2R6GF

The crystal structure of the e. coli maltose transporter
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
492
structure length
490
Chain Sequence
DALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITANWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title Crystal structure of a catalytic intermediate of the maltose transporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 131
structure length 490
sequence length 492
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 2r6gF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 2r6gF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 2r6gF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 2r6gF02
4JBWG 3PUWF 3PUZG 4YMWC 4JBWF 3PUYG 4YMSC 4XTCN 4YMTB 3PUZF 3PUXG 3RLFG 3PV0G 4KHZG 3TUIA 3PUYF 4XTCM 3D31C 3PUXF 2R6GG 4TQUN 3RLFF 3PV0F 4YMVC 4KHZF 4XIGN 4KI0G 2R6GF 3TUJA 3PUVG 4TQUM 3TUZA 3DHWA 4KI0F 4XIGM 4YMUC 3PUWG 2ONKC 3PUVF
chains in the Genus database with same CATH superfamily
2QVAA 3TLSA 1NAFA 5LMNT 5HXSA 5LP6E 4LF9T 2I6HA 2V26A 4IDPA 5AQPB 2Y8DA 2XAHB 2HPLA 3M3ZB 1I94T 5FXXA 5AQLB 4MFRA 4YHHT 4B3ST 2W67A 2OLTA 5JQGE 4DR2T 1OWAA 4AKHA 1HCIA 3F31A 4JI4T 3CMLA 4NUUA 5AFUL 3UQ4A 4TN7B 1SA0E 3SOLA 4UF0B 4KHZF 1HFAA 4A56A 2D0UA 2DI4A 1W0AA 3FXEB 2H7OA 4TNVA 5FL0A 4HWIB 3I0OA 3AA0B 4KHZG 2FJAA 3DJBA 2I59A 2BKPA 1W0BA 4IE7A 2QA7A 3RC8A 3VHLA 5FMNA 2KSRA 3ZYMA 4G2AA 2NWBA 4EOZB 3DP7A 4ZI7E 3FB2A 1FEWA 1N34T 4XZCA 4AKLA 3NZQA 4WZXA 3QNUA 2VKOA 4U74A 2LOPA 5HCMA 2V6XA 2CXDA 1SUMB 2WB5A 3AEBA 1CHUA 4H9PC 2MYSA 4PFOA 3QC9A 3ZJ2A 3AE5A 4TQUM 2BS2A 3HKDE 1UK5A 4JI8T 2BS3A 2CHOA 2D5UA 3EI0A 4QWNB 1T8BA 4UELA 4AQGA 5ABFB 2XQ7A 3A5XA 3AAIA 4LF8T 2L3LA 3NRXA 4H9QC 2WU5A 3E22E 5JDHA 5F8PA 1ZV4X 4QHOA 4JI2T 4H9RC 5LHGB 4AIUA 4UR9A 1US7B 4WW0A 4OYKA 2VASA 2WZHA 5AQOB 4OHFA 2LKHA 4UEMA 3FZLB 2WM9A 2V6YA 3J7Yq 1HNZT 3FZFB 2WMNA 1OEDA 3U78A 5JDLA 4JI6T 2WQYA 4UV8B 2NTXA 3N9LA 1BR0A 2W00A 3VR9A 4IE6A 5HCJA 2V7KA 3Q2MA 4LF5T 5LA6E 3D0TA 3ZC1A 3AVSA 4ZZCA 1HNWT 1AJ3A 3CK6A 1ZP0A 4IDNA 2JQQA 4QH5A 2V5CA 3VR8A 3E0ZA 1WRDA 5FYMA 3N9NA 3BQIA 2NW9A 5L3BB 2WBLA 1HX8A 4B3TT 3SFDA 5DJQC 5CGMA 2Q9QA 5LGTB 5FP3A 3ESLA 2XQ4A 2V6YB 2UUCT 4ZHQE 2BG9E 5HXRA 2IAKA 2XUEA 4IDOA 4DV6T 1OEDB 3UU6A 3TUJA 2AE9A 2XASB 3EDUA 2VURA 3IF8B 2NW7A 2BKOA 2HPJA 4C90A 4JBWF 3C50A 4O4LE 5LNKA 3ZC0A 2OV9A 3O1JA 4DUYT 3SFEA 2ZMAA 1XNRT 2N2NA 2LE8A 1YD8G 3N2KE 1VCSA 2X9YA 3UULA 2DWGA 3K8PC 4JBWG 2KNDA 5C2TA 3N5LA 3FBZA 5FXVA 4U3CA 5M4YA 4GYRA 3S4UA 4HFDA 1D0XA 5A1LA 3TKLB 5LB7B 4C91A 4F6RC 2M6BA 1KNRA 4JI5T 1WYCA 3RIFA 4H9SE 2IHR1 2WDVA 3QB5A 2CCQA 1VOMA 1IBMT 3R6NA 2X68A 3B13A 3V5SA 3N9MA 3AVRA 1QSDA 3MXZA 1D0ZA 3PU3A 4B6XA 2IC6A 4HFEA 2CWYA 4MALA 5AQNB 2NW8A 4EEDA 5BR8T 4JYAT 2W62A 2XSBA 1UX5A 3ZN1B 5AQSB 2BG9A 2CPTA 3PV0F 3EDVA 5F5WA 4X1KE 2PFVA 3C4ZA 4PJMA 1D1BA 2XZEA 2VVNA 5LOVE 3PUVF 3Q5WA 4AI6A 5ABHA 3MJXA 1H7CA 4MHCA 4YMWC 4DR4T 4IHJE 5DQVA 2K48A 1S94A 3UQ7A 3OTOT 3PV0G 2VQET 5AQFB 2CE7A 3OKQA 1UX4A 1XMQT 2R6GF 1WCRA 3PUVG 5JTGA 1ZEEA 5LBQB 4ILAA 5EK4A 4YMUC 4HWDA 1J5WA 4ZI3C 4ZI2D 4HEAA 4H9NC 2H88A 3WAJA 4EIWA 2JQKA 2ODVA 1WR0A 1ZOYA 2CXFA 2WAUA 3KBUA 5LJMA 4EZ4A 1R8IA 2W4XA 3UFEA 3ETVA 4F8HA 4CXWA 4H63H 4K0KT 3I9YA 1B7TA 4AKRB 4KBMB 1X9BA 1W9RA 1YQ4A 4COFA 1J1JA 3RGLA 3EAMA 5DQWA 4X66T 2EHOC 3GWHA 4EGWA 2X0LB 5AQJB 4YY3T 3ZN0B 4LFBT 2VWAA 4DV0T 2QGSA 5L3DB 3CQGB 4IT4A 3ZT7A 3JC6D 4JEHB 5AQUB 4ILBA 4M1PA 3A8YC 5CA1E 2KZ7B 1JNZA 1BR2A 4UVBB 3RX6A 2KLQA 2WZIA 2FJDA 3RYCE 5L4HA 3ZMVB 5KMGP 3CX6B 2X66A 3RIUC 1SE7A 4PK5A 4EB6E 2LSIA 1SHZC 3ZMUB 4E7ZA 1M62A 1HR0T 1YW0A 4NIQA 2A72A 5ABEA 4V1Av 4DV7T 4DV1T 2FUPA 2UU9T 5L4EA 3RC3A 2W63A 5LCYA 3UT5E 4DV2T 1Z0PA 4WNKA 2VK9A 2XQ5A 4UVAB 3TLWA 5HEUA 2V8SV 4G63A 4YJ2E 1GQEA 4PJLA 4AISA 4WYVA 3LK42 3MK7C 4TX5A 2X9HA 2XSAA 4A97A 2BZBA 4EYYR 3ETUA 3UU8A 2Q9QC 1IJ5A 3OPCA 2M67A 5KDMC 2WDQA 3KV6A 3TLUA 3C4WA 2N1GA 4H9OC 3ZPOA 4TQUN 3FZKB 3AA7B 2VKDA 2JPFA 2W2UA 4Z91A 3RF1A 3MA9A 3H3MA 1IZNB 3P4WA 2WWVA 1M7KA 4DV3T 4BAYB 3I9WA 5FNVE 2YOEA 4JI0T 3FZMB 2ZM2A 4JI1T 4QX8B 3RRCA 1ZKEA 3RKGA 2RPAA 2C5KT 3RQWA 1HF8A 3AEGA 4HFHA 5CFBA 3PTRB 2E8IA 1Z8UA 3AB3B 3B5MA 3ONXA 5EK3A 4JV5T 5KX5E 2IW5B 4ASKA 4XTCM 2WMOA 5FY7A 4ZS3A 2D0TA 2J4GA 2W61A 5FY1A 2L8KA 3AAAB 3N9QA 3RRWA 3AEEA 2KXPB 2YK0A 3CQCB 2W0GA 5TAOA 4YMTB 2X9XA 3PJAA 3K1SA 1XNQT 3SS1A 2WY2A 5LGUB 2LJLA 4A98A 3HI2A 3LK3B 4YHJA 4E7SA 4NUVA 5HWXA 3H3AA 3WI3A 2Z6EA 3NWIA 5KXJA 2BG9C 2ZM0A 2EHOA 2LOSA 4I4TE 2H89A 3J9X1 1UGOA 3ZSTA 4HWCA 2J1DG 3AECA 4PW8A 4AQYT 5IHYA 3N9OA 4DR1T 4CI1B 2X67A 2YDRA 2Y6XA 4ILCA 4L0RA 3RYHE 4IE0A 3RI5A 3ONJA 2NOXA 4UV9B 2CXLA 4OX9T 3RLFF 3RIUA 4ISTA 5DABA 3H37A 5EZYE 3P4RA 5JDNA 2XHEB 2LSGA 1VRBA 2EHOB 3UFGA 3AE1A 1QLBA 2J47A 3ZJ1A 2YDSA 5AQVB 4PNIA 3QOFA 3RLFG 4QXBB 5AQKB 1XWMA 3UU5A 3GN5A 2MTQA 3AE4A 3GA8A 3ZT6A 1MIVA 3HKEE 2A9UA 2KT9A 5JDMA 2XQ9A 4PK6A 2XJ7A 2QYWA 3UUNA 4X65T 2DLRA 4HN9A 4TUYE 2ACXA 4NPPA 2AXDS 2LSKA 2UXBT 4ZOLE 2JQ9A 5LMUT 5LYJE 5AQIB 5HEOA 5LXTE 3TUZA 3P4PA 2D9DA 1WFDA 3LG7A 4X5TA 2WS3A 4GIWA 5JH7E 1HNXT 1UUSA 5HEGA 2X0YA 3TUIA 4QXCB 2LHRA 2LSYA 5ADXL 3LSVA 4Z8XA 3CX8B 4AXPA 1T72A 3GN5B 3IA3A 2A3DA 5L3GB 2LLYA 4GKJT 4ISSA 5JDFA 1HG5A 2LT3A 5J2UE 1UURA 4PJNA 5AQTB 3CX7B 3O1IA 5AQGB 4X1YE 2GK9A 3ZKRA 3C64A 2JRKA 3HKCE 5JDGA 4EV6A 1MMAA 1V9DA 5JDQA 4DNDA 2BDEA 4QKNA 3R84B 4PK4A 3ANWA 5IYZE 2Q9QB 3P4QA 1IBKT 5AQQB 1HS7A 3SRZA 4ANJA 2HN2A 5FKYA 4DVDA 2XQ3A 2MBGA 2M6IA 3BK9A 2V5DA 4ZI2C 3E08A 4YMSC 5C8YE 3B57A 4DMWA 2XQAA 5H6RB 4A5XA 5ETWA 4IDQA 4LMJA 2E9XD 2YDQA 5J2TE 2HH7A 2V7LA 3CVRA 5LG4A 1T7SA 1NEKA 1YKHB 5IUXA 5FXZA 4QX7B 5LGNB 2CHNA 2IC9A 5EK2A 4AKIA 4N78D 2WWUA 3CQXC 3NRYA 4IE5A 2JJ9A 4CXYA 4BJMA 1D1AA 3NVOA 4BA9A 1D1CA 3K3QC 4DMVA 4HE8A 4LFCT 1L0VA 5J1GA 3JC6C 2ZLYA 2FJEA 2FBWA 2J62A 5GONE 3CPZA 2XQYA 3PUSA 3DHWA 5AQRB 5L2LA 4DV5T 2UXNB 3WAKA 2OA5A 3EHZA 1KEYA 3FBLA 1FMVA 5HWYA 4YTNA 2YU2A 1CUNA 3DTOA 2R6GG 2Y48B 5LJNA 2QRXA 3OYXA 3QB5K 4HFVA 2BG9B 1LRZA 3CWZB 1D0YA 3UTKA 4X1IE 1MMGA 2XAGB 3RQUA 4P09A 2VKJA 3TLTA 5FL1A 3O4XE 4O2BE 4I43B 1MNDA 1EZ3A 4DR6T 4K0UA 2UXXB 3C4XA 3P7IA 1YQ3A 3O1HA 3AE9A 4KP3C 3RKOA 3BQLA 1E2AA 2H7VC 5FVLA 3VRBA 4XIGM 3ONLC 4J2CA 1X79A 3PU8A 3EVYA 4JI7T 2YN6A 2E5LT 4PJJA 4XAXB 1KFYA 1IJ6A 5E0OA 2IDOB 2PTFA 4DR3T 2LRLA 2JMKA 1IBLT 2D2SA 4ZI3D 5LG3A 5AQHB 4XTCN 4HTEA 4GKKT 3PUXF 1UCUA 4MBQA 2BBJA 3K3NA 4U72A 3RYIE 3GMIA 4DIDB 5H6QB 4EEBA 4FJOA 2WSSV 5L3CB 2VKHA 1N36T 2WDRA 3PUXG 1Y01A 2XY8B 5HYAA 5C3JA 1LKXA 4QH1A 1BR1A 4DR7T 3A7MA 4IGUA 3PDYA 5JREA 4Z90A 2IIUA 3M65A 4DBRA 4UXNB 4ZS2A 2BKNA 3G06A 4UF0A 3SWHA 4IREA 4KMCA 3QUJA 4LF7T 3ZEFB 4LMLA 3IEEA 1WR6A 1MMNA 2C0SA 2RP4A 3W15B 2XQ6A 3I1AA 2E2AA 3L09A 2CWOA 3AA6B 2NR4A 2CRBA 4U2ZA 4DR5T 3C51A 2LRKA 3HKBE 4YSZA 4QH4A 4IE4A 4B3MT 2CBJA 4PAGA 3O9XA 4B3RT 4AQFA 3F2EA 4KUMB 2MOZA 4WBOA 3PUWF 3L8RA 3ZCIA 1FMWA 1W09A 5JVDE 2DCFA 4CI2B 3NKZA 1FIOA 2XAQB 1IAPA 2XQ8A 2F4VT 3AE3A 4I55E 1HX1B 3PUWG 2MAWA 2W66A 3EABA 4ERRA 1HG2A 3UU4A 4YSYA 3PUQA 4TZ4C 3ZSSA 3T1HT 3ZYKA 4EYUA 2XAJB 5JR9C 5ABFA 3T1YT 4U7IA 2Q9QD 4XBFB 1OEDE 1WYBA 5HXHA 1Y64B 5BMVE 3X1DA 2NTYA 2XM2A 3BQKA 3PUGA 4PFPA 3AA1B 1JNRA 4DO0A 5CB4E 2RA1A 1BR4A 2VL8A 3KVBA 4QXHB 4YTPA 2K9AA 4HKAA 3AAEB 3MACA 3ZMSB 4GK0E 3HR0A 4TWHA 3VKGA 1O3XA 3Q9DA 2JQHA 3VKHA 5HAXA 4OK0A 4CI3B 3KVAA 3JCFA 4I0UA 2MPKA 1XDOA 3T8OA 3CKDA 3NZPA 2LKGA 5J0ZA 3I0QA 4L9IA 4U2YA 3HL6A 4JEUB 5HEJA 4CN6A 4IDZA 4H63V 3FZHB 4DUZT 1LVFA 4KX6A 2ZM8A 3KINB 4BJNA 3AEFA 1ZHCA 3VRAA 2LSJA 2KWHA 2V1DB 2VB6A 2SPCA 2KWIB 4P0BA 2P9BA 1N33T 4HFBA 5L47A 3KBTA 2ES0A 2PJQA 3MKDA 2DL1A 2UUAT 2V7MA 1G73A 3KDSE 1YKEB 2DNXA 1LVKA 4JLEA 3KV5A 1KNPA 3RIAA 2CMRA 2XTLA 1U4QA 3OYZA 4DBQA 3OVUA 3FXDB 4JI3T 2JMHA 3PUYF 3ZMZB 3N2GE 3AEDA 3PE0A 2YINA 4U33A 1KF6A 4TV8E 4LFAT 2E9XC 4FI5A 2C5IT 2ODUA 2V7JA 2FJBA 4GK5E 4OYJA 3PUYG 5LBMA 1I6ZA 3OJAA 4UIGA 2K5BB 4YT0A 3N9PA 2CLYC 3RYFE 4KI0F 2CEAA 4IIJE 3L3PA 1KNZA 3ZMTB 4ADZA 4TWFA 3V5UA 4EAHA 2IUBA 1MNEA 3KV9A 4KI0G 1XMOT 2WU2A 2LEHA 1OXZA 2YKSA 2BBHA 1XZYA 2LM9A 5JRCA 2BVLA 4LF4T 3LBXA 1MIWA 4TNWA 5FVKA 2B76A 3D31C 3PJAJ 3K3OA 3KV4A 4CZZB 3L39A 5CJ5A 4EXTA 4IL4A 3PURA 3Q5EA 5JR9A 1QUUA 1E1HB 2CM0A 2PBIA 2H3RA 2A2FX 4YXDA 1FJGT 1J5ET 2IMLA 4XIGN 4GOUA 4HWFA 3PUAA 3ANWB 4TV9E 5FXWA 4AQFC 3AE6A 3ZYLA 3MZKB 2CBIA 2NP9A 4YLHA 5HEHA 4CQIA 5JRCB 4X20E 2DWKA 5LHHB 4O4IE 4LF6T 3LBXB 4JUYA 4P0AA 4CN4A 3C98B 4O4HE 2K24A 4HFCA 4HWHA 2VQFT 4YJ3E 5JR9B 1MMDA 4HGAA 1NENA 3FHNA 4YSXA 2DHRA 1VCTA 1U5PA 3UUXB 3AE7A 3P50A 4CN1A 2ACZA 2YEVC 2X0HA 3JAEA 3AE8A 3AEAA 5LHIB 3Q5DA 3RPUA 4X64T 1YXRA 3UUMA 2KMFA 3LJCA 3HA4A 2HHHT 4UVCB 2VL0A 4I50E 4O8SA 3AXJA 5AQMB 3LFMA 4KHPT 1HTJF 2WP9A 3IHRA 2UUBT 5HXEA 5HXCA 4WBNE 5L3EB 4L5GA 2XAFB 3AE2A 2JIWA 3OBVE 2K3WA 3PUZF 4Q25A 3UUBA 3U3IA 4EZHA 2BVMA 4NXMT 5IWAT 3NBXX 3RH3A 4ZEYA 3Q5XA 3LK2B 1N32T 1DU2A 3PUZG 2CA5A 1NWMX 4U31A 4HFIA 4TWDA 3F57A 1E7PA 3TLVA 2I0MA 4YTMA 2X51A 3UU3A 3LDQB 3AXJB 2E9XA 3EUHA 4CXXA 4ZZBA 2VVSA 3JAFA 4IL9A 2KINB 2LM2A 2XPKA 3ABVA 2G0UA 4ILUA 2LHNA 5FY0A 2L9QA 3ZCJA 2PG8A 2N9DA 1WLXA 4O2AE 5CA0E 3JADA 3P4SA 5L3FB 3N2OA 1S35A 4AKGA 1OEDC 4MLKA 2X9WA 2B1EA 1XDPA 4DV4T 2HN1A 2XM1A 2EHOD 3ZLIA 4YMVC 1KK7A 2YU1A 4NXNT 4X62T 3VU7H 3IBPA 3QK6A 4O4JE 4YFSA 2E5VA 2ZM6T 4U7YA 2WCAA 4OFZA 2V7IA 2BS4A 3ZT5A 4P1NA 1G8XA 4LMKA 2C5JA 2E9XB 1MIYA 3KFWX 4GYSA 5ABGA 2UXDT 3CIRA 4ZXLA 3RHWA 2UXCT 5F3JA 3P8CD 2CLYB 1T98A 2ONKC
chains in the Genus database with same CATH topology
4JBWG 3PUWF 3PUZG 4YMWC 4JBWF 3PUYG 4YMSC 4XTCN 4YMTB 3PUZF 3PUXG 3RLFG 3PV0G 4KHZG 3TUIA 3PUYF 4XTCM 3D31C 3PUXF 2R6GG 4TQUN 3RLFF 3PV0F 4YMVC 4KHZF 4XIGN 4KI0G 2R6GF 3TUJA 3PUVG 4TQUM 3TUZA 3DHWA 4KI0F 4XIGM 4YMUC 3PUWG 2ONKC 3PUVF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBW G;  3PUW F;  3PUZ G;  4YMW C;  4JBW F;  3PUY G;  4YMS C;  4XTC N;  4YMT B;  3PUZ F;  3PUX G;  3RLF G;  3PV0 G;  4KHZ G;  3TUI A;  3PUY F;  4XTC M;  3D31 C;  3PUX F;  2R6G G;  4TQU N;  3RLF F;  3PV0 F;  4YMV C;  4KHZ F;  4XIG N;  4KI0 G;  2R6G F;  3TUJ A;  3PUV G;  4TQU M;  3TUZ A;  3DHW A;  4KI0 F;  4XIG M;  4YMU C;  3PUW G;  2ONK C;  3PUV F; 
#chains in the Genus database with same CATH topology
 2QVA A;  3TLS A;  1NAF A;  5LMN T;  5HXS A;  5LP6 E;  4LF9 T;  2I6H A;  2V26 A;  4IDP A;  5AQP B;  2Y8D A;  2XAH B;  2HPL A;  3M3Z B;  1I94 T;  5FXX A;  5AQL B;  4MFR A;  4YHH T;  4B3S T;  2W67 A;  2OLT A;  5JQG E;  4DR2 T;  1OWA A;  4AKH A;  1HCI A;  3F31 A;  4JI4 T;  3CML A;  4NUU A;  5AFU L;  3UQ4 A;  4TN7 B;  1SA0 E;  3SOL A;  4UF0 B;  4KHZ F;  1HFA A;  4A56 A;  2D0U A;  2DI4 A;  1W0A A;  3FXE B;  2H7O A;  4TNV A;  5FL0 A;  4HWI B;  3I0O A;  3AA0 B;  4KHZ G;  2FJA A;  3DJB A;  2I59 A;  2BKP A;  1W0B A;  4IE7 A;  2QA7 A;  3RC8 A;  3VHL A;  5FMN A;  2KSR A;  3ZYM A;  4G2A A;  2NWB A;  4EOZ B;  3DP7 A;  4ZI7 E;  3FB2 A;  1FEW A;  1N34 T;  4XZC A;  4AKL A;  3NZQ A;  4WZX A;  3QNU A;  2VKO A;  4U74 A;  2LOP A;  5HCM A;  2V6X A;  2CXD A;  1SUM B;  2WB5 A;  3AEB A;  1CHU A;  4H9P C;  2MYS A;  4PFO A;  3QC9 A;  3ZJ2 A;  3AE5 A;  4TQU M;  2BS2 A;  3HKD E;  1UK5 A;  4JI8 T;  2BS3 A;  2CHO A;  2D5U A;  3EI0 A;  4QWN B;  1T8B A;  4UEL A;  4AQG A;  5ABF B;  2XQ7 A;  3A5X A;  3AAI A;  4LF8 T;  2L3L A;  3NRX A;  4H9Q C;  2WU5 A;  3E22 E;  5JDH A;  5F8P A;  1ZV4 X;  4QHO A;  4JI2 T;  4H9R C;  5LHG B;  4AIU A;  4UR9 A;  1US7 B;  4WW0 A;  4OYK A;  2VAS A;  2WZH A;  5AQO B;  4OHF A;  2LKH A;  4UEM A;  3FZL B;  2WM9 A;  2V6Y A;  3J7Y q;  1HNZ T;  3FZF B;  2WMN A;  1OED A;  3U78 A;  5JDL A;  4JI6 T;  2WQY A;  4UV8 B;  2NTX A;  3N9L A;  1BR0 A;  2W00 A;  3VR9 A;  4IE6 A;  5HCJ A;  2V7K A;  3Q2M A;  4LF5 T;  5LA6 E;  3D0T A;  3ZC1 A;  3AVS A;  4ZZC A;  1HNW T;  1AJ3 A;  3CK6 A;  1ZP0 A;  4IDN A;  2JQQ A;  4QH5 A;  2V5C A;  3VR8 A;  3E0Z A;  1WRD A;  5FYM A;  3N9N A;  3BQI A;  2NW9 A;  5L3B B;  2WBL A;  1HX8 A;  4B3T T;  3SFD A;  5DJQ C;  5CGM A;  2Q9Q A;  5LGT B;  5FP3 A;  3ESL A;  2XQ4 A;  2V6Y B;  2UUC T;  4ZHQ E;  2BG9 E;  5HXR A;  2IAK A;  2XUE A;  4IDO A;  4DV6 T;  1OED B;  3UU6 A;  3TUJ A;  2AE9 A;  2XAS B;  3EDU A;  2VUR A;  3IF8 B;  2NW7 A;  2BKO A;  2HPJ A;  4C90 A;  4JBW F;  3C50 A;  4O4L E;  5LNK A;  3ZC0 A;  2OV9 A;  3O1J A;  4DUY T;  3SFE A;  2ZMA A;  1XNR T;  2N2N A;  2LE8 A;  1YD8 G;  3N2K E;  1VCS A;  2X9Y A;  3UUL A;  2DWG A;  3K8P C;  4JBW G;  2KND A;  5C2T A;  3N5L A;  3FBZ A;  5FXV A;  4U3C A;  5M4Y A;  4GYR A;  3S4U A;  4HFD A;  1D0X A;  5A1L A;  3TKL B;  5LB7 B;  4C91 A;  4F6R C;  2M6B A;  1KNR A;  4JI5 T;  1WYC A;  3RIF A;  4H9S E;  2IHR 1;  2WDV A;  3QB5 A;  2CCQ A;  1VOM A;  1IBM T;  3R6N A;  2X68 A;  3B13 A;  3V5S A;  3N9M A;  3AVR A;  1QSD A;  3MXZ A;  1D0Z A;  3PU3 A;  4B6X A;  2IC6 A;  4HFE A;  2CWY A;  4MAL A;  5AQN B;  2NW8 A;  4EED A;  5BR8 T;  4JYA T;  2W62 A;  2XSB A;  1UX5 A;  3ZN1 B;  5AQS B;  2BG9 A;  2CPT A;  3PV0 F;  3EDV A;  5F5W A;  4X1K E;  2PFV A;  3C4Z A;  4PJM A;  1D1B A;  2XZE A;  2VVN A;  5LOV E;  3PUV F;  3Q5W A;  4AI6 A;  5ABH A;  3MJX A;  1H7C A;  4MHC A;  4YMW C;  4DR4 T;  4IHJ E;  5DQV A;  2K48 A;  1S94 A;  3UQ7 A;  3OTO T;  3PV0 G;  2VQE T;  5AQF B;  2CE7 A;  3OKQ A;  1UX4 A;  1XMQ T;  2R6G F;  1WCR A;  3PUV G;  5JTG A;  1ZEE A;  5LBQ B;  4ILA A;  5EK4 A;  4YMU C;  4HWD A;  1J5W A;  4ZI3 C;  4ZI2 D;  4HEA A;  4H9N C;  2H88 A;  3WAJ A;  4EIW A;  2JQK A;  2ODV A;  1WR0 A;  1ZOY A;  2CXF A;  2WAU A;  3KBU A;  5LJM A;  4EZ4 A;  1R8I A;  2W4X A;  3UFE A;  3ETV A;  4F8H A;  4CXW A;  4H63 H;  4K0K T;  3I9Y A;  1B7T A;  4AKR B;  4KBM B;  1X9B A;  1W9R A;  1YQ4 A;  4COF A;  1J1J A;  3RGL A;  3EAM A;  5DQW A;  4X66 T;  2EHO C;  3GWH A;  4EGW A;  2X0L B;  5AQJ B;  4YY3 T;  3ZN0 B;  4LFB T;  2VWA A;  4DV0 T;  2QGS A;  5L3D B;  3CQG B;  4IT4 A;  3ZT7 A;  3JC6 D;  4JEH B;  5AQU B;  4ILB A;  4M1P A;  3A8Y C;  5CA1 E;  2KZ7 B;  1JNZ A;  1BR2 A;  4UVB B;  3RX6 A;  2KLQ A;  2WZI A;  2FJD A;  3RYC E;  5L4H A;  3ZMV B;  5KMG P;  3CX6 B;  2X66 A;  3RIU C;  1SE7 A;  4PK5 A;  4EB6 E;  2LSI A;  1SHZ C;  3ZMU B;  4E7Z A;  1M62 A;  1HR0 T;  1YW0 A;  4NIQ A;  2A72 A;  5ABE A;  4V1A v;  4DV7 T;  4DV1 T;  2FUP A;  2UU9 T;  5L4E A;  3RC3 A;  2W63 A;  5LCY A;  3UT5 E;  4DV2 T;  1Z0P A;  4WNK A;  2VK9 A;  2XQ5 A;  4UVA B;  3TLW A;  5HEU A;  2V8S V;  4G63 A;  4YJ2 E;  1GQE A;  4PJL A;  4AIS A;  4WYV A;  3LK4 2;  3MK7 C;  4TX5 A;  2X9H A;  2XSA A;  4A97 A;  2BZB A;  4EYY R;  3ETU A;  3UU8 A;  2Q9Q C;  1IJ5 A;  3OPC A;  2M67 A;  5KDM C;  2WDQ A;  3KV6 A;  3TLU A;  3C4W A;  2N1G A;  4H9O C;  3ZPO A;  4TQU N;  3FZK B;  3AA7 B;  2VKD A;  2JPF A;  2W2U A;  4Z91 A;  3RF1 A;  3MA9 A;  3H3M A;  1IZN B;  3P4W A;  2WWV A;  1M7K A;  4DV3 T;  4BAY B;  3I9W A;  5FNV E;  2YOE A;  4JI0 T;  3FZM B;  2ZM2 A;  4JI1 T;  4QX8 B;  3RRC A;  1ZKE A;  3RKG A;  2RPA A;  2C5K T;  3RQW A;  1HF8 A;  3AEG A;  4HFH A;  5CFB A;  3PTR B;  2E8I A;  1Z8U A;  3AB3 B;  3B5M A;  3ONX A;  5EK3 A;  4JV5 T;  5KX5 E;  2IW5 B;  4ASK A;  4XTC M;  2WMO A;  5FY7 A;  4ZS3 A;  2D0T A;  2J4G A;  2W61 A;  5FY1 A;  2L8K A;  3AAA B;  3N9Q A;  3RRW A;  3AEE A;  2KXP B;  2YK0 A;  3CQC B;  2W0G A;  5TAO A;  4YMT B;  2X9X A;  3PJA A;  3K1S A;  1XNQ T;  3SS1 A;  2WY2 A;  5LGU B;  2LJL A;  4A98 A;  3HI2 A;  3LK3 B;  4YHJ A;  4E7S A;  4NUV A;  5HWX A;  3H3A A;  3WI3 A;  2Z6E A;  3NWI A;  5KXJ A;  2BG9 C;  2ZM0 A;  2EHO A;  2LOS A;  4I4T E;  2H89 A;  3J9X 1;  1UGO A;  3ZST A;  4HWC A;  2J1D G;  3AEC A;  4PW8 A;  4AQY T;  5IHY A;  3N9O A;  4DR1 T;  4CI1 B;  2X67 A;  2YDR A;  2Y6X A;  4ILC A;  4L0R A;  3RYH E;  4IE0 A;  3RI5 A;  3ONJ A;  2NOX A;  4UV9 B;  2CXL A;  4OX9 T;  3RLF F;  3RIU A;  4IST A;  5DAB A;  3H37 A;  5EZY E;  3P4R A;  5JDN A;  2XHE B;  2LSG A;  1VRB A;  2EHO B;  3UFG A;  3AE1 A;  1QLB A;  2J47 A;  3ZJ1 A;  2YDS A;  5AQV B;  4PNI A;  3QOF A;  3RLF G;  4QXB B;  5AQK B;  1XWM A;  3UU5 A;  3GN5 A;  2MTQ A;  3AE4 A;  3GA8 A;  3ZT6 A;  1MIV A;  3HKE E;  2A9U A;  2KT9 A;  5JDM A;  2XQ9 A;  4PK6 A;  2XJ7 A;  2QYW A;  3UUN A;  4X65 T;  2DLR A;  4HN9 A;  4TUY E;  2ACX A;  4NPP A;  2AXD S;  2LSK A;  2UXB T;  4ZOL E;  2JQ9 A;  5LMU T;  5LYJ E;  5AQI B;  5HEO A;  5LXT E;  3TUZ A;  3P4P A;  2D9D A;  1WFD A;  3LG7 A;  4X5T A;  2WS3 A;  4GIW A;  5JH7 E;  1HNX T;  1UUS A;  5HEG A;  2X0Y A;  3TUI A;  4QXC B;  2LHR A;  2LSY A;  5ADX L;  3LSV A;  4Z8X A;  3CX8 B;  4AXP A;  1T72 A;  3GN5 B;  3IA3 A;  2A3D A;  5L3G B;  2LLY A;  4GKJ T;  4ISS A;  5JDF A;  1HG5 A;  2LT3 A;  5J2U E;  1UUR A;  4PJN A;  5AQT B;  3CX7 B;  3O1I A;  5AQG B;  4X1Y E;  2GK9 A;  3ZKR A;  3C64 A;  2JRK A;  3HKC E;  5JDG A;  4EV6 A;  1MMA A;  1V9D A;  5JDQ A;  4DND A;  2BDE A;  4QKN A;  3R84 B;  4PK4 A;  3ANW A;  5IYZ E;  2Q9Q B;  3P4Q A;  1IBK T;  5AQQ B;  1HS7 A;  3SRZ A;  4ANJ A;  2HN2 A;  5FKY A;  4DVD A;  2XQ3 A;  2MBG A;  2M6I A;  3BK9 A;  2V5D A;  4ZI2 C;  3E08 A;  4YMS C;  5C8Y E;  3B57 A;  4DMW A;  2XQA A;  5H6R B;  4A5X A;  5ETW A;  4IDQ A;  4LMJ A;  2E9X D;  2YDQ A;  5J2T E;  2HH7 A;  2V7L A;  3CVR A;  5LG4 A;  1T7S A;  1NEK A;  1YKH B;  5IUX A;  5FXZ A;  4QX7 B;  5LGN B;  2CHN A;  2IC9 A;  5EK2 A;  4AKI A;  4N78 D;  2WWU A;  3CQX C;  3NRY A;  4IE5 A;  2JJ9 A;  4CXY A;  4BJM A;  1D1A A;  3NVO A;  4BA9 A;  1D1C A;  3K3Q C;  4DMV A;  4HE8 A;  4LFC T;  1L0V A;  5J1G A;  3JC6 C;  2ZLY A;  2FJE A;  2FBW A;  2J62 A;  5GON E;  3CPZ A;  2XQY A;  3PUS A;  3DHW A;  5AQR B;  5L2L A;  4DV5 T;  2UXN B;  3WAK A;  2OA5 A;  3EHZ A;  1KEY A;  3FBL A;  1FMV A;  5HWY A;  4YTN A;  2YU2 A;  1CUN A;  3DTO A;  2R6G G;  2Y48 B;  5LJN A;  2QRX A;  3OYX A;  3QB5 K;  4HFV A;  2BG9 B;  1LRZ A;  3CWZ B;  1D0Y A;  3UTK A;  4X1I E;  1MMG A;  2XAG B;  3RQU A;  4P09 A;  2VKJ A;  3TLT A;  5FL1 A;  3O4X E;  4O2B E;  4I43 B;  1MND A;  1EZ3 A;  4DR6 T;  4K0U A;  2UXX B;  3C4X A;  3P7I A;  1YQ3 A;  3O1H A;  3AE9 A;  4KP3 C;  3RKO A;  3BQL A;  1E2A A;  2H7V C;  5FVL A;  3VRB A;  4XIG M;  3ONL C;  4J2C A;  1X79 A;  3PU8 A;  3EVY A;  4JI7 T;  2YN6 A;  2E5L T;  4PJJ A;  4XAX B;  1KFY A;  1IJ6 A;  5E0O A;  2IDO B;  2PTF A;  4DR3 T;  2LRL A;  2JMK A;  1IBL T;  2D2S A;  4ZI3 D;  5LG3 A;  5AQH B;  4XTC N;  4HTE A;  4GKK T;  3PUX F;  1UCU A;  4MBQ A;  2BBJ A;  3K3N A;  4U72 A;  3RYI E;  3GMI A;  4DID B;  5H6Q B;  4EEB A;  4FJO A;  2WSS V;  5L3C B;  2VKH A;  1N36 T;  2WDR A;  3PUX G;  1Y01 A;  2XY8 B;  5HYA A;  5C3J A;  1LKX A;  4QH1 A;  1BR1 A;  4DR7 T;  3A7M A;  4IGU A;  3PDY A;  5JRE A;  4Z90 A;  2IIU A;  3M65 A;  4DBR A;  4UXN B;  4ZS2 A;  2BKN A;  3G06 A;  4UF0 A;  3SWH A;  4IRE A;  4KMC A;  3QUJ A;  4LF7 T;  3ZEF B;  4LML A;  3IEE A;  1WR6 A;  1MMN A;  2C0S A;  2RP4 A;  3W15 B;  2XQ6 A;  3I1A A;  2E2A A;  3L09 A;  2CWO A;  3AA6 B;  2NR4 A;  2CRB A;  4U2Z A;  4DR5 T;  3C51 A;  2LRK A;  3HKB E;  4YSZ A;  4QH4 A;  4IE4 A;  4B3M T;  2CBJ A;  4PAG A;  3O9X A;  4B3R T;  4AQF A;  3F2E A;  4KUM B;  2MOZ A;  4WBO A;  3PUW F;  3L8R A;  3ZCI A;  1FMW A;  1W09 A;  5JVD E;  2DCF A;  4CI2 B;  3NKZ A;  1FIO A;  2XAQ B;  1IAP A;  2XQ8 A;  2F4V T;  3AE3 A;  4I55 E;  1HX1 B;  3PUW G;  2MAW A;  2W66 A;  3EAB A;  4ERR A;  1HG2 A;  3UU4 A;  4YSY A;  3PUQ A;  4TZ4 C;  3ZSS A;  3T1H T;  3ZYK A;  4EYU A;  2XAJ B;  5JR9 C;  5ABF A;  3T1Y T;  4U7I A;  2Q9Q D;  4XBF B;  1OED E;  1WYB A;  5HXH A;  1Y64 B;  5BMV E;  3X1D A;  2NTY A;  2XM2 A;  3BQK A;  3PUG A;  4PFP A;  3AA1 B;  1JNR A;  4DO0 A;  5CB4 E;  2RA1 A;  1BR4 A;  2VL8 A;  3KVB A;  4QXH B;  4YTP A;  2K9A A;  4HKA A;  3AAE B;  3MAC A;  3ZMS B;  4GK0 E;  3HR0 A;  4TWH A;  3VKG A;  1O3X A;  3Q9D A;  2JQH A;  3VKH A;  5HAX A;  4OK0 A;  4CI3 B;  3KVA A;  3JCF A;  4I0U A;  2MPK A;  1XDO A;  3T8O A;  3CKD A;  3NZP A;  2LKG A;  5J0Z A;  3I0Q A;  4L9I A;  4U2Y A;  3HL6 A;  4JEU B;  5HEJ A;  4CN6 A;  4IDZ A;  4H63 V;  3FZH B;  4DUZ T;  1LVF A;  4KX6 A;  2ZM8 A;  3KIN B;  4BJN A;  3AEF A;  1ZHC A;  3VRA A;  2LSJ A;  2KWH A;  2V1D B;  2VB6 A;  2SPC A;  2KWI B;  4P0B A;  2P9B A;  1N33 T;  4HFB A;  5L47 A;  3KBT A;  2ES0 A;  2PJQ A;  3MKD A;  2DL1 A;  2UUA T;  2V7M A;  1G73 A;  3KDS E;  1YKE B;  2DNX A;  1LVK A;  4JLE A;  3KV5 A;  1KNP A;  3RIA A;  2CMR A;  2XTL A;  1U4Q A;  3OYZ A;  4DBQ A;  3OVU A;  3FXD B;  4JI3 T;  2JMH A;  3PUY F;  3ZMZ B;  3N2G E;  3AED A;  3PE0 A;  2YIN A;  4U33 A;  1KF6 A;  4TV8 E;  4LFA T;  2E9X C;  4FI5 A;  2C5I T;  2ODU A;  2V7J A;  2FJB A;  4GK5 E;  4OYJ A;  3PUY G;  5LBM A;  1I6Z A;  3OJA A;  4UIG A;  2K5B B;  4YT0 A;  3N9P A;  2CLY C;  3RYF E;  4KI0 F;  2CEA A;  4IIJ E;  3L3P A;  1KNZ A;  3ZMT B;  4ADZ A;  4TWF A;  3V5U A;  4EAH A;  2IUB A;  1MNE A;  3KV9 A;  4KI0 G;  1XMO T;  2WU2 A;  2LEH A;  1OXZ A;  2YKS A;  2BBH A;  1XZY A;  2LM9 A;  5JRC A;  2BVL A;  4LF4 T;  3LBX A;  1MIW A;  4TNW A;  5FVK A;  2B76 A;  3D31 C;  3PJA J;  3K3O A;  3KV4 A;  4CZZ B;  3L39 A;  5CJ5 A;  4EXT A;  4IL4 A;  3PUR A;  3Q5E A;  5JR9 A;  1QUU A;  1E1H B;  2CM0 A;  2PBI A;  2H3R A;  2A2F X;  4YXD A;  1FJG T;  1J5E T;  2IML A;  4XIG N;  4GOU A;  4HWF A;  3PUA A;  3ANW B;  4TV9 E;  5FXW A;  4AQF C;  3AE6 A;  3ZYL A;  3MZK B;  2CBI A;  2NP9 A;  4YLH A;  5HEH A;  4CQI A;  5JRC B;  4X20 E;  2DWK A;  5LHH B;  4O4I E;  4LF6 T;  3LBX B;  4JUY A;  4P0A A;  4CN4 A;  3C98 B;  4O4H E;  2K24 A;  4HFC A;  4HWH A;  2VQF T;  4YJ3 E;  5JR9 B;  1MMD A;  4HGA A;  1NEN A;  3FHN A;  4YSX A;  2DHR A;  1VCT A;  1U5P A;  3UUX B;  3AE7 A;  3P50 A;  4CN1 A;  2ACZ A;  2YEV C;  2X0H A;  3JAE A;  3AE8 A;  3AEA A;  5LHI B;  3Q5D A;  3RPU A;  4X64 T;  1YXR A;  3UUM A;  2KMF A;  3LJC A;  3HA4 A;  2HHH T;  4UVC B;  2VL0 A;  4I50 E;  4O8S A;  3AXJ A;  5AQM B;  3LFM A;  4KHP T;  1HTJ F;  2WP9 A;  3IHR A;  2UUB T;  5HXE A;  5HXC A;  4WBN E;  5L3E B;  4L5G A;  2XAF B;  3AE2 A;  2JIW A;  3OBV E;  2K3W A;  3PUZ F;  4Q25 A;  3UUB A;  3U3I A;  4EZH A;  2BVM A;  4NXM T;  5IWA T;  3NBX X;  3RH3 A;  4ZEY A;  3Q5X A;  3LK2 B;  1N32 T;  1DU2 A;  3PUZ G;  2CA5 A;  1NWM X;  4U31 A;  4HFI A;  4TWD A;  3F57 A;  1E7P A;  3TLV A;  2I0M A;  4YTM A;  2X51 A;  3UU3 A;  3LDQ B;  3AXJ B;  2E9X A;  3EUH A;  4CXX A;  4ZZB A;  2VVS A;  3JAF A;  4IL9 A;  2KIN B;  2LM2 A;  2XPK A;  3ABV A;  2G0U A;  4ILU A;  2LHN A;  5FY0 A;  2L9Q A;  3ZCJ A;  2PG8 A;  2N9D A;  1WLX A;  4O2A E;  5CA0 E;  3JAD A;  3P4S A;  5L3F B;  3N2O A;  1S35 A;  4AKG A;  1OED C;  4MLK A;  2X9W A;  2B1E A;  1XDP A;  4DV4 T;  2HN1 A;  2XM1 A;  2EHO D;  3ZLI A;  4YMV C;  1KK7 A;  2YU1 A;  4NXN T;  4X62 T;  3VU7 H;  3IBP A;  3QK6 A;  4O4J E;  4YFS A;  2E5V A;  2ZM6 T;  4U7Y A;  2WCA A;  4OFZ A;  2V7I A;  2BS4 A;  3ZT5 A;  4P1N A;  1G8X A;  4LMK A;  2C5J A;  2E9X B;  1MIY A;  3KFW X;  4GYS A;  5ABG A;  2UXD T;  3CIR A;  4ZXL A;  3RHW A;  2UXC T;  5F3J A;  3P8C D;  2CLY B;  1T98 A;  2ONK C; 
#chains in the Genus database with same CATH homology
 4JBW G;  3PUW F;  3PUZ G;  4YMW C;  4JBW F;  3PUY G;  4YMS C;  4XTC N;  4YMT B;  3PUZ F;  3PUX G;  3RLF G;  3PV0 G;  4KHZ G;  3TUI A;  3PUY F;  4XTC M;  3D31 C;  3PUX F;  2R6G G;  4TQU N;  3RLF F;  3PV0 F;  4YMV C;  4KHZ F;  4XIG N;  4KI0 G;  2R6G F;  3TUJ A;  3PUV G;  4TQU M;  3TUZ A;  3DHW A;  4KI0 F;  4XIG M;  4YMU C;  3PUW G;  2ONK C;  3PUV F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...