2R6GF

The crystal structure of the e. coli maltose transporter
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
492
structure length
490
Chain Sequence
DALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITANWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a catalytic intermediate of the maltose transporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
total genus 131
structure length 490
sequence length 492
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 2r6gF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 2r6gF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 2r6gF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 2r6gF02
4TQUN 4XTCM 4YMSC 3PUZG 3PUYG 3PV0F 4KI0G 3PV0G 3PUYF 4KI0F 3PUZF 4YMWC 4YMVC 4TQUM 4XTCN 3PUXF 3D31C 3RLFF 3PUVF 4YMUC 4KHZG 2R6GG 3PUWF 4YMTB 4JBWF 3TUJA 4JBWG 3PUWG 2R6GF 4KHZF 2ONKC 3TUIA 4XIGN 4XIGM 3TUZA 3PUVG 3RLFG 3PUXG 3DHWA
chains in the Genus database with same CATH superfamily
4KUMB 2XM2A 3HKCE 2FBWA 4ZS3A 5J1GA 4QXBB 4YMWC 2YN6A 2W00A 3AEBA 1MIYA 5AQSB 5CFBA 2WBLA 1CHUA 3SWHA 1S94A 4IE4A 1ZOYA 1SE7A 5FYMA 3KBUA 1Z8UA 2IAKA 2WAUA 3EVYA 3WI3A 3N9NA 3JCFA 4KHZG 3UUXB 2LSYA 2V6YA 2WP9A 3PTRB 1YKHB 2G0UA 4HGAA 5JR9A 4ZOLE 3RC3A 4EYYR 4DV6T 3KINB 1XMOT 5KXJA 2OA5A 5LHGB 3EDVA 4X1KE 1HFAA 3ANWB 4A97A 4EIWA 1G8XA 5LG4A 4B3RT 3Q5DA 1Z0PA 1WLXA 2Z6EA 3O1HA 4HN9A 3S4UA 5BMVE 4YFSA 4OX9T 3MJXA 2ONKC 2J62A 2VASA 2WDRA 2XQ6A 1ZEEA 3RH3A 2MAWA 3VU7H 4ZI3D 1J5WA 5HEJA 4U74A 5JTGA 4DV1T 2EHOC 2Y6XA 2VQFT 4HWHA 4YTMA 4JI0T 3FHNA 3ZYKA 2MBGA 3CX6B 2NTXA 3PUYF 4X1YE 4KX6A 2XUEA 2L3LA 3KVAA 1HS7A 3OVUA 2Y48B 1YXRA 2DL1A 3AE3A 3LK2B 3D31C 4H63H 4HTEA 1ZHCA 1FIOA 2D9DA 3ETUA 3K1SA 4L5GA 4O2AE 3ZMZB 2N2NA 5LGTB 1FEWA 5J0ZA 1UGOA 3RQWA 3CVRA 3DJBA 2M6IA 3RIUA 4DV5T 2ZM2A 2XQ9A 1BR0A 4HKAA 1KK7A 3CIRA 3V5SA 5L4HA 3AE9A 4CI1B 1KNZA 5FNVE 3RHWA 4EEBA 3E08A 4IDPA 3CK6A 3FXEB 3L39A 3UTKA 2Q9QB 4JYAT 3HI2A 4B3TT 1IZNB 3TLVA 4UIGA 4ISSA 3RLFG 5JR9B 4O4IE 3R84B 4C90A 4J2CA 5FP3A 2XAHB 3JADA 1KNRA 2N1GA 3UFEA 4YMSC 3FZMB 2UXCT 4TV8E 2L8KA 3H3MA 2VL8A 3FXDB 2UUBT 5F5WA 3T1YT 4HFCA 3SFDA 3ZJ2A 5AQOB 5JDHA 4HFVA 2BBHA 2X51A 2JRKA 5GONE 2XPKA 4LF8T 5JR9C 4K0KT 3K3OA 3AEAA 3SFEA 2YU1A 3P8CD 4MFRA 5JVDE 1N32T 2H7VC 5HCMA 4OYJA 4COFA 4LFAT 4YMTB 3FZLB 4TUYE 1SUMB 2OLTA 3ONJA 2ODUA 1SHZC 1W0BA 2Q9QD 2X68A 5F8PA 2AE9A 4EAHA 1D1AA 4YSYA 2V5DA 4LF7T 3CQCB 4N78D 4BJNA 4IE5A 3IF8B 2BKPA 3L09A 3ZMTB 5JDMA 4DV2T 4LMJA 5LHHB 3OTOT 1YQ4A 4AKIA 2F4VT 2W63A 3K8PC 2E9XC 2CBJA 1M62A 5AQMB 4CI2B 3NRXA 3PV0F 1EZ3A 4FI5A 1LVFA 3RQUA 2ZM0A 4DR6T 1NEKA 5TAOA 2Q9QA 4PK4A 2KWIB 4WBNE 4O4HE 2CE7A 3AAAB 3ZCIA 2WMNA 1E2AA 2XAQB 3ZSTA 3NVOA 3A7MA 3C4ZA 4ZI7E 4HWCA 2XTLA 5F3JA 1L0VA 3UU5A 3LK3B 4DV7T 2XQ8A 5HEGA 4HWFA 5FXZA 2HN1A 3JAEA 4WW0A 4DR4T 2W2UA 3PUQA 4H9SE 4DR1T 2UUCT 2E5LT 4PFOA 2ZLYA 2ODVA 5JDQA 3E22E 3LFMA 2GK9A 5J2UE 3VKHA 4GYRA 3FBZA 2YKSA 3CQGB 3K3NA 3M3ZB 4YSXA 5LP6E 2A2FX 2ES0A 3OJAA 2JPFA 5FXVA 2A3DA 3RX6A 5L3BB 2NP9A 5AQIB 4NUUA 1T7SA 3P7IA 2VURA 3UU3A 1J1JA 3PUZG 2FUPA 2JJ9A 3MACA 2DLRA 3O4XE 4UXNB 1IJ5A 1HCIA 3PUSA 5FXXA 5HEHA 4ZEYA 2YEVC 4JEUB 5JH7E 1QUUA 3I0OA 4AQFA 4QX8B 2CBIA 3ZLIA 3Q9DA 3J7Yq 4AQYT 1JNRA 4A56A 2QYWA 1NENA 2XQ4A 4EB6E 2ZM8A 2HPJA 3BK9A 2RA1A 2YK0A 5L47A 4P09A 5HCJA 5ABFB 3O1JA 1XWMA 3KDSE 4H9NC 2JQKA 2CXFA 3IHRA 2WWVA 4NUVA 5L2LA 4H63V 4EOZB 2IDOB 5DQVA 4CQIA 5CJ5A 4ERRA 5LA6E 4OFZA 4ZZBA 2XQAA 5AQQB 2QRXA 4ZI3C 2C5IT 3KV6A 4O8SA 4QH5A 4UELA 4F8HA 2W0GA 4JI6T 4NXNT 4OK0A 4PK5A 3ZMVB 1LRZA 4HFEA 2V7MA 4GKKT 2PJQA 4UR9A 4PJJA 4YXDA 2CXDA 3AE4A 2VVSA 4OHFA 3ANWA 4ZZCA 2NWBA 4UVBB 4OYKA 4IDQA 4IDOA 5LHIB 5LGUB 3AE1A 3HR0A 2NW8A 3F57A 4MBQA 5FL0A 1BR1A 1XDPA 5FY0A 3RIUC 2V26A 4WNKA 3RPUA 3U78A 3ZEFB 5BR8T 3FB2A 4H9OC 2J47A 1E1HB 3H37A 3AECA 1E7PA 2XAJB 3VRAA 1YD8G 1X79A 4HFBA 4JBWG 2KWHA 3CX8B 2V8SV 3P50A 3PE0A 4QXCB 3MK7C 3RIFA 4UVAB 5ABHA 5LG3A 4QXHB 2XQ7A 3MXZA 2WWUA 3O1IA 4ILUA 2JMKA 5FY7A 5JDNA 2XSBA 1Y01A 1UX5A 2BKNA 2LSJA 1MIVA 2CHOA 3I1AA 2LM2A 4GYSA 1UCUA 4KMCA 2X9XA 1FJGT 2BVLA 5AFUL 4CXXA 4X20E 3FBLA 2KNDA 1YW0A 2LRLA 4DBRA 4I43B 2XSAA 2WU5A 1OEDC 3ZMSB 2WU2A 3ONLC 5AQFB 2EHOB 3RYCE 3RYFE 3CWZB 4C91A 2FJEA 3P4PA 4IDZA 4LFCT 4CN1A 3AA6B 2W61A 2VKDA 4H9QC 5LGNB 2OV9A 3QK6A 4L0RA 4UVCB 4EZHA 4NXMT 3GN5A 4YHHT 3ZC1A 1OEDB 4PK6A 2BG9B 3BQLA 2YDSA 3SOLA 4DV3T 3VRBA 2VB6A 1NWMX 3C4XA 1KEYA 3I0QA 4TWHA 3ZKRA 5M4YA 1HR0T 4P0AA 5HWYA 1HG2A 4CXWA 3UFGA 2WDVA 5AQKB 5JDLA 4DBQA 2E5VA 4QX7B 2N9DA 5HXSA 2NTYA 1HNWT 4B3MT 2KMFA 3CPZA 1MMDA 2J4GA 2QA7A 4UEMA 4X1IE 3TKLB 3PV0G 1D0XA 3QB5K 3PUZF 2XQYA 4XZCA 5AQJB 1D0YA 1OWAA 2M67A 3B13A 3LK42 4IL9A 4Z90A 5L3CB 4GKJT 2X0YA 3PDYA 4JI5T 1WFDA 2BDEA 1UK5A 1MMAA 3AE8A 4O4JE 4P1NA 4QH1A 4I50E 3RYHE 3O9XA 3VHLA 2H88A 4PW8A 5DJQC 5ETWA 5CA0E 3ABVA 5AQRB 2L9QA 4A98A 3ZMUB 1UX4A 3NZQA 4QHOA 2K48A 5FL1A 4JBWF 3L8RA 5LXTE 3EHZA 1GQEA 4NPPA 3NBXX 4GK0E 3VR9A 2CXLA 4YJ3E 4AISA 1I94T 3NKZA 3HKDE 2V1DB 2VKJA 5HXHA 2BVMA 2WB5A 5LOVE 5DABA 2HHHT 3TUIA 2EHOA 4DUYT 3X1DA 4XIGM 3AAIA 2LE8A 2XM1A 3KV5A 4Z8XA 1T98A 4IHJE 3Q5WA 4KP3C 3C64A 3AXJA 4XTCM 4GK5E 4TNWA 1US7B 4DR3T 2UXDT 4AQGA 3GN5B 4YJ2E 2X0HA 1IBMT 4JI2T 3BQKA 2ZMAA 4AKGA 4XTCN 2DCFA 2MTQA 4JI8T 2HN2A 4X65T 3RLFF 4LF9T 4X5TA 2LHRA 2I6HA 5C2TA 5FXWA 4U31A 5AQUB 2LT3A 2XZEA 5H6QB 4HE8A 5JQGE 4YT0A 3Q5EA 4B6XA 3AVSA 4DMWA 3P4WA 5HXCA 1O3XA 2YU2A 3EI0A 3UUMA 4A5XA 4BA9A 3RKGA 4DR5T 4WZXA 2BZBA 3FZKB 4IREA 5L3DB 2LKHA 4XAXB 2DNXA 2LOPA 3ETVA 3PUWG 2LEHA 2LOSA 2KSRA 3OBVE 2LKGA 5KMGP 3RF1A 2KINB 3JC6C 3RRWA 5FVKA 4AIUA 4LF5T 1IBKT 3IEEA 2IUBA 3ZJ1A 5JREA 3A5XA 3AEGA 4JV5T 2JQHA 3EDUA 1VRBA 2ACZA 2VKHA 2WDQA 2WQYA 2CCQA 3LG7A 2V7LA 1T72A 2QGSA 4IE7A 5A1LA 2A9UA 5LB7B 4X66T 3PUYG 3ZT7A 4ZI2C 4JI7T 3UUNA 4TNVA 4O2BE 3L3PA 3JAFA 4YMVC 4JI4T 1N33T 1G73A 3KV9A 1XNRT 3PUXF 3LSVA 3MA9A 1WCRA 3QC9A 2IC9A 4DNDA 5L3EB 2CEAA 1U4QA 2X67A 3CMLA 3GA8A 3M65A 5AQNB 2X9WA 3I9WA 3LJCA 3NRYA 4O4LE 5AQVB 2CHNA 4DIDB 4ILAA 2VVNA 4PFPA 2W67A 1R8IA 4CI3B 1VCTA 4ISTA 3SS1A 2YINA 2IIUA 3V5UA 2D2SA 5ABEA 4TV9E 1WR6A 5CB4E 5HXEA 5HAXA 2BS2A 5LMUT 5AQGB 2XAGB 4AQFC 3B57A 3H3AA 5C3JA 2ZM6T 4HWIB 4CXYA 1FMVA 4IE0A 4YSZA 4KHPT 4UF0A 1W0AA 1I6ZA 2WM9A 3FZFB 5DQWA 5EK4A 5AQTB 4GOUA 4YY3T 4DUZT 4X62T 1BR4A 2E9XD 2CWYA 3R6NA 2CMRA 4CZZB 2HPLA 5LYJE 1N34T 1N36T 2K3WA 5EZYE 4TZ4C 5HXRA 3N9OA 3QB5A 1H7CA 1OXZA 3EAMA 3N9QA 2WS3A 3A8YC 4JLEA 3J9X1 5HWXA 2JIWA 3AE6A 3SRZA 3AA0B 2KT9A 1DU2A 3TUJA 2LLYA 4JEHB 2IW5B 4U7YA 3W15B 2BKOA 4G2AA 3PJAA 2W62A 3RYIE 2EHOD 4IGUA 2MYSA 2K5BB 3HL6A 3QUJA 2C5JA 2NR4A 5IUXA 5LJMA 3TUZA 2C0SA 3AE7A 3EUHA 3JC6D 3D0TA 2JMHA 4U2ZA 5C8YE 1U5PA 2MPKA 3Q2MA 5CGMA 2X9YA 5AQHB 2WCAA 2XAFB 2V6XA 2K9AA 4KI0G 1VCSA 4PAGA 2UXBT 2BG9A 4ANJA 2W4XA 2B76A 4ADZA 4YTNA 4QKNA 3C4WA 2XHEB 3I9YA 4H9RC 1ZP0A 3OKQA 3QNUA 3K3QC 5EK3A 3ZN1B 5JRCB 3PUVF 1D0ZA 4YHJA 1UURA 5ABGA 3UT5E 3UUBA 2UUAT 3RRCA 3AEFA 2DWGA 2AXDS 4WBOA 1HNZT 3QOFA 3IA3A 4FJOA 3UQ4A 1HTJF 2LJLA 3HA4A 3ZC0A 3PJAJ 5L4EA 5IWAT 4TWDA 2V5CA 2RP4A 4IIJE 4DR7T 3TLSA 4UF0B 5AQLB 1IBLT 4ILBA 3E0ZA 1LKXA 4H9PC 1HF8A 2VL0A 2XQ5A 4B3ST 2ACXA 2CA5A 2SPCA 2NW7A 3AEEA 4I55E 2BBJA 2WY2A 2PG8A 2X9HA 4U3CA 2J1DG 2CLYB 2WMOA 4U2YA 4UV9B 3DHWA 1SA0E 5LBMA 4EYUA 4TQUN 2LRKA 2KZ7B 5FY1A 3N2GE 5LCYA 2YDRA 1XZYA 3N9PA 1KFYA 4QWNB 4JI1T 1XDOA 3WAKA 3WAJA 2PBIA 4MHCA 4TQUM 4IT4A 1J5ET 3PU3A 2E8IA 4DO0A 1HX1B 4XBFB 5KDMC 1JNZA 4TX5A 4TWFA 4ASKA 2BS3A 4ZHQE 4I4TE 3VR8A 4CN6A 3ZYLA 1MIWA 3AEDA 3KVBA 2UXNB 3LBXB 5FVLA 3T1HT 2UU9T 1MMNA 4MLKA 5L3FB 1NAFA 2C5KT 3PUGA 4LMKA 4ILCA 2Y8DA 3EABA 5FMNA 3MZKB 3RGLA 1WRDA 2XQ3A 3UQ7A 5CA1E 2H7OA 3AE5A 2LHNA 2B1EA 3AAEB 3CX7B 4KBMB 5KX5E 5JRCA 1W09A 3KBTA 2PTFA 4BJMA 4EEDA 3BQIA 3ONXA 4AI6A 2D5UA 2HH7A 2H3RA 3C51A 3UU4A 1HX8A 4IDNA 4PJLA 2W66A 1XMQT 4AKHA 3TLWA 3VKGA 2KLQA 2QVAA 3DP7A 2VK9A 2LSIA 4EV6A 4LMLA 4LF4T 1VOMA 2I59A 4UV8B 2YOEA 4YMUC 2E9XA 3HKBE 2WSSV 3N5LA 3N9LA 2V7KA 4CN4A 1Y64B 5H6RB 3T8OA 1IJ6A 2A72A 2LSKA 4P0BA 2JQQA 2Q9QC 3ZCJA 5LMNT 4K0UA 2FJBA 2V7JA 2IMLA 1BR2A 3P4SA 3PUAA 3CQXC 1X9BA 2UXXB 2R6GF 2I0MA 2BS4A 2KXPB 4HWDA 3ZSSA 2DHRA 4AKLA 2XASB 4E7SA 3F31A 2MOZA 4YLHA 1MMGA 4DV0T 3ZT5A 3ZPOA 3KV4A 5EK2A 4Z91A 4XIGN 2CLYC 1WR0A 5E0OA 3PU8A 3C50A 3HKEE 3LBXA 1QLBA 3G06A 3TLTA 4YTPA 3ZYMA 4PJNA 1WYBA 3AE2A 4L9IA 4Q25A 1D1CA 3AA7B 2WZHA 2VWAA 4V1Av 4HFDA 2H89A 1FMWA 2D0UA 4PJMA 1IAPA 2NOXA 4U7IA 5LBQB 4ZXLA 2X0LB 3RIAA 3UULA 1V9DA 4TN7B 4E7ZA 4BAYB 1KF6A 3AVRA 2D0TA 4QH4A 2K24A 3OYXA 4U72A 5AQPB 1AJ3A 3GMIA 2WZIA 2CWOA 3MKDA 3UU8A 1B7TA 2RPAA 4G63A 5HEOA 5ADXL 3RI5A 4DV4T 3NZPA 4LF6T 3CKDA 3LDQB 5IHYA 4EZ4A 3UU6A 2X66A 2DI4A 4X64T 2YDQA 2JQ9A 4IL4A 4HFHA 4ZS2A 3F2EA 1XNQT 4EXTA 3RKOA 1CUNA 2FJAA 2E9XB 2PFVA 3B5MA 3ZN0B 2V7IA 3N9MA 3OYZA 2IC6A 3P4QA 4M1PA 5HYAA 2V6YB 3ESLA 3N2KE 3PURA 3P4RA 4DMVA 3ZT6A 1OEDA 1HG5A 3PUXG 2VKOA 3KFWX 4HEAA 4NIQA 3AA1B 4MALA 2E2AA 5LJNA 1ZKEA 2P9BA 4KI0F 4JI3T 4DR2T 1D1BA 3AB3B 1YKEB 2IHR1 2FJDA 3N2OA 1ZV4X 1MNDA 4U33A 1QSDA 1MNEA 4WYVA 5JDFA 2CM0A 1S35A 4EGWA 1W9RA 3RC8A 2VQET 4JUYA 1LVKA 1UUSA 3FZHB 4PNIA 5FKYA 2LSGA 3U3IA 1KNPA 5IYZE 5L3GB 4HFIA 2R6GG 3PUWF 3GWHA 2XJ7A 4I0UA 3C98B 2NW9A 3AXJB 3TLUA 4AKRB 1WYCA 2LM9A 1YQ3A 4ZI2D 5J2TE 2BG9E 2BG9C 1T8BA 2M6BA 3NWIA 4DVDA 1HNXT 2DWKA 4KHZF 1M7KA 2CPTA 5HEUA 5JDGA 3Q5XA 4AXPA 3DTOA 3OPCA 3IBPA 2XY8B 1OEDE 3PUVG 4GIWA 4F6RC 4IE6A 5LNKA 5ABFA 4LFBT 2CRBA
chains in the Genus database with same CATH topology
4TQUN 4XTCM 4YMSC 3PUZG 3PUYG 3PV0F 4KI0G 3PV0G 3PUYF 4KI0F 3PUZF 4YMWC 4YMVC 4TQUM 4XTCN 3PUXF 3D31C 3RLFF 3PUVF 4YMUC 4KHZG 2R6GG 3PUWF 4YMTB 4JBWF 3TUJA 4JBWG 3PUWG 2R6GF 4KHZF 2ONKC 3TUIA 4XIGN 4XIGM 3TUZA 3PUVG 3RLFG 3PUXG 3DHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQU N;  4XTC M;  4YMS C;  3PUZ G;  3PUY G;  3PV0 F;  4KI0 G;  3PV0 G;  3PUY F;  4KI0 F;  3PUZ F;  4YMW C;  4YMV C;  4TQU M;  4XTC N;  3PUX F;  3D31 C;  3RLF F;  3PUV F;  4YMU C;  4KHZ G;  2R6G G;  3PUW F;  4YMT B;  4JBW F;  3TUJ A;  4JBW G;  3PUW G;  2R6G F;  4KHZ F;  2ONK C;  3TUI A;  4XIG N;  4XIG M;  3TUZ A;  3PUV G;  3RLF G;  3PUX G;  3DHW A; 
#chains in the Genus database with same CATH topology
 4KUM B;  2XM2 A;  3HKC E;  2FBW A;  4ZS3 A;  5J1G A;  4QXB B;  4YMW C;  2YN6 A;  2W00 A;  3AEB A;  1MIY A;  5AQS B;  5CFB A;  2WBL A;  1CHU A;  3SWH A;  1S94 A;  4IE4 A;  1ZOY A;  1SE7 A;  5FYM A;  3KBU A;  1Z8U A;  2IAK A;  2WAU A;  3EVY A;  3WI3 A;  3N9N A;  3JCF A;  4KHZ G;  3UUX B;  2LSY A;  2V6Y A;  2WP9 A;  3PTR B;  1YKH B;  2G0U A;  4HGA A;  5JR9 A;  4ZOL E;  3RC3 A;  4EYY R;  4DV6 T;  3KIN B;  1XMO T;  5KXJ A;  2OA5 A;  5LHG B;  3EDV A;  4X1K E;  1HFA A;  3ANW B;  4A97 A;  4EIW A;  1G8X A;  5LG4 A;  4B3R T;  3Q5D A;  1Z0P A;  1WLX A;  2Z6E A;  3O1H A;  4HN9 A;  3S4U A;  5BMV E;  4YFS A;  4OX9 T;  3MJX A;  2ONK C;  2J62 A;  2VAS A;  2WDR A;  2XQ6 A;  1ZEE A;  3RH3 A;  2MAW A;  3VU7 H;  4ZI3 D;  1J5W A;  5HEJ A;  4U74 A;  5JTG A;  4DV1 T;  2EHO C;  2Y6X A;  2VQF T;  4HWH A;  4YTM A;  4JI0 T;  3FHN A;  3ZYK A;  2MBG A;  3CX6 B;  2NTX A;  3PUY F;  4X1Y E;  4KX6 A;  2XUE A;  2L3L A;  3KVA A;  1HS7 A;  3OVU A;  2Y48 B;  1YXR A;  2DL1 A;  3AE3 A;  3LK2 B;  3D31 C;  4H63 H;  4HTE A;  1ZHC A;  1FIO A;  2D9D A;  3ETU A;  3K1S A;  4L5G A;  4O2A E;  3ZMZ B;  2N2N A;  5LGT B;  1FEW A;  5J0Z A;  1UGO A;  3RQW A;  3CVR A;  3DJB A;  2M6I A;  3RIU A;  4DV5 T;  2ZM2 A;  2XQ9 A;  1BR0 A;  4HKA A;  1KK7 A;  3CIR A;  3V5S A;  5L4H A;  3AE9 A;  4CI1 B;  1KNZ A;  5FNV E;  3RHW A;  4EEB A;  3E08 A;  4IDP A;  3CK6 A;  3FXE B;  3L39 A;  3UTK A;  2Q9Q B;  4JYA T;  3HI2 A;  4B3T T;  1IZN B;  3TLV A;  4UIG A;  4ISS A;  3RLF G;  5JR9 B;  4O4I E;  3R84 B;  4C90 A;  4J2C A;  5FP3 A;  2XAH B;  3JAD A;  1KNR A;  2N1G A;  3UFE A;  4YMS C;  3FZM B;  2UXC T;  4TV8 E;  2L8K A;  3H3M A;  2VL8 A;  3FXD B;  2UUB T;  5F5W A;  3T1Y T;  4HFC A;  3SFD A;  3ZJ2 A;  5AQO B;  5JDH A;  4HFV A;  2BBH A;  2X51 A;  2JRK A;  5GON E;  2XPK A;  4LF8 T;  5JR9 C;  4K0K T;  3K3O A;  3AEA A;  3SFE A;  2YU1 A;  3P8C D;  4MFR A;  5JVD E;  1N32 T;  2H7V C;  5HCM A;  4OYJ A;  4COF A;  4LFA T;  4YMT B;  3FZL B;  4TUY E;  1SUM B;  2OLT A;  3ONJ A;  2ODU A;  1SHZ C;  1W0B A;  2Q9Q D;  2X68 A;  5F8P A;  2AE9 A;  4EAH A;  1D1A A;  4YSY A;  2V5D A;  4LF7 T;  3CQC B;  4N78 D;  4BJN A;  4IE5 A;  3IF8 B;  2BKP A;  3L09 A;  3ZMT B;  5JDM A;  4DV2 T;  4LMJ A;  5LHH B;  3OTO T;  1YQ4 A;  4AKI A;  2F4V T;  2W63 A;  3K8P C;  2E9X C;  2CBJ A;  1M62 A;  5AQM B;  4CI2 B;  3NRX A;  3PV0 F;  1EZ3 A;  4FI5 A;  1LVF A;  3RQU A;  2ZM0 A;  4DR6 T;  1NEK A;  5TAO A;  2Q9Q A;  4PK4 A;  2KWI B;  4WBN E;  4O4H E;  2CE7 A;  3AAA B;  3ZCI A;  2WMN A;  1E2A A;  2XAQ B;  3ZST A;  3NVO A;  3A7M A;  3C4Z A;  4ZI7 E;  4HWC A;  2XTL A;  5F3J A;  1L0V A;  3UU5 A;  3LK3 B;  4DV7 T;  2XQ8 A;  5HEG A;  4HWF A;  5FXZ A;  2HN1 A;  3JAE A;  4WW0 A;  4DR4 T;  2W2U A;  3PUQ A;  4H9S E;  4DR1 T;  2UUC T;  2E5L T;  4PFO A;  2ZLY A;  2ODV A;  5JDQ A;  3E22 E;  3LFM A;  2GK9 A;  5J2U E;  3VKH A;  4GYR A;  3FBZ A;  2YKS A;  3CQG B;  3K3N A;  3M3Z B;  4YSX A;  5LP6 E;  2A2F X;  2ES0 A;  3OJA A;  2JPF A;  5FXV A;  2A3D A;  3RX6 A;  5L3B B;  2NP9 A;  5AQI B;  4NUU A;  1T7S A;  3P7I A;  2VUR A;  3UU3 A;  1J1J A;  3PUZ G;  2FUP A;  2JJ9 A;  3MAC A;  2DLR A;  3O4X E;  4UXN B;  1IJ5 A;  1HCI A;  3PUS A;  5FXX A;  5HEH A;  4ZEY A;  2YEV C;  4JEU B;  5JH7 E;  1QUU A;  3I0O A;  4AQF A;  4QX8 B;  2CBI A;  3ZLI A;  3Q9D A;  3J7Y q;  4AQY T;  1JNR A;  4A56 A;  2QYW A;  1NEN A;  2XQ4 A;  4EB6 E;  2ZM8 A;  2HPJ A;  3BK9 A;  2RA1 A;  2YK0 A;  5L47 A;  4P09 A;  5HCJ A;  5ABF B;  3O1J A;  1XWM A;  3KDS E;  4H9N C;  2JQK A;  2CXF A;  3IHR A;  2WWV A;  4NUV A;  5L2L A;  4H63 V;  4EOZ B;  2IDO B;  5DQV A;  4CQI A;  5CJ5 A;  4ERR A;  5LA6 E;  4OFZ A;  4ZZB A;  2XQA A;  5AQQ B;  2QRX A;  4ZI3 C;  2C5I T;  3KV6 A;  4O8S A;  4QH5 A;  4UEL A;  4F8H A;  2W0G A;  4JI6 T;  4NXN T;  4OK0 A;  4PK5 A;  3ZMV B;  1LRZ A;  4HFE A;  2V7M A;  4GKK T;  2PJQ A;  4UR9 A;  4PJJ A;  4YXD A;  2CXD A;  3AE4 A;  2VVS A;  4OHF A;  3ANW A;  4ZZC A;  2NWB A;  4UVB B;  4OYK A;  4IDQ A;  4IDO A;  5LHI B;  5LGU B;  3AE1 A;  3HR0 A;  2NW8 A;  3F57 A;  4MBQ A;  5FL0 A;  1BR1 A;  1XDP A;  5FY0 A;  3RIU C;  2V26 A;  4WNK A;  3RPU A;  3U78 A;  3ZEF B;  5BR8 T;  3FB2 A;  4H9O C;  2J47 A;  1E1H B;  3H37 A;  3AEC A;  1E7P A;  2XAJ B;  3VRA A;  1YD8 G;  1X79 A;  4HFB A;  4JBW G;  2KWH A;  3CX8 B;  2V8S V;  3P50 A;  3PE0 A;  4QXC B;  3MK7 C;  3RIF A;  4UVA B;  5ABH A;  5LG3 A;  4QXH B;  2XQ7 A;  3MXZ A;  2WWU A;  3O1I A;  4ILU A;  2JMK A;  5FY7 A;  5JDN A;  2XSB A;  1Y01 A;  1UX5 A;  2BKN A;  2LSJ A;  1MIV A;  2CHO A;  3I1A A;  2LM2 A;  4GYS A;  1UCU A;  4KMC A;  2X9X A;  1FJG T;  2BVL A;  5AFU L;  4CXX A;  4X20 E;  3FBL A;  2KND A;  1YW0 A;  2LRL A;  4DBR A;  4I43 B;  2XSA A;  2WU5 A;  1OED C;  3ZMS B;  2WU2 A;  3ONL C;  5AQF B;  2EHO B;  3RYC E;  3RYF E;  3CWZ B;  4C91 A;  2FJE A;  3P4P A;  4IDZ A;  4LFC T;  4CN1 A;  3AA6 B;  2W61 A;  2VKD A;  4H9Q C;  5LGN B;  2OV9 A;  3QK6 A;  4L0R A;  4UVC B;  4EZH A;  4NXM T;  3GN5 A;  4YHH T;  3ZC1 A;  1OED B;  4PK6 A;  2BG9 B;  3BQL A;  2YDS A;  3SOL A;  4DV3 T;  3VRB A;  2VB6 A;  1NWM X;  3C4X A;  1KEY A;  3I0Q A;  4TWH A;  3ZKR A;  5M4Y A;  1HR0 T;  4P0A A;  5HWY A;  1HG2 A;  4CXW A;  3UFG A;  2WDV A;  5AQK B;  5JDL A;  4DBQ A;  2E5V A;  4QX7 B;  2N9D A;  5HXS A;  2NTY A;  1HNW T;  4B3M T;  2KMF A;  3CPZ A;  1MMD A;  2J4G A;  2QA7 A;  4UEM A;  4X1I E;  3TKL B;  3PV0 G;  1D0X A;  3QB5 K;  3PUZ F;  2XQY A;  4XZC A;  5AQJ B;  1D0Y A;  1OWA A;  2M67 A;  3B13 A;  3LK4 2;  4IL9 A;  4Z90 A;  5L3C B;  4GKJ T;  2X0Y A;  3PDY A;  4JI5 T;  1WFD A;  2BDE A;  1UK5 A;  1MMA A;  3AE8 A;  4O4J E;  4P1N A;  4QH1 A;  4I50 E;  3RYH E;  3O9X A;  3VHL A;  2H88 A;  4PW8 A;  5DJQ C;  5ETW A;  5CA0 E;  3ABV A;  5AQR B;  2L9Q A;  4A98 A;  3ZMU B;  1UX4 A;  3NZQ A;  4QHO A;  2K48 A;  5FL1 A;  4JBW F;  3L8R A;  5LXT E;  3EHZ A;  1GQE A;  4NPP A;  3NBX X;  4GK0 E;  3VR9 A;  2CXL A;  4YJ3 E;  4AIS A;  1I94 T;  3NKZ A;  3HKD E;  2V1D B;  2VKJ A;  5HXH A;  2BVM A;  2WB5 A;  5LOV E;  5DAB A;  2HHH T;  3TUI A;  2EHO A;  4DUY T;  3X1D A;  4XIG M;  3AAI A;  2LE8 A;  2XM1 A;  3KV5 A;  4Z8X A;  1T98 A;  4IHJ E;  3Q5W A;  4KP3 C;  3C64 A;  3AXJ A;  4XTC M;  4GK5 E;  4TNW A;  1US7 B;  4DR3 T;  2UXD T;  4AQG A;  3GN5 B;  4YJ2 E;  2X0H A;  1IBM T;  4JI2 T;  3BQK A;  2ZMA A;  4AKG A;  4XTC N;  2DCF A;  2MTQ A;  4JI8 T;  2HN2 A;  4X65 T;  3RLF F;  4LF9 T;  4X5T A;  2LHR A;  2I6H A;  5C2T A;  5FXW A;  4U31 A;  5AQU B;  2LT3 A;  2XZE A;  5H6Q B;  4HE8 A;  5JQG E;  4YT0 A;  3Q5E A;  4B6X A;  3AVS A;  4DMW A;  3P4W A;  5HXC A;  1O3X A;  2YU2 A;  3EI0 A;  3UUM A;  4A5X A;  4BA9 A;  3RKG A;  4DR5 T;  4WZX A;  2BZB A;  3FZK B;  4IRE A;  5L3D B;  2LKH A;  4XAX B;  2DNX A;  2LOP A;  3ETV A;  3PUW G;  2LEH A;  2LOS A;  2KSR A;  3OBV E;  2LKG A;  5KMG P;  3RF1 A;  2KIN B;  3JC6 C;  3RRW A;  5FVK A;  4AIU A;  4LF5 T;  1IBK T;  3IEE A;  2IUB A;  3ZJ1 A;  5JRE A;  3A5X A;  3AEG A;  4JV5 T;  2JQH A;  3EDU A;  1VRB A;  2ACZ A;  2VKH A;  2WDQ A;  2WQY A;  2CCQ A;  3LG7 A;  2V7L A;  1T72 A;  2QGS A;  4IE7 A;  5A1L A;  2A9U A;  5LB7 B;  4X66 T;  3PUY G;  3ZT7 A;  4ZI2 C;  4JI7 T;  3UUN A;  4TNV A;  4O2B E;  3L3P A;  3JAF A;  4YMV C;  4JI4 T;  1N33 T;  1G73 A;  3KV9 A;  1XNR T;  3PUX F;  3LSV A;  3MA9 A;  1WCR A;  3QC9 A;  2IC9 A;  4DND A;  5L3E B;  2CEA A;  1U4Q A;  2X67 A;  3CML A;  3GA8 A;  3M65 A;  5AQN B;  2X9W A;  3I9W A;  3LJC A;  3NRY A;  4O4L E;  5AQV B;  2CHN A;  4DID B;  4ILA A;  2VVN A;  4PFP A;  2W67 A;  1R8I A;  4CI3 B;  1VCT A;  4IST A;  3SS1 A;  2YIN A;  2IIU A;  3V5U A;  2D2S A;  5ABE A;  4TV9 E;  1WR6 A;  5CB4 E;  5HXE A;  5HAX A;  2BS2 A;  5LMU T;  5AQG B;  2XAG B;  4AQF C;  3B57 A;  3H3A A;  5C3J A;  2ZM6 T;  4HWI B;  4CXY A;  1FMV A;  4IE0 A;  4YSZ A;  4KHP T;  4UF0 A;  1W0A A;  1I6Z A;  2WM9 A;  3FZF B;  5DQW A;  5EK4 A;  5AQT B;  4GOU A;  4YY3 T;  4DUZ T;  4X62 T;  1BR4 A;  2E9X D;  2CWY A;  3R6N A;  2CMR A;  4CZZ B;  2HPL A;  5LYJ E;  1N34 T;  1N36 T;  2K3W A;  5EZY E;  4TZ4 C;  5HXR A;  3N9O A;  3QB5 A;  1H7C A;  1OXZ A;  3EAM A;  3N9Q A;  2WS3 A;  3A8Y C;  4JLE A;  3J9X 1;  5HWX A;  2JIW A;  3AE6 A;  3SRZ A;  3AA0 B;  2KT9 A;  1DU2 A;  3TUJ A;  2LLY A;  4JEH B;  2IW5 B;  4U7Y A;  3W15 B;  2BKO A;  4G2A A;  3PJA A;  2W62 A;  3RYI E;  2EHO D;  4IGU A;  2MYS A;  2K5B B;  3HL6 A;  3QUJ A;  2C5J A;  2NR4 A;  5IUX A;  5LJM A;  3TUZ A;  2C0S A;  3AE7 A;  3EUH A;  3JC6 D;  3D0T A;  2JMH A;  4U2Z A;  5C8Y E;  1U5P A;  2MPK A;  3Q2M A;  5CGM A;  2X9Y A;  5AQH B;  2WCA A;  2XAF B;  2V6X A;  2K9A A;  4KI0 G;  1VCS A;  4PAG A;  2UXB T;  2BG9 A;  4ANJ A;  2W4X A;  2B76 A;  4ADZ A;  4YTN A;  4QKN A;  3C4W A;  2XHE B;  3I9Y A;  4H9R C;  1ZP0 A;  3OKQ A;  3QNU A;  3K3Q C;  5EK3 A;  3ZN1 B;  5JRC B;  3PUV F;  1D0Z A;  4YHJ A;  1UUR A;  5ABG A;  3UT5 E;  3UUB A;  2UUA T;  3RRC A;  3AEF A;  2DWG A;  2AXD S;  4WBO A;  1HNZ T;  3QOF A;  3IA3 A;  4FJO A;  3UQ4 A;  1HTJ F;  2LJL A;  3HA4 A;  3ZC0 A;  3PJA J;  5L4E A;  5IWA T;  4TWD A;  2V5C A;  2RP4 A;  4IIJ E;  4DR7 T;  3TLS A;  4UF0 B;  5AQL B;  1IBL T;  4ILB A;  3E0Z A;  1LKX A;  4H9P C;  1HF8 A;  2VL0 A;  2XQ5 A;  4B3S T;  2ACX A;  2CA5 A;  2SPC A;  2NW7 A;  3AEE A;  4I55 E;  2BBJ A;  2WY2 A;  2PG8 A;  2X9H A;  4U3C A;  2J1D G;  2CLY B;  2WMO A;  4U2Y A;  4UV9 B;  3DHW A;  1SA0 E;  5LBM A;  4EYU A;  4TQU N;  2LRK A;  2KZ7 B;  5FY1 A;  3N2G E;  5LCY A;  2YDR A;  1XZY A;  3N9P A;  1KFY A;  4QWN B;  4JI1 T;  1XDO A;  3WAK A;  3WAJ A;  2PBI A;  4MHC A;  4TQU M;  4IT4 A;  1J5E T;  3PU3 A;  2E8I A;  4DO0 A;  1HX1 B;  4XBF B;  5KDM C;  1JNZ A;  4TX5 A;  4TWF A;  4ASK A;  2BS3 A;  4ZHQ E;  4I4T E;  3VR8 A;  4CN6 A;  3ZYL A;  1MIW A;  3AED A;  3KVB A;  2UXN B;  3LBX B;  5FVL A;  3T1H T;  2UU9 T;  1MMN A;  4MLK A;  5L3F B;  1NAF A;  2C5K T;  3PUG A;  4LMK A;  4ILC A;  2Y8D A;  3EAB A;  5FMN A;  3MZK B;  3RGL A;  1WRD A;  2XQ3 A;  3UQ7 A;  5CA1 E;  2H7O A;  3AE5 A;  2LHN A;  2B1E A;  3AAE B;  3CX7 B;  4KBM B;  5KX5 E;  5JRC A;  1W09 A;  3KBT A;  2PTF A;  4BJM A;  4EED A;  3BQI A;  3ONX A;  4AI6 A;  2D5U A;  2HH7 A;  2H3R A;  3C51 A;  3UU4 A;  1HX8 A;  4IDN A;  4PJL A;  2W66 A;  1XMQ T;  4AKH A;  3TLW A;  3VKG A;  2KLQ A;  2QVA A;  3DP7 A;  2VK9 A;  2LSI A;  4EV6 A;  4LML A;  4LF4 T;  1VOM A;  2I59 A;  4UV8 B;  2YOE A;  4YMU C;  2E9X A;  3HKB E;  2WSS V;  3N5L A;  3N9L A;  2V7K A;  4CN4 A;  1Y64 B;  5H6R B;  3T8O A;  1IJ6 A;  2A72 A;  2LSK A;  4P0B A;  2JQQ A;  2Q9Q C;  3ZCJ A;  5LMN T;  4K0U A;  2FJB A;  2V7J A;  2IML A;  1BR2 A;  3P4S A;  3PUA A;  3CQX C;  1X9B A;  2UXX B;  2R6G F;  2I0M A;  2BS4 A;  2KXP B;  4HWD A;  3ZSS A;  2DHR A;  4AKL A;  2XAS B;  4E7S A;  3F31 A;  2MOZ A;  4YLH A;  1MMG A;  4DV0 T;  3ZT5 A;  3ZPO A;  3KV4 A;  5EK2 A;  4Z91 A;  4XIG N;  2CLY C;  1WR0 A;  5E0O A;  3PU8 A;  3C50 A;  3HKE E;  3LBX A;  1QLB A;  3G06 A;  3TLT A;  4YTP A;  3ZYM A;  4PJN A;  1WYB A;  3AE2 A;  4L9I A;  4Q25 A;  1D1C A;  3AA7 B;  2WZH A;  2VWA A;  4V1A v;  4HFD A;  2H89 A;  1FMW A;  2D0U A;  4PJM A;  1IAP A;  2NOX A;  4U7I A;  5LBQ B;  4ZXL A;  2X0L B;  3RIA A;  3UUL A;  1V9D A;  4TN7 B;  4E7Z A;  4BAY B;  1KF6 A;  3AVR A;  2D0T A;  4QH4 A;  2K24 A;  3OYX A;  4U72 A;  5AQP B;  1AJ3 A;  3GMI A;  2WZI A;  2CWO A;  3MKD A;  3UU8 A;  1B7T A;  2RPA A;  4G63 A;  5HEO A;  5ADX L;  3RI5 A;  4DV4 T;  3NZP A;  4LF6 T;  3CKD A;  3LDQ B;  5IHY A;  4EZ4 A;  3UU6 A;  2X66 A;  2DI4 A;  4X64 T;  2YDQ A;  2JQ9 A;  4IL4 A;  4HFH A;  4ZS2 A;  3F2E A;  1XNQ T;  4EXT A;  3RKO A;  1CUN A;  2FJA A;  2E9X B;  2PFV A;  3B5M A;  3ZN0 B;  2V7I A;  3N9M A;  3OYZ A;  2IC6 A;  3P4Q A;  4M1P A;  5HYA A;  2V6Y B;  3ESL A;  3N2K E;  3PUR A;  3P4R A;  4DMV A;  3ZT6 A;  1OED A;  1HG5 A;  3PUX G;  2VKO A;  3KFW X;  4HEA A;  4NIQ A;  3AA1 B;  4MAL A;  2E2A A;  5LJN A;  1ZKE A;  2P9B A;  4KI0 F;  4JI3 T;  4DR2 T;  1D1B A;  3AB3 B;  1YKE B;  2IHR 1;  2FJD A;  3N2O A;  1ZV4 X;  1MND A;  4U33 A;  1QSD A;  1MNE A;  4WYV A;  5JDF A;  2CM0 A;  1S35 A;  4EGW A;  1W9R A;  3RC8 A;  2VQE T;  4JUY A;  1LVK A;  1UUS A;  3FZH B;  4PNI A;  5FKY A;  2LSG A;  3U3I A;  1KNP A;  5IYZ E;  5L3G B;  4HFI A;  2R6G G;  3PUW F;  3GWH A;  2XJ7 A;  4I0U A;  3C98 B;  2NW9 A;  3AXJ B;  3TLU A;  4AKR B;  1WYC A;  2LM9 A;  1YQ3 A;  4ZI2 D;  5J2T E;  2BG9 E;  2BG9 C;  1T8B A;  2M6B A;  3NWI A;  4DVD A;  1HNX T;  2DWK A;  4KHZ F;  1M7K A;  2CPT A;  5HEU A;  5JDG A;  3Q5X A;  4AXP A;  3DTO A;  3OPC A;  3IBP A;  2XY8 B;  1OED E;  3PUV G;  4GIW A;  4F6R C;  4IE6 A;  5LNK A;  5ABF A;  4LFB T;  2CRB A; 
#chains in the Genus database with same CATH homology
 4TQU N;  4XTC M;  4YMS C;  3PUZ G;  3PUY G;  3PV0 F;  4KI0 G;  3PV0 G;  3PUY F;  4KI0 F;  3PUZ F;  4YMW C;  4YMV C;  4TQU M;  4XTC N;  3PUX F;  3D31 C;  3RLF F;  3PUV F;  4YMU C;  4KHZ G;  2R6G G;  3PUW F;  4YMT B;  4JBW F;  3TUJ A;  4JBW G;  3PUW G;  2R6G F;  4KHZ F;  2ONK C;  3TUI A;  4XIG N;  4XIG M;  3TUZ A;  3PUV G;  3RLF G;  3PUX G;  3DHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...