2R6CG

Crystal form bh2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
138
Chain Sequence
LLPAFQNAERLLLAHMMRSRDVALVVQERIGGRFNIEEHRALAAYIYAFYEEGHEADPGALISRIPGELQPLASELSLLLIADDVSEQELEDYIRHVLNRPKWLMLKVKEQEKTEAERRKDFLTAARIAKEMIEMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of hexameric DnaB helicase and its complex with a domain of DnaG primase
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Replication
molecule keywords Replicative helicase
total genus 32
structure length 138
sequence length 138
chains with identical sequence H, I
ec nomenclature ec 2.7.7.-:
pdb deposition date 2007-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.860.10 Mainly Alpha Orthogonal Bundle DNAb Helicase; Chain A DNAb Helicase; Chain A 2r6cG01
4IM9A 2R6DA 2HAJA 3GXVA 2LZNA 1JWEA 4ESVA 1T3WA 1Z8SA 2Q6TA 2R6CG 2R5UA 2R6AA 2R6CA 2VYFA 1B79A 3BGWA 4EHSA 2R6AC
chains in the Genus database with same CATH superfamily
4IM9A 2R6DA 2HAJA 3GXVA 2LZNA 1JWEA 4ESVA 1T3WA 1Z8SA 2Q6TA 2R6CG 2R5UA 2R6AA 2R6CA 2VYFA 1B79A 3BGWA 4EHSA 2R6AC
chains in the Genus database with same CATH topology
4IM9A 2R6DA 2HAJA 3GXVA 2LZNA 1JWEA 4ESVA 1T3WA 1Z8SA 2Q6TA 2R6CG 2R5UA 2R6AA 2R6CA 2VYFA 1B79A 3BGWA 4EHSA 2R6AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IM9 A;  2R6D A;  2HAJ A;  3GXV A;  2LZN A;  1JWE A;  4ESV A;  1T3W A;  1Z8S A;  2Q6T A;  2R6C G;  2R5U A;  2R6A A;  2R6C A;  2VYF A;  1B79 A;  3BGW A;  4EHS A;  2R6A C; 
#chains in the Genus database with same CATH topology
 4IM9 A;  2R6D A;  2HAJ A;  3GXV A;  2LZN A;  1JWE A;  4ESV A;  1T3W A;  1Z8S A;  2Q6T A;  2R6C G;  2R5U A;  2R6A A;  2R6C A;  2VYF A;  1B79 A;  3BGW A;  4EHS A;  2R6A C; 
#chains in the Genus database with same CATH homology
 4IM9 A;  2R6D A;  2HAJ A;  3GXV A;  2LZN A;  1JWE A;  4ESV A;  1T3W A;  1Z8S A;  2Q6T A;  2R6C G;  2R5U A;  2R6A A;  2R6C A;  2VYF A;  1B79 A;  3BGW A;  4EHS A;  2R6A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...