2R76A

Crystal structure of the rare lipoprotein b (so_1173) from shewanella oneidensis, northeast structural genomics consortium target sor91a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
NQLSLSSSDEYKELTRLVRERLRLNNVKIVDAANDVPVLRLITDSLERSTLSLYPTGNVAEYELIYFVEFAVALPGKEAQPFKIEIRRDYLDDPRTALAKSREMELLVKEMRIQAADRILQSMASTEVNLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rare lipoprotein B
publication title Crystal structure of the rare lipoprotein B (SO_1173) from Shewanella oneidensis.
rcsb
source organism Shewanella oneidensis
molecule tags Lipoprotein
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 2r76A00
3BF2A 2R76A 5IV8B 4NHRA 4RHBB 5IXMB 5TSEA 2JXPA 4KWYA 2N8XA 4N4RB 4Q35B 4RH8A
chains in the Genus database with same CATH superfamily
4B3RE 4K0KE 3IWCA 1EH6A 4DV0E 2YZTA 4HEIA 3BF2A 4P78A 4JV5E 4DR3E 3BGHA 4LF4E 4B3ME 2EOMA 3JU0A 3ZOQB 2N3HA 4BC9A 2YU5A 3VHTB 2YWQA 1PJQA 3THOB 2EN7A 1DI2A 4N4RB 2JOBA 2YTJA 1A1GA 2UXCE 3C6MA 1F2IG 4DR6E 1NEIA 1Z1BA 4GKKE 3LLHA 2YT4A 4F6MA 5AE3A 3JTZA 1YFHA 5F3WA 2EOQA 4LF8E 2EN2A 2EP3A 1X5WA 4BMJA 1UILA 5IV8B 2RS7A 2EM5A 2UXDE 1TF6A 4M2ZA 2EM9A 2LUQA 4DV4E 1XMQE 2EMYA 3EPJA 3F6GA 4JYAE 1HR0E 2VRDA 1AAYA 2WBTA 4WXCA 4DUZE 4R8OA 1X49A 4ZYDA 4O5GA 4DKKA 2LMZA 1WRJA 2JYAA 2EMFA 4TUGA 5AC5A 2YTDA 3K6QA 1GQEA 1DQ3A 1TN9A 4R2AA 2LCEA 2VQEE 4WX9A 2B3TB 1ZAAC 2JVAA 5KL5A 2WZOA 2EMGA 4LFAE 1X6EA 2EMCA 2MDGA 3C6KA 1X3CA 4B3TE 1STUA 4YHHE 2YTIA 1UN6B 2LVHA 2DMIA 3HXLA 2EMWA 2EOSA 2V89A 1IBKE 5LMUE 1PDAA 2FTXB 3J81C 2YU8A 4BHCA 2EE8A 1IBME 1RC7A 3DF6A 2NA2A 5A2QC 5AC4A 4BS9A 2JR1A 1X47A 2YTFA 2L2NA 2V83A 2EN6A 2I13A 1A1IA 2R76A 2EPLX 4BC7A 1EH7A 2NUGA 5KL6A 5AE1A 2EPPA 4X64E 4NHRA 2EM0A 1DGCA 1YUJA 2RPCA 1MEYC 2DIXA 2FGGA 4I8OA 4R03A 3AUZA 2EMBA 4P7DA 1YZ9A 4ZYEA 2EM7A 5DNYA 1QNTA 2YSPA 2EMHA 2RSMA 1T38A 2LE2A 1AH5A 1T4NA 2EMZA 1KJKA 4F9CB 4R2DA 4R2EA 3EQ1A 3KZYA 3HPZA 4GKJE 4DR1E 2EMKA 2EQ1A 5LL6R 1N34E 2MKNA 2L8TA 4JI7E 4DV6E 1XMOE 1L4SA 2EN1A 5CFFE 4X66E 2EQ3A 4DMIA 2RTXA 2HHHE 2IHR1 1RQ0A 4WFTA 1T4OA 2KONA 4GZNC 3T1HE 3VYXA 3OTOE 1A1JA 1N36E 4LF7E 2LTRA 2EPUA 1GZ6A 5LMNE 5TSEA 2N8XA 1IBLE 4DR2E 1G2DC 2KHXA 2EL5A 3BIDA 1YYKA 3DJWA 1BB8A 2FV4B 4WYQB 2JPAA 2V8QB 3KWRA 4F54A 1JK1A 1T4LB 1RMDA 2NABA 4KHPE 2B9DA 1UBDC 3F6HA 4DV2E 4M9VC 2YRHA 3VYYA 4O43A 2EPRA 4Q35B 5ADZA 3ECRA 5FLXC 3UK3C 2ZM6E 2EOHA 3ADGA 2B7VA 2EMIA 3JAMC 1B69A 1X6HA 1FKAE 4JI4E 2N3GA 2EPOA 4MLQA 3THNA 2UXBE 2CSHA 2PRTA 2UUAE 2LRSA 4FK5C 2EM6A 3IWBA 1P47A 2EPAA 1WJPA 2V85A 2EPCA 2EN8A 2ELZA 3HPSA 4O24A 1YUIA 5LLQA 4O4KA 1IQOA 4KWYA 2DLKA 3VK6A 2MDRA 2WCC3 4LFBE 1WXRA 2RSIA 2YTOA 3L00A 2LJHA 2GHFA 2ELYA 2EPNA 3QG5C 4JI0E 1J26A 2D9HA 4DR4E 2M7QA 1SFEA 3EPKA 2I9IA 1N33E 1X6FA 5AE2A 1N32E 1JK2A 2L92A 3T1YE 2G7HA 2EM2A 2R1FA 2L3CA 4LF5E 4LFCE 3EPHA 2VF1A 1TF3A 2DMYA 4M30A 4BCAA 3OMLA 1ZR9A 4DV3E 2YTGA 4X62E 2BB8A 4R2SA 4DV5E 2V88A 2JXPA 1YYOA 4Q28A 2EPZA 2M1SA 4DUYE 1EH8A 1ZU1A 3KZZA 5IXMB 3HQ1A 2LBSB 1G2FC 2EORA 4L5NC 2DGCA 4F9BB 3C4TA 4DR5E 2E72A 2F4VE 2ENHA 2L3JA 4B3SE 2JOXA 2EMXA 4IS1C 4JI2E 2YTPA 4YY3E 4NXNE 2EOEA 2EOIA 1I94E 1A1LA 5A6AA 3ADIA 2LTSA 2YRKA 2J7JA 2B7TA 5A6JA 4RH8A 5A6BA 2EMLA 4F9AB 4JI3E 2VQFE 1PJSA 2V87A 4OX9E 2HJJA 4LU9A 1YSAC 1MGTA 2UUBE 2EL6A 4OOGC 4WXDA 4IJDA 2EL4A 5AASA 3ADLA 2A25A 5KL3A 2ENAA 5IWAE 2HC5A 2NUFA 2M9AA 4ZYGA 1HNWE 2CPNA 4R2QA 2EPKX 4RHBB 2LUPB 2EN4A 3HTXA 2EPXA 2E1MA 2LV2A 2E5LE 2EOYA 2RQLA 5A69A 4JI5E 4DV1E 3RMPA 4R2PA 1YPNA 2DLQA 1IQSA 4WSPA 1KYQA 2YTEA 2EQ0A 5BR8E 2EJ4A 3IWDA 2WBUA 4KZSA 2EM8A 1UHZA 2JWOA 2K7IA 1HNZE 2EM4A 4DV7E 2DRPA 3FIGA 5A6KA 4JI1E 2YTQA 1A1FA 2EPMX 3H09A 4HTGA 2K4VA 2ADRA 2HGHA 4LTYA 2YTNA 4JI6E 2EWLA 1J5EE 4LF6E 1XNRE 1ZBTA 4X8WA 1FJGE 1BBOA 3P1XA 2DSYA 2L2MA 3J80C 1X48A 4TUIA 2EM3A 3J7Yp 5T6JA 4WPYA 4JI8E 1ZBQA 4X9JA 1N3GA 4M0VA 1A1KA 2GLIA 4ZYHA 4F2JC 4R2CA 4BBYA 2EMAA 3C4BA 2EN3A 2V86A 5A6BD 4GEQB 2MC5A 4WSGA 2JY9A 2MKDA 1BBGA 2L33A 3TQMA 1IMUA 2NUEA 1EKZA 2VE7C 5IT9C 1O0WA 2KOUA 2RS6A 5KL7A 2Q8UA 1WHQA 2EOZA 5KL4A 2LJUA 2MC6A 1PJTA 2CT1A 2YSOA 2YRMA 4LF9E 3MHSC 1T39A 1HNXE 1GTKA 4NZVA 2DB2A 4NXME 4MLVA 2F8BA 4J8ZA 3BBGA 2LT7A 2WBSA 3MHHC 1SR9A 2EOJA 3M99B 3MSWA 2M4IA 2H36X 1XNQE 1QU6A 2UUCE 2ODRC 2YPNA 2EOXA 1PKPA 4BHBA 2EOOA 2EOFA 2EZ6A 1LLMC 4F6NA 2JP9A 2UU9E 2LO3A 2CTDA 2L6MA 4X65E 3J7AG 2BBGA 4DR7E 4AQYE 1NCSA 2ODRD 3ADJA 1WHNA 3AV0A 2ENCA 4L8NA 3EPLA 1YYWA 1A1HA 4R2RA 5KL2A 3LMLA 2L2KB 2GPIA
chains in the Genus database with same CATH topology
3BF2A 2R76A 5IV8B 4NHRA 4RHBB 5IXMB 5TSEA 2JXPA 4KWYA 2N8XA 4N4RB 4Q35B 4RH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BF2 A;  2R76 A;  5IV8 B;  4NHR A;  4RHB B;  5IXM B;  5TSE A;  2JXP A;  4KWY A;  2N8X A;  4N4R B;  4Q35 B;  4RH8 A; 
#chains in the Genus database with same CATH topology
 4B3R E;  4K0K E;  3IWC A;  1EH6 A;  4DV0 E;  2YZT A;  4HEI A;  3BF2 A;  4P78 A;  4JV5 E;  4DR3 E;  3BGH A;  4LF4 E;  4B3M E;  2EOM A;  3JU0 A;  3ZOQ B;  2N3H A;  4BC9 A;  2YU5 A;  3VHT B;  2YWQ A;  1PJQ A;  3THO B;  2EN7 A;  1DI2 A;  4N4R B;  2JOB A;  2YTJ A;  1A1G A;  2UXC E;  3C6M A;  1F2I G;  4DR6 E;  1NEI A;  1Z1B A;  4GKK E;  3LLH A;  2YT4 A;  4F6M A;  5AE3 A;  3JTZ A;  1YFH A;  5F3W A;  2EOQ A;  4LF8 E;  2EN2 A;  2EP3 A;  1X5W A;  4BMJ A;  1UIL A;  5IV8 B;  2RS7 A;  2EM5 A;  2UXD E;  1TF6 A;  4M2Z A;  2EM9 A;  2LUQ A;  4DV4 E;  1XMQ E;  2EMY A;  3EPJ A;  3F6G A;  4JYA E;  1HR0 E;  2VRD A;  1AAY A;  2WBT A;  4WXC A;  4DUZ E;  4R8O A;  1X49 A;  4ZYD A;  4O5G A;  4DKK A;  2LMZ A;  1WRJ A;  2JYA A;  2EMF A;  4TUG A;  5AC5 A;  2YTD A;  3K6Q A;  1GQE A;  1DQ3 A;  1TN9 A;  4R2A A;  2LCE A;  2VQE E;  4WX9 A;  2B3T B;  1ZAA C;  2JVA A;  5KL5 A;  2WZO A;  2EMG A;  4LFA E;  1X6E A;  2EMC A;  2MDG A;  3C6K A;  1X3C A;  4B3T E;  1STU A;  4YHH E;  2YTI A;  1UN6 B;  2LVH A;  2DMI A;  3HXL A;  2EMW A;  2EOS A;  2V89 A;  1IBK E;  5LMU E;  1PDA A;  2FTX B;  3J81 C;  2YU8 A;  4BHC A;  2EE8 A;  1IBM E;  1RC7 A;  3DF6 A;  2NA2 A;  5A2Q C;  5AC4 A;  4BS9 A;  2JR1 A;  1X47 A;  2YTF A;  2L2N A;  2V83 A;  2EN6 A;  2I13 A;  1A1I A;  2R76 A;  2EPL X;  4BC7 A;  1EH7 A;  2NUG A;  5KL6 A;  5AE1 A;  2EPP A;  4X64 E;  4NHR A;  2EM0 A;  1DGC A;  1YUJ A;  2RPC A;  1MEY C;  2DIX A;  2FGG A;  4I8O A;  4R03 A;  3AUZ A;  2EMB A;  4P7D A;  1YZ9 A;  4ZYE A;  2EM7 A;  5DNY A;  1QNT A;  2YSP A;  2EMH A;  2RSM A;  1T38 A;  2LE2 A;  1AH5 A;  1T4N A;  2EMZ A;  1KJK A;  4F9C B;  4R2D A;  4R2E A;  3EQ1 A;  3KZY A;  3HPZ A;  4GKJ E;  4DR1 E;  2EMK A;  2EQ1 A;  5LL6 R;  1N34 E;  2MKN A;  2L8T A;  4JI7 E;  4DV6 E;  1XMO E;  1L4S A;  2EN1 A;  5CFF E;  4X66 E;  2EQ3 A;  4DMI A;  2RTX A;  2HHH E;  2IHR 1;  1RQ0 A;  4WFT A;  1T4O A;  2KON A;  4GZN C;  3T1H E;  3VYX A;  3OTO E;  1A1J A;  1N36 E;  4LF7 E;  2LTR A;  2EPU A;  1GZ6 A;  5LMN E;  5TSE A;  2N8X A;  1IBL E;  4DR2 E;  1G2D C;  2KHX A;  2EL5 A;  3BID A;  1YYK A;  3DJW A;  1BB8 A;  2FV4 B;  4WYQ B;  2JPA A;  2V8Q B;  3KWR A;  4F54 A;  1JK1 A;  1T4L B;  1RMD A;  2NAB A;  4KHP E;  2B9D A;  1UBD C;  3F6H A;  4DV2 E;  4M9V C;  2YRH A;  3VYY A;  4O43 A;  2EPR A;  4Q35 B;  5ADZ A;  3ECR A;  5FLX C;  3UK3 C;  2ZM6 E;  2EOH A;  3ADG A;  2B7V A;  2EMI A;  3JAM C;  1B69 A;  1X6H A;  1FKA E;  4JI4 E;  2N3G A;  2EPO A;  4MLQ A;  3THN A;  2UXB E;  2CSH A;  2PRT A;  2UUA E;  2LRS A;  4FK5 C;  2EM6 A;  3IWB A;  1P47 A;  2EPA A;  1WJP A;  2V85 A;  2EPC A;  2EN8 A;  2ELZ A;  3HPS A;  4O24 A;  1YUI A;  5LLQ A;  4O4K A;  1IQO A;  4KWY A;  2DLK A;  3VK6 A;  2MDR A;  2WCC 3;  4LFB E;  1WXR A;  2RSI A;  2YTO A;  3L00 A;  2LJH A;  2GHF A;  2ELY A;  2EPN A;  3QG5 C;  4JI0 E;  1J26 A;  2D9H A;  4DR4 E;  2M7Q A;  1SFE A;  3EPK A;  2I9I A;  1N33 E;  1X6F A;  5AE2 A;  1N32 E;  1JK2 A;  2L92 A;  3T1Y E;  2G7H A;  2EM2 A;  2R1F A;  2L3C A;  4LF5 E;  4LFC E;  3EPH A;  2VF1 A;  1TF3 A;  2DMY A;  4M30 A;  4BCA A;  3OML A;  1ZR9 A;  4DV3 E;  2YTG A;  4X62 E;  2BB8 A;  4R2S A;  4DV5 E;  2V88 A;  2JXP A;  1YYO A;  4Q28 A;  2EPZ A;  2M1S A;  4DUY E;  1EH8 A;  1ZU1 A;  3KZZ A;  5IXM B;  3HQ1 A;  2LBS B;  1G2F C;  2EOR A;  4L5N C;  2DGC A;  4F9B B;  3C4T A;  4DR5 E;  2E72 A;  2F4V E;  2ENH A;  2L3J A;  4B3S E;  2JOX A;  2EMX A;  4IS1 C;  4JI2 E;  2YTP A;  4YY3 E;  4NXN E;  2EOE A;  2EOI A;  1I94 E;  1A1L A;  5A6A A;  3ADI A;  2LTS A;  2YRK A;  2J7J A;  2B7T A;  5A6J A;  4RH8 A;  5A6B A;  2EML A;  4F9A B;  4JI3 E;  2VQF E;  1PJS A;  2V87 A;  4OX9 E;  2HJJ A;  4LU9 A;  1YSA C;  1MGT A;  2UUB E;  2EL6 A;  4OOG C;  4WXD A;  4IJD A;  2EL4 A;  5AAS A;  3ADL A;  2A25 A;  5KL3 A;  2ENA A;  5IWA E;  2HC5 A;  2NUF A;  2M9A A;  4ZYG A;  1HNW E;  2CPN A;  4R2Q A;  2EPK X;  4RHB B;  2LUP B;  2EN4 A;  3HTX A;  2EPX A;  2E1M A;  2LV2 A;  2E5L E;  2EOY A;  2RQL A;  5A69 A;  4JI5 E;  4DV1 E;  3RMP A;  4R2P A;  1YPN A;  2DLQ A;  1IQS A;  4WSP A;  1KYQ A;  2YTE A;  2EQ0 A;  5BR8 E;  2EJ4 A;  3IWD A;  2WBU A;  4KZS A;  2EM8 A;  1UHZ A;  2JWO A;  2K7I A;  1HNZ E;  2EM4 A;  4DV7 E;  2DRP A;  3FIG A;  5A6K A;  4JI1 E;  2YTQ A;  1A1F A;  2EPM X;  3H09 A;  4HTG A;  2K4V A;  2ADR A;  2HGH A;  4LTY A;  2YTN A;  4JI6 E;  2EWL A;  1J5E E;  4LF6 E;  1XNR E;  1ZBT A;  4X8W A;  1FJG E;  1BBO A;  3P1X A;  2DSY A;  2L2M A;  3J80 C;  1X48 A;  4TUI A;  2EM3 A;  3J7Y p;  5T6J A;  4WPY A;  4JI8 E;  1ZBQ A;  4X9J A;  1N3G A;  4M0V A;  1A1K A;  2GLI A;  4ZYH A;  4F2J C;  4R2C A;  4BBY A;  2EMA A;  3C4B A;  2EN3 A;  2V86 A;  5A6B D;  4GEQ B;  2MC5 A;  4WSG A;  2JY9 A;  2MKD A;  1BBG A;  2L33 A;  3TQM A;  1IMU A;  2NUE A;  1EKZ A;  2VE7 C;  5IT9 C;  1O0W A;  2KOU A;  2RS6 A;  5KL7 A;  2Q8U A;  1WHQ A;  2EOZ A;  5KL4 A;  2LJU A;  2MC6 A;  1PJT A;  2CT1 A;  2YSO A;  2YRM A;  4LF9 E;  3MHS C;  1T39 A;  1HNX E;  1GTK A;  4NZV A;  2DB2 A;  4NXM E;  4MLV A;  2F8B A;  4J8Z A;  3BBG A;  2LT7 A;  2WBS A;  3MHH C;  1SR9 A;  2EOJ A;  3M99 B;  3MSW A;  2M4I A;  2H36 X;  1XNQ E;  1QU6 A;  2UUC E;  2ODR C;  2YPN A;  2EOX A;  1PKP A;  4BHB A;  2EOO A;  2EOF A;  2EZ6 A;  1LLM C;  4F6N A;  2JP9 A;  2UU9 E;  2LO3 A;  2CTD A;  2L6M A;  4X65 E;  3J7A G;  2BBG A;  4DR7 E;  4AQY E;  1NCS A;  2ODR D;  3ADJ A;  1WHN A;  3AV0 A;  2ENC A;  4L8N A;  3EPL A;  1YYW A;  1A1H A;  4R2R A;  5KL2 A;  3LML A;  2L2K B;  2GPI A; 
#chains in the Genus database with same CATH homology
 3BF2 A;  2R76 A;  5IV8 B;  4NHR A;  4RHB B;  5IXM B;  5TSE A;  2JXP A;  4KWY A;  2N8X A;  4N4R B;  4Q35 B;  4RH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...