2R69A

Crystal structure of fab 1a1d-2 complexed with e-diii of dengue virus at 3.8 angstrom resolution
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
97
structure length
97
Chain Sequence
SYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of a neutralizing antibody to dengue virus alters the arrangement of surface glycoproteins.
pubmed doi rcsb
source organism Dengue virus 2 thailand/16681/84
molecule tags Viral protein/immune system
molecule keywords Major envelope protein E
total genus 6
structure length 97
sequence length 97
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2r69A00
3J27A 4FG0A 4X42A 5GZNA 3N40F 1URZA 2I69A 4FFYA 2HG0A 2JV6A 2V33A 5H37A 5AAMC 5AAWC 3UAJA 4FFZA 3MUUA 3N42F 3UYPB 1OANA 3C6EA 5LBVA 4AL8C 5LBSA 4BZ2A 4ALAC 5KVEE 3N41F 2H0PA 3G7TA 4UTAA 3P54A 4AM0Q 1PJWA 1OK8A 1S6NA 5IZ7A 1TG8A 5JHLA 3N43F 4UTCA 3UZQB 5JHMA 2P5PA 5B1CA 1UZGA 4UTBA 1SVBA 1RERA 3C5XA 3IRCA 5IREA 4L5FE 2ALAA 5KVDE 2R29A 3J2PA 5GZOA 1Z3RA 5KVGE 3N44F 4GT0A 4UT6A 5KVFE 3WE1A 4GSXA 3VTTA 5LCVA 3UZEC 3UZVA 2GG1A 2JSFA 4UT9A 1Z66A 4BZ1A 1ZTXE 2R69A 1OKEA 2JQMA
chains in the Genus database with same CATH superfamily
5DS8A 2O1AA 3IDMA 5D96C 4OGYH 1Y1UA 1YG9A 3MKKA 1OQXA 1YPZB 3PGFL 3HN3A 4KXZH 3OB0H 1T2JA 3RI5F 5LXVA 3DRTB 1QFWL 5E51A 2XZAL 1J0IA 1TVHA 3RWEB 4HS3A 1AGFB 4KUCF 2RIKA 5B7FA 5F0JB 3FO0L 1Y6KR 2XYCA 4AY0A 2UX6A 2X0VA 5CU5A 5K59F 1M42A 3QPQD 5L4IA 4K5MA 2IPTL 3CIQA 3KH4A 4FABH 2FH8A 1KXVA 3QWRA 4XNYH 4XNDA 1X9LA 3HIZA 3ARGD 2Y7MA 1IMHC 3GMQA 5IW6A 2G5RA 3ZHDA 4JRXB 1YEDA 3UP6A 4EEEA 1S7QB 1IKNC 1BAWA 4XTRC 4OIAA 4WTWA 5HHOB 2XX1A 3N9GL 3GBDA 2W9LA 2AC0A 4S1RH 5GGSY 1NMBH 4NP4H 2YXVA 4KHXL 4BM7A 1H3XA 4OJYA 4WUUB 5SX4I 1BVOA 2QKSA 5TE4H 2GIYA 1NLDH 1WFNA 2JCCF 4MX7B 4Q8BA 1O0VA 1NC2D 3GJFA 3PLYA 4PJXE 5E6ID 1C5DB 5DF0A 5LO7A 3RAJH 1G1YA 5JW5A 4HJ0C 4NRYA 4WW1A 1U8IA 4Z7WF 5CD3B 4BRJA 1NDTA 1LXMA 1JAEA 3GGWB 1KOAA 3GKWH 5DMIH 1RULL 2H2SD 5F9OL 3O11B 1XGZA 4CA4A 2X4QB 4JDTH 1T2QL 4TVPE 4YXLL 2J1YA 1IC4H 1FAIH 3PP3K 2L3BA 4LVHC 2YUZA 1HI6A 3QQ9C 4HX1A 1LEIA 2YKKA 1HHHB 3VD4A 3ULUF 1Y18B 3UBXI 4YDNA 3F62A 5IVZB 4OZIF 3OC5A 3P0VH 2AQSA 5D7JB 1S7TA 4FX5A 3VXUA 4HPOH 4ZFFB 3GSOB 4PRAB 1ZVYA 5I75C 4FI7A 4FG0A 4APQA 3D52A 3SDAD 5HGBA 4D3CL 2OTWA 5DHDA 4AENB 4HWBL 3HE7A 2X12A 3VRIA 1LMIA 2WXGA 2Y1YA 3WL9B 1FVEB 2F5BH 3CJJA 5HHOA 5FECA 5BRPA 3JUZA 3EBGA 5L8JB 2R1YA 5TDNB 4Q9QH 4TVUA 1QP1A 2EDFA 4AJWA 3E6FB 1VGEH 4PTUA 2H41A 3P77B 5GZNC 4XN7A 3NRPA 5AG8A 4PJIE 4KKAD 4KJPC 1KJVB 5IHZA 2MHAA 3J2PA 1MCSA 4MWFB 4Y2NA 5FM8A 4ODWB 3APMA 5ERWB 4GRMB 2YQGA 4CN4A 5I0XA 1NCCL 4U05A 5AG9A 5J11B 2VDNL 4GQ9L 1PFOA 3LV3B 1F4AA 2A4CA 3WS6C 3TCTA 2J5LB 3VO0A 1WFMA 4UCFA 4X98A 2V8MA 3MRRB 3OAYK 1E5CA 3FTGB 5F6HI 3H55A 5DJZB 2WBWB 3A6BL 2CHWA 3PIQB 2ZOOA 4TUJB 4CKQA 2F74A 3VGEA 2JCCB 2P8MA 5DVKA 1ZGLP 1AI1L 1Z3GL 1I8AA 1DJHA 2GHZA 2XI9A 3EO1A 5D1ZC 1VEOA 2PYEB 4PW4A 3IN0A 3CFCH 1DBML 4UZGA 3W11C 1FZJB 1GPOL 2DD8H 4NHCH 4IKNA 3V0DA 2FJGB 1A7PH 4K9JA 1RZKH 4C8XA 1AHWC 3V4VH 5JHAA 1ITCA 4LARL 2BVPA 1D6EB 4O2EB 4C4KT 3QO1B 3WTVA 3O4OB 5ISZA 2JH2A 2K9FB 4PJCA 1UWXK 2AEPH 3F7KA 4Z76A 5ESAB 2NY5H 2YFNA 3KPSE 1CL7I 1UTDA 4J8RA 1DQQB 4QRSB 1FO0H 1JPST 4JHWH 1FNEB 4OFYD 4UQBA 4PCKA 4WSGA 4HCGA 5DZNA 1U95B 5T33L 3FSVA 3CCHA 3GMNB 4OFQA 2ED9A 3G3LA 1E4HA 1AHMA 1OZUA 3GB7B 4UILH 1S5IL 3N1FC 2YZ8A 4H1LG 1ZOXA 4PJCF 2VKXA 3S34H 2MOQA 2G9HB 1W16A 3HE7C 3KD4A 1S9XB 5LGYA 3C6LB 1MVFA 4LEBA 3MUGA 1IU1A 2VZVA 3SYQA 3FPYA 3L1OL 4X6EB 1OSZB 1BZ7B 1FJ1B 3NFSH 3VXSD 4YDKH 4ZQTA 1TNMA 4HJJL 2CK2A 1ZGLB 3ABGA 4M1GL 2P52A 2IWKA 4ZT1A 3THMH 5DVLA 1BVLA 5IK3A 3B3IA 3U25A 4YHKH 5I8EA 2XVBA 2DH2A 3ZIYA 1UJ3B 2IDCA 5DMKA 4WW1B 1NAMA 4E2OA 1RIHH 1OTTD 5LXGL 3G08A 5CD5C 3F01A 5EOCL 2EDTA 2WLZA 2DTSA 2UUDH 4FYTA 2HKHL 1MCLA 4WI2A 5DFWH 3AWFA 2AK4D 2R39A 2XN2A 3BRFA 2E9JA 4XI5C 5C07D 5HHPB 3O2DA 3CVHA 4XWOC 4QPEA 5JZ7C 3EH2A 3HRPA 3IDYC 5BXFB 3JBG7 2CALA 4DCQA 2X4RB 3V4PH 4XCFL 1HZKA 3BD4A 3FQ4A 2WP3O 3VI4A 1T83A 4WSJA 4R7LA 2AJUL 1QLEB 1TZIB 3MLVL 5J57B 5IQNA 4ZXBA 2NNXA 4LLDB 1ZV9A 2AV7A 3SDCD 4TL5A 5IBUB 4NSKB 2E9GA 3FTVA 5EU4B 1UWFA 4WU7A 4A2HA 5JHDB 1INEL 1BQHG 2DQIH 2OCJA 3PGFH 4J3OH 4XMZA 4D0CB 3ECUA 2YPLE 5EIIA 2YD9A 3FCBA 1X6NA 4NO2B 43CAA 1COBA 4ZUWA 3X14B 3BPOB 2XIDA 5BVPL 2ATKA 3WTYA 2ZX8A 4NNXA 2Q6WB 3SQRA 2BSBA 3ZTDC 3B2UD 3C60C 2DIEA 3HC4L 3K72A 2A9NL 3OD3A 5IBLD 3ABKB 4GNKB 3QA3B 1LO2L 3N85L 3DDFA 1JPTL 3DTUB 2UVEA 5HD8D 3DK2A 2VDQH 3EYVB 1YMME 2BDNH 2XXCB 2R7EB 2BRRH 2QZQA 5CHNB 4DNLA 3VI4B 5EZLA 4XWGL 2CHZA 1MWAL 2NRDA 2VDOL 3G6DH 1I1YA 4IDLA 4W9GC 5EC2A 5KZCB 1GZQA 4K3DL 1QRNB 1AZZC 5DJAB 4AQ1A 2NW2A 4N85A 4FXKC 4TLSA 5FLVA 1YDPB 3HFFA 4BUQA 1T7WA 5F1IB 1E5BA 4GO6B 4XPHL 1NFKA 5C0FB 2FO4A 4NENA 4OCSL 4JVWA 4TSCL 2ITCB 1S7TB 3L2NA 1XF2A 1KULA 4DKFL 3G9VA 2IH1B 1RUAL 2VXTH 5DDHB 4XXDA 1JRHH 1EJOH 3R0NA 3IFPA 4Z76B 1JZ2A 1LO0L 3TC9A 1R4XA 4ODSH 3RL1A 4OT1H 3HE7B 5C0NC 1L6XA 1G7PA 3FFDA 4ZOCA 5F6IC 4P3CL 5T3XH 4L4VD 4MS8C 2YAQA 2WTPA 5BV7H 4ENZA 4JZNA 3HG3A 3TASA 5IR1B 1GZPB 4KX9A 4UQEA 4OIBA 4RGND 5F9WC 4XNZB 3CLWA 3LKSB 3T77A 1BF5A 4LQFL 5AKRA 3SKNA 5HYJA 1IGMH 1NCWL 2FJHA 5IB5B 4BZ1L 3BWAB 1JV2A 4FNLL 4PJ6A 1F41A 4G7YL 4MAUL 1WJ3A 2VLJD 4KAQH 4ESKA 1TFPA 1UJ3C 4LVNB 5CR1A 1S7XB 3Q44A 4JPWL 1WFIA 1FYTA 1ZLVH 3HHSB 2C3GA 2A6DA 3QORC 5JPMC 1FL3B 2QVKA 5MEND 5E8NA 1A64A 1MI5E 4N0UE 4UUJB 3AG3B 4OGAC 4IIQA 4HOMA 3C5XA 2EVFA 1PZ2A 4FS0A 4TUKH 1GGTA 3R7QA 5C0FA 1PZ5A 3WIHH 4GRWH 4AV0A 2EECA 3Q43A 4UV7L 5CGBA 2JSFA 1T7VA 2CLVB 1XF5A 5E1GA 3ULVE 2H6PB 4MNQA 3X13B 4XR8C 1NEZG 1XAKA 3F12A 3ULVH 3GXUB 4DUVA 1TQBC 2P44B 5CZXD 4N2NA 5E1IA 1C1EH 1TYEB 2F0CA 2X10A 5HJGA 3JT0A 2AK4B 2RFXA 1GSMA 3UDWA 1XGRB 5KSAA 1N5AA 2XWZA 5GGVL 3GMOB 4PLOB 4A68A 3ZHKA 2FUTA 3W37A 3OPZL 1IGYA 3CFEB 3EGSB 4XXWA 4ZUTB 3T2LA 4AVIA 3W9DA 4PJCB 3NCYS 2J5LC 1D9KB 4JUSA 1MJUL 1I7TB 2GABA 3WJMA 4C56B 2VDKL 2FECL 5IB1A 4XNQA 3MUZ1 3Q7JA 1K5NA 2DI9A 1WAAF 5IFJA 4LLUA 3MKGA 3AT8A 4AH2A 2VITA 3MRIB 1PU0A 3AZUA 4FMVA 4ZSOA 1OAZH 3VQ2C 3TJEL 4HG4K 1V8HA 1CLYH 2QZ5A 1AXSB 1AQKL 4BYHA 3L3IB 2IGTA 5HDBE 3WUZA 1U3HD 3D0AA 3LHPH 1FVCB 2W8CA 3V5DB 4YSRA 1RK0A 2Z93B 1WE5A 2D3LA 2WJ7A 4HZAA 4N26A 1J05B 5DK0A 3EDJA 3RWCA 5CGMA 2NUTB 4DW2L 2QFPA 4EBQH 4XNAA 2CSPA 5M95B 2OSXA 2JQMA 3O6MH 4Y9EA 2W38A 1KJ2A 1MW2A 2F58H 3E2HC 3PJSA 3FQ1A 3OQRA 1YCSA 4NZDA 2OQJA 2IADA 1Q72L 4NPYB 4PYHA 2WZAA 3OZ9L 4Z7QF 4HPHA 4EIGB 5FR3A 2ICWJ 3RPIA 3LEVH 1CICB 4NOBA 3F7PC 3NEEA 2GVYA 2ZAHA 3HN8A 3HKFA 3WIIL 4Y2DC 2DKUA 3VFOA 1QI5A 2D73A 1CLOH 1M56B 1O6TA 4XZUB 4BFOA 1QR1A 5DEFA 2NZIA 5JMOC 1F3RB 1UD8A 4QJ5B 5D72L 4YDIH 5DQDH 1DEEA 35C8H 4ZFFA 3TO4A 2OR9L 4B5EA 4DEPC 4Y5YC 5EEVA 3ESUF 3VSVA 2AEQH 4IJ3B 1U8NB 5FPIA 2OTWB 3KM1A 1TZHA 4L4TE 1I8IA 2YRLA 5SWSD 4A67A 4TVPD 3CC5A 3BO8A 4XWOD 2PYFA 4XN4A 4OKDA 3ZKXB 5CXPA 2XZZA 4Z7IA 3APCA 4FTVE 5F9DC 4ZMLA 3U0TA 1S78D 2G3MA 3UTTD 1Y6NR 2A1WH 3ILQC 4BQ6A 1BXUA 1WTGT 3NSDA 4H1LH 5HPOA 1QEWB 2Q7NA 2VSDA 2YOAA 3DMMA 1VPOH 5E6SB 3PXHA 1CYWA 2FJSA 4DVBB 4WU7B 1IQWL 2WZ6A 2Z35A 3H3KA 3LPWA 3PABA 3WNOA 3AU0A 5I71B 2X4TA 4KVNH 3V2AR 1NCIA 3HPLB 4LLWA 3TIDB 2K1MA 5LGJB 1PNCA 5INCA 5SX4H 1HYRC 2ATKB 2XZCH 4LBAA 3GRWH 3IU3A 3UTSD 1DBKL 1HE7A 1S7XA 5BV7B 1F4YL 1S7QA 2YGOA 32C2A 3BI9X 1T3FA 1HWGB 3LRHA 4DAGL 4RQQA 1FIGH 5LCVA 4F15C 2Z4TA 2C7FA 4YVUA 2K8MA 2WQXA 4UIKH 2VDNH 4GQ9H 5DJXA 4DFHA 3RILA 4KNTA 1BQRA 2B15A 1SJXA 1XXFC 4PJ9A 3OKYA 3BGMA 2VM3A 3S98A 1KXTB 1GKEA 2XV2A 3SGJA 2E6QA 5L0QC 3ZQWA 2GPZA 4FP8H 1UWYA 3REVB 1RJLA 2JJTC 3LZRA 1UUNA 3UZQB 3KGSA 3CDGB 4MNGE 1GZQB 2ZNWA 3CFJB 3MJWA 3IJHA 4GMSH 5DA4A 3VGAC 4UNIA 3ZW3A 4DEUA 4F2ME 5I16B 2VABA 4BINA 2CO1A 4ODHL 2IFFL 4OF8A 5F70A 1WFOA 4L5FL 5FW6A 1DVZA 3HHMA 1ZE3C 2NY6B 2ITCA 5I5MA 2Z64C 3RDTB 3B2VL 1I85C 4KJYB 4X5LA 3TYFB 3B43A 2DOCA 5E9AA 3VD7A 3K71B 4I1PA 2O93L 4JB9H 4IBLT 4LLWB 2GBUA 1NGYA 2H26A 3O6KH 4M61B 5AZ2H 1E40A 2K6ZA 5EU6A 3P11H 4M1DL 4BSWA 4D8PA 1D5MB 2ZWSA 2G9HA 2WBKA 1JGUH 1G9HA 2V4LA 3EFOB 2DYPB 4YLBA 4WI3A 4AE0A 3DBXB 4OQTA 2YAEA 3PV6B 1AO7E 1ASPA 3HBPA 3C09B 3SKNB 2XWTA 4MA7H 1GYCA 3IKCB 4C55A 3CQPA 1Y6MR 3JTTA 4JM2B 5C0EA 1XR8A 2NNFA 2VKWA 2WUCL 3D2UD 2ICEB 3HZYB 3T8MA 3VU1A 1UXSB 1DVFA 4XO5A 1DQMH 4CN6A 4H88H 4PD4J 4IOIA 1DJWA 4P2QE 4GUPB 3CSTA 2AEIT 1BFVL 1BG9A 4MMZB 5SWZD 2H4EA 3IJ9A 3MRBB 5E8EB 4A38A 4D2NA 1ID5I 2EYRB 4XTRD 1SDAB 5I30L 4GXFA 4P2YA 4OVVA 1WF5A 2ENSA 2ZG2A 3L17A 4YXHH 3U7WH 3Q6GH 4GG8A 1IEHA 2NY4D 5HY9B 3QUXD 1OB1A 2VL5A 2WZPA 4IRJD 3OMIB 4WEBH 7PCYA 3IJ8A 3L3HB 5C92A 3MRLA 3CVHB 5TE6H 3IGAA 3LKOB 1FL5A 4YWGL 5JLZB 2CGRH 2ISDA 3IRPX 1UXMA 4HJ0D 4PJ8C 3EO1B 5BW7C 4HFWA 1GTFA 1QSFE 3RY6A 4O51A 3QG7L 5B3SB 3MRCA 1NOLA 4U1MB 3SDXF 4YDZA 5DZLA 2R0WH 3IGUA 4YL9A 1YVLA 5AVRB 4P46D 2RR3A 3PWPD 3IDNB 3D4CA 6FABH 1GS8A 1JZ6A 1HN1A 5D2LB 1MH5A 3QQ9D 3STLA 3FT0A 1T4KB 5T1MB 1P4UA 3TURA 3UYRH 3WO3B 5LDSA 1NANI 4TVPL 4IOSD 5IY5B 4CADB 3RP1A 1EFXD 3QCTH 2HPTA 4XVJL 2D03H 2ERJB 1X9UA 4F5CA 3OTTA 3QG7H 5EPMA 3P9LB 3HUJB 4ZFZA 4NGHL 4AVJA 2Q8AL 2V3EA 1G94A 5DK2A 4JM2F 1BQHB 5JHDE 2OP4H 1GAFH 2VQ4A 4PWEA 4Z3EA 2KLSA 1LP9F 5BQDA 4V1DD 3VFWA 1EO8H 3BWSA 4ZAKB 1JNJA 3WSQH 1XGTA 4V1DB 4FTVD 5DHVH 4EVNB 4OZGA 3ES6B 2XWJA 4KVCH 4U2YA 3LS4H 5EO1B 3C6LA 1ZEAH 4OM1L 1ICTA 5EOTA 1ETZA 3MODL 2N3JA 3A6BH 4KRMB 5AD0A 1OAYH 1AQDB 4OJEH 1T22A 2QHLA 4PY8J 1F18A 1RJYB 2ZX6A 2J4WH 5ENWB 2OJZL 4TSBH 3I6LD 1I3UA 5JORA 3LXUX 4YSQA 3U4AA 4PG9A 2Q86A 3WFCL 5I1IL 4PRPA 1ORQA 2V9TA 5D93C 3FQNA 3M46A 3CE1A 4U31A 1T2XA 4NO5A 2V7HA 2R4SL 2XPZA 5KSAD 1V54B 2B1HL 3HUJA 1NGXA 5J11C 1T66C 3BT0A 4N1EA 3T2OA 1BBDH 2NLJB 2K78A 3FT4A 1F45A 1MNNA 2VDPL 3IDXH 4N1CA 3SKJH 4X7SL 1F8TH 4LCYB 4LPUA 4L3CB 1B4RA 4YAQB 4EZMA 4ZFOL 1XCWA 1T7YA 2XQYG 1L0PA 5HJDA 3Q6FB 1WD8A 4I9WE 3HS9A 3FFCA 5EO1A 3WE6A 1O9ZA 5G5DA 2AVFA 5C0BD 4MNGB 3ALPA 5F0LB 2HT3C 3WN5A 1JWUA 2EIMB 2JTYA 4NDMA 2VNCA 4LSRH 2O5ZH 3ZBMA 2YD0A 4JDTL 3RUGF 5IQ7H 3WELA 2CBQA 2W1NA 5FUZL 3F5WA 3HFML 5E5RB 2BC4B 2JK5A 3CN4A 4G8FA 2DM3A 1QBBA 4W9JC 4Y16B 3VGFA 3FONA 1EK3A 2IG2H 1RMFL 4GKNA 3WG7B 2HFGL 2W07A 4RSVA 3LKNB 3MV9E 3RL2A 5IV2B 4XAKD 5BS0B 1LQSR 1MRCH 3A23A 3KCPB 1BOYA 3R8BB 3GD1C 5IIEB 3O4OC 3IDIA 1VERA 2KLTA 3L1GA 3ECBA 5DRZA 2C7UA 2PW1A 4PJXB 1RCYA 4J28A 4GBXB 4A37A 4HJTA 1IQDB 5HYSG 5C07B 1CFSB 1FIEA 4OD1H 1WZAA 1KCLA 2XZCL 1TG8A 1XB6A 4J4PA 5I8KL 3T0VA 3QFJB 2MQGA 4ZTOH 3WI9A 3WS6A 1U8CB 3F6JA 1QNZH 2W92A 3LEYL 3NJGA 4F7CA 4KPHH 1I82A 3PYCA 3QWNA 2XLLA 2FB4L 2OYLA 2YBRA 5A1AA 3PDOB 4JAMA 5D70H 1OQOA 3MRCB 4GG6A 1BVKA 2X9ZA 3FCGA 3AFLA 2CO6A 4JFEA 4L0PB 3SDAB 1J1PH 4Z3TA 2JB6B 2MTPA 1S7UA 1RU9H 3HMWH 1JP5A 3UGXA 1BZOA 2XZQH 4MRCA 4M5ZL 2WUBH 3DIVA 4FFZA 3WNMA 1BEYH 5J56B 1YC8A 2CIIB 1GRWA 1WCBA 1M7IA 1I3RA 2NCEA 4L9LA 4WDIA 3DX3A 1ULVA 5J6GA 4Z7WE 3RIAF 1A1NA 3L4YA 4KTEL 3DNKA 1T0OA 5ECGA 1B4TA 3QNXB 1U2YA 2NY5L 1XB8A 3NESA 4LL9A 3TA3B 1WFTA 3PPSA 1IC1A 4X2UA 1A02N 3DJTA 2X9XA 5IV2A 4M43L 4Y4KB 3WNJA 4UT9A 2NZ1A 2DQGH 2XTJD 4DO5A 3CFUA 5I76A 3STZA 3MLYL 4P3WA 4XVUC 5KBDA 4FKEA 1HNYA 4WGVB 1BQ5A 2H32B 3FQRB 1RZ8B 3T3PE 2A3TA 1N6VA 4FMKA 1JYXA 3BX7C 4LCWB 5B38B 2E7MA 1BJMA 3RPIB 1HSBA 2HJFB 4PGBA 4FEMA 2JIXB 3JVGC 3B56A 1PD6A 1JF5A 2NYYC 2E7CA 3ISRA 4U1NA 4JAMB 1KT2A 4GG8B 4M7LT 1M7XA 3DX8A 3PG2A 4ONHA 2NY2B 3NIFE 4MQTB 5C0ND 4PWHA 1GYUA 3M1CA 3QYCA 3ULUC 2NY7L 1IJNA 5LGHL 6TAAA 3TZVA 4LDOB 4UZUA 1JUFB 1X4XA 4GP5B 3CN3A 3G04A 3BO8B 4HXBH 3EADA 1S7SB 3BT2L 1HXMA 1SFHA 5EWIH 4W6XB 1QA9A 3QHFL 2ZUYA 2EVHA 4B9KC 2LTQB 4PG2A 3QULA 1YYLH 5FM4A 3A47A 1D3CA 1KFAL 1N4XH 2MFNA 1JMXA 3DX1A 4XP4H 2FQGA 2ZUTA 1XCQB 4QO1A 3HZ3A 2X1XR 1NGWB 4L3AA 3WY2A 2YXFA 3SDXE 2R0ZL 4HS6A 1RULH 3NJVA 2FQDA 1SVZA 3QDHA 3QYMA 1U4FA 4ODWA 4DN4H 3JWDH 4LT7A 1XSIA 4O02L 3RX9A 3ILEA 3UEQA 1S9KC 2IQAA 2WBJB 4B7IA 2Y2TA 4KTDL 3MLZL 4PREA 4ZO9A 3V0EA 4WO0A 4PVBA 4X4YA 3R4DA 3B9KD 4NQXA 2HN7A 3D39B 1AYOA 1VFOA 3B9KB 4NQDD 5DGQA 1ZA6B 5C0AA 5TF1H 1JZ7A 2B59B 2AJSH 2E27L 4G6JH 2FT8A 3ZE0E 2Z7ZA 1JZGA 3HNTL 3CLFH 1KZQA 2PP8A 3CHPA 3LS5H 1MCWM 3MACH 1J5IA 4I0PA 4UQ2A 4DFIA 4G7VH 5DQJB 2CO2A 3G04B 1B9ZA 5H94B 3K6NA 4I13B 4XE0A 5K59E 2QQKL 3BQUB 2WQ8A 4G80B 1TJHL 4GH7B 2Q3ZA 5DFVD 4NZRL 3UX9B 4RFEA 3KJ6L 3RWIB 1OP4A 1XMWA 4X8GA 1MW0A 3DVIA 1USZA 4W9HC 1AO7D 4M6MH 1A5FH 3EJJX 3QUML 4D9QE 2ATAA 5GRXG 4Z3GA 3NIDB 1A6VL 3TT3L 2LHAA 1CXEA 2BHZA 1K6QH 1K8IA 5B39B 2R0ZH 4KJYA 3FQNB 5C6TH 3D5OF 3HCVB 5INDB 4Q89A 3NSCA 3QUZD 2AQ1A 2SEBA 2B08A 2CCLA 3D4ZA 5EMYA 3OR6B 4JREB 3BPOC 1Z9PA 2DQHL 3P9MA 1CK0H 3RFZB 5D6CB 3H9HA 4ZAKC 1RZJH 5C09D 1IGIH 3BH4A 2C3WA 1ZA6A 1B6UA 4HXAL 3MRRA 4Y5XB 2YKLL 4U4BA 2OMWA 1UOWA 4DKFH 4EI6B 1NFDA 5LCVL 2EE6A 2KZKA 4YDVB 2ZYIA 4W9DC 2HYMA 2YBGA 3FFCB 3QDJE 1NIDA 4M62H 4FL4C 5LGHH 3QQXA 4YJZL 2I07B 3BKCL 4GUPA 5IESH 2DQDL 4XWGH 3TNMA 4MD4B 3AC0A 3CVIH 3CFDB 3T1FB 1E2WA 3FN0H 1N8ZB 1X7SA 2JKNA 1NUGA 1C8QA 1AD0B 3CXDL 3U4KA 2OBGA 5D1XC 2O61A 4KRPD 1BZ9B 4OIFA 1T1XA 3C5JA 2YUWA 4WW2C 4NWTH 4PJBF 2WOYA 4A63A 2EIBA 4MAYA 4WU5A 2KPWA 4HJ1A 5D7JA 2AMUA 2AXGA 4JJHA 5I74B 4HEPG 4JKPL 3NK3A 4YHIA 3CX5J 1UHVA 1ACYH 2IANB 4JCLA 4JKWA 3KJ4B 4XBEH 4YIQB 2BNQB 1R3JB 2IDFA 5JQIB 1QUPA 4GSXA 1NOFA 5LLIC 5LCVH 1QSEE 2XY1A 2AZUA 2QLVB 4G7SB 1E9PB 4WTZA 4YX2L 1NCDL 4N8PA 3CFJA 3F2LA 4LLYA 4S2SB 4XC3H 1SM3L 3GXDA 5FYJD 2O6EA 1MIMH 2XQYA 3DSNA 5D4QA 3ESOA 3KWTA 1U8MB 1FNAA 3HR5B 1XT5A 1H3TA 1FFNA 4FQPA 2CRZA 4Y8AA 4DP9X 4UT9H 2XKNB 2J8UB 3QUXC 3J7HA 4ZOBA 4BFJA 3ZYJA 2TSAA 3L48A 4NN6B 2HG5A 5IREA 2ZCKH 1UD5A 4IGBC 4RNRB 3WIHL 3ENEA 1SQ2N 1FNSH 3KPSB 3UDWC 5KSAC 2Q7YB 2YEVB 3HNTH 4HS8H 4NT6A 2IEPA 4QRPD 5HI3C 3GMQB 1EHLL 5C0BA 1KLUB 4WO4C 2BWDA 2CKNA 3AQYA 1RJZA 3D39D 1TQVA 3MNVB 1ASQA 3D3VB 3FU3A 1DQML 2V5SA 1P7KB 4M4RB 5C08A 1VB9A 2ZONA 4K15A 4PJIF 4DH2A 1VKXA 1LE9A 4PJEE 5EUOE 3FUHA 1PG7L 1QLEH 3K74B 4GAJH 4O2CB 2PCPA 3C5ZA 3WMPA 4Z7VB 1RZIB 3B1UA 5H37H 5IB3B 1UACH 2FSEA 4M93B 2ZKXA 1IBDA 1A6AB 4V1DE 2J7LA 1VDGA 4NRYB 2C9QA 4N6RB 1TPXB 1BPLB 2Y7QB 4Z5RB 4DQOL 3VWKB 4PMEA 4AJYV 3RVVC 5FM5O 3DURA 3QJHA 3N40P 3RB7A 2NYYD 3PWLB 1XGYH 3BDYH 4G82A 1LL1A 1N26A 2BMKB 2OI9C 2AJYL 1AZRA 1WV7T 3CQFA 3NSXA 2PR4H 2LVCA 3HLAA 1JHLH 3TT1H 3LKPA 3QZWA 3SBRA 5JLZA 1FHGA 4K8RD 4EJ1C 1VGKB 2B14A 1QSVA 2HUHA 2QQLL 2WLNA 4X6CE 3HBGA 5HI4D 4X99B 4CMMA 2O6CA 4Y9FA 3II1A 3JSSA 1UC6A 3FB6A 1PEWA 1M53A 3KW7A 2FL5B 2Y23A 3QIWD 1JWMA 2QGCA 3S5YA 2JQAA 3LQZB 4AL8H 4E41B 3CD4A 3WL9A 5GGSA 3OX8A 2W65A 3NTCH 4BZ2H 3ZTJG 1AE6H 2G5UA 4A6YB 3UPRA 4IRZH 1CL7H 3MYZA 1A7NL 2VAAB 3X2QB 1HH6A 1I75A 3ABZA 4KJWD 4LBEB 1ASOA 1C12B 1KB5B 4YSSA 5L0QB 2GCYA 3VD9A 1MCWW 3CSYB 2BNRD 4FG6C 3Q0HA 4N6RA 4BZ1A 4K3JL 1T0PB 4NC1C 4B9YA 5CN3A 3L3JB 1XIWA 1U8OA 1T0MB 2A9AA 2NTFA 4Q58C 5C0DA 3QR1A 5C09E 4DEWA 4AYSA 1HILA 3F7VB 4Z0XA 2BPBA 3TNNA 4AK1A 2A74B 5KYXB 1T6VN 5I5JA 3OKEB 1PJWA 3L6FA 3IFNH 3AS2A 3QPQC 5IUCA 1JPSL 3JVFC 3VXMB 4Y5YB 2UXGA 1DDHB 4W1TA 4M03A 2CBTA 2AMGA 1A1MA 1IL1A 1TVDA 4OCXH 4B9IA 4A7GF 4FZ8H 3QBTB 1FSKB 2A9CA 2VXUH 3MGAA 4L4TB 3MCKA 5DRXB 1J9QA 5L2KB 3ULVF 3VH8G 3LZPA 8PAZA 2BVTA 3LH2H 4XB7A 3EYFB 3R18A 2BSSB 1VZHA 1FZMA 4KROD 5I73B 4XX1G 1D6EA 1IO4C 3GPEA 4NKOB 4KROB 2PCFA 1A1NB 1IGCH 2NXYD 1Q94A 3VWJD 2DJUA 4WV1B 3VMNA 4KTGA 4H0IA 1KWKA 3B6SB 1MY5A 3SN6N 4NKIL 2PPCA 2ZUUA 1DSFH 1J11A 5I2IB 2E76C 1E0OB 1D5ZB 4Z95L 4IHBA 5E99H 1AACA 3ROLB 1CIDA 3WJJC 2VXVH 4IIQB 3FO1A 2ZYRA 2G75B 4YWGH 1EZVY 1SYVA 1Q72H 3AQDA 3SYCA 3GHPA 5FV1L 2P24B 5B21A 1U3ZA 3BCFA 2FTAA 2DQJH 3TA3C 3D48R 2X1WL 3R8QA 3UTSB 4N0CD 4R96B 3F00A 4MJIE 1QNIA 3T3PB 5ANMA 1NIEA 2YMTA 3OBAA 3ARFA 1KIPA 3DI2B 3QS2A 5AVZB 1OWRM 4ZTEA 3IFLH 3DX6A 3NN8B 4MD5B 1WC7B 1U8LB 4NJ9L 4F58H 3L7EA 3QUHA 3L4UA 4NC2B 3P40A 1TQCC 4FQXA 2TRYA 5I6XC 1NCNA 4PCTA 4KZ0A 4WY7L 4YR6B 3L3GA 2VDNB 3D0LA 3HC2A 2WTRA 4I0PC 5E00A 2FSEB 4APXA 4YNYA 3FONB 2J43A 3B3IB 4PP2A 4DN4L 1P2CA 2ZT9C 4TKWA 5E8OA 5J7CC 1O7DE 3JYCA 1KC5H 3O0LA 4XNQB 5IQ7L 3VI3E 2HVBA 1FGNH 4CC4C 3KPMA 2JWYA 2ZPKL 2F53E 5DEGB 4JHWL 4UDUB 1ED3B 2PO6B 5C07A 3QEGL 3DIFB 2Z65C 3QNZB 3TL5A 1U8QA 4LESA 1JTTA 1CBVH 3SCMD 2VXQL 2HT3D 5MEQB 3TFBA 4EZJA 3JWOH 4NNPL 4DP7X 1PS3A 3FH5A 3HLKA 3GBML 1VJSA 2H9GA 1ND0A 3HI1B 4XCFH 3FQUA 2YWZA 1HEZA 4ACTA 2X6AA 5GRZA 1RSYA 2EEBA 4G8EB 5CILL 1LK2B 1URLA 4Y2OA 2F19L 2HT4C 2Z31D 2ZPKH 4AQAA 5ICYA 3WCYA 5DSCB 4HJSA 3S8FB 3B8SA 4HCFA 4P2OB 4PRIA 1BFSA 5E8NB 4UNTA 2BSDA 4P4KB 5EIIG 3N42F 1T5XB 3QORD 3ZTNL 1MLCA 4HIXL 3PWVB 4HCRA 1AG6A 4F27A 1NC2B 4UANA 1ECYA 3Q2VA 1D2PA 5BS0D 2IBBA 3KBHE 1BSIA 4U1IA 4LCVA 3TP4A 2EDBA 1J8SA 1MN4A 2P5PA 1L9OA 1CL7L 3MBEA 1IGIL 3CDFA 4FL4B 4H13C 4X6DF 5DRWA 3MA7A 4MDJB 2XFGB 4DK3A 1CE1L 2R4RL 3EJPA 1P5UA 2N59A 3HS0C 5D1QD 2WYTA 1I8IB 3NQIA 5FWQA 3CXFA 2NX5D 3HPJA 2F18A 4LMQE 5LKNA 2ZG1A 4OLYL 5I5IA 1TETH 2KL6A 5HDBF 3NIDE 5D1ZD 4U0RC 4PHZA 2F1AA 3B2PA 1I7ZB 3F6LA 1F4WL 4ODSL 3VB9A 3BEVA 3LYRA 4WI9A 3ZZLA 3V9EA 5JQ6L 4AW4A 1XZ0A 3BGAA 5IP4A 5MHSE 4JL1A 1M7DA 3MLTA 3L13A 3E8VA 3BVWA 3VXQA 3BIAX 1PAMA 4NKIH 2COQA 4DO4A 2A1WL 4XPHH 1C5CL 3MV8E 4H44C 3AY4C 3DX9B 4C4KO 2EUWA 4S0TD 4KQ0A 3VFUB 4XCCL 1BYOA 1TTCA 3MV01 5ID1A 1UM4H 4P2OC 5F88B 2YSSA 2HWZL 4OLYH 4QRUA 2VLME 4PMFA 2B7DT 2ED8A 3J8F7 5H4YA 3IU3B 2FD6H 1K8DA 2NUTA 3P2TA 3RKDC 3TESA 4FYSA 1CGXA 4LSRL 4WUKH 1HQRB 5CD5D 1WIOA 1LEKA 3DROA 2E3VA 2DQTL 1JI1A 5LVEA 1ZT4B 1QBML 5E0FA 5DRWB 3KL3A 4BSVA 4AKPA 4H1LA 3M17A 2QV4A 4MSWA 1ORSA 1NLDL 3PS6A 1A21A 3SOBH 3VI4F 5JA8B 1MLBA 3HE6B 2HMIC 1D7DA 1CDIA 4KI5D 1A4KA 4G8IB 4OLEA 3U2SA 5I66A 3UEZA 4WI4A 2BJMH 3LKQA 1JGVH 5CP7B 1RVFL 2O5XL 1ZHKB 4ZO6A 2VLKE 3T6XA 1P4BL 1YMMB 3MLWL 4JFQB 5E6ZA 4XC1L 1Z9LA 3PWNA 3O9WD 4X6DB 1MRFH 3QJZA 1KBWA 3RDTA 4IRSB 4HALA 3U2IA 4HWBA 1ZSDA 3II2A 3JQOB 4IRSD 4XVSH 3HNVH 3HJ0A 1F8TL 2JQZA 1THAA 1BVNP 3FJTA 3ARDC 1PYWA 2HKAA 3U1SL 1VFAB 2OMYB 1KTLB 4ERSH 3S37L 4GIPD 4ZRGA 3ZZSA 4AGOA 1HJCA 2NY1B 1T4WA 1GPOH 2DD8L 1OAKL 4JFPA 2PO6D 3U4BH 2XZAH 2F5AH 3VCLB 4WFEE 4XHQA 4BV1A 1FC1A 1H0DA 3OF6A 4NBYB 3UJTL 1KXVC 2BP5M 5E0QA 5EUOF 4HV8A 4FULA 4PRBB 4Y4HA 4ZS6C 2ZSVA 3CFKB 4AMWA 2F8IA 3QG6A 1KBVA 4PWJA 5LJYH 1CR9L 1J1XL 1MLBB 4YSDA 1A8JH 1QSED 1GAFL 3RWGA 4BFFA 2DQUH 3GSNA 3GBNL 3P9MB 3QHZL 4P23B 4ONGH 3GHBL 3K4DA 4R4FH 1TEFA 5E03A 4GY4A 5CINL 5EBLB 4YN3A 8CGTA 1KGWA 3BIKA 2KYIA 2VUOA 3QVAA 1SYVB 1DVSA 1NCUA 2JJSA 3HJEA 3F7YA 4M6OL 3NT0A 3D4YA 2FHBA 2QR0A 2ZXQA 3GRWL 4G6AC 5BZWA 3TVMC 3MBEC 5B1BB 5FA4B 1S3KH 4KDTA 3VQLA 5JW4M 1KCWA 4F15B 1M6OB 4Y1AB 1JGLH 5D7IB 3D0VA 3MRQA 3RAJL 4F8NA 4P59H 3QRBA 1NCHA 3LDBC 3RWDA 4TQPA 1VFUA 3S2CA 4KHTH 5HD8C 5E8DL 1ZVHA 5KS9F 2W9DH 4IKLA 4N0YL 3ARTA 4HJGA 4KK5C 3BDYL 5TDNA 4KO6A 4P2RA 1OF2A 3OKDA 1IGCL 1XGUA 2E6JA 2WN3A 1EHKB 4EN2A 1HHGB 5FWRA 4F5CE 1GGYA 4JHZA 3IAPA 4OQTL 2HRGA 3MR9B 1LD9A 4UWQB 1M1SA 3UZVA 2KZBA 4JFFB 4FFVC 3CBJB 2JB5L 3WJLA 4HIHB 1D5MA 3BZEB 5TF0A 3O3UN 4G6FB 1K6QL 4NQTA 2YC1A 4ZO7A 3CIAA 5AVVB 4JG5A 3FCSA 5I0YA 1RZKL 1BFVH 4ZPVB 3WS3B 3OHMB 4XVUD 3SJVE 2EXYD 1WWCA 3GO1H 3HZVB 2CCWA 2CJ3A 5B1CA 4A2LA 5BVJB 4NBZB 5KVEL 4NZRH 4KHXH 3RKDD 4Z3JA 1GCFA 2ZKYA 3O3AA 5J13B 4OVUA 1KN4H 3EGDA 4LLVB 1Z3GH 5FO7A 1EEYB 1MIEL 2W0FB 3FW6A 3FSOA 4XBPA 3QPKA 1HH6B 4PIBA 3KE0A 1QEWA 3DMMB 2UWEA 4JREC 4MS6A 1U8KA 1FNSL 2YGNA 3KWWB 3ZMEA 4EQ3A 2VE6B 3H54A 1WYJA 3FQYA 1NMCB 5DZJA 1VESA 4LSUL 2EIZA 2GAZA 2ZSWA 5F8QC 1U3YA 3S4SA 3TEZA 3IETB 5AZ2L 2CDFA 3KPSA 3KCPA 3UAEA 4WKXA 1KENL 5D7IF 3QJSB 2VLMD 2NY0C 5J12B 4P2QD 5F3FA 1PZDA 4P05A 5SWZE 1HSAA 3MGTB 5E9NA 2JCCE 4N2OA 1QRND 4IDJL 1RUPH 2PCYA 3WUWA 4TVSa 4CMHB 5DWUH 4JN2A 4AG4H 1XCXA 3KYOA 4G8GB 3QXUA 4I77H 2R1YB 2J25A 3D25A 3HC0A 5KSVA 4UTBL 2P5ED 4UF7C 1U58B 5EC1A 2PO6C 2LFEA 3LPPA 5DS1A 2P5EB 4KMTH 4PJDB 4QMEA 3U36A 4X4KA 2GQHA 1E8XA 3UTTE 2EICA 4Y4FA 4DZBB 4MFHA 4FQ2L 3CDZB 1IE4A 1IAKB 1E9OA 3SY0B 3D4GA 2Z91B 4KFMA 4FA8A 4LGRB 4Z7NF 3B7RL 5I9QC 2YA2A 4NO0D 5C6TL 2JV6A 1DUYB 1YEGH 2BNUA 3GXTA 1HEHC 3O45B 4O02B 4MQ7A 4RMQA 2WVSA 3X14A 5IQ9A 3CFBB 4JW3A 3IDJA 2IPUG 4GEJA 2E86A 5FC9A 3PHAA 5DLMH 2XWJB 2E7BA 4DSYA 3MTRA 4XO9A 5EOCH 3IDIB 1I4FA 3X1FA 3ZE0B 4C58B 4TTDC 2FO8A 4IEFB 2P28B 3RWFB 2GK2A 4FC3E 1JXGA 1JJUA 4HKJA 5L7XL 5JW4N 1GW0A 1IEAA 3PF2A 3FB7A 4G7YH 4M5YH 1DVFD 3KPRB 4YBLB 4AXWA 3GIZH 3THML 4Y1AD 5DO8A 3UTOA 1Y07A 4OLVH 3X3GL 3BW9A 1ZHKA 1WT5A 1XXDC 2BVPB 3MNZA 2XN9A 3T3PF 2G4GA 4UOW1 3NABL 2XV6B 3QXWA 1YEKH 2QGEA 2BM3A 5I1EL 3O4LA 2X2YA 1A6ZA 4JZJB 2GHWB 3KYNA 5EB9A 5FF6A 2FJFB 5D1QA 3T71A 4WW2F 1QOKA 4UYQA 4ELDA 3GDBA 3HAEA 4JFDE 4FZ8L 5J6GB 2Z9TA 4HX1B 5D7EA 3QXVA 4B95C 3UPCA 1JRHI 1BQLH 4C56D 4GJTB 3IU4L 1F02I 3WTXA 3T1WA 1MAJA 2FBOJ 2F8XC 1QKZH 3RUGE 2OPCA 4FCAA 3U1QA 3TFKC 4TULL 1MDAA 5T3XL 2WV3A 4TPRL 2VIRB 4RFNC 3ZQ9A 1A6WL 1AGCA 1QO3B 3NFPA 4BIKA 3EJSA 2EINB 3MJ9L 5FUOL 4OFIA 1GGCL 2FJHB 1A8ZA 5E2VL 2VLJA 2CLZA 3CSGA 3FRPG 2AJSL 4IOSA 2NY1C 1FZOA 4KZDL 1DVUA 4NQED 4R5TA 5AYUH 2WB1A 5MENA 1OSPH 2PR9A 5F96L 4GRMA 3K5RA 1AOZA 1OCZB 4BZ2L 1HHKB 2D4FA 5BS0A 1FNHA 4JQXA 3G6DL 4ANVA 1UZ8B 3QIBA 4M7JL 1DE4B 3GJFK 4N3TA 4ATWA 5ITFA 5F0PB 4YFEA 2KC0A 5FA3B 3QT2A 4F8PA 3T0EC 2FT6A 3DUUB 1PZ5B 1KELL 3GSXB 5IOPA 4AUYA 1FRGH 3A21A 4G9DA 4LKCA 1RL1A 2ZUWA 5T5NG 3GHBH 2G3ZA 5CF3A 3N1QC 4GW1B 4BE5A 4IBUA 5GS2H 4O2FA 4ZD3L 1U8LA 4ZFGH 5BXFA 4LIQL 2AAVA 5FDWA 1N5YL 5ADOH 3O11A 4QY8B 3KGUA 1JSYA 1UB6B 5I8OH 5H8DA 1LK3L 5JOPD 2DQHH 2A2QT 5KSBB 2OXHB 3D18B 1BREA 2ZXAA 3D0LB 4LEXH 1DQJB 1X5YA 3EYUH 2C9UA 2L7EA 3GMPA 4J3XA 5FK9B 1TMQA 2E7HA 3T77B 1N6UA 3O2VH 4Y4FC 1MJUH 4M6AA 1YECL 4F2EA 2HTLC 1WZMA 1YECH 4Z3HA 5DMGC 1ZLSL 3VXUB 1JV2B 5GGQL 5DD6B 4UOZA 4ZMYA 5I6LA 5I6KA 2WLKA 3I3DA 4ERSL 1RVFH 4QHKJ 1Q8MA 1U8PB 3A4FA 3B2MA 4UT6H 3OM3B 4NZ8A 1S5HA 1ZE3H 3BDBA 1LLAA 2IC2A 2BP8B 1W72B 4FLOA 5EU5B 3STZB 3L81A 3QI9B 4Q6KA 1R3HA 3KNBA 5DUMH 1R47A 1NSNL 2GSMB 5A6LA 3GSUA 2JNZA 2EKSB 2Q3AA 4BKLA 1HL8A 1ZDSA 1X5FA 3RNKB 1R24A 3T6QC 2LGNA 1EV2E 3GLAA 2A83A 3ESMA 4LCWA 2AGJH 4GO9A 5IFHH 4WNJA 3QDGB 1JDCA 5T3ZD 3HI6H 4FADA 4W9FC 1EXUA 3CN1A 4G8EA 3FSAA 5MERA 3DVFA 1IQWH 1SNRA 2HLAA 2LFGA 1AS6A 3A22A 4QIRA 1MWAB 4AV4A 1IBGL 3ZPDA 5JW3L 1S6NA 4UQ3B 4P0DA 1B0IA 2HKFL 4BA0A 5M94B 5CEZH 2DQTH 4WIQA 3HA0A 3BP7B 3H6JA 1ERNA 4HUUA 4ODUB 3PREA 5CLTA 5E9DD 5K5YA 4A7UA 2MEJB 3E9TA 3ETSA 4TSCH 4J3OD 4OBRA 4UBDC 5EHFA 2XX0A 3W38A 1NKRA 1A4AA 3TCXA 3TBTB 3BRDA 3CHXA 5AW7B 4MVBD 5JNYB 4XPTL 4KQ4L 4XPTH 1RIVH 4X8CA 4HD5A 1JGEA 2EO9A 2XPGA 2CE6A 3GIVA 4XN1A 5D7SL 2ZKHH 4HOXA 2H6OA 3UPAA 5GS1A 3FNKA 1WA2X 2HFEA 3LIZL 3QXTA 3L3IA 3A3YB 3QHFH 3A6CH 2NPLX 3VE0A 5C2BH 1QLRA 3CX5K 2YHGA 2BSEA 4XPFL 1NCGA 2C1PA 2X2HA 2HLFD 3COOA 2CDGB 4YLCA 2R29A 2A6JA 2DLGA 5KVGE 4FDWA 7PAZA 3ZE0F 4P59L 3AY2A 1X5JA 4QF1A 4BD4A 3KLHD 4PVLA 2DYPD 5C70A 4LASL 1MCNA 3ZT6A 1G7IA 2BCMA 3V0JA 3QAZC 4YGVB 5HHOD 2LR4A 4HIEA 4K7PH 4YBQD 4OGAD 1OSYA 5BVPH 4UQ3A 2F1EA 1NUDA 5LDUA 3GRBA 4KGLA 2XN0A 3FU7A 3QEHA 3FHAA 4B60A 3EF7A 1JPTH 1AXTL 1AQHA 4U1KA 2QKIC 1M05B 1MRDH 2FX7H 3L9EA 1EMTL 2B0SL 4PBWD 3B9EA 1YYMH 3H0TB 4WWOA 1WZLA 4MKTA 4WWKB 1BVLB 4KK8D 4AQEB 1YEIL 3UJTH 1Z9SA 1UJ3A 3KEHA 1KGCE 4KTEH 5KOVC 3WOVA 4NQEE 3UADA 2ZAIA 2E56A 3MNWB 1MW3A 4D0BB 1TVBB 5L6YH 3QJHB 4JRYA 1R46A 4WKZA 4KO5A 4NLAA 1GGBL 1EEUA 4N2LA 3IRCA 4HWZA 4JFFA 4KI5F 1UVQB 5HI5C 2PXYC 5KSBA 4MXVF 4NNPH 4AE1A 4K5OA 3S4SG 2FGWL 2IBZX 2IMMA 3B2VH 2AKRB 5CFAA 3GMPB 5IROC 4ZD3H 4D9QD 1R3KA 4GMTL 2UZXB 5HHQB 1MVUA 1V5JA 2HG5B 3PABB 2D7QA 3P4MA 4LF3A 4WTZG 1Z5LA 2V5YA 5ABZA 1EDQA 3BHBB 3AITA 4Q9QL 4HK0B 1S7WB 1E5YA 4Z7WB 4Y4KD 1GOFA 1YSOA 4Z7QE 4NYLB 3C08H 4GIOA 4M48L 5B22A 3RZWA 1U8HA 1U41A 3GSQA 3LNFA 4X6CF 5I6PA 2LT9A 3QQDB 4ELMA 4HPOL 4PJBE 5IHHA 4UZSA 2Y5QA 4FQCL 4HUWB 2IADB 3OXSB 1QLFA 1N7MH 3OJVC 2CHDA 4P49A 1PSKH 1LEGB 4ZAKD 1F90L 4CVUA 3QC5X 4OUOA 4Y1SA 3W3BA 2E6PA 3MRBA 5E8EA 1GXEA 2BHUA 1N6QH 2W9EL 4ZPTB 4IS6A 4P48A 2DZEA 3GUTB 4KJQD 4DKTA 5AAPA 4BH7B 4ISVB 4AQ8A 4GLRI 1DQLH 3T0AA 3LXBA 4B3EA 3DTDA 3RVTC 5HDWA 3D34A 3LD8C 1JVLA 4MA1C 4XNZC 1DZ0A 1SEQL 2J2ZA 1XMEB 5CBEA 2WUCH 4JGUA 2GIMA 3ZRFC 1IC7L 4JVPA 2Y6SC 2WTOA 3BH9B 3AGVA 2Y69B 4TXVB 1TQBB 1X5IA 5F6IB 2ENJA 3FO0H 2GUOA 4RFEB 5HGGS 3MOQA 1Z5YD 3WEMA 5IOKA 4HGWA 4U1GC 5IHUL 3OPUA 4RGOL 15C8L 1KCUL 1JF6A 3STLB 1N5AB 4ZUSA 1IAKA 2ARJQ 5A43C 4ZMQA 1UA6L 1TUPA 1MCJA 4RGNB 3E6FA 1NZRA 2W60B 2YK1H 3U6XS 4F2MB 4LOUC 5K9JL 3NJMA 1TTAA 3ZL2A 3ZZ1A 1E65A 5ILTH 1WGOA 1BD2B 4MWFA 1JZFA 2OL3H 2H0PA 3MXWH 2XWBB 4XP5H 4P23D 4OD3L 4HG4J 3SB3A 2EE9A 1JNLH 4LLUB 4ONFL 5JIPA 4G83A 3TWCL 1KLUA 4UM9D 3CZGA 4QTFA 4KKLC 5EF1A 1Q9WA 3SDCA 1CDHA 4JG0H 4WV1C 4Y5XA 3V6BR 1MFVA 2TSBA 3ULUH 1A2YB 2SODB 2ETWA 3HZVA 3WTWA 2BY1A 4U6HA 4JANA 5E5MA 5LAXA 1QHPA 1UD4A 4DZ8B 1KIPB 3WXVL 5DK0B 2DQIL 4R0LC 5AOIA 3I84A 2ED7A 2P48B 4EAEA 1RZ7H 3KYKH 1C16B 1FL6A 2FX8L 2AS5M 3KEDA 3QCUL 3SKUD 3D39E 4L4JA 1D5RA 3GLZA 4WWKD 2L7QA 1JHLL 3TT1L 3HR6A 2PTTB 3RZCB 1FFQA 4OJAA 1X4ZA 4APXB 4NQCD 4HF5L 4XN8A 4ZUSB 1URIA 3NYKA 3SQBA 3QIUD 1KB5H 3ZR6A 2EDXA 5FHAH 4EDXA 4DERA 2YD2A 3H7LA 3O41A 3TU6A 2AJ3B 3TYFA 4N2BA 2A73A 2X7LA 1IC5H 3HVDA 4HUXB 5T3XD 4XNXH 3QFGA 4JRYB 1T2QH 3MYJA 1YNLL 4MMXB 3QZLA 5T1KB 1BZDA 2VDMH 2QT6A 3AU1B 3JV6B 4PB0H 4MCMA 3S5LB 1DJXA 2GEEA 3L3KA 3P4LA 1CLVA 1RIHL 4GS7C 1IGYB 3CFEA 4ZUTA 3SDCB 3U0WL 1UKSA 1ZHLB 2K6WA 2G4EA 5IHZB 1OTSC 5I18L 3I9IA 3P3UA 1FN4A 5LAPA 4J39A 4PVNA 4NERA 3HZMA 5F1NA 3TM6A 1DCEA 1CGUA 3K0WA 3V4LA 4H8WC 2RB8A 5DFVC 4TOYL 4UOJA 3G5WA 4HPYH 4JPKL 1JWUB 3H3PL 1BLNA 1P4BH 3IBEA 2YPLB 1MG3C 4RCAA 2GBAA 3S3SA 2FZ3A 5I30H 2WYIA 5ACMA 4J5VA 2X4UA 5AVQB 3QUYA 1MCQA 1NSNH 5T8IA 1NC2A 4X8JB 4LCWD 2Y0SA 3E80A 4JHAL 5DWPA 1Q0EA 4PI0A 4X7CC 2R8SH 3CVHL 2D2OA 2UY6A 3QS3A 3CGTA 4S1DC 4R4NC 5AB1A 3E1F1 5FOBA 5DJ6B 3C5SB 2B1AL 3TF7C 5E2WL 4CSSA 4KBPA 5SX5H 4N20A 1T7ZA 3T0EB 4PS3A 3K4ZA 3KPPB 3NGBC 4OAWB 5JXAH 5I1LB 4F24A 2AEPL 3J07A 4YO0A 4I3RH 4KNSA 3E3QE 4NUQA 3QAZB 5CGYD 2X4NA 4POZC 3DYPA 4AQ1C 1QR1B 5JQHC 1A0QH 4N2DA 4XCCH 3GSWA 3PHOB 2QTEA 1IGJB 1RKRA 4PWKA 4JS7A 4YX2H 5BMFH 3DTXA 3TVMA 4P5MB 4LSQH 2B9AA 4BWWA 3IRZA 2EE0A 5AENA 4HFUL 4UB0L 2ZCHL 4I77L 3N91A 2Y9RT 3MMEA 3MLSL 1MFBH 5JQ6H 3MODH 4QHNA 4R7DB 4PEEA 1HCZA 1TZAA 3NIGE 3EUUA 3SGKC 1UOLA 1WPCA 3QPXH 1SFDA 2WLMA 4TMPA 1OPGH 1A4JA 2MQCA 3GLDA 4HGMA 6PCYA 4C47A 5EIQA 4HHGA 1JERA 5FHBH 1R24B 2XA8L 4RMTA 3BZ5A 3BVDB 3D3VD 5AOMA 4ICXA 3BN9D 4H26A 3LIZA 3TIDA 3G08B 1XO8A 1GS7A 2C9PA 4P4KC 5AYUL 5FOBB 5F97E 1WC7A 1ADWA 1EEZB 4UQCA 4HFUH 5HVHB 3QJRB 2Q20A 3T0EA 1NEZB 3HE6A 4CC1A 4R5XA 1SDDB 4MCZB 1X5LA 4PJ5D 1Q0XL 1WUNT 1INDH 3KPRD 1JF1B 3NA4A 4ORGB 4Z7VE 2G2PA 1QPPA 3GYRA 2B2XL 2RH0A 2JCWA 3MBWA 4GP4B 3FULA 3T08A 4R2GC 4ZS7H 1B0GB 1HH9B 3S3CB 1XF3B 2YEZA 3RDTC 1CTNA 3MLUL 1I9JH 3APDA 3D2TA 4ZXBB 9PCYA 1MFDL 1XGQA 1D2OA 2BFVH 3KG5A 3D7PA 4J2QA 1ZS8B 4JDZA 4N0UB 4ALAC 2LLGA 3MRJB 3GIVB 3MXWL 4XP5L 3OJDB 1XCTA 2X4RA 3NP3A 2GT9A 1CU4L 1KENH 3TEYA 5EU3A 1ZIAA 3QZNA 1G6RB 4HH8A 4NXKA 5JIKA 4JGNA 5T1DL 4M6NL 2BSED 4FI8A 4NZFA 5AVXB 2CAKA 1E2ZA 1KPUA 4JRXD 5F93C 1OV8A 2VT0A 2QHRL 3LX9A 3G5YA 3QEGH 5T1KA 3ZE2B 4NCC1 5B1JA 4DVRL 2OR9H 2WN2A 4RMRA 2O4EA 2WAQA 1X5KA 3NACL 4YZFE 1LO0H 4NZUH 1MCPH 1U3HB 2ESVD 4NDMB 4LVHB 1SJHB 1NBYA 3FOLA 3MRMA 1QACA 1YNTA 4X5WB 1BJ1H 3R1GL 3BC9A 5D55A 4JQIL 4YHPA 3QRLA 3DVGA 3RZCC 3DMMD 5EV7A 5H35B 2BS8A 4LGSB 4Z23A 5T1JA 5CBAB 3DBXA 1JGLL 3V0IA 3VD1A 1JHKL 3PV6A 3WTSA 3VACA 4IK7A 3MC0A 1T03H 4XP1H 4QI3A 2H45A 5EH1A 1CXLA 1OE3A 3HI6L 3KNBB 4X8JA 2Y1VA 2VQUA 3BVUA 4FF9A 1U21A 4FXGC 3WKQA 1KY7A 2A0LC 1BIHA 1IARB 5MP6L 3UTSA 4OU3A 1Z9SB 3QC6X 4NI6A 5B39G 3ZOAA 1ZPLA 1ACCA 5EOQL 4PTTB 5EFIA 3CFMA 5JXEA 1KGJA 3HUJE 3GGWA 3PV7A 5DTFA 5FKAB 2AK4A 4GG6B 1TYJA 4HU2A 4NCDA 3KPTA 5F1IA 3QDMA 5KSUB 3DXAE 5CSGA 5B1AB 2W95A 1T1WB 3M1BB 2ZNXA 1NPNA 4GQRA 5SWSB 5T1LA 1F4WH 3BMVA 3ZDXB 3UO8B 1LHZA 3QG6B 3AUVA 4PJHB 5D5MF 2F5AL 4HDIA 3FOLB 4DJMA 1TEGA 1IM3A 1G7PB 2VDOH 1WISA 3FFDB 3LEXA 3QR2A 4Y5VB 3VG9C 4AZ8A 3ARQA 4MJ6B 2GB2A 4U49A 1R5VB 3DX4A 2FEDD 2BIQA 5FCUH 5HGBB 3NPSC 3CZLA 1U6AH 5HVFB 2ZOKA 3SBPA 3K2IA 1VCBC 3QNZA 4GFTB 4QEGA 1UATA 2ADFL 2DKSA 3QQDA 4ELMB 4L3FA 1UQSA 1IKFH 4JO8A 1DUZA 2X2UA 1JK8A 2IF7A 3A0OA 5BZWB 2NW3A 5JO5A 1TTGA 2BZ7A 4XP9H 4A7GA 4F1SA 4AL8C 3VGGA 1VZIA 2OL3L 3GMLA 3H9SA 1RUKH 4PLJC 2CLVA 2CPCA 5IESL 2CPUA 3CDYA 3WE6B 1S7RB 2XNAA 3MBXH 3SOTA 4FFYH 1N8ZA 4H8UA 1IFHH 3EFDL 4PJAA 15C8H 3FOMA 4W4NA 4XPAH 4GXUM 3M7OA 3UOAB 2RD0A 1CC3A 4PD4K 3VG0L 4ISVA 4ZFOA 4BFRA 4LRNH 3UTPE 3PL6A 2ADFH 4U6XA 3C60A 3PAYA 2VL4A 2DLFH 2H5UA 3BAJA 1UXLA 1X5ZA 4JN1H 1NGZB 1RFDH 5BO1H 1JVKA 4I2XB 4YHNA 3I9AA 3K2KA 1AC6A 1QWUA 2D03L 1RURH 2HRLA 1L9NA 2TRHA 5AL8A 3DV4A 3R7RA 2F61A 4WO4D 2WWMC 2ZKMX 3Q8AA 1ZLVK 4UQIM 1YEEL 2XQYK 3UAFA 3VWKD 1KTLA 4DWHA 1MNUH 4LLMB 4KPHL 3H42L 3P3RA 3T4AB 4QNPF 2IH8A 5DS2A 3AS3A 1H5BA 4H8WL 4P9MH 1LILA 4WF7A 4XMPH 4P4RA 4PV9B 2ZX7A 1QWHA 8FABB 4OZHF 4Y2DD 1AR1C 1T89C 4W4OA 1K5NB 1OARL 1JRHL 4WVRA 5DEJA 2P26A 3VA6A 3NSFA 3NH7L 4BZYA 3PFQA 4P5MA 4PJ5E 5GISH 3K2UH 4XMKL 2CIKA 3POHA 3AREC 3PNWA 1BAFH 3NAAL 5FYKU 2Y3NA 2Z91A 2FIKB 1MNUL 4YHOH 4ZX4A 2AKRA 4P2OD 4NQCE 3CZNA 3HG1D 1NDMB 4JM2D 1GGUA 4NJ9H 3C08L 2OK0L 3ARVA 1UWEH 4GKSB 4PAZA 1QWNA 4ONOA 3T3MB 1NM9A 4RDBA 3DJ9A 4NFBA 3GRGA 4AYEC 5D93B 2DLFL 4X42A 4NC1E 2Y22A 2YPKB 4F7PA 1W8NA 3WN6A 2JCCA 4R4FL 2Y06L 3L5XL 4H88L 3V4VB 1LE9B 3I50H 3FB5B 2ZP8A 1BZ7A 1FJ1A 1S5IH 2CXKA 3LVTA 4FG2A 1KCVL 4GBXD 1MHPH 3VFTB 5CEZE 2VMDA 1M1XA 1HQ4A 4PJ8D 2LAGB 3VFVB 3H2PA 3VTMA 4A39A 1L7TH 3K1KC 1J9CT 1NLBH 1U93B 4JM4H 4XMPL 5JPMA 3EXLA 3SDYH 1P4IL 1HZLA 2I9LA 4OZ4B 4PGBB 3V6OC 3UTTA 2K4WA 3D33A 3LCYA 4FFTA 3VD3A 3IJHB 4AEHH 2V3DA 3CTTA 1S7VA 1G9ML 4FKKA 3VG9B 3BP6B 4MCNA 2D0FA 3S3JA 2FIRT 4JPSA 4AVHA 3DURB 4ZFQA 2CKBA 1TZHB 4NIKB 1DL7H 3KJ4C 1TKWA 3SSGA 4GB9A 1QYGH 2VDRB 1I1FB 1YEHL 1IKOP 5D71L 3TBVA 4AI7A 2Q0ZX 4AYGA 5HHPA 4IRSA 1T6BX 4UDTA 1BBDL 1WSST 2PP7A 3QXAB 2BERA 1XIWC 3L3KB 4Y16C 5JHDD 3W56A 4PHXA 2ERJC 1R1CA 3GK8H 3TIEA 3BUDA 3GBLA 4Q6IC 4OFPA 4ODHH 1WVZA 1HXMB 4GRWB 1X44A 4NUGH 4MTMA 2BIHA 2P80D 3MGOB 3AB0C 1RJCA 3LS4L 4PR5A 5C7ZA 1HYSD 4HWBH 3JWOC 5J0BA 4GI8A 1EEYA 2W0FA 3I9GH 3C6EA 1J7VR 4F37K 1RUKL 3FB5A 1T20B 4DTGH 2EVGA 4LKXA 2X4TB 1CGVA 4U7KA 1EAPB 3MRPB 1KPRB 4WFFD 4I9XA 1HFUA 3ZHLA 1ONQA 1B2YA 4XH2B 3BFQG 2JELL 3QDGE 4MNQE 3QJOA 5FO9A 2HA1A 1FIGL 2NQ3A 4XNUL 5AVYB 4B7LA 4POYA 5CBAA 1A6AA 2XVKA 3UZQA 1A3RH 1K4CB 1P6WA 3AT0A 1FCCA 4AT6B 4Q56A 3ZDXF 4RMBA 2HG0A 4KITB 5KZCD 4KNUA 4LPWA 4AL8L 4YL4A 3MDJA 1RIVL 3S5ZA 3IXAA 3O3DB 1UCTA 4ZUUA 1RJLB 3HRZB 4FQJL 4DN3H 1UYWH 2OX5B 3FQXA 1A9VA 3QH3A 4AJVA 4R83A 5AW9B 4QXVA 4KOCA 4U1NB 1WT5C 3IDYB 5E2VH 3NGBB 1J1OL 3OXRB 4BH8A 3UJIH 2KZWA 4HKZA 4N2AA 1A7OH 5I24A 5DURD 2EUZA 2D9QB 2JF1A 3L5JA 5D7HA 3TVMD 3RI5K 1RK1A 3ZSTA 3ARBB 1EA9C 1QKZL 1SOQA 4PY8I 5JPNC 1F4XH 4B6ZA 2COVD 3HE6C 4R7DA 2BNQE 2UXTA 1T80A 4KDVA 1FZOB 3O41B 4KUZH 5CJ8A 1PX8A 4OH2A 5IJKA 5K33A 1LO3H 2A73B 4GFXA 2IAMB 3FF7A 2V8LA 2P7TA 4DP6X 1J5HA 1OGTA 2DL2A 4ODTH 5EU5A 5A3ID 5C0BB 4BXSV 3BVTA 3HG1B 4WK4B 5CJOH 3K72B 1KIQA 2IPKA 4U1LB 3F3HA 4K7FB 4P04A 4YBHA 5EEZA 1W0WA 1WBZB 3GMLB 4RZKA 1OO2A 2V5MA 4P5KA 1WGVA 1EVUA 2CKBH 1FUNA 3WMSA 5DHYA 5HDRA 4W68A 4F7PB 4QHMA 4JO5A 1L9RA 2VR4A 3HZKB 1D5BB 2JKWA 3AWEA 3Q9QA 3FT9A 5L7XH 2X5PA 1JI2A 3T0WA 2ZICA 2YA1A 4N0RA 2OMBA 5BZZA 2F7IA 5C7XL 2YD6A 3FTXA 1P7BA 3G5ZA 3GZOA 5AB9A 1VADA 1CZ8H 2KBGA 3L1FA 4LSDA 2NSXA 4ZFGL 1DJYA 4YS4A 3KPOA 5D9SA 5EZIL 2NY4C 4N25A 1WICA 3MJGX 4YDMA 43C9A 2P8LA 4Y1AE 2VDMB 3T3ME 1JPSH 2IH1A 3F12B 1ZLDA 5IW6B 4D7BA 4AENA 4HK3N 1CT8B 1FE8H 3W2DL 4JM4L 4IOFD 5LBSH 1ED3A 3W0WB 2QLYA 4G6KL 4F7MA 1DO5A 3SPIA 1AHWB 1NGXB 3I9PA 1J0ZA 4FQQB 4POUB 1XF4A 2E8ZA 5I15L 3CUPA 4EI5A 4KDTC 4XNMB 4L9DA 2QQQA 2DQCL 1UADC 3QIUC 1CZ8L 4JQXC 1AR1D 3W11D 5EO0B 3SQOL 2AV1B 2Y25A 3ZDZE 2DEWX 1JDDA 2EC9U 1CBJA 1WHOA 2P8MB 3HRZC 2IO5A 5CJBA 3VGHA 5DD1L 4TLTA 1HC1A 3IFLL 4X0KB 4F58L 5TGBB 3VX0A 5KBLA 1HXKA 2HTKC 2KDGA 4ZSOB 1C12A 1GGCH 1KB5A 4OJFH 1NDMA 3L7EB 2VLRD 5FHBL 3VTAA 1QUNA 4LEEA 2X4QA 4R4BB 4N9GB 4LLQA 1VLXA 1D5XA 5DEZA 2WPGA 4K2UH 4XPBL 2ICWI 4X9IA 5ALCL 5IHBA 1BBJB 2VXVL 4OZGB 5CJQL 4PRHD 3BP7A 2DICA 4HKXB 2JIXD 2F53A 2Z92B 4Q9RL 4X6BA 4ONFH 2I85A 3SYOA 3HKZA 2ICCA 1LP9E 5GJSH 4EE2A 5ACZB 1GMIA 3H0TA 1I4FB 2J8UE 1ZV2A 4MJIB 1CJYA 4N8UA 4LQFH 5ICUA 1JYNA 3WIHA 2QADC 5LBGA 4FKHA 1IGFL 1IV8A 1T1WA 4AGPA 1CICA 4WFFE 1WIPA 5DVMA 5DLLA 3EAKA 3DXAB 3DX7B 4FFYA 3QWRD 3LN9A 1FFPB 1R3IH 1THCA 4G59C 2UWEF 4PY7B 1QHOA 5BRZA 3PGCB 3TN0B 1MIML 1XZ0B 4UTAA 1GHFL 4HDIB 1Q1JL 5I1AB 4EN3B 3M8OH 5E1AA 4OFYA 2W0LA 5JOFB 1HKLH 2H0JA 3WFDH 5A7EA 1KUMA 3WIIH 4ODVL 2OJ1A 3MCLL 4L1BA 5AW6B 4CDGC 2R0LL 3ARBD 4UT6A 1B4JH 1ZS8A 5D70L 3CN2A 1EBPA 4NO0B 1BMZA 1D5ZA 1NCAH 4P4KA 1CD1B 4K2UL 4PGDA 5T5FL 4TUJA 4APQC 4GI6A 3ZHNA 1JNHA 1WBXA 2VC2B 1XH3B 1PG7X 4DESA 3K91A 4FFVD 1OOWA 1UG9A 3H3PH 4CW1B 4R0LB 1FVDB 1B2WL 5F0MB 4M6OH 4J3SA 4QHLA 1FORL 3PE9A 1G9NL 2PPFA 5DD1H 1H3UA 2J1ZA 2VQ1A 2C3VB 3BSZH 5DT1L 5C0IB 1S9VB 2IOIA 2X4PA 5I18H 4I0PD 5B38A 4PJCE 3S9DB 3FUIA 1MEXH 3GHEH 1PLBA 1YPZF 4OUUB 1OCWH 1UA3A 2RCSL 1ECZA 3DGGA 5C0GB 3L7FA 4K94C 4P2CG 3IMTA 3ZE2E 4XPGH 3A4AA 3UC0H 3WEOA 1E5ZA 2NR6C 3KPRE 5A7BA 4BQ8A 4QRSA 2ZP0T 3KWVA 3ORJA 2EYSA 5DJXB 1S7UB 1NUNB 3T6WA 4B9GA 4O00A 5DZOA 5KYYB 5AAWA 3MFFB 2XBZA 4X5XB 3JWNE 2WQAA 2XPGB 5GS1B 1MFMA 3SO3B 1CDJA 3Q2WA 4WEEA 2W0PA 2AF2A 4J4PC 3CFIC 3D9AH 4X4ME 4D0DB 1QLRB 3CC1A 1ILSA 5KANG 2AHIA 5LN8A 5TQ2L 1J48A 4OV5B 1SMDA 1KLGB 3MRDB 4J1UA 4PV1C 5J1SC 1P9MC 4X9YA 4WI7A 4G71B 3MJ7A 4AM0B 1FVDA 3ULUE 3O2DH 4M7KH 2CIKB 2CU9A 1I3RB 2EXWD 3ISYA 1WLHA 4MQXC 3FUJA 5C09B 2Q6WA 4NSKA 5EU4A 5JHDA 1B9KA 1WWWX 1EO5A 1ZGLA 4KOBA 1PQZB 3BYYA 1NMCC 1M6UA 1MCEA 5GGTL 5IVXF 2AEWA 1YN6A 2WGNB 1TZOA 4JEGB 5KW9L 1A5FL 4F7KA 1EZVX 3CFTA 4XHJC 1MRDL 2FX7L 4FQIH 4WV1A 5JR1H 3KVQA 5B3NA 5KTEL 5I76B 1WIUA 2IVFC 1TQTA 2Y06H 3ARDD 2YPLD 4Z8FL 4G42B 3V4PB 3FQRA 4X5PA 1ESOA 2D7OA 2D31A 2W65B 1I31A 2NY4B 4IIQC 3UXFA 3NIDF 12E8H 4IBTA 3HAEG 1R3HB 4N2FA 1CK0L 4PH8A 3UPRB 3RWHB 1IUZA 4BUGA 1SZNA 3VFVA 1DR9A 1BM3H 4GRLB 4YHYC 3TA4D 3RNKA 2JXMA 4U7MA 4YBQC 5I1CH 2XIIA 1JN6B 1G7JB 3RY4A 4R3SA 3L16A 5EC2B 2NYZA 1WWBX 4P2QB 5F89B 3QRFM 5A2LH 1LO5A 5C08D 1MCIA 1G7LB 3QUMA 4M5ZH 1RHFA 2VSKB 4NN5B 3IPEA 1H9VA 5DD0H 1N0XL 4FAAB 1YRKA 5D2NE 3A6CL 4N2HA 3PL6B 5B4MC 3FB8B 1K8IB 5B39A 1ZLWK 1ACZA 2FNBA 1ACYL 2FB4H 3MNDA 4HS6B 4V2CB 1PBYA 2O26U 4BDVA 4JG1H 3X1NA 1MCRA 1E43A 2KQNA 1YNKH 4JX0A 4J3VA 5DJ8A 2M26A 1G0YR 1MVYA 5D72H 3L4WA 5F7UA 3BZFB 3P4OA 1PKQA 3TBTA 3VFSB 1Z9NA 4FFZL 3ATDA 5DD3L 1HNGA 1K8DB 1MDTA 2DEXX 5IGXH 2Z8RA 3C87A 3OL2A 2P5WA 5F7BA 3UBFA 5B7EA 3AGWA 1DEDA 4I2XE 3MLZH 5GRVK 1SJVA 3MV9A 3RJOA 5LAXB 1R5WB 4XCEB 4G1MB 4G9FD 1J1XH 1GJUA 4AYID 5F3HB 1CR9H 2HN7B 3D39A 4Q4IA 2PPEA 2MSPA 4JLRB 2EDDA 2JJVA 3AWGA 1IAOA 2PYED 2DLEA 1TCMA 1YYML 1Z9OA 3L3DB 4ZFZB 3VXPA 1D5XB 4ECNA 1AGEB 2CMRL 2WLLA 1OWWA 4A2MA 2GC7C 4X80H 3RWDB 5GXBB 4J6IA 3UYPB 2D3NA 1SXCA 2F53B 2Z92A 5JDSA 5FO8A 3X13A 2YD5A 3MVSA 3DYOA 1EZUA 1AAJA 1ZGLM 3M07A 3BVXA 4QWWD 2Y1ZA 2X7LB 4HIQA 5GGTH 1NBCA 2DS4A 1DO6A 4G6KH 5IMMA 2DQMA 5BZDB 4YR6A 4OAWA 3RFZA 2YIHA 4TQIA 2IANA 4JE0A 5E2TL 1HS6A 4TNFA 5E2TH 1UM5H 4Z7UE 4DGIH 4U2ZA 2CRIA 3S36H 3PNRB 2P5WB 4PGEB 2HXAA 4YQXH 2H32H 5AQ0A 2IQ9L 1JWSA 2Y4SA 3TN0A 1TZGL 3WS3A 4AUUA 1EZSA 5ISZD 2HVKB 2YAPA 3FO9A 4FQXC 4N5UA 3IBOA 1SBBA 2F8VA 2AQTA 5AW4B 3ARGB 3GM0A 1L4IA 3I6SA 1AXTH 1E9OB 1E8WA 1QFWI 4K5PA 3VJ6A 3DIFA 4EI5D 5J3HD 4NO0A 3LV3A 2YGPA 4RBPK 4WHTB 2BS71 3CFDA 3NIFF 1EJ6A 4AGNA 3MACL 4YPJA 1U4EA 2O5XH 1SYSA 2ZSWB 3HG1E 4RETB 1XSOA 4HUCA 5EBWA 3TH3T 2Y72A 3QK0A 4PJGE 3P69A 3KS0J 3QJFA 5I17A 3FQUB 3OLEA 4OR1A 5DHYB 4DZ8A 2IXQA 1NH6A 3X11A 3WTUA 3QXDA 2UYLB 2OSWA 4FOMA 2EP6A 1S9VA 2HFGH 2UXFA 3OQ3B 3RTQD 1W0YT 4LPCA 3U79A 2NY3B 4GAFB 5T5FA 3SDDA 1OAJA 3O3BB 1RU9L 4MNHB 1QBLH 2W91A 1FI8C 2NY5C 3GMOA 4QOKB 5CP3A 1IVTA 3EHBD 1QATA 2NX5B 3EJYD 4ZMAT 3G5ZB 3QFJD 5F6HJ 3V6OE 4ICWA 3WUWG 1AS7A 1XL6A 4BK4A 5HPMA 2CO7B 4QOKE 1I8MB 3MLXH 1HWWA 5DVPA 2ADGB 1RD6A 3MRHB 5C8JB 2VZ1A 4TPRH 1E4XI 1B0GA 4Q6YA 3LN5A 3CLEL 4A7SA 5DUML 5KAQF 3JTSB 1H6FA 4TNWK 1AJ7H 1Z3RA 3FCTA 3MJ8A 2E47A 2YRBA 4MYPA 4Y4FB 3VJ6B 5C0CB 1Q9OA 3S35L 1ZA3B 3O6LH 1HOCA 3I6GA 1NCDH 3CHQA 1A7PL 2VDLL 2XRAL 4NHCL 1CQYA 4ALAH 2JE8A 4ZZFA 3VM5A 3MAWA 4XT1C 2BIOA 3KXFE 4DCQB 2J88H 2QKIA 3GJEB 1XV8A 4NT6B 3U46A 3EJRA 2CA3A 1SLVA 2P47B 3T0EE 1L7IL 1CYXA 5KS9E 5GGSB 4AW7A 1G4RA 3MUY1 4WNQA 3MNMA 4JG0L 4RQQB 1FH5L 5D8JL 5DJDA 3A24A 1AKJB 1TLKA 4PRDB 5FYJE 5J6SA 3RGHA 1JZ5A 3CVCA 3I02B 3UBXA 5D7LE 4YVNA 4Q14A 3OKKB 4M5SA 5IF0A 1WH0A 3NBNA 2UXVA 1BZEA 1RLWA 3GI9H 3VFOB 3WJJA 3S4SB 1E67A 1HE8A 2ED6A 1BZQK 1VFBA 3QDGD 4FTVB 4TV3A 4DTGL 4HKXA 4R7NA 3OZ9H 4NC0B 2AJZA 1ZXKA 3V4PA 4LAQH 3WD5L 4B0MB 1CD8A 2FK9A 2LU4A 1YMMD 1IT9H 1L6PA 4J3OC 3RURA 2OR7A 1HAUA 4LOUD 4YBLC 3WIFA 5IHUH 2D7TL 4R7VA 2ORBH 3FTUA 3CZUB 5CMAB 3D12B 1XCTB 2P3YA 3RUGA 4RFNB 4NUJA 2VR3A 4PRHE 2WWOA 1A1MB 5AOJA 3SQOH 1IC7H 4JPVH 1DL7L 2PTUA 3BUBA 3DHUA 3A4DA 3UCRA 1UH3A 3TOPA 3BUIA 1XEDA 4BSWB 2KDYA 1DANT 3UAJD 2FO1A 3B8YA 1IGTB 2OXHA 2YS4A 5JOFA 1VGEL 3V8CA 2IJ0C 3NIFB 4DVBA 5AOKA 1SVCP 4ZW3A 4HJGB 3W2DH 3D30A 2OJEB 3LQAH 4NKOA 3U30B 2JI2A 5I0ZA 1XF2B 1MJJB 1S9WA 3BESR 1XR9B 1BQLL 4MDIA 3WSQL 2OTUA 1ZAGA 4K94L 5BS0E 2HFFA 3M86A 1JDAA 2ZUQB 3QB7C 5EEUA 2MRYA 3TA3A 3ZZQA 4MMZA 2ADIB 1XGYL 2X09A 1T3FB 3EOTH 3L5XH 4WTXA 5CU9A 5EEWA 4HH9A 3C2AL 3CMOH 4RDQF 4G3YH 3VD0A 3V0AC 1W15A 4JG9A 3K0YA 1DE4A 5ITFB 3WNIA 4DK5A 5E8PB 1NMBL 3ZT7A 3SKMA 2WLJA 3GSXA 4FNQA 4IOIB 4UV7H 4QRPA 3SDXB 3N0AA 1SN0A 3NFSL 1LWRA 3TWYA 4WEMB 4D9LH 1BD2E 5SWZA 4D9LL 3TJHD 1HZHL 3BP4B 2D7MA 4I89A 3G5VA 4X9FA 2BOBA 3VUAA 4BZ2A 3BIKB 4ZJ9A 1D7BA 4OCRL 3MV7B 3ATAA 4NO3A 3CH1A 4FN0A 5AYQA 1T04A 3MV7D 5JYLA 5DLML 1XF1A 4KTDH 4Y19D 4L3EE 4U6VH 5EF2A 3TLRA 4AC4A 4PJFA 1CXFA 2W94A 4R5VA 3ZE1B 1IKNA 2VJ8A 4ZUVA 1IGML 1NCWH 2R56L 5I8CB 5BV7C 3LN5B 4R97B 3IWVA 2APWA 5DO2C 4MJ6A 4BA8A 2KKQA 2AERT 5AVTB 1GCYA 3TCLB 3H56A 4PN6A 3RG1C 3AT9A 5FV2A 4P3CH 1F6FB 1UWGH 4AM0A 1I8UA 1JVOA 3PCYA 4WK2B 1QSFD 2DM4A 3RU8H 5GJTH 2X1QA 1ZIBA 1OTUD 1BJ1J 3PGCA 3FQTB 1WS7A 2QKIB 5HVGB 3DO3A 1M4KA 3PNWB 4D9RD 5JHLH 1FRGL 2G5BB 5CEXB 1TF4A 4MA1B 4U6YB 5EU7E 4AMXA 4NKDA 4TUOA 1QFHA 5CZVL 1A14L 2BIMA 1F4HA 1AYRA 3BPLC 1FYTB 2AI0L 2AI0H 1QVOA 1T5WB 4EXKA 1L5GB 2GTWB 2WXOA 1MLCB 2V17H 2R2CA 3U2JA 4KKPA 2WTRB 4MYWB 1EHNA 3DUSA 4X7EC 2PN5A 3WJLC 2DJSA 3OAZK 2WXIA 1NGZA 1LQBC 2QQLH 3ALXA 1KF9B 2F2HA 5I1DA 1JXKA 4XBPB 5I8CA 2PYEA 4R26L 2RJMA 2XSKA 1ORQB 1WAPA 3FBKA 4URKA 3GSOA 3QJVB 4KJPD 1JPGA 2NSMA 3BXNB 2VXQH 1PTZA 3V55A 4UU9A 4MJID 1B6DA 4DP0X 3CK0L 5ENWA 3SYPA 4PU2A 4FMFA 4M3KB 3PAZA 2RQ8A 4HA1A 5CMAA 1AQ8A 4OI8A 3GI8L 3SGDH 3O8XD 3RA7L 3ARBC 4PJ5A 5MEQA 1L6ZA 4ABVA 1JHTB 1K5WA 3V5KA 2DQEL 2EDMA 3BW9B 3MCLH 3NMEA 2E9WA 2WWMD 3IVKB 1XSJA 1C9SA 4C83A 1BDYA 4JKLA 1ZXQA 3FK3A 5GHWH 5HYEA 3SPVB 1BGXL 2ROXA 3AMLA 2EYSB 3U1SH 1UT2A 3WHE1 4MJ4A 1E9QA 4UDTB 1LK2A 4MZIA 3CCHB 3GMNA 2J72A 3FYIB 2ZUXA 3HAEB 1KV3A 3H4HA 4TL4A 3KYOB 4G8GA 4Q52A 5IW1B 1Z5LB 5F7LB 5A2JH 2QPSA 1I8LC 3F5WB 1N3NA 1TZ8A 4OZFB 1IRAY 1UZGA 3LEYH 1UA7A 1RZJC 3T9WA 3U7WL 1PPIA 2V2WA 1S8DB 4CJ0A 1Z0MA 3FH8A 2MOVA 4W81A 4E9YA 1A66A 1MFEL 1TEYA 3D85A 5EOTB 4XN2A 2FWOA 3MBED 2E27H 4G6JL 1R5IA 4G9FA 5LHDA 4Z6AT 3WDJA 2KHAA 3MBEB 4UU9B 2N01B 5HHVL 3ULSB 3VFTA 1KJ2B 2XNAB 3EJZD 2JK5B 4IKKA 2OMXB 2FX9L 4ADIA 2FHCA 4PRPE 4I1RA 4KK6D 5ISZE 1Q38A 3EOTL 4X7TB 4Z7UF 3V6ZA 4J2XA 3O45A 4HSCX 4PJ5B 1P9MA 4FJ6A 1FDLH 1JK9A 5DMKB 3WNPA 4FZEL 3BP4A 5CSZB 5K9OB 2Z4QB 3I6KB 1TPXC 4UYPA 1AD9A 4U3XA 5T3XE 3FS9A 3L5WA 5KVFL 4PLJD 3FPXA 2YBRB 3GMRA 1DVFC 3VX1A 3UL4A 5I1GH 1VIWA 3GSRA 5TF1L 1SOXA 3WLBB 4KVPA 1XGPB 3QFJA 3QAQA 4FXKA 1C7SA 4CDHA 3N6YA 2NLJA 3TXAA 4U0RB 1RZKC 2DQCH 3RWJA 5JYMA 1Q90A 2GUYA 2CGYA 1A3QA 3VFUA 3OAZH 2L0DA 1RP9A 2W9DL 5F72S 3MRNB 3MREA 2ITEA 4DKEH 2VDML 4R3SB 4EXPX 5JIIA 2MQ3A 3OLIA 1JMZA 4HKZB 1WG3A 2CGZA 4DN3L 4LCUA 5L6YL 2CUAA 3QDMD 4PJBA 2ZOLA 4WHDA 2X9WA 2B2XH 1FF5A 3QDMB 2N56A 4YFDB 1A9EB 3MLPA 5HHNB 2K70A 2EILB 3MV7E 3S37H 3FCUB 2WM0A 5LNEA 1V3MA 3LPGA 4Y19E 2FBRA 1JV5B 3CZFA 3Q5OA 3P4NA 2ZKWA 1OSPL 2ARJA 3B9VA 3CFQA 4HXBL 2ESVE 2QEJA 2Y1AA 4HQQL 4KI1A 4FI6A 1W80A 5KYWA 5DJ8B 4Y5VA 3QWOB 3QCUH 4BFBD 4KJWC 4YDJB 5JHMA 5J06A 2J4WL 5KEZA 2JJTA 4WSKA 5F7YC 4AZUA 4AT6A 1EGJH 4I48B 5CUSH 4CVXB 5BOJA 5CJXA 2VLRB 4U1LA 4JY4B 2B39A 4ONHB 1FH5H 5D8JH 5IEHA 5KG9A 5LUMA 4LZKA 1RLBA 1LDSA 1M3JA 2QSCH 2FEEI 5GIRA 3TEUA 4DOHE 3ULUL 3UACA 1JGVL 3DUSB 4N24A 1ZJBA 4FJZA 2C8NA 3C5ZB 2J2ZB 3VXUE 3NZHL 3IYLW 4QGTA 3CHSA 4JFEE 5IM7A 1QX1A 3MLSH 3VQ1C 1I8MA 4WJ5B 5ICZB 3CSYA 3G6JB 5F7NC 1OCRB 1L0YA 2W0KA 4NO3B 5DS8B 2F1BA 5F7EL 2PR4L 3ZLQC 3OXRA 3QI9C 4PUBH 1TZIA 3AM8A