2R76A

Crystal structure of the rare lipoprotein b (so_1173) from shewanella oneidensis, northeast structural genomics consortium target sor91a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
NQLSLSSSDEYKELTRLVRERLRLNNVKIVDAANDVPVLRLITDSLERSTLSLYPTGNVAEYELIYFVEFAVALPGKEAQPFKIEIRRDYLDDPRTALAKSREMELLVKEMRIQAADRILQSMASTEVNLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rare lipoprotein B
publication title Crystal structure of the rare lipoprotein B (SO_1173) from Shewanella oneidensis.
rcsb
source organism Shewanella oneidensis
molecule tags Lipoprotein
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 2r76A00
4KWYA 4RHBB 5IXMB 2JXPA 2N8XA 5IV8B 5TSEA 2R76A 4N4RB 4Q35B 3BF2A 4RH8A 4NHRA
chains in the Genus database with same CATH superfamily
1HNZE 3HQ1A 4LFAE 1L4SA 2R76A 4Q35B 1EH8A 2YTEA 3TQMA 1N34E 1JK2A 4P78A 1Z1BA 4DR5E 1YUJA 2YU5A 4BBYA 2EOJA 1MEYC 4OOGC 1EH6A 4BHBA 4JI1E 4LFCE 4JI3E 2JR1A 4OX9E 1KJKA 2L2NA 3EPHA 2FTXB 1X5WA 4DV5E 2EOXA 2IHR1 2NA2A 1X6HA 3KZYA 3EPLA 4DV2E 4GZNC 2EMAA 2EZ6A 2F8BA 4KWYA 2HC5A 1WHNA 2EPXA 2M9AA 4DUZE 2GLIA 4J8ZA 1ZBQA 2YRMA 5AC4A 1QNTA 3DF6A 2E72A 1SR9A 1X49A 2ENHA 2YU8A 3ADIA 2E5LE 3HPSA 4GEQB 4ZYGA 2LTSA 4F54A 1GTKA 1O0WA 4WXCA 2YTOA 5KL4A 1N36E 2WCC3 1J5EE 1YPNA 2EPNA 3VK6A 4DR2E 2EMCA 2LJHA 2NABA 2F4VE 2H36X 3THNA 2JYAA 1MGTA 1T4NA 2HJJA 1YZ9A 4DMIA 4KHPE 2EMWA 1EKZA 2ODRC 1YYOA 5AE3A 2ZM6E 1YUIA 4DUYE 2DB2A 2EN7A 4JI2E 5BR8E 2MC6A 2YTNA 1DGCA 4BCAA 2FGGA 2V86A 4Q28A 4WX9A 2L3CA 3THOB 2EMYA 4YHHE 2VQEE 4BS9A 2YPNA 2N3GA 2NUGA 4F2JC 4NHRA 1GZ6A 4WXDA 3J80C 3MHSC 1HNWE 2K4VA 4JI5E 5IWAE 2L3JA 2BBGA 1T38A 2EPCA 2JWOA 4BC9A 2DMIA 2YTDA 2EMKA 4MLVA 3HXLA 2EQ3A 3EPKA 5KL7A 5KL6A 2DIXA 5CFFE 3T1HE 3DJWA 2L2MA 4F9BB 2EL5A 1GQEA 4LF5E 3C6KA 4R2SA 1F2IG 1IBLE 1A1GA 1BB8A 4JI6E 4P7DA 5AE2A 2EN3A 1G2FC 3IWDA 2JXPA 2YTFA 5LMNE 4WSGA 3FIGA 3J7AG 2GPIA 2EOSA 3C4TA 3JU0A 1A1FA 1AH5A 2EN4A 3KZZA 2M1SA 2EOOA 2HGHA 4LF7E 2RPCA 5FLXC 3LLHA 1J26A 2JOBA 4F6NA 2EMGA 4X66E 2EPKX 3AV0A 1XMOE 1BBOA 2PRTA 4TUGA 2DLQA 2GHFA 2V88A 2EOZA 3LMLA 5KL3A 1STUA 1LLMC 2ADRA 2LO3A 2LT7A 1PKPA 2YT4A 1KYQA 4JI7E 1ZU1A 3H09A 4NXNE 2RSIA 4X62E 1UN6B 4X64E 2EM2A 2YRKA 2WBTA 2VQFE 5KL5A 2B9DA 1A1KA 3F6HA 4B3RE 4MLQA 3J7Yp 4B3SE 1TF3A 2B7VA 3C4BA 5KL2A 1N3GA 2I13A 4NZVA 2EMZA 2ODRD 2EOFA 2UXDE 4O4KA 2YRHA 3BIDA 2EMXA 2HHHE 4B3ME 1NEIA 2LBSB 4O5GA 2UXCE 3BBGA 2EMFA 3P1XA 1WXRA 4M2ZA 3VHTB 4I8OA 4LF9E 1WHQA 1X3CA 3IWBA 5F3WA 2EPRA 4DV6E 2JOXA 2EPAA 4DV7E 2DSYA 4R2CA 5IT9C 5AE1A 3VYYA 4DR6E 1UILA 2EMIA 3K6QA 2EN6A 2L33A 2RS6A 4HTGA 1ZR9A 4GKKE 2EN8A 2K7IA 4WSPA 2YSPA 1YFHA 1TN9A 1PJTA 2A25A 2EJ4A 2L92A 5A69A 3OMLA 2D9HA 2ELYA 2L8TA 3J81C 4F6MA 4B3TE 2EOIA 4TUIA 1XMQE 3T1YE 1N33E 1IQSA 4F9CB 4JI8E 1IBME 4LFBE 5LL6R 1YYWA 4N4RB 3OTOE 2L6MA 4IS1C 1T4OA 4LF4E 2M7QA 1WJPA 5AASA 2N3HA 4WYQB 3ECRA 4O24A 1A1LA 4X9JA 2EOEA 2EOYA 1X47A 2DGCA 2VE7C 2LCEA 4R2EA 4IJDA 1JK1A 2MDGA 2EOQA 2JY9A 2RTXA 2EPZA 2M4IA 2YTIA 5LMUE 5A6BA 1N32E 3EPJA 1I94E 2B3TB 5IXMB 2EP3A 2JPAA 2LTRA 4LTYA 4DR3E 1P47A 2YTJA 1B69A 3UK3C 4X8WA 2EM0A 1DQ3A 2EPPA 4RHBB 2RQLA 2BB8A 2MC5A 1XNQE 1BBGA 1HR0E 2V85A 2V89A 2KHXA 2EM6A 2ENAA 4R2DA 2EWLA 2J7JA 4K0KE 5A6BD 2G7HA 4L5NC 4AQYE 2RSMA 4ZYEA 1IQOA 2EQ1A 1X48A 4R03A 2EM5A 2EPOA 4WPYA 1X6FA 4WFTA 1AAYA 1YYKA 2B7TA 2V87A 2UUCE 2JP9A 5T6JA 4R2RA 2DMYA 4DV3E 2E1MA 1A1JA 4M30A 2CPNA 5A6JA 4JI4E 2EORA 2UUAE 2EL4A 1SFEA 1UHZA 4YY3E 3QG5C 1DI2A 3JAMC 2EMLA 1ZAAC 2CTDA 2EQ0A 4DKKA 1YSAC 2VRDA 3ZOQB 3ADLA 5TSEA 3C6MA 4DR1E 2NUFA 2UU9E 4JV5E 1EH7A 4LU9A 2UUBE 4JYAE 1XNRE 5AC5A 4M0VA 5LLQA 4HEIA 1FKAE 4R2AA 4DR4E 2EL6A 2JVAA 1PJQA 2L2KB 4L8NA 5DNYA 3ADGA 4O43A 2YWQA 4BMJA 2N8XA 3MSWA 2WBUA 2EM4A 2LJUA 4R8OA 4DV4E 2RS7A 5A6KA 4ZYDA 3M99B 4BHCA 3ADJA 1TF6A 1RMDA 1WRJA 3HPZA 2EOHA 2EMBA 4M9VC 4RH8A 2YTQA 2KOUA 3JTZA 2V8QB 2UXBE 1RQ0A 2EMHA 1X6EA 3AUZA 4DR7E 2FV4B 2EM8A 3BGHA 2YZTA 2WBSA 1G2DC 2EE8A 2R1FA 1PDAA 4LF8E 2EN1A 2YTPA 1FJGE 4GKJE 3KWRA 1T4LB 1A1HA 4JI0E 4DV0E 2EM3A 1ZBTA 4FK5C 5ADZA 2CT1A 2NUEA 2EM7A 1HNXE 5IV8B 2I9IA 2MKNA 5A6AA 2LV2A 4ZYHA 1QU6A 4R2QA 3EQ1A 1UBDC 2KONA 5A2QC 2LMZA 3MHHC 2LUQA 2MKDA 2MDRA 3HTXA 1A1IA 2EM9A 2LUPB 2LRSA 1NCSA 2EPLX 4BC7A 2YTGA 2LVHA 1RC7A 2EPMX 2DRPA 3RMPA 3BF2A 1T39A 3L00A 1PJSA 2VF1A 2EOMA 2LE2A 1IMUA 2Q8UA 4X65E 4DV1E 2CSHA 4LF6E 2DLKA 2V83A 2ELZA 3IWCA 4NXME 2WZOA 4R2PA 2EPUA 4KZSA 2EN2A 2YSOA 3VYXA 1IBKE 3F6GA 2ENCA 4F9AB
chains in the Genus database with same CATH topology
4KWYA 4RHBB 5IXMB 2JXPA 2N8XA 5IV8B 5TSEA 2R76A 4N4RB 4Q35B 3BF2A 4RH8A 4NHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KWY A;  4RHB B;  5IXM B;  2JXP A;  2N8X A;  5IV8 B;  5TSE A;  2R76 A;  4N4R B;  4Q35 B;  3BF2 A;  4RH8 A;  4NHR A; 
#chains in the Genus database with same CATH topology
 1HNZ E;  3HQ1 A;  4LFA E;  1L4S A;  2R76 A;  4Q35 B;  1EH8 A;  2YTE A;  3TQM A;  1N34 E;  1JK2 A;  4P78 A;  1Z1B A;  4DR5 E;  1YUJ A;  2YU5 A;  4BBY A;  2EOJ A;  1MEY C;  4OOG C;  1EH6 A;  4BHB A;  4JI1 E;  4LFC E;  4JI3 E;  2JR1 A;  4OX9 E;  1KJK A;  2L2N A;  3EPH A;  2FTX B;  1X5W A;  4DV5 E;  2EOX A;  2IHR 1;  2NA2 A;  1X6H A;  3KZY A;  3EPL A;  4DV2 E;  4GZN C;  2EMA A;  2EZ6 A;  2F8B A;  4KWY A;  2HC5 A;  1WHN A;  2EPX A;  2M9A A;  4DUZ E;  2GLI A;  4J8Z A;  1ZBQ A;  2YRM A;  5AC4 A;  1QNT A;  3DF6 A;  2E72 A;  1SR9 A;  1X49 A;  2ENH A;  2YU8 A;  3ADI A;  2E5L E;  3HPS A;  4GEQ B;  4ZYG A;  2LTS A;  4F54 A;  1GTK A;  1O0W A;  4WXC A;  2YTO A;  5KL4 A;  1N36 E;  2WCC 3;  1J5E E;  1YPN A;  2EPN A;  3VK6 A;  4DR2 E;  2EMC A;  2LJH A;  2NAB A;  2F4V E;  2H36 X;  3THN A;  2JYA A;  1MGT A;  1T4N A;  2HJJ A;  1YZ9 A;  4DMI A;  4KHP E;  2EMW A;  1EKZ A;  2ODR C;  1YYO A;  5AE3 A;  2ZM6 E;  1YUI A;  4DUY E;  2DB2 A;  2EN7 A;  4JI2 E;  5BR8 E;  2MC6 A;  2YTN A;  1DGC A;  4BCA A;  2FGG A;  2V86 A;  4Q28 A;  4WX9 A;  2L3C A;  3THO B;  2EMY A;  4YHH E;  2VQE E;  4BS9 A;  2YPN A;  2N3G A;  2NUG A;  4F2J C;  4NHR A;  1GZ6 A;  4WXD A;  3J80 C;  3MHS C;  1HNW E;  2K4V A;  4JI5 E;  5IWA E;  2L3J A;  2BBG A;  1T38 A;  2EPC A;  2JWO A;  4BC9 A;  2DMI A;  2YTD A;  2EMK A;  4MLV A;  3HXL A;  2EQ3 A;  3EPK A;  5KL7 A;  5KL6 A;  2DIX A;  5CFF E;  3T1H E;  3DJW A;  2L2M A;  4F9B B;  2EL5 A;  1GQE A;  4LF5 E;  3C6K A;  4R2S A;  1F2I G;  1IBL E;  1A1G A;  1BB8 A;  4JI6 E;  4P7D A;  5AE2 A;  2EN3 A;  1G2F C;  3IWD A;  2JXP A;  2YTF A;  5LMN E;  4WSG A;  3FIG A;  3J7A G;  2GPI A;  2EOS A;  3C4T A;  3JU0 A;  1A1F A;  1AH5 A;  2EN4 A;  3KZZ A;  2M1S A;  2EOO A;  2HGH A;  4LF7 E;  2RPC A;  5FLX C;  3LLH A;  1J26 A;  2JOB A;  4F6N A;  2EMG A;  4X66 E;  2EPK X;  3AV0 A;  1XMO E;  1BBO A;  2PRT A;  4TUG A;  2DLQ A;  2GHF A;  2V88 A;  2EOZ A;  3LML A;  5KL3 A;  1STU A;  1LLM C;  2ADR A;  2LO3 A;  2LT7 A;  1PKP A;  2YT4 A;  1KYQ A;  4JI7 E;  1ZU1 A;  3H09 A;  4NXN E;  2RSI A;  4X62 E;  1UN6 B;  4X64 E;  2EM2 A;  2YRK A;  2WBT A;  2VQF E;  5KL5 A;  2B9D A;  1A1K A;  3F6H A;  4B3R E;  4MLQ A;  3J7Y p;  4B3S E;  1TF3 A;  2B7V A;  3C4B A;  5KL2 A;  1N3G A;  2I13 A;  4NZV A;  2EMZ A;  2ODR D;  2EOF A;  2UXD E;  4O4K A;  2YRH A;  3BID A;  2EMX A;  2HHH E;  4B3M E;  1NEI A;  2LBS B;  4O5G A;  2UXC E;  3BBG A;  2EMF A;  3P1X A;  1WXR A;  4M2Z A;  3VHT B;  4I8O A;  4LF9 E;  1WHQ A;  1X3C A;  3IWB A;  5F3W A;  2EPR A;  4DV6 E;  2JOX A;  2EPA A;  4DV7 E;  2DSY A;  4R2C A;  5IT9 C;  5AE1 A;  3VYY A;  4DR6 E;  1UIL A;  2EMI A;  3K6Q A;  2EN6 A;  2L33 A;  2RS6 A;  4HTG A;  1ZR9 A;  4GKK E;  2EN8 A;  2K7I A;  4WSP A;  2YSP A;  1YFH A;  1TN9 A;  1PJT A;  2A25 A;  2EJ4 A;  2L92 A;  5A69 A;  3OML A;  2D9H A;  2ELY A;  2L8T A;  3J81 C;  4F6M A;  4B3T E;  2EOI A;  4TUI A;  1XMQ E;  3T1Y E;  1N33 E;  1IQS A;  4F9C B;  4JI8 E;  1IBM E;  4LFB E;  5LL6 R;  1YYW A;  4N4R B;  3OTO E;  2L6M A;  4IS1 C;  1T4O A;  4LF4 E;  2M7Q A;  1WJP A;  5AAS A;  2N3H A;  4WYQ B;  3ECR A;  4O24 A;  1A1L A;  4X9J A;  2EOE A;  2EOY A;  1X47 A;  2DGC A;  2VE7 C;  2LCE A;  4R2E A;  4IJD A;  1JK1 A;  2MDG A;  2EOQ A;  2JY9 A;  2RTX A;  2EPZ A;  2M4I A;  2YTI A;  5LMU E;  5A6B A;  1N32 E;  3EPJ A;  1I94 E;  2B3T B;  5IXM B;  2EP3 A;  2JPA A;  2LTR A;  4LTY A;  4DR3 E;  1P47 A;  2YTJ A;  1B69 A;  3UK3 C;  4X8W A;  2EM0 A;  1DQ3 A;  2EPP A;  4RHB B;  2RQL A;  2BB8 A;  2MC5 A;  1XNQ E;  1BBG A;  1HR0 E;  2V85 A;  2V89 A;  2KHX A;  2EM6 A;  2ENA A;  4R2D A;  2EWL A;  2J7J A;  4K0K E;  5A6B D;  2G7H A;  4L5N C;  4AQY E;  2RSM A;  4ZYE A;  1IQO A;  2EQ1 A;  1X48 A;  4R03 A;  2EM5 A;  2EPO A;  4WPY A;  1X6F A;  4WFT A;  1AAY A;  1YYK A;  2B7T A;  2V87 A;  2UUC E;  2JP9 A;  5T6J A;  4R2R A;  2DMY A;  4DV3 E;  2E1M A;  1A1J A;  4M30 A;  2CPN A;  5A6J A;  4JI4 E;  2EOR A;  2UUA E;  2EL4 A;  1SFE A;  1UHZ A;  4YY3 E;  3QG5 C;  1DI2 A;  3JAM C;  2EML A;  1ZAA C;  2CTD A;  2EQ0 A;  4DKK A;  1YSA C;  2VRD A;  3ZOQ B;  3ADL A;  5TSE A;  3C6M A;  4DR1 E;  2NUF A;  2UU9 E;  4JV5 E;  1EH7 A;  4LU9 A;  2UUB E;  4JYA E;  1XNR E;  5AC5 A;  4M0V A;  5LLQ A;  4HEI A;  1FKA E;  4R2A A;  4DR4 E;  2EL6 A;  2JVA A;  1PJQ A;  2L2K B;  4L8N A;  5DNY A;  3ADG A;  4O43 A;  2YWQ A;  4BMJ A;  2N8X A;  3MSW A;  2WBU A;  2EM4 A;  2LJU A;  4R8O A;  4DV4 E;  2RS7 A;  5A6K A;  4ZYD A;  3M99 B;  4BHC A;  3ADJ A;  1TF6 A;  1RMD A;  1WRJ A;  3HPZ A;  2EOH A;  2EMB A;  4M9V C;  4RH8 A;  2YTQ A;  2KOU A;  3JTZ A;  2V8Q B;  2UXB E;  1RQ0 A;  2EMH A;  1X6E A;  3AUZ A;  4DR7 E;  2FV4 B;  2EM8 A;  3BGH A;  2YZT A;  2WBS A;  1G2D C;  2EE8 A;  2R1F A;  1PDA A;  4LF8 E;  2EN1 A;  2YTP A;  1FJG E;  4GKJ E;  3KWR A;  1T4L B;  1A1H A;  4JI0 E;  4DV0 E;  2EM3 A;  1ZBT A;  4FK5 C;  5ADZ A;  2CT1 A;  2NUE A;  2EM7 A;  1HNX E;  5IV8 B;  2I9I A;  2MKN A;  5A6A A;  2LV2 A;  4ZYH A;  1QU6 A;  4R2Q A;  3EQ1 A;  1UBD C;  2KON A;  5A2Q C;  2LMZ A;  3MHH C;  2LUQ A;  2MKD A;  2MDR A;  3HTX A;  1A1I A;  2EM9 A;  2LUP B;  2LRS A;  1NCS A;  2EPL X;  4BC7 A;  2YTG A;  2LVH A;  1RC7 A;  2EPM X;  2DRP A;  3RMP A;  3BF2 A;  1T39 A;  3L00 A;  1PJS A;  2VF1 A;  2EOM A;  2LE2 A;  1IMU A;  2Q8U A;  4X65 E;  4DV1 E;  2CSH A;  4LF6 E;  2DLK A;  2V83 A;  2ELZ A;  3IWC A;  4NXM E;  2WZO A;  4R2P A;  2EPU A;  4KZS A;  2EN2 A;  2YSO A;  3VYX A;  1IBK E;  3F6G A;  2ENC A;  4F9A B; 
#chains in the Genus database with same CATH homology
 4KWY A;  4RHB B;  5IXM B;  2JXP A;  2N8X A;  5IV8 B;  5TSE A;  2R76 A;  4N4R B;  4Q35 B;  3BF2 A;  4RH8 A;  4NHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...