ADOH 5E8OA 1RU9L 4I89A 1GSMA 4D0CA 4ETQB 4K94C 1AKJA 4NYLB 2ITFA 2QR0B 3R0MA 3MR9B 4MQSB 4U0RC 3HI1A 4ODSL 3KPSD 5E08L 4LK4A 3IGUA 4P8QA 3IPEA 1E4XI 4LAQL 4YWGH 3ZUNC 1DEDA 2R2BA 5HHVH 4AMXA 2ZG1A 3FQ1A 3KXFD 1RJLB 2JKJA 3ZRSA 1EJOH 2CO7B 3HN5A 4RSVA 5FCSH 3U9UB 4XVSH 5EU6D 3FT3A 4G7QB 1S3KL 2GBUA 3D85D 1D7DA 5BV7L 2N56A 2Z91A 1SDAB 1E5BA 2PYEE 4XBPA 4JM4L 5GSVB 1BQSA 2BP8B 3G5YB 1MFCL 5D7JB 5IT2L 4PJXA 3IFPB 3CK0L 3RIAK 2W91A 4MDJB 5ITBH 3LS5L 4A7SA 5I0XA 5D1ZI 1NAMA 4UOW0 4E5XG 2V7NB 3BKYH 4Q2ZA 5ESQA 4AG4H 4XHQA 2BHYA 1JZGA 4P2OA 4IBWA 4Y9GA 1MIEH 2VGLM 4H88H 4PV9B 4WJKB 1WC7B 2H8PA 4YVUA 1YEGH 2VDLB 5DZOA 3S6CA 4HUMB 4ZFZB 4AV0A 2BNQA 1J0ZA 1GCYA 2V2WA 2EAEA 3EOTL 4Q56A 3LH9A 1P84K 3DURA 1CO1A 3DBXB 2BOCA 3LEXA 5J5EA 3WAJA 3UJIL 3MV9B 3OAWA 4OJFH 3E3QC 2A4ZA 3JVGC 5C0CE 3CVHB 4NOFA 4YQXH 3L3DB 5GGVL 3V9CA 1ZXQA 2KS0A 3C60B 3QNXB 3T6XA 2FBOJ 3J07A 1I4FA 1R5IB 5FGRA 3UZQB 4BFKA 3BZFA 4OZGF 5IP4A 4IW4C 4EOWH 1KPUA 1KT2A 2H45A 3BDBA 5IROA 5BV7C 4ZXBA 5EEXA 2AI0L 1LHZA 5FDWA 2BSTA 1TVDA 1QYGL 1HCFX 1IC0A 5K9QI 1M2VA 2W0FB 1XH1A 4F2FA 5LGJA 3RTQC 1KLUA 5FYKE 4N2MA 3QJZA 5CSGA 1DBKH 4WWOA 3VB8A 1ROWA 1CG9A 1CYWA 2CMRL 5IMKA 4GG6B 3STZB 4TVPE 4F9PA 4HVBA 3UTSA 3RWDA 4PJFE 5FV2A 3ZSSA 4P23A 4M6ML 4LFHD 3MRHA 2C3XA 4JPWH 3QJQB 3FBQA 1N59B 4R0LC 2H2SC 5DUMH 4LCCB 4OZGA 1Z3RA 1Z9SA 5C0IA 4LO9A 2Y1VA 4MJID 5K93A 4JJHA 1MFDH 2NX5D 3LXCA 3QWRA 3B43A 4FERA 3D12B 5C1MB 3NJVA 3EW3B 1YN6A 4Z7VF 1KJ2B 4K3JL 1PJ9A 3VXOB 1UG9A 4TNEA 4EF3A 2NT0A 3QEHB 3LVEA 1KTJA 3LKSA 1KG0B 5BRZA 1FO0L 3WJJC 1AGBB 1EAPA 5IJVA 5IFJA 4KK9C 4RH4A 1JK9B 4XMVA 4KMQA 4PLNC 3QUYB 1NL0H 3MKGA 3FPYA 2HFFB 3HS8A 3V79C 3QG7L 1VGKB 1IAOA 5GQBA 2OI9C 3ZRCC 1MIMH 3QDMA 5CIPB 4PLJD 3TS8A 1QVOA 5JXAH 1XBDA 4U3CA 1XH3A 3ZBMA 4Z76A 1JHLH 2VDML 3DK0A 4HAGA 4GW1B 2QPSA 2C4XA 3RIFF 4JFFD 1CTNA 1DQDL 3FQWA 4U6TA 5IB5B 5C09D 4CRPA 3PL6C 3GXNA 5KAQG 1NCJA 4JRXE 1FSKC 2B4CC 2XG4A 1XF3A 3CDZB 1RERA 1OF2B 2EZ0D 4PFEA 4NI3A 2E7LA 3T6WA 1JPGB 1RZJC 4KQ3L 3NCBB 3Q2VA 1FLRH 1WBZB 3CFJA 3AQYA 1RZGB 3NSDA 4FEMA 4UBDD 5JW3L 5D5ME 4O5LH 2WXMA 5I1HL 3F7YA 1PDKB 5MERB 5ADPH 3MACH 4L9LA 4N1CA 4NHCH 3C9NB 5JW5A 4UQCA 4DUXA 3L16A 5CEZL 5DUBB 4KHXL 4YDZA 5E5MB 5MEPA 1YEEL 4MNQD 1K6QH 2PW1B 5H94A 5SV4A 3S35X 4DZ8B 4KJYB 4X6EB 4BUGA 1EHLH 5CN1A 2P46B 1SMOA 4QO1B 4KKAD 3IBOA 4NJAH 3FAWA 3LRSA 4LHUG 3TFBA 3MV8B 1DFXA 3KH3A 3BUYA 5LHDA 3FO0L 3VFRB 1MNUL 2ED9A 4HEMA 3AG4B 4JQIL 4M29A 3V9EA 1DBML 3M1CA 4RGMC 2X38A 4OD1H 2WB7A 1KJ3L 5T5FL 2CDFB 3ULUL 3D9AH 4N20A 1E65A 4EBQL 2XPGA 2WQVA 3OXRA 1ZY9A 1BOGA 2E9GA 1ED3A 1HINH 1BQKA 2OW6A 1X44A 1J9TA 4K8RD 1HH6B 4MMYA 3KBHE 3D39E 4U6XB 1JV5B 2X6CA 2CA4A 3BLBA 3BUPA 1S9KC 1C9SA 3EJQA 4E9WA 3NG5A 1GZHC 4JG0L 3PP3K 5IQ7L 2EIZA 6FABH 2WNXA 1LWHA 4RRPA 1KYOK 2WVVA 2XIIA 4GW5B 3GD1C 1FV1A 2MSPA 2HVBA 4YSDA 1J1PH 1SJEA 4RWHA 1SMAA 3V0AC 1QR1B 4BBWA 2JH2A 2BY1A 2QGEA 4PM1A 5I6PA 4F7TA 2X4RB 5DFVC 4PUBH 1PIFA 2M8XA 2H7WA 1OOAA 1OXYA 3VQLA 1T7WA 4TNWF 4B41A 5B1AB 3Q2WA 3WLBB 5I66B 2EADA 3NP4A 3DX9B 5DURB 5I71B 4NO5B 5I19L 3V5KA 1CTMA 2H6UA 3HG5A 3IKCB 3QQ9C 4HWBA 3RGVB 4F2MA 1MLBB 2ZCKH 4MX7B 4OF3A 3GJFH 3VGBA 2XA8L 4R2GD 5HI4D 2ZWSA 3PHQA 5DK0A 4GRWH 3QZNA 4OQTA 2EJ1A 5KSVA 2ITEA 2VC2B 3BWUF 1LMKA 4OCNC 2JNZA 3D50A 1GMEA 1INQB 3GXTA 3ROLB 2EUVA 1NDGB 3KD4A 4NKIL 1U6AL 5EBWB 4OJDH 5FXCH 3T65B 2VM9A 4PJEF 3WEOA 3LKQB 4ZW7A 2IH8A 1FL3B 3ZE2B 3BAIA 3K8KA 3Q2NA 4GKLA 4B0MM 2H9GA 4MCYA 1NM4A 4GMSL 2XXFA 5E03A 1JNHA 4FI6A 3UPAA 5JDJA 1WH0A 3B2UC 5DSCB 2VR4A 5E4EB 3FFDB 1MLCB 3GMLA 3DV4B 4LLDB 4WEEA 5KTEH 1PLCA 4DHLA 3I3EA 1L3NA 1AZRA 4S1DC 4L1TA 1S7QA 2IH9A 4M62L 3UPRA 1U58A 4I1PA 2IQ9H 3O2VL 1EHNA 3QDGD 1SVCP 4OLEA 1ZVNA 5EEVA 5BO1L 3GUTB 2Q3AA 3QJUB 4X4XA 4ZMLA 2ZUWA 2ZSVB 5I0VA 5DLML 4JPQA 2C1PB 4FHJA 2V2TA 1DSFH 4AY0A 4E9SA 4J39A 4TTDC 1OL0A 2Z0UA 3O6FB 1VFAB 3B37A 3HKZA 3PP3H 1HH9A 4NSKB 1J5HA 2P5ED 5CSZA 5E7FA 1SVBA 1ZLSH 3RZWA 4FZ8L 4U1GB 5CJQL 1D7BA 1PZDA 1EZLA 1T66D 1XSIA 4MWFB 5HPMB 2CRZA 2VQ4A 3VTMA 3GBDA 4F58L 4OJCA 2I26N 3SKUD 5DTFB 3OTTA 4G9DA 2YGQA 1L6XA 1HU8A 3MV11 1U8PB 4FQ1H 4KXCA 3F58H 1VSCA 3K4DA 1OWWA 2FIKB 2DKMA 1BXUA 4X0NA 1LWJA 1T89A 4N6RA 4BSVA 3GSNH 2VDRB 4MBRA 5FYJE 1ZT7A 3QEQB 4JHAL 1CFQA 1VKXB 3QFJB 2QVIA 1P7QD 3N44F 2FEDD 4KJWD 4KVCH 2WTRB 1LO5A 1KCWA 4K9JA 2KDGA 1EGJA 2OA9A 3QDJE 3DOSB 3OKLB 3O0RL 1XF1A 2EVJA 4ZMNA 2ZOKB 2B3RA 4ZW6A 3AWFA 3ALXA 3CZEA 4FQXA 2X4PB 5EC2A 1GPOH 1ZHKA 2LHAA 1TVHB 4OGAC 2VLJD 4NQDB 4JY4B 1IGIL 4ANUA 4I18B 3REVB 1I8IB 2ZUUA 2PPEA 2P5WB 4P05A 5D2LF 4P06A 1IAKA 4F5CE 2V17H 4OCRL 4AKQA 2PYFA 3RA7H 3LOWA 4ODWB 3MU3A 5AZEH 4F7EB 2J72A 4PJBB 4KGJA 1FJ1A 1B3IA 5JOEA 3OLGA 1R75A 4TUUA 1CIDA 1MKFA 3SDDC 2YZ1A 4C56A 1WQVT 2E47A 5LAXB 2VSCA 2VUOA 1B6DA 1KTLA 2JCCF 2Q3ZA 5HTSA 5IQMA 1WP6A 5T3ZL 1MI5B 5DVNA 2O6FA 4WWKA 5IM7B 2N4IA 3OKEB 3WTSA 5I5IA 1Y0LA 3WS3A 1JPSH 1LE5B 2PWGA 3LV3B 3KPOA 4FI8A 2V7HA 3ULAB 1Q1PA 2ZG2A 5E24E 4IEFB 3ESMA 5ECGA 1NIDA 3BP7B 2I5YH 3EHBD 1A1OA 1HSAA 3FTSA 3LMJL 4ENEC 1VHPA 1BVNP 1ZGLA 5L4FA 2JCCA 5LGHL 4QRRB 4AYFA 3FSAA 3RL2A 3O4LD 5C0RL 3ZMEA 5DZVA 3WHE1 4B9IA 3C09C 2AJUH 4P2QE 4JFXB 5INCA 1UM5H 3D48R 5E1AA 4APQA 3SE8H 5C0DA 4UQIM 5ICXA 1CL7I 3NIDB 3JV4B 5IHWA 1MVUB 3AU1B 4QHMB 3U36A 3ZSTA 1ETJA 1DLFL 2J57A 2YBRA 5FO8B 1IQWL 4UILH 5I5RA 2FNBA 4XN7A 4AMWA 3PJNA 4QRUB 4P5MB 4P2RB 4FULA 2ZUQB 5IW3A 4U6VL 5C07D 2IXQB 3C08H 5DMYA 3ETBF 1NBVL 2BW5A 4OJAA 4OM1L 1FVEA 2WYTA 3FL7A 5EULV 2ZKHL 5TJWK 1W8NA 1DQTA 4PRHE 4BK8A 3MYJA 4TSBH 2DWSA 3UAEA 5AZ2H 3BPNC 3H9SD 4POZD 5DMGD 5GHWL 4M7ZB 5I76B 1Q9OA 3BD4A 4LCWD 4NRYA 2J7LA 5DVKA 1N64L 3MJ8A 3I50H 2BP0B 2QL1A 3BWSA 3WNIA 2DZEA 4RVBA 5E0QA 4O2FA 1D7FA 1MHCB 1EEUA 4PCYA 2DW5A 1N12A 3DC0A 1T1WB 1YEKL 2BMKA 3S5LB 4ONGL 3ZTNH 5I16A 3T3PE 3WO4C 2CPUA 1DLHA 1AQKL 3T0AA 4V33A 1NGXA 1WZAA 5ICZB 3MV7B 2X42A 3KNBB 4Y16B 1MWAL 1JDAA 3MOBL 4GG8A 1GAFH 3S98A 4ALAC 5B38B 5MEOA 1OW0A 1P0SE 3AABA 5AOMA 2PTTA 3RVWC 4Z7IA 1IBGL 3DIDA 3VXRB 1JFHA 1KCSL 4Y4KB 1XSJA 1QSEE 2BY0A 4XXDB 4G1MA 1DBBL 3INUL 4MCNA 3WTTA 3CN4A 1CLOH 2EDEA 3KYMA 1M05B 4PWGA 4ZPVB 5IMMB 1AMYA 2C9PA 4X7CC 4EZLA 2E56A 3PXLA 2DLHA 2FATH 1UOLA 4FXGA 3SD2A 4DKAA 4PJ9C 1XQ4A 3BUTA 3WIHH 4R4ND 4PSRA 1ZV5A 3WGUB 3OAUH 3OAZK 4PRBB 1I3RA 4TUOA 3V8CA 3HW7A 1UJ3A 4HAKA 3KM1A 2B77A 2FR4B 1UXSA 1ZHNB 5AVZB 1YUHB 1UHVA 1A4JA 1LO3H 4DP0X 4P59H 1GIGL 1E8WA 1ILSA 4R4FH 5JA9A 1Q9LB 3ULVE 3BZ5A 1U8NB 1UASA 4G8FA 5IOPB 1DQVA 1E3ZA 4Y19B 4EUPG 5KVFH 2XFXB 1RUPL 4XNBA 3BXNA 4Y9FA 5AD0A 3S36H 3HLAB 4DP6X 4JR9H 4M7LH 4NPYA 2NY3C 3KPMB 2PYEA 2Q6WB 3QHZH 1UA6L 1UZ8A 4HIXH 3C87A 1T0NB 4PJIA 4UQEA 1EEYB 3AAZA 3GM0A 4R6UA 1PFCA 5EN3A 2FHFA 4IRSB 1OT4A 3AW5A 4UOZA 2JKXA 3SBWA 2RD0A 3VGFA 1R33A 1IL1B 1EMTH 3DYPA 4TSCL 4Y4HB 4NN5C 3T8VA 3TF7C 1BBDL 4ZW5A 1BYNA 1W0VB 2UZIH 4RBPK 1YPZB 3QZMA 2CWRA 2DKSA 3OKNB 1VGEL 1GL4B 3UADA 5IGXL 1AR1B 3WO3B 4YEEA 4NZTH 3MUZ1 2WNKA 5E2TH 3IGLA 4LIQE 1RUMH 2X1OA 2NY0B 1KGIA 2XQYG 1N6VA 2FYYA 2CKBL 4MLIA 5AALA 3T4YB 1H3PH 5C0CA 4LSPL 4PJFF 2Z64C 1KNOA 1JGDA 3KWXA 3QR2A 4R97C 4X80L 3RILA 4GB9A 4S1RH 2XETA 5C0FB 3S35L 2BIPA 3E1F1 3JSSA 3SPCA 2ALAA 1G7IB 4LEOB 3PHOB 1YEWA 1VZIA 4NO2A 3ZKND 2I60L 3BSZA 1NTDA 3U1SH 4ANVA 4N90D 5KYWA 2AQQA 3UROR 4PJ7A 3NZ8B 4CC4C 1H6FA 1U8IB 3H53A 5LG1A 5EA0H 3KLQA 3QO1B 4KZDH 4G6KH 3X14A 2J8UE 1D5ZA 3QNFA 1H15B 2XWXA 4CMMB 3CFBB 3CUPA 4PJFA 1CFNB 1WFTA 3MFFA 2Q7YA 2AQ2A 1UH3A 2AJYH 2YMXL 3GNML 4N5EC 1C5DA 2QGBA 2VN3A 3OAZH 4FP8L 4PWFA 4GSXA 4WHYH 4CBZA 3QGVA 3BWZA 4UQ2A 2DPKA 3WFDL 3H1ZA 4IYKA 1HHGB 1UEMA 1ZPLA 4EVNA 4WTZG 3LKNB 3L7FB 4TRPH 1TJXA 4IIQA 4M43H 1IAMA 4ZAKC 4GAJH 4IS6B 4AMKH 1NFDE 2ZOLA 3QPXH 4AQEB 2QMJA 1KYUA 1RVFL 3IU3B 2FCBA 3PAZA 3T2NH 3ARXA 4KXAA 1OHZA 1AKPA 2IGLA 1PPIA 3K2KA 3WNOA 5EPMA 4AV5A 5AENA 2EO9A 4LCIH 5KS9E 4WHDA 1Z3GH 3U2JA 1Y6KR 5DJ0A 5D5MF 4G6AC 3U79A 4R8WL 2APVA 2COVD 1WWAX 3TH2T 3EDEA 5EBMB 2AKRB 1AKJB 1HHIB 1X5GA 2KERA 1F2XK 3DUUA 1VEPA 2AXWA 4FE9A 4KQ4L 1E27B 3HI1B 4MS6A 3MRLB 1I3GH 2JE8A 3DGGA 3EYQC 5A16B 5ICUA 2DRUA 2I85A 4WUUE 5AYUH 1IGCL 1IGYB 1D9KA 4YH6A 4C58B 4M4PA 1DVQA 5ISZB 4LLUA 5T1LA 3VMPA 5KBDA 3W11D 2EDYA 3BW9A 3APMA 4W9HC 3B8YA 1ZEAL 3OR7A 4L0ZA 1J8HA 4FABH 2BXYA 2WQ8A 4B53A 4FNLL 1WD9A 3ES6B 3LNGA 1BJMA 5JXEA 4UNVA 3OQ3B 2J56A 5JW4N 4XBPB 5D5MA 4L4JA 1GZPB 1LMIA 3OG4B 3ZQ9A 3QE5A 3KBEA 3QA3B 4D3CH 2YGPA 4WWPA 2PW2A 2X12A 4FTVD 1X7QA 1EXUB 4KKLD 1BLIA 4LSSL 1R5VB 5JZ7C 3A6CL 4DK6A 1V7NL 5HGBA 4YDLC 5TFSL 3RWEA 1A64A 1NGYA 3HMWL 2GK0B 4JJOA 1TEFA 2BFVL 2V6HA 1P7BA 4CU8A 3MRMA 3RZCC 4CADB 3JYBA 1K5NA 4H0IA 1HJBC 2XV3A 3IPFA 2VERN 4ISVA 2YA1A 1MF2H 1CS6A 4BWTA 5IBLD 1QBLL 4WY7L 4J3OF 1YMMD 3B9KA 4A7QA 5C8JA 3VD0A 1I4FB 5HHQB 5CJBA 4H8WL 4FN0A 3PGDA 1HKLH 4UU9B 1MUJA 1NANH 2P44B 2BRQA 4ZXBB 3HZKB 1JD9A 2FT7A 3FQ2A 3H3BC 3CZKA 4YXHH 5DQDH 5ENWB 4XMLH 5HGAB 3WL9B 1ZT1A 1ADQA 3OHXC 2IG2H 5E99L 3DI2B 1BDYA 1L0XA 4I77H 5EF1A 4L29B 3V5DB 3CZSA 1FN4A 1EQWA 5IMKB 1YN7A 4NKMA 3O3EA 3NA4A 1A6UH 2EO7A 5HP5A 3QQXA 3QAZB 4P23B 2W9DL 4NZ8A 3MRHB 1DJZA 3EYVB 2NYKA 3NFNB 2Y7SA 3E6HA 4F8LA 4OZGB 3VRIB 4K94H 1CI5A 2NUTB 4NKQB 3SYCA 3V0HA 5C0IB 1BMZA 1RUQL 2DWXA 4GRMA 5AEAA 4KBPA 4LOFA 2NY4D 4PGCB 1RZIB 1HHHB 4IIZA 2H6OA 3ZYZA 3GS0A 3X2QB 4HJUA 3NEOA 1IJ9A 4X98B 1F4WH 1SBSL 2Y7MA 2B7DT 4JG9A 5DA4A 1QFWH 4NCC2 4I7ZC 3LKSB 4Z7WB 4Q6YA 3B3IA 1CFSB 1RZFL 1T0OA 1GGBL 4KH2A 4MQXD 5CMAB 2EICA 4HCRH 3CX5K 3F7PC 2P9RA 4OTXH 3HB3D 3QRGL 4UINL 2Q7NA 25C8H 1UCBH 3A5VA 2WY3B 5ALBL 2VISB 1IC4L 1WITA 5DZJA 1TPXC 3O45A 1U21A 4JG5A 4I2XE 4MRCA 2EYTA 5JHBA 5KW9L 1BM3L 3O2DL 4EZKA 3TYGL 2EXWD 4Z7VB 4APXB 2R4RL 2KHAA 5DHVH 1I7UA 1IGFL 4YGVB 3BPLB 1XF3B 2XTJB 5F93C 1AZVA 3LZRA 2B3IA 1QFUH 3AVEA 4ZMTA 5EF3A 2CHWA 4ODSH 5E08H 1KCRL 2QSTA 1IMHC 2X88A 1CB4A 4LAQH 1XL4A 1T3FB 4DPBX 3FU7A 3FF8A 2MFNA 3BH4A 5TD4A 4NT6B 4FJZA 3OM3B 2K6YA 5IEHA 2BNQD 5KUMA 4OD3L 2FBJL 1S3KH 4QXTB 4XI5D 1HYRC 2W9EL 5BV7H 3QQ3B 2MOGA 5K9KA 4KGLA 4W9EC 4A2EA 4JM4H 2AXGB 2QLVB 4EE2A 1MFCH 2WNWA 5IT2H 4GUPB 4HQQL 3BUYB 3CK0H 1WA1X 3CFTA 2YUZA 4MAUH 3LS5H 4LMQE 2R7EA 3ZDXE 1TQWA 3VW3H 1NDTA 3GDBA 2FBRA 4TNVF 1O9VA 5IROD 1KXHA 2EACA 3MJ9A 1UURA 5DEGB 2VDLL 3IU4H 3F84A 4N2EA 4XTRD 5DO8A 1FHGA 3IMRA 4YJZL 2X09A 3PS6A 1A6TB 2VKXA 3RUGE 3SJVD 1YNKL 4MXVE 4GINA 1JERA 4JDZB 3EOTH 4PLKD 9CGTA 4RFNB 5DMKA 1BCIA 1UM6H 3CVCA 1GA2A 2BK8A 1NGZB 3CVHL 2K45A 3UJIH 4PLJC 2R4SL 4AGNA 1EFXA 3RAJL 3UTSD 2VYRE 4PBXA 3QDJA 5GGVH 2LABA 1FV1B 4KV5E 1KV7A 4MZ3A 2XA3A 3GMRA 2GB2A 2B1HL 2AJXL 2FB4L 2YEZA 3JTSB 4DAGL 3X1BA 1OGTA 3FT4A 3ZTJH 1W0WA 3GKZA 1KJVA 3QJTB 2AI0H 4XOCA 2F53E 2EZ0C 4HLJA 1YCSA 4JRFA 1O5DT 2GTZB 3QWRD 2GJ6B 1QYGH 3VYNA 3ZHNA 1DVFD 3OVUB 2R2EB 4UBDC 5FYLL 2VITA 3OJ2C 3K80A 2OMTA 1WGVA 1JYVA 1FNAA 4QGYA 4QMEA 2AHIA 3V5KB 4OLXL 4A7UA 5CHNA 5BRZD 3SKMB 1HNGA 2CMRH 3VWJB 1V7ML 3PWNB 1EHKB 1F18A 3TASA 2W59A 2CE6A 2X4TA 5DK0B 3ZGHA 2ODIA 4M6MH 3E9UA 1RQ5A 2NTFB 3MGOA 4KKAC 2YPLE 1ZDSA 4YZWA 1H8NA 4ZMWA 4B6ZA 2B4CH 1B0IA 4WIQA 1OANA 1OP3K 4L4VD 2W65B 3QQ4B 1TTGA 2F08A 1KJ2L 1Q90A 4ATWA 1WBYA 5M7QA 5TTRA 3WNPA 1T80A 4XRCA 4G6JL 4CSTA 4CSZA 4FFZA 5HDQL 2K7PA 3BT2L 1F3JA 2Y3AA 2H9GB 1IKNC 1O6SA 1Q9WA 3JWNC 1X5YA 2ADIB 3ARUA 1FO0H 4K8RC 3UBXI 4DUVA 2XWZA 2CH8A 3S2AA 2B14A 4MLSA 3QG7H 1ZOXA 2A6DA 2UY7A 2UWEE 1AOHA 3HIZA 1U58B 2OJZL 2VDMH 4AK2A 1DQDH 4PJ8A 1G7PA 4XX5A 4QNPE 4PJEB 3F85A 2GSGA 2V2TB 2QLYA 1VENA 3UC0L 1M4KA 4HA1A 3FQXB 3UTQB 1Y1DA 1EZVY 4GAFB 4GUCA 1DQIA 4NQSB 2YD4A 3FN0L 3T3PF 4F15C 3AB0B 4PTTB 1U95A 4WI0B 3I75A 2EUXA 4KQ3H 3BVTA 1UC6A 5CSZB 4LHQB 4QTFA 1AZZC 2ADJB 1Z1WA 1BP3B 4ANWA 4NB7A 2BDNL 5JW3H 4Q6IC 1H8OA 5I1HH 3EO1A 4ZUUA 4HIJB 3V4PA 4JFQA 4BRJA 4L2YA 3WTYA 4R2GC 4LPWA 2K4WA 3K1DA 4RMBA 5HI4C 3SGDI 5CEZH 4Q9RL 4BA0A 1SZNA 2WO4A 4KHXH 1OSZB 3W57A 5ANMB 2AERT 2IV8A 3L5WB 3CV5A 2EYSA 2JI2A 4I3GA 3FMGL 2YD1A 3DGCR 2EEAA 3Q1SL 1IARB 4HBQA 5E00A 2WTOA 4BSVB 5IREA 3ARZA 3QR1A 2CJSA 5TPWL 2YOAA 1BZ8A 1ZT7B 3FO0H 4I5BB 1MNUH 1Q1JL 5AAWA 3K2IA 3Q0HA 2G5BB 1A7RL 4JQIH 3RB7A 1DBMH 4JO3L 3GIVB 2IAMD 1KJ3H 5T5FH 3ULUH 4EBQH 1JCVA 1YAZA 3LQAL 4LEBA 5DZAA 5I8CA 4PGZA 3ULVF 1O7SA 1DVXA 2EVGA 2H26A 2TAAA 5A7EA 2G0LA 4PMEA 1OP3H 4GAYA 1FZMA 1QSEA 4HHAB 3OAYK 1ZHKB 4WFHE 4HV8B 4JG0H 4U6HA 2H32H 3GXDA 3QNZA 4QRPD 5AVTB 1UOVA 1SVZA 4U31A 1FNEB 3RWJB 1BF8A 1H5BA 2N59A 3MNZB 3PU7A 1BBJA 2OSLA 1G0YR 2MTPA 2VH5L 1Z9PA 2AV1B 1OAYL 2IMMA 1P1VA 1I1YB 3KWWA 2DQCL 3WY3A 4DQOL 1V3JA 3K2UL 5FA3B 2WAQA 1T0MA 3ASWA 4J3WA 1TTCA 5DEJA 3ABMB 4YDIL 3EYOA 2UX6A 1S9WA 2OCJA 4KJQD 3H9YA 4JRLA 1NFIB 1NMAL 2P3YA 1AD0B 3RIAF 3GZOA 2BZCA 1T66C 4HK0B 4W9FC 3ZYJA 5I19H 1Y0LB 3D34A 4OVUA 3S3BB 3LEVL 5GGTL 5D2LB 3KPOB 3QFDB 4HETA 1XCQA 2XA8H 1VFMA 5GGSA 2VC2L 3DX6B 3OGCA 2XZQL 3EDKA 4XP6L 3VQ2C 1ANUA 3W37A 2X4SA 4B7LA 4D0DA 4R90L 1E8YA 1WWCA 1OCOB 3O3DA 2DQDL 4NKIH 1RULL 1OP5K 1U6AH 1K4DA 2Y0SA 5D96C 3S5LG 2JCCB 1P6WA 3IAQA 4KJWC 3P11L 2FEDC 3NT0A 3BT0A 3MRCA 4P4KA 2G3NA 4N3UA 1S9YA 4GRLA 2EVHA 2J8UF 1IFGA 5HDRA 3AWEA 4M3JA 3G3LA 5BZXA 4B50A 5B38G 3A23A 3MRBB 4L37A 3NDZE 4Z3EA 2EUZA 5K9JL 4YPGB 4ZO8A 1VIWA 3T8XB 3U36B 5HYQA 3UTTB 2HN7B 2YBRB 3FSWA 4YS4A 2ZOOA 5BMFL 2F5BL 1TZHA 4WJ5A 2HRPL 1AIZA 2JJTA 1UGNA 3EYFA 3LKOA 4M62H 2RHEA 3P2BA 3UYRL 5HHNB 2VE6B 3O2VH 3GBNH 2BH0A 1NFDF 4HAFA 3UAAA 2A74C 1H6TA 3GO1L 4GI6A 3VI4E 1I8MB 5PAZA 5DLMH 4CKQA 2PF6A 5EBLA 5H37A 4XMXA 2WUCL 4GXFA 3BEVA 3CFCL 3LIUA 4JDEA 1J05A 3NVQA 2BIHA 4OZFA 2DI9A 5TDPA 3U0PB 4D9RD 3H55A 2CLVB 1TCRA 4FZ8H 4P5KB 3Q5TA 4WI4A 1U3YA 3LN9A 4XZUB 2EE9A 1EZVX 2KL6A 4F58H 2NY1B 4FQXD 4G8GD 5E2WL 3DSNB 1GH7A 3DX8B 1IM9A 3NJJA 2VWEE 2WBWB 3THML 4QRFA 3B3BA 3IFLL 3EHBC 2VQTA 2ZCLL 1PEZA 3ULSB 3F12A 4EAEA 3TH3T 3MBEA 4UOQA 5L9DH 5IHBA 4LVOB 4ES8A 2RFXA 5KS9A 4KAQL 1JGEB 5I0WA 2GG1A 4MMXC 2F2HA 2WVUA 3ESVF 3QXAB 3UP6A 4C56D 5IB1A 3VD3A 1G7MA 2F54E 4LCYB 4U1NA 4NP4L 4W9IC 3GK8H 1BLNA 3O0RH 3QP3A 2DQUL 1ZE3C 3LPFA 4WUUA 1L7IL 1UJ3B 3MO1A 4WWKD 3AACA 5T3XL 1UA3A 3GLDA 3MRQB 1D7CA 1Z9OA 1A4JB 4PRAB 1ZCRA 4MS8D 5KYXA 4PMFA 4RGOL 1LEGB 1QO3B 4G8FB 1DN2A 1XD0A 2VT0A 2NT1A 4NFDA 4OCRH 5AW0B 3X13A 5HYIA 4UQDA 1RZKL 4U1HA 3WFBL 3D69A 1G7HA 4R5TA 4BQ8A 1VLXA 2NR6A 1JHKL 3QIBB 2EO1A 5JNYB 5C0AB 4POZC 3BCDA 5DMGC 2WSKA 4Z3HA 4HD9A 4RNRA 2VR6A 3A4DA 3II1A 3D8MA 5T3ZH 3MODL 3DVNA 2IOOA 4XP9L 1I85A 4FJ6A 3ILPB 3T1FA 2COQA 3HUJE 3F7VA 3OLEA 3V0JA 1QMUA 1UT9A 2HTKD 1F8TL 4F1ZA 4HS6A 5DS2A 3TNNA 1KY6A 4D94A 5AW5B 4L0YA 1MCNA 5SWZA 2R29L 4PB9H 4PG9B 3F62A 1BSIA 3EH4B 5GRVK 3TZVB 1AGEA 3LMJH 4NS0A 2AJ3B 5IB2B 4FYQA 3CHQA 1JS4A 3QVAA 3L9RB 5BW7C 3MRFA 3KPPA 2P8MB 3Q5YA 4BWWA 5LGHH 3U6RB 2IDQA 1TMCB 2OMZB 4Y7OC 5C0RH 4HMDA 2MNUA 4YHZH 3MREA 3HHSA 4R4NC 5KYWB 4JVPA 2E74C 4NDMA 4XPFL 3BQVA 2D8KA 1ZLEA 1GTFA 1C08A 4DH2A 2PMZA 4H44C 1L9TA 3B9EA 4RAVB 4XNMB 1DLFH 4ZT1A 4BUQA 2EC9T 4BEIA 3X14B 1G1CA 1PQZA 1D5ZB 3MUUA 1XXDC 1PX3A 3CC5B 1OHQA 1GRWA 4EMZA 2VN4A 5DJYB 1J1OL 3EXLA 1SRDA 4YNYB 1NBVH 4OM1H 4U7SA 2Y06L 5EU4B 1PZAA 2G60L 1R3LB 2ZKHH 3WEXA 2XN9A 3LKPA 1E0OB 3ENEA 4EVNB 5GHWH 3DXAE 1UB5B 5I9QC 2HRGA 2Y2TA 2VABB 4XOAA 5FKPA 1E90A 1N64H 1IE5A 2Q7AA 1LEIB 3QJSB 1N0LB 1KXTA 4POUB 1KLFB 2OMVA 3FDWA 1HWHB 3IS0X 1YEKH 3TA3B 3VD7A 1TEGA 4ONGH 4NCC1 4P49A 3TA4D 4GUOA 1AQKH 3NH7L 3KPQA 1MWAH 3MOBH 5FHAL 4EN3D 3ET9F 3B1TA 3MCKB 4OZHE 3CCHB 5ABAA 1T5XA 4R5XA 3LIZL 3VFPA 1C8PA 4FKKA 4ZSOA 1IBGH 2VMDA 5F7EL 1I9EA 5GSRA 1KCSH 4HSQA 4Y5VB 3WIAA 3Q44A 1D9KB 3CAFA 4R83A 1M2OA 1LILA 5E8EA 1DBBH 3INUH 4RGNB 1GY1A 4YSSA 3II3A 1D5BB 4LLUB 4MNGB 4XO4A 4HOXA 1I7RA 2CPCA 2PYED 3N9GL 4JRXB 4PQXA 4O02A 4QHKI 2J6WA 3ZKNC 3KPRB 4ACTA 5SWSE 1RUAH 2YPVL 4BV1A 3ZDXF 1NFAA 1YEDB 2DQFB 3NFPB 3WNLA 3JZYA 1I1RA 3BGAA 1S9XB 3LTVA 3EJTA 3VE0B 5GS1C 4QXGL 4Z77B 1GIGH 3RUGF 4PGDA 1X7QB 4MXVF 3TU6A 1DJYA 3QZWA 2G3MA 4FEIA 2ZUTA 3JV6A 1KBGL 3RI5K 3IDMA 3QJFA 3OKOA 5TDOB 1K4CB 5CEXB 3A21A 1NC2B 5C0CD 2BWQA 2O6CA 3EYUL 1UA6H 1J12A 2TRYA 3P3SA 1GZQA 4KV5F 2GUYA 3ZHLA 5D71L 1PNDA 2LFEA 2EE6A 1NOLA 3DVIA 3L95A 5TDNA 4PCSA 3QDHA 4LRIC 4TSCH 3OLIA 4JRYB 3N6YA 5DWUL 3P4LA 2UUDK 4EI5A 1CGXA 3R0NA 1X5XA 2DICA 4LPXA 4AE1A 2VLRA 3B9KB 4ELDA 4X8JB 5LBSL 1A6AA 1AQHA 1HESA 1VGEH 1PU0A 5AKRA 5FYKD 2R15A 3D39B 5IGXH 5IW1A 3QO0B 4WV1A 4PV8A 1JYNA 4ELKB 4A6YA 3V8OA 2VO5A 3E8UL 4JM2A 1XXFC 5DC0A 1U2HA 1NKOA 2CKBH 1CDCA 4LSPH 2ICWB 1ZT1B 1CLCA 4X80H 5JDSA 3G6AA 3N0AA 1JWSA 5FFOA 2W95A 5DJZA 4GO9A 3S35H 3V52H 3W11C 5DHMC 3LH2H 4F8TA 2WIMA 4AIEA 2QQKL 1PZ2A 2ATPA 3NEXA 4NKMB 2F53A 1USZA 2I60H 4ODUA 1A0QL 3F04A 4FQIH 3GHBH 3DHUA 2YFNA 5F9OL 1ITCA 3CZLA 4LOEA 5J1SC 2WZPA 2WQUA 4FQCL 1MOEA 1KB5B 4KKLC 3L3HB 4ZMYA 2DLEA 1L9MA 4PCTA 1IM3D 4P3WA 1TLMA 2YPLA 3GNMH 4O2CA 5EC1A 3OMZA 4FP8H 4PS8A 2UWEF 4X7FC 3WFDH 2NQDA 1MCQA 1RP9A 1JRHL 4TN9A 3AG3B 3WG7B 5FKAB 5IB4A 2BIQA 2Y24A 2P24B 1OTUD 1URIA 3TEYA 2ATAA 5DUJA 5C7ZA 4QNPF 3OGOE 2FQFA 4X6BB 3M45A 5T1LD 3U7WL 1R3JA 3QIUB 5IBLC 5DJXB 1R3HB 4F2EA 1J8HD 2HJKA 2XWCA 4RCAA 2GJJA 1RVFH 1U33A 4AC4A 3I85A 1JXFA 1CGSL 4IRJA 5F1NA 2EYTB 2MCG1 2A73B 3Q8EA 4WFEE 1W72B 5DD5L 5B22A 2FHBA 2E0PA 3FN9A 4L8SC 4EIBA 4QHPA 5BQ7A 3IDNA 1AANA 2CBOA 3MRRB 4K7PY 2I9TB 4PVNA 4KQ4H 5MP6L 4GS7B 2EVIA 2EH8L 5FM5O 4DP9X 5TF1L 2UUDH 1IGCH 4GKNA 4WEBL 5D9SA 4S1QH 8FABB 3FU7B 4WDIB 3TNMB 3D07A 2NXYB 4YDMA 4YC2C 3LNEA 1DVUA 2I07A 1ZEAH 4OKVB 5I1LA 5IEHB 2WWKT 1NMBL 4GP4B 1RK1A 1D6VL 1F90L 4N2GA 4FNLH 4MMZB 4U1IA 1CE1L 3FO1B 1F86A 3GLZA 5G4NA 2AW2A 4YL9A 5E23A 1P5UC 2ISDA 2XTLA 3RJDA 1H3WM 1MHPL 1XGUA 3WE1A 1L0YA 2NY4C 4UZGA 1HSBA 4N0UB 3QEGL 1KULA 2NSXA 2D2CC 5JW4Q 5D7LB 4MNHA 4LSSH 5B8CB 3V5HB 1FVCB 2ZX8A 3A6CH 5DJAA 1F1DA 1V7NH 3FCUB 5TFSH 4NM4L 3AREB 3HMWH 3GYRA 3MXWH 3X1EA 2BFVH 3UAJA 4OZIE 4CILA 4MQXC 5FLVA 3EJPA 3C8KB 5DYOA 5J12C 4MHHI 1QTPA 3WDJA 3HB3C 4OFKA 5DMKB 3DO7A 2B5IC 3IJEB 2FGWH 2D0FA 4I0PA 3WSQL 3WY1A 1A2YA 3LS4L 2BZ7A 1NGPH 4NLHA 3OPZL 2WBXA 2Y7LA 3HE7A 1QBLH 1EFXB 3FHQA 3IE4A 4KTEL 4P0DA 1N70A 3NP3A 3QDJB 4XVOA 4DP1X 3VFNB 3G5VA 5C9KA 3PAUA 2NSMA 3K7UA 3U0TA 1HXMB 3US9A 3ARBA 4H8WH 5DR5H 2EXWC 2DY2A 2VNCA 1A9BA 1S8DB 2YEZB 4OSUL 5ICYB 1JWMA 3PE9A 1NIBA 3FT4B 5FO9A 4C4KT 2W0KA 2X89D 4BH7A 4M8UA 2QPFA 4QRSB 5IQNA 1E7UA 4DOHB 4PWIA 4Q9QL 4CVWA 3VGEA 3LNDA 4FKHA 5HHXL 1CZ8L 5E99H 4P2OC 3MCYA 4EUPH 4K9EC 3QRFM 3VFSA 4Y4FA 4N2BA 4AT6B 1IEBB 1EDHA 3RFZA 3VI3A 1M3JA 1CTOA 2X4TB 2W9DH 1AQ8A 2AK4E 2PR9A 4XI5C 2QBWA 5EU5A 2VR7A 3L2NA 5T1DH 3WXWL 4DP8X 1RUQH 2QV4A 2WHVA 4LKCA 1T83A 1E6JL 5F9WB 1B0GA 2X9ZA 5CEYA 4HWNA 2J1XA 1OP9A 4P2YA 5DFWH 2E7CA 5IROC 1MREL 1SBSH 1RD6A 1HZLA 4JPSA 4JFDA 3TBSB 3BEWB 4XTRC 4ENZA 4CJ1A 3CLWA 3OKYA 1Q9WB 1JMXA 2WZAA 5CGBA 1GGBH 1MH5B 3EUDA 5EZLA 4PLKC 1JTOA 2YKLH 2CO4A 3B6SB 3GMPB 3LPOA 3VI4F 3P0YL 4UINH 2QPEB 5GS0D 3ARDA 4F9PC 2HVJA 3CWGA 5ALBH 2K0RA 1G4MA 1IC4H 3TO4A 1W0YT 1Y18A 1JVLA 3BAXA 3SDYL 4MRBA 4P2QB 5DJ2A 5D1ZA 5KW9H 1BM3H 3O2DH 4DP5X 4YIQA 1DN0B 3OKMB 3TYGH 2LVEA 2PTUA 4XXCA 5G5DA 2R4RH 3IJYB 4F7MB 4M6OL 2GSGB 2WYZA 1GGCH 3WNKA 1IGFH 5DQ9A 3H4FA 4XCFH 4CVZA 3AJ7A 3GHEL 5I6KA 3MRKB 4L4TE 3T5WA 1BD2B 1DVFC 4L05A 1KCRH 3WDHA 2UYLA 3GXMA 2F8IA 4W9LC 3MSPA 1M3IA 3RWCA 2O5ZL 2F68X 2QQNL 2X7LB 4K7PX 1EXGA 2PCYA 4PRHB 3UYOD 1Q0XL 4X8XA 5DURD 4LKXA 3RGVD 3H4HA 1JZ8A 4OD3H 1BIHA 3L4TA 5K1JA 2X40A 2W9EH 5FFLA 2ROYA 2E86A 2Z31B 4OGYL 4NKOB 2X3AA 1LEKA 5LGKA 2ZT9C 2ZOTA 1CK0L 1HZHL 1P7KA 2IDCA 1U8KA 3T3PB 35C8L 4XXWA 1QPXA 1PTZA 1O7DC 5JHDE 2G4EA 2OJEA 2GEQA 2H2PD 3GEWB 4BZ2A 5BXFB 3U2IA 3ZMNA 2X5PA 3P4MA 1RPUA 4LDEB 2VDLH 4A66A 1S78D 2W8CA 2PCPA 3MROB 3QT2A 5BJTA 2M1KA 5I8CB 2EIKB 5JQIB 2H26B 2E7LC 3BISA 2ZKXA 1YYML 1YNKH 4GAYB 1QSEB 4YDNA 1OSEA 2GHZA 4PRIE 4ODVL 1WF5A 3D3VA 1BZQK 1ETZA 2FT6A 3MYZA 4L9LC 3POHA 5EOTA 5EN2B 2R4SH 1T20A 3D2UD 4CU6A 2A9NL 1H5BB 1ZXKA 4KZEL 2OSLB 3HC3L 1XZ0A 3N42F 1A66A 1L7TL 2IWKA 3PABB 4W70A 2B1HH 2AJXH 2FB4H 3L48A 4DAGH 1U8CA 4PCKA 2ARJB 2CIKA 1T0MB 3L1FA 4Y5YA 4GUQA 3EOAA 3HUJF 1S9WB 2GQHA 4BUHA 5KVGH 3QORA 4F7CB 3LDBC 2B59A 4HWEL 5AW2B 5FYLH 3UJJH 3K71A 4HWBL 3J8F7 3RDTA 4X4ME 5DF0A 1YO4A 3OL2A 5LBVA 3WIFA 4OLXH 3PWPE 2DD8L 4HS3A 1TO4A 4J3UA 1QZ1A 1V7MH 3CHOA 4EIZC 4X6DE 4HEPG 5JYMA 2CRYA 2QTVA 3VFVA 1YNTF 3BZDA 3UZVB 2XX0A 4DKDC 3CBRA 1Z9NA 2JKIS 4N24A 2MOQA 4D0DB 5K59E 1E5ZA 1W8OA 2A4EA 2A9AA 1KJ2H 1P1ZA 2X4NB 3AT8A 2HA1A 3FN3A 1PKOA 3EZJB 4GQPH 5JYLA 3I02A 1C1EL 4PJ8D 1QRNA 4XN9A 3LXAA 4G6JH 2NY7L 5EFIB 2IAMC 5HDQH 4OCYH 1S9YB 2ZXDA 3BT2H 5D1XB 2IJ0C 2M26A 3MDJA 4WK2B 2AEIT 2ZKMX 2F8OA 4GBXA 5CWSA 4XNAA 1NMCC 1N5AB 4X8GA 5EUKB 1F00I 3V6FB 4D8PA 5CIPH 5J3HD 1YNTA 1BFSA 4KK6D 3RE0A 3P9MA 5BNXD 3MRJB 2N7BA 2IALA 1B9ZA 3QC6X 1DBAH 1KTKE 3U46A 3U6XA 4B60A 2CG9X 5E8NA 1E9QB 2C1OA 3M8OL 2OJZH 1E2WA 3CFUA 4TM9A 1R5WA 1T04B 1TZAA 4P46B 4LLMB 4LDLB 4DIXA 1JPTL 1F2QA 3DWTA 3NOIA 5F7DB 3UC0H 2WKOF 3W0WD 4NC2B 1HQRA 2J8UB 3MZTA 2PWFA 4HIIA 2YZ8A 5EZOL 3RNKA 3V0DA 3FN0H 1ZHBA 4KJQC 2ZXQA 1J05B 4U1JB 1DFBL 1LP9E 1KENL 3AY4A 1WA0X 4Z3FA 3VSVA 1QHOA 1YEIL 1GGIL 1YECH 2J4WH 2QKIA 2XQBH 2Z92B 1G9ML 3IGFA 3NJFA 4OZHF 1TITA 4X0KA 3DJSA 1ZLDA 4MQ7A 5K39A 4YBHA 1A6VL 5MI0C 5KVDE 4Q9RH 4HKXB 3ARSA 4B97A 4HGKC 2WXLA 3C8HA 3MNWB 2E6QA 2VW4A 1NFDB 3BWUC 1DANU 1SBBA 1PAMA 3UTPD 1QSFE 1M7DB 1F02I 2C9XA 3FMGH 4AIZB 5E6UB 1UD6A 4PI2A 1OLLA 3MBEB 3Q1SH 3U7YL 2Z7UA 1BZ7A 5JPMB 5TPWH 5CKAA 4L3EE 4C83A 3P30H 4BQCA 2VDNH 2FGZA 1EGJL 1A7RH 3HZYA 5J56B 1TZIA 2LTQC 5CZKA 1VZHA 5EZPA 4JO3H 5CZVL 2Q76A 4XN5A 1EVUA 4PHZA 1G7MB 3LQAH 1Z32X 4QRRD 4H8PA 1BLNB 5FHBL 5BZWB 3TH4T 3K72B 4OI9A 4HW6A 4R7NB 4RMTA 5E6SB 1U91A 2AFNA 4KNUA 4KXZH 4U3SA 3VA6A 4HS8H 2A0LD 4E0RA 2JVUA 2IANE 2FJHB 5FF6A 3TWYA 3WJJA 3ZDYE 2E7DA 4LP4A 2VXQL 4HBCL 3DMMA 4E9TA 3D69B 1UXWA 1R24B 1RY7B 4H25A 4E41D 4X5WA 4ZUVA 4MYPA 2VH5H 1EFQA 4ZRGA 1OAYH 4MASA 2EDOA 4N22A 1T89C 1SXCA 2DQCH 1PD0A 3REWB 1Z9MA 1YVLA 4DQOH 3K2UH 1XT5A 3BAEL 3Q48A 4UQ3A 1I1AA 4YDIH 4YHOL 4RNRB 4KKBD 2IC2A 3L3JA 5LQBL 1KCVL 5F89B 1NMAH 3DIFB 4GI9A 4GRWB 5F0PB 1Q72H 2BSRB 4P4KD 3KS0H 4GRLD 2AXJA 1W80A 3DRTA 4NQEA 5GGUB 2RJMA 3LEVH 1FH5L 5GGTH 4FQXC 4TLSA 3CVDA 3HA0A 1U93B 3F7VB 2VC2H 4X50A 4WHCA 1XGQB 4LLQA 4OF5A 2G2RB 1UXLA 2D31A 3P2DA 4HS6B 2NXZB 2XZQH 3DX7A 4XP6H 3X3FL 3VA2C 1UD5A 3C5ZA 3VH8B 2XT1B 4AQOA 2BO0A 4K71C 2DQDH 2JWYA 3IDJB 3ZYOA 3P0VL 1NUGA 3P9LA 5CBAB 3P11H 1P5VA 3MJWA 2QADD 3UZEC 4PJ6A 5E1HB 5F1OB 4AV4A 3MJ7A 3T1WA 4JNXA 5B1JC 3MREB 3HHSB 2BNRA 2ZPKL 2N0MA 3DPBB 1GYAA 3LSOA 2X0VA 3ZN6A 3SB3A 4WWKC 5K9JH 1XGTA 4UMGA 2OL3A 3EGSB 3MRDB 2IFGA 5BMFH 1XH2A 3X1FA 1DSWA 1NWPA 4MS8C 4N0FA 2DIJA 2NPLX 5KSUB 2ZYSA 4OCWL 2HRPH 2K78A 4QIRA 4WUKL 5L2KA 4Z5RB 1I1CA 1S7SB 1IM9D 3UYRH 3W9EA 4CA4A 1YYLL 4G7VL 3CIQA 1NCTA 5DVMA 4E42B 3GO1H 4MD4A 3QUXB 4MAZA 3LB6D 4N5UA 5F96L 4FMFA 3KPSE 5BZDB 4KRPB 3IDGA 1A6PA 1FVDA 2WUCH 2OJ1A 1QBBA 1CXIA 2OSXA 3CFCH 3EUUA 5FKPB 3IRPX 5HJDA 3KXFE 2CM5A 5D2NC 2GY7B 3VXTA 1JJUA 1KZYA 4MJ5A 1RL1A 5EU6E 1FL5B 2YAPA 1IBBA 3FH5A 4E36A 2HTKC 4WUUD 5E2WH 1KSRA 4WRLA 4ZFOA 2Y7NA 2YWYA 3U4BL 3THMH 4IRZA 3UERA 4AM0B 4DGIL 3QYCA 2JKWA 2B16A 3ARTA 4YR6A 3IFLH 2ZCLH 5JUEL 3VFPB 3KJ4C 3GINA 4G6FB 4G6ML 4PWEA 5GSRB 4GAGL 1ZLVH 4I2XB 1BGXL 3OC5A 5IMLA 4KAQH 1ZS8A 2NR6D 3DV6B 4WEUD 3PWUA 4Y5XA 1XH0A 3FU6A 1R3IH 2F1BA 4M48L 4W9GC 4R7DB 4NP4H 1SXBA 2C9QA 2DEXX 4NXKA 1V5JA 5C6WH 5EDSA 2DQUH 1NLDL 3L3KA 3DA0A 5FECA 4YUEL 1L7IH 2BHFA 5T3XH 2X3BA 3PV7A 1IZKA 3GRBA 4LLWA 2E27L 3DX2A 3AT0A 2WO3B 3NCYP 5JQHC 5LDUA 3N85H 1NDMB 4IGBB 4OZIF 5KSBA 1B0RB 1DEEB 2XBDA 4RGOH 1QWUA 2HT4D 3DNKA 3MHZA 3L7EB 3PIQB 1RZKH 4J3OG 1QZNA 3CXDL 1OW0C 1SEBA 3QJFB 2WIIB 3OKOB 5SWZD 5FB8A 1TJHH 2CHDA 3MVSA 3EH5B 1JHKH 4NAMA 5IW6A 1UEYA 3TPKA 4NQCD 2CDEB 2DKUA 1GZQB 1K2DB 2VQ1B 1S7UB 3RIKA 4BK4A 4LOVA 4JQXA 3BIKB 4WHTA 3MODH 2VRAA 2ZE0A 4FXGC 4XP9H 5E9DA 4EI5B 1WFMA 4ADGA 2X10A 5F7WC 3RUGB 1DVZA 2J2ZA 1WIOA 1VF5C 4XPAL 2QVFB 2MPAH 5I73C 4GH7B 5JPNA 4EDWH 4HFWA 4ZMXA 3FU9A 1F8TH 4EN3C 4P2CG 3P02A 4HIHB 3UO1L 1SPDA 4GP8B 2R29H 4MJIE 5EB9A 4YHPB 4K7PL 3JWDL 4M9PA 4PP2A 5JDSB 5I75B 2DIAA 4Z7QB 1JWSB 4W4OA 4MFHA 2F74B 4TQEL 2XN9D 4EI6B 5IKCB 1C8QA 4ONHA 3GRWA 3D4YA 3U2SA 4JLRA 3AMLA 4NO3B 3VXQA 5FOBA 3SBWC 4ADJA 4FCHA 4JN1L 1DDTA 4XPFH 1GW6A 2BLFA 4YLBA 5FW7A 1JV2B 4M3HA 4TVPL 4P9HC 2OMYB 2UY6A 2FO8A 2YD6A 5AW7B 3G5XB 3PWLA 4ZNEA 1L5GA 4XX1G 3BZEA 5C09E 1J1OH 1JF1A 3QZPA 4QTHB 4OB5L 5IVZA 3KL3A 2YPLB 1L9RA 2Y06H 5EC1B 1QASA 2G60H 4H5SA 3CN1A 4MDIB 1TJGL 1FZJB 2Q86B 1HQ4B 4CVUA 3KLHD 1ZA3B 5IESL 5DEFB 4PR5A 3B7RL 5DRZA 1W16A 4NN6C 1VB9A 1SYSA 4M5TA 1TSRA 3IB4A 4A7TA 1RURH 4WZ9A 4KK5D 1FNLA 2P8LB 2Z8SA 3HRPA 3VWKB 4PIBA 4HXAH 4LNRA 2R0ZL 2KLTA 2ENSA 3BFOA 4IRJB 5I26A 4HUWA 3CN0A 4RAUA 4M00A 4MNQE 3WN6A 5F7UA 2FUTA 3ZL2A 3GJEB 3NH7H 2HRLA 5HVFB 2YEVB 5J0BA 5FHAH 3WGVB 4MD5B 1EH9A 1NCUA 1I3VA 2C8NA 3LIZH 4XH2A 2EYRA 2UWEB 4OZ4A 4WNQB 5F7EH 1NIFA 5IHZA 1DO5A 1QAWA 4UT9A 1DUZA 1ORSA 5BUAA 5F97E 4CAGA 2FIRT 4L23A 3TPUB 3GSVA 3RX7A 2DQHL 1MJJB 5I17A 4HGWB 4YX2L 1KN2L 3JWNE 3PGFL 4WCYH 4N0YL 3T77B 4IIQC 3ZW3A 1RK1B 4L4TA 2YPVH 2IQAA 2R59A 4UAHA 4U6YA 4NQQA 4U1IB 4B9CA 3K81A 3OX8B 1FE8H 4PYHA 1EEZA 4JEGB 2Y1YA 1F6AA 4HJIA 1HSBB 4QXGH 2VLRD 3EADA 4OV5A 1EHXA 1GR7A 1E5CA 4HUUB 3SPJA 3EGDA 4U1MA 4JO1L 3V6OC 2HLAB 1EWHA 4GXUN 4YK4C 1KBGH 3VJ6A 4F8NA 2JJWA 2WXIA 5T1MA 4JM2D 5C0EB 1EBPA 3B8SA 1ODUA 2GFBB 3AXLB 3VSQA 5KYNA 4LEEA 5F9DC 1LQBC 3F7LA 1HNYA 1OTUC 1ZPUA 3O8XB 1E8ZA 4E9QA 5JHDA 5D71H 2ITCB 4RFEA 1SHSA 5FIEA 3S5ZA 4DN3L 1BXAA 2CBPA 1NPNA 2WLKA 4X5XA 1Q0YL 1KEGL 2F53D 5DWUH 5L0QC 1Z2KA 2HCZX 1Z0MA 3NJXA 5LBSH 3U0TB 3WFCH 4AYBA 3TIEA 1UWEL 3AU0A 1PCXA 2LR4A 2LE9A 3ZYIA 3OKDB 2WZPD 1JWMB 4U33A 3ARFB 1FG2B 4JFPA 1FFPA 3DO3A 4D0BA 2ZUSA 4X6DF 1N68A 4AYMC 2C3GA 5ERWA 4R3SA 5ECJE 5KVMC 3LYRA 4FXKC 4Y4FB 1CDBA 3WKML 2QQKH 3B9DA 5K59F 3RFZB 2R23A 3HVDA 4AUYA 3HMXA 2BS71 1ZS2A 1A0QH 3L3IB 4N85A 4WENB 3L1OL 5F9OH 1SDDA 1KB5L 3SQBA 3VXNA 2WCGA 4ZUTB 2C9VA 3F83A 4JANA 4KWUA 1BXXA 4FQCH 1BAWA 2VIRB 4X6CF 1B0GB 1KIQA 3QDGE 2WXFA 4JN2A 2YQGA 1G0XA 5F3BB 2ESVA 1UVQA 2ED6A 2AF2A 2NW3B 4G71B 2XQ0A 3RX5A 1JRHH 1R17A 1WDAA 2EKSB 2TSBA 4A2LA 1LK2A 1VEOA 2P5EE 4K07A 2YD9A 3FRUA 3ARDB 2B15A 1SY6A 2B8OT 3GB7B 2LV4A 3HNSL 3L3GA 3S8FB 5HBBA 3UEQA 1Y18B 5AOIA 3TJPA 1CGSH 2WBJD 4UTBL 4MAYD 3S7GA 1LP9F 1QA9A 1T7VA 2WWMD 3IAPA 4RETB 5ESVA 4TLUA 1FDLL 5DD5H 1S4IA 1U3HB 5I1GL 2YC1A 2PWDA 3FT9A 1SLWA 4K4KA 4PY7A 4QOKB 4GQRA 3SPVB 2ZONA 1KIUA 5MP6H 5EU3B 2EH8H 4R96A 2Z8WC 2NOYA 5TF1H 1G0DA 1E5UI 4H20L 4HPOH 1ECYA 4WEBH 3T0DA 4S2SA 2A4CA 1X4YA 3VI4B 3SY6A 3UAJD 2OMXA 2Z35A 3IMBA 3FPXA 1LO4L 1NMBH 2WXKA 1F90H 1WCBB 2VLJE 4I0PD 1F1GA 1N2RB 5IG7A 4MA1C 1DCLA 3HE7D 4E2OA 1MHPH 3UTZA 3ARVA 1UD4A 4K5OA 1CICA 2IPTL 5D7KD 3SHSA 2IGFL 3QEGH 5CCGE 1U8KB 2E8YA 2YD0A 4B9GA 1OVZA 1IT9L 1J0YA 2NLJB 4BWUA 2ICEC 3EDDA 1CLZL 4K9EH 4PREA 2YXWA 3IJ7A 2C7UB 4NM4H 4TXVB 1QSFA 5E6ID 4I0CC 3WN5C 1D5RA 2DIBA 2OZNA 3QJHA 4GKSA 4PB0L 4WSKA 5FYJL 3ZDYF 4AVHA 5BJTB 4GLRI 3V4UL 1A14L 3VD4A 4WSJA 4UZSA 2D7PA 2KBGA 4PWKA 4H2AA 3CSYB 5GS0C 4NPJA 2Q1EA 2JIXA 3HR5A 3WSQH 3LS4H 4QLWA 3OPZH 5EOTB 2PCXA 4KTEH 3MLTB 5F1IB 2F54B 1WWWX 5IHLB 1M7IB 3WU1A 4MB4A 2G75A 4ZTOL 2H0JA 3N3EA 4ZAKA 1OWRM 2AABL 1NC4A 4HXBL 3T3MF 3RIFK 2EQDA 4N1HB 1CDIA 3BUQA 1CXEA 4QRQA 3VGHA 3FZUD 4ZQKA 1HI6B 4GSQA 3SSGA 3BMWA 4Q9QH 3QORB 5FO7A 4M93C 3BH9B 5HYSG 4OT1L 3M1BA 4JFDD 3IMTA 4BZ1L 3O4LE 4HDIA 3STBA 1G9NC 2XWJB 5ANHA 4HS3B 1FFTB 3TCLA 4AYID 1SXNA 1BZEA 4DN4L 4U0RB 3RP1A 1R34A 2FVNA 4HT1L 3WEBA 5H37G 1FZOA 4EZMA 3VFVB 4HUVB 1CXFA 1Q94B 5DZLA 2RR3A 4KXBA 4M8RA 1FH2A 3KLLA 2YAQA 2OYPA 3TO4D 2WD0A 3WXWH 4BQ6A 1AMXA 2LOEA 2FSDA 1P1ZB 2VL5A 1E6JH 4WU5A 5F9JA 5C07E 3NABL 2ENJA 3CFMA 4FFZL 5D1ZD 3TN0D 3HUJB 3QPKA 4OUUB 5FK9A 2DV6A 1WS7A 5DRWB 2H2PC 2R9HD 1MREH 3SQRA 4Y1AE 2X4OA 3FQNB 1FZKB 4LVEA 3BRFA 1TTAA 1S78C 1V54B 4IQHA 5IFAL 3H9SE 3BPCB 4LCWE 2H3NA 3U0WL 3ZO0A 1YMHA 1BFOA 2EDQA 2XI9A 5CWSB 3PQYB 2VDOB 3LAFA 2GCYA 5J89A 1YNTB 1HXYA 3P0YH 2XBZA 2QVMA 4ILDA 4A7VA 4XNZC 5DJCB 1TFPA 1E30A 2O5XH 4JFSA 3PWVB 3U46B 5JIQA 4WU7A 4PG2A 3SDYH 5EO0A 1HJCA 1BPVA 1HN1A 3GQFA 4NUJB 2ERJC 1D5XB 4M6OH 1NBZA 1M1SA 4PJAA 1TVBA 4XAWL 2Q10A 1S7XA 4PJDF 3D25A 3H7LA 3GHEH 3MGTB 4HIIB 1KFGA 2O6EA 5F0MB 5DI8B 3NCEB 2MTAA 2QJDA 4PJCA 4KNSA 4RISL 4XP4L 4V11A 5BV7B 2O5ZH 2R1WA 1PYWB 4XCNB 1Q0XH 2D3NA 3NUKA 3EF7A 3KPSA 3NTCL 3WS6A 5C9JB 2DYPB 2O61B 1AXTL 3DXAB 5AW1B 3N04A 3RTQB 1KGCD 4NIKB 1JTTA 3D3VD 4WK4B 4PY8J 3COOA 3VYOA 4J1UB 4PD4J 4OGYH 4Z3TA 1RUKH 1WE5A 5EU6A 3TIDA 1BZ7B 1P4BL 1HZHH 2OKMA 4PJ8C 3CH1B 1MHEB 4G83A 4UMSA 4ZUSB 4S1SL 4Q6KA 2ZCHH 5HHOA 4R0LB 4WNJA 1D5MB 3GJFA 5JLZA 4WTWA 4D2NA 2Q76B 4OZHB 1XR9A 5KUKA 5EOCL 3Q8AA 1R3KA 2DJMA 4MJHA 6PCYA 1OO2A 1YYMH 3BUBA 3X11A 1RZ8B 4PRDA 4NEHB 3VH8G 3RDTD 3N41F 4ODVH 1HEHC 5J3HC 4KK6C 4I9WD 3ZKXC 2X70A 1A5FH 4PJ5E 5D7SL 1BQHB 1JIBA 2V2XB 4XO9A 3NCJL 3TJHD 4A7GA 4LXFA 1IBZA 5SWSB 5K1NA 3KDPB 2A9NH 3NCYS 1UXWB 3HC3H 4MCZB 4ZUVB 1L7TH 1NCNA 2A6JB 4AQZA 2P49B 4J6RL 4XVTL 4IBVA 3ULVL 1EXHA 1MFMA 1T1ZA 3KGUA 4OY9A 4NBYB 3T0WA 2P8PA 2QT6A 4ZBJA 3UBXA 3NBNA 4O4YL 3AS0A 1QRND 3BVWA 1Q9KA 4FAAB 2XTSA 4X9BA 5DS8A 4HWEH 3PL6B 4HWBH 2ZX6A 1HILA 1AI1L 2FZ3A 1FSKB 1EO7A 1GOGA 3M88A 1TYRA 2HTLD 1OLZA 1G7QA 3K91A 4GBXD 4POYA 3QWQB 1T4KA 4LLYB 4N90E 4OQTH 3P3TA 1KDIA 1S6NA 4C8XA 3FQRB 1X9RA 4N8VB 1G43A 4HKJA 2AQRA 2EDLA 3DTDA 4JE0A 2CKNA 3RVTD 2VMEA 4X9YA 2YRZA 5C3LD 2DMHA 1FYHB 3DTXA 1XBRA 2D3JA 2IVFC 1C12A 5EV7A 1X5JA 1P5VB 1IAII 2NY7H 2CNZA 2A9CA 2X2UA 1K3ZA 2EH7H 4P57A 3MJ7B 4MJIA 2Y23A 3GWJA 4OGQC 1M71A 3ZZQA 2VMCA 2RTTA 3GSRA 2VDMB 3ECVA 4DGVH 2A0LC 4IJ3C 7PCYA 3GSNA 4KY1L 5AW8B 1F41A 1QEWA 2K6ZA 1IJNA 2BHZA 5IQOA 4YFEA 3STLA 1NEZB 3QS3A 4N8CH 3VD5A 5CS7A 3FB6A 4DO6A 3GKWL 3HE6A 2E9IA 3M8OH 5A2LH 4AZ8B 1NEUA 1NPJA 2RACA 4HCIA 3FU0A 1K8IA 3G5WA 3S97C 2H6PB 2WQSA 1JPTH 1OAQL 4AJWA 2WMPA 2ZF8A 4K7FA 4M7JL 1DVYA 4KKBC 2F7RA 5IQ9A 2WNGA 3PWJB 2QZQA 2R69L 3BQUA 5C09A 1DFBH 1KENH 2XZZA 4P4KC 4YE0A 2VXSL 2FUQA 1YEIH 4GRLC 1GGIH 3TEXA 5AFAA 1G9MH 1JDDA 3EO0B 3TTSA 5F1KC 2WZ6A 3IS1X 5AVXB 3U83A 1A6VH 3SIKA 4PYGA 1A7OL 3MLWL 4HK3N 5DJDB 4UM9D 4ZS7L 5K9OA 1T7XA 2X41A 2WN3A 3L5XL 4TOYL 1HAUA 2UZXA 3LY6A 4YR6B 1ICTA 3UYPB 2MQCA 2JJTC 2PPDA 4FTVE 3DMMD 3SYAA 3E6FB 3WHE0 1PF3A 2CO6B 4MNQA 3C8DA 4QF1A 1JK8B 4QT5B 1MWOA 2DQ6A 5T1JA 3T8MA 3W39A 5CNHA 1EGJH 2QADC 3PWUB 4K15A 5CZVH 2YWZA 4PRPE 3MLZL 4PBVC 5M94B 5C0BD 5DK3A 1I1AD 2DWEA 4ESKA 3HG1B 5FHBH 3BJLA 2KZ1B 3GSWA 1U8MB 3L3KB 4BXSV 4LGSB 2YGOA 1C5CL 1WG3A 1TTRA 2C9AA 2J55A 1KPVA 1P7HL 1E5YA 3C6LB 4NQED 4PUBL 5E2VL 1YMME 1SLXA 1IKNA 3HC0A 4KO6A 3DDFA 2WGXA 4ZPTA 2VXQH 1E8XA 4HBCH 2EIDA 2LU5A 3FTWA 1GYCA 1TKWB 1E4KC 1M6OA 4Q7DA 5DQJB 3G6DL 4KKRA 3MA9H 1MCIA 3LB6C 1YZZA 5CUSL 3C5ZD 3IETA 4AX3A 4XNQB 1CR9H 2WQWA 3BAEH 1E9OB 2BVQA 4Y2DA 3RWIB 4YHOH 3WMQA 1SXSA 2IV9A 2MWCA 4WI3A 2W5PA 4LAJH 5LQBH 3MRNA 3BIAX 4L18A 2OXHB 2VLLA 2DTSA 1ZTMA 2F18A 4NZRL 5D93C 2ITDA 2NUPB 3L6FB 4OZIB 2BNRD 1FH5H 3FSOA 3OWEA 4GKZA 2A83B 4XC3H 5E4AA 2Q5BA 3SBQA 2H0EA 3ZHDA 3P3UA 4AL8L 3X3FH 5I1IL 4Q6IA 5D1QB 1UCTA 1ZVSB 4M8QB 3VDAA 4F7KA 4AH2A 5L2KD 3ZE0E 4LBEA 2XYCA 4ZDHA 5JW4M 3MX0A 3P0VH 4JG1H 2NR6C 3WUZA 4OLYL 5E4IA 2ALWA 5GGVY 3U4AA 1E2ZA 1BVZA 1J11A 2J3SA 1UACL 3KMDA 1OQXA 4XB8A 3WYRA 2E4TA 4AGOA 2ZPKH 3KPRD 1SN5A 4LLAA 4NZUH 5FGCB 5TH2B 4BGLA 1V55B 3IF1B 4RIRA 5EU7E 1I85C 3IFOA 3HPLA 4LNVA 3FOLB 2GSIA 3QNYA 4OQ1A 3PWLB 1QPPA 2X2JA 3DOHA 3D4ZA 4N8PA 4HFUL 1P69B 2CXKA 2HT4C 4OCWH 4WUKH 3G08B 3SY0A 4BSWA 5E1IA 3QWNA 2Y25A 1INEL 4J3XA 2AK4B 1NCBL 1YYLH 2MJWA 3ARWA 4G7VH 4LSRL 1Q8MA 1J5IA 1JGVL 1I53A 3L1GA 4G80B 4HIEA 2KDYA 2WWKO 2XACC 4L0PB 3U6XS 4PJXE 3DSFL 1BAGA 5D7IE 1MPAL 1HDMB 4L9DA 1TFHA 5GRYA 3EBAA 1YQVL 4WTXA 2CGZA 3OJVC 3QIWA 3F58L 2OYKA 2A38A 3NQIA 3WMSA 3SDDB 5ACZB 5ACMA 4I4WB 4LNRB 1QX1A 1MAML 4G43A 3WD5L 2HX7A 3I6KA 1KCKA 3DLQR 4RAUB 4F33A 5IF0A 3BP5A 2OCCB 1KPRB 3HNTH 3ME0B 2Q3XA 5EG6C 2AQTA 1PKQE 1IGJB 4V1DD 4ETYA 3U4BH 1I8KA 4DGIH 5IV2A 1BVKB 1FFNA 1KTDA 2HUHA 2N7SA 3S3JA 4BDVA 2DLFL 4H8HA 4A04A 3QRBA 5JUEH 3SZKC 2AJZB 2CM6A 1MY7A 2EYRB 4OZ4B 3GGWB 3CZFB 4G6MH 4GAGH 2Z1PA 1ORSB 1NM9A 3BPOC 2ORBL 1BGXH 4QHLB 3VRJB 3ZMRA 5C7XL 3DX4A 1PGRB 5FM5M 2EDKA 4FL4C 3TGXA 6PAZA 3W9DB 4G9FE 4M48H 3SJVE 2R0KL 2IAAC 5I74C 4G8EB 4WEMB 2IQAB 4D7BA 1MSPA 2DJSA 2XUWA 1NLDH 3KLSA 4PD4K 12E8L 3K5RA 2VTFA 3O41A 4YUEH 1M53A 4HJGB 4JMXA 5F3HB 3MRGA 1P7QA 5E9DD 2E27H 1AE6H 3AWGA 4CUCA 3IN0A 3L4YA 1HT6A 1YG9A 3C09B 1YQ2A 3GTVA 1PW3A 3VFUB 5J1AA 3CXDH 3EFFA 2GT9A 3FU3A 3MA7A 1NLBL 5T1MB 2V5MA 4HC1A 5I8EA 2F58L 4ORGA 3ZU8A 1HHJB 3KLHC 1ACZA 2IBZX 7CGTA 4MXQD 5BOPA 1M7UA 4IKIA 1P4LA 5KJRL 3NFSH 1FNHA 4KK5C 4AYSA 2RIKA 3BPNB 3RNQA 4LP5A 3T0EA 5D6CA 5KWYC 4XPAH 4IU2A 4PRIB 3CE1A 4HSAC 3WJMB 2WXHA 2MNWA 5HGGS 4L4VE 4PS3A 3UO1H 5C0GB 2VAAB 4D0BB 2AJUL 1UM5L 4ADIA 2QFPA 2E46A 3JWDH 4WNSA 3WO4B 3KGRA 5I0DA 1E28B 1O7DE 5ERWB 5EO1B 1VACB 4N86A 2XG5A 1N8ZA 2CRIA 2VLME 3FTZA 4TQEH 2FWLB 4U1LB 3U30C 3QC5X 1Q38A 1F3DH 5F71A 3FOMA 4D9LH 5FYKH 2DQIL 4G5AA 1AC6A 3LX9A 1YJDC 4JN1H 5AW6B 5ILTL 4QXVA 4BH8A 1PY4A 5GISL 1SDDB 4YN3A 3ELAT 4MMXA 1UWYA 4TVPH 2MQ0A 1NIAA 4Y8AA 3MNVA 2BX5A 4JANB 3PWPB 1XB8A 4WFFD 2I7SA 4P4RB 4PJ9B 3QI9B 4X6DB 4WV1C 3WELA 3ZQWA 4LL4A 5AYQA 5D7LD 2AEWA 4JM2C 1AZBA 4OB5H 4WFGD 1JRHI 3NMEA 2J44A 1L6PA 2Z8VC 1U8HA 2WLIA 4Z7AA 1TJGH 1B4JL 5E1GA 3QZBA 1NBCA 3T04D 4IU3A 1U2CA 5IESH 1XO8A 2R83A 2MPVA 4RZCB 3BHBA 3IGAB 1RIVL 1BZDA 1VFBB 4G8AC 3NN8A 4OF7A 4Y1AA 2FWOB 2NY3B 3L3GB 5C3IA 4L4TD 3H9SA 4N2IA 3WTVA 4AK1A 2R0ZH 3BJ91 1E5AA 2L7EA 4RAHA 3WAKA 4CW1A 3WUWA 1OIOA 2Y1AA 4X6CB 5CD3A 5GZOA 1JZEA 1S7TA 2EXTA 3BP6B 5F7KC 3RB5A 3CN2A 5CU5A 1TETL 4YDVA 4NX0A 2YC1B 3GSXA 2JFCA 4K5NA 4NN5B 2Y5EA 2W07A 1OALA 4MJ4A 3QB7C 5B1KA 2XBTA 4X5PA 2YGVA 6CGTA 3OAUL 4UDTA 1I1FB 4UUJA 4Y7MA 4OBRA 2AITA 3F6JA 4M02A 3AGWA 4ZNCD 2HH0L 3ZUCA 1DQLL 1LO3L 1SJHA 1CURA 2DQHH 5LAPA 5CLYA 2FO4B 1N18A 4YX2H 1KN2H 3PGFH 3BFQG 2YAFA 3G04A 5JHDD 4R97B 4WWNA 5BW7A 1LP9B 2Z6FA 4NNPL 4CBPA 4RMUA 1I9RL 1OB1B 2E76C 1AHWB 2Y6SD 5CJXA 3TX4A 2G9KA 3N1GC 4ZZKA 3OJDA 3F5WA 3J7HA 3OF6D 5HYJA 4QRPE 2ZYIA 3RWHA 4CSSA 4DVRL 3L08A 3R4DA 4B27A 1MCWM 2EVFA 4H2CA 4BFIA 2ZX5A 1KB3A 2AGJL 2JI1A 2IH3B 2XVLA 1N26A 4U4IA 4HKZB 5I1DA 4MTMA 4XPBL 1LGVA 4GY4A 3JV0A 4GKSB 3GMQB 2VSDA 3UEZA 2P7TA 5EIVA 3L9EA 3U9WA 3EBGA 4QRTB 4L3EB 1K8DA 5F2FA 2Q87A 2ADGA 1ZWIA 4N2LA 2FEEL 2EIJB 2GTWA 2JIXB 1KB9K 1MRFH 2YLKA 5DDHB 3QYNA 4EN2A 1Q0YH 3VCLB 1K9TA 1PCSA 3KBPA 4DQAA 1ODAA 1KEGH 5IR1B 2WBJC 4MAYC 2J1KA 2WWMC 4P3DB 1UWEH 1YA5A 3CHSA 3WBDA 1F97A 2FO1A 3F00A 2J20A 2YSSB 4L5FE 3P4NA 4Z3IA 4P07A 4ZO7A 2IANB 1S7VB 4XR8C 4PJ5A 4HPYL 3KJ6L 3EKCA 3MOQA 3QRLA 3ZDYB 1VJSA 4ZOEA 4KMTL 2ESVD 3FF7A 1A6ZA 1KIPB 4JRWA 5I8KL 3M1BB 1XB3A 4CKVX 3UAJC 4D8OA 2EEBA 4J3OH 3WTXA 3TCLB 3WKMH 1A47A 4JVWA 1JZ3A 2AXFA 2CUMA 2X4UA 2R1YA 3TV3L 1WO2A 3AQZA 4I0PC 2J25A 3HPJA 3HE7C 3IXTB 5D70L 1F11A 3L1OH 4TLTA 3RY6A 1KB5H 2O1AA 3T3MB 3AGVA 5JTWA 4FTDA 5DRXA 2VZUA 4JGUA 3FB5B 3BGMA 4ODXB 3TESA 3SD5A 1NICA 2Z31D 4F9LC 3M1OA 2GKIA 2Y5QA 1QLFB 3JT0A 2BVPB 5FK9B 5J9PB 1BWWA 2BC4A 4GW4A 4M3KB 5IMOA 4A2DA 1CDGA 5JORB 2A9BA 2P4AB 2ZKYA 3KLAB 5CSBA 5E6IC 3T2NL 3QULB 1SYVB 1MHHA 4LHJB 1BX2B 3SDAA 1YMHB 5CP3H 4A2FA 2HJFB 5KN5B 1MCDA 4Z78B 2JMRA 3OV6A 5DD6A 3RL1B 2OP4L 5I2IA 4YDLB 1NBYA 3LN5B 3Q3GB 5CP7B 1TU2B 4PRNA 3ZIMA 1CE6B 3HZVB 5LB1A 4AXWB 3IXAB 4GFTB 5EEYA 4DKFL 4HH9B 1GC1C 3QG6A 1N67A 3NJLA 4G8GE 3RZCB 5EO0B 4UTBH 1IRAY 2FJGA 1QI4A 1TCMA 4PGEB 3R18A 5KBKA 1NBZB 5DD1H 4E9XA 5I1GH 1TVBB 1CICD 1T83C 2IPKA 1G6RB 3PUUA 4LRIA 4FABL 2PCFB 3FZUC 1JWUB 4TPRL 1WIUA 1RZPA 1BQHG 2YGNA 3MMEA 4HLZH 5GIRB 4H20H 2X44D 4K5PA 4A63A 4F3FA 1HCVA 1QSFD 1I7ZA 4C56E 1XGZA 3D33A 3NGBC 3ESOA 4FQJL 3HN8A 4JS7A 3GHPA 3KPSB 1LO4H 1ZTXE 1SGKA 5HGHA 3SGEH 3OHXB 4AIXA 2EKJA 5HY9B 4H7VA 3MRIB 3DRQB 3KXFB 5CBEA 1QFPA 1BVLB 3TO4C 1XMEB 4FG4A 5MENA 5KSAD 1D6EB 2IPTH 5E8PA 3ZR5A 5EU6B 4B96A 4PJDB 2IGFH 2VLKA 1KY7A 3F7RA 5D1ZC 1HHKB 3TN0C 4BZ2L 3MJ9H 4XXCC 2R9HC 3D85B 3L1EA 1IT9H 3V7AG 1NC4D 1MJ8L 2E6JA 1CLZH 3HZMB 5JOFA 1F1AA 5JLZB 1CF8L 1OM3L 3ASOB 2AAVA 4N8VG 1P9MA 5AKTA 4JFYB 4J3TA 1R3KB 4QWWD 3H0TB 5FYJH 5C08A 3VXSA 1HKLL 2IWFA 2ZYHA 1A14H 4QI3A 3V4UH 1V3KA 5KYYB 2XU9A 3VTTA 3BMVA 5D2NE 1UUNA 1QUNB 5CGYD 4M4RB 4PRPA 3KH4A 1BVOA 1ZJAA 3MNMA 4DTGH 5F8QC 2IG2L 2JKNA 4OD2B 1CVRA 4ZTOH 4QPEA 5B1BB 1CGWA 3H56A 1FO0A 5D6DA 2EE0A 2C9UA 2ADYA 1OB0A 2XKNA 4TVUA 4XMTA 3GF8A 2XWBB 4XXWC 2P8PB 1TPXB 2AJVL 1FBIH 1V8HA 4U1KB 5ETUB 4F27A 4PU2A 3UP1A 5AWNL 2AANA 1NEZG 1OPGL 3BP4A 4JDTL 4GNKB 3O9WA 2YD3A 4TLKA 2JK5B 4BZ1H 3VGDA 2FZ3B 2PETA 1FCGA 3FS9A 4UAOC 3G6JA 2PXYD 5EZJB 1GHFL 3ZE0F 4QHUA 2FL5B 3QUKB 3US0A 3IVKB 4HT1H 1LD9B 2Y22A 1QFWL 4UDUB 1B3JA 3O3AA 4JY5H 2P47B 3PAYA 4F7PA 4XN4A 4K23L 5DJ8B 4ZUWA 3FQTA 1THAA 2VJ8A 2X0UA 3EDFA 4UTCA 2ZYRA 3GFUA 3QWOB 4HCRL 4X7TB 1Q4NX 3NABH 4FFZH 25C8L 3SCMA 1UCBL 1J9RA 2UZYB 3LN4A 5I8OL 1OGAD 4Y5YC 3V6ZB 1SJMA 4PTUA 4FQPA 3JYCA 4MJIB 2VMJA 5IFAH 2VDOL 2NX5B 4XCEA 1ZSDB 2G9HB 4ANXA 1JI2A 2JXMB 1SFHA 3RDTC 2X6MA 1EHAA 1YDPA 4PJXF 4RESB 3TJHC 5JA8B 1QFUL 3TBWA 3K4AA 5FOJA 5I1AA 5D7IF 3R06A 5F3FA 4JQIA 3FB6B 4LPUA 4FQQA 4EKJA 3OKKA 5T5FA 5ABZA 4KZ0A 4R4BA 3B2VL 1HNFA 2GIYA 5BS0D 4G1EA 2CCWA 3MAWA 4KTDL 1JUFB 2LLNA 2WLJA 1ZD6A 4XAWH 3WY2A 3FUMA 4JFEA 2WBKA 5EUOE 3M7FB 4JFFB 5C09B 2MHAA 4X6FA 1T1YB 5HHOD 5HJ3A 1NWOA 4RISH 4XP4H 1UXMA 4PJIE 2HTLC 3PFUA 4KROD 2Q2LA 4MAUL 4GBXC 1FYTA 1OAJA 2CK2A 3NTCH 5D7IA 3TYFB 5BUGA 1R0AL 3VW3L 1AXTH 43C9B 1LXMA 4KHTL 5I82A 2AV7B 3HAEB 4BFFA 3VXMA 1U8LA 3IU4L 4RQQA 4BHUI 2GHWB 3BLKA 3RVTC 3FU8A 2WKLA 5E70A 4NHUA 3NSFA 4ODHL 1KMGA 2VSKB 2WYHA 1P4BH 5EO9B 1H3GA 1QOKA 3TBVB 4MNQB 1A1NA 1W15A 1UM6L 4IKJA 1G7JB 1PZBA 4S1SH 3IRZA 1UKSA 1PKQA 4IBLT 4QDGA 2HVKB 3NJMA 1A1MA 5EOCH 5C0ND 5LXGL 2Z4QA 2NTSP 2C5DC 3AY4C 4N8UA 3WHXB 1GKOA 1PZ5A 1UGKA 2QKIC 3QUGA 4ZTEA 1KBPA 4LPVA 1NCCH 3TL5A 2R0WL 2IADB