2R76A

Crystal structure of the rare lipoprotein b (so_1173) from shewanella oneidensis, northeast structural genomics consortium target sor91a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
b'NQLSLSSSDEYKELTRLVRERLRLNNVKIVDAANDVPVLRLITDSLERSTLSLYPTGNVAEYELIYFVEFAVALPGKEAQPFKIEIRRDYLDDPRTALAKSREMELLVKEMRIQAADRILQSMASTEVNLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rare lipoprotein B
molecule tags Lipoprotein
source organism Shewanella oneidensis
publication title Crystal structure of the rare lipoprotein B (SO_1173) from Shewanella oneidensis.
rcsb
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 2r76A00
4NHRA 2JXPA 5TSEA 5IXMB 4KWYA 4RHBB 2N8XA 2R76A 4RH8A 4Q35B 5IV8B 4N4RB 3BF2A
chains in the Genus database with same CATH superfamily
2K4VA 2CT1A 2DB2A 2YWQA 2EOYA 4O5GA 2V87A 1BB8A 4YHHE 2MKDA 2MC5A 3HPSA 4R2CA 4M9VC 2WBSA 2MDRA 2EMAA 2ODRD 1UN6B 4WSPA 4BHBA 4L5NC 4YY3E 2J7JA 3MHSC 2MC6A 1ZU1A 2EMFA 2L2MA 2CTDA 2YTOA 2UU9E 2EMXA 2E72A 1SR9A 5F3WA 1N3GA 2YPNA 2YT4A 1EH6A 1GTKA 2EMHA 3BBGA 4BC9A 3DJWA 1O0WA 4ZYDA 5IXMB 2EJ4A 2VQFE 4J8ZA 4L8NA 4LF4E 2EMGA 2E1MA 2L2NA 2V83A 1A1KA 1ZBTA 1X47A 2FGGA 2M4IA 2RS7A 1G2FC 3BF2A 2B7TA 4R2PA 4BMJA 4JYAE 2UXDE 1ZBQA 2EMIA 3MHHC 2EQ1A 4JI7E 4X65E 2ELYA 4JI8E 2EORA 4R2EA 4HTGA 2LTSA 2EOEA 3UK3C 2K7IA 2ELZA 1X3CA 1GQEA 2EQ0A 2EN8A 4R2RA 2DLQA 1YUIA 4RHBB 2EMBA 2EP3A 2LRSA 2N8XA 4LF9E 1TN9A 4B3RE 2UUCE 4F6NA 2EOSA 2RSMA 4X62E 5DNYA 4LU9A 4B3SE 4DR7E 4KWYA 2YTFA 3VYYA 2LTRA 4R2SA 2F8BA 1BBGA 2EMKA 4FK5C 4ZYGA 2LVHA 1YPNA 1ZAAC 1ZR9A 4OX9E 2EPLX 1IBLE 2LMZA 2EOJA 1WXRA 2N3GA 1WJPA 2EN1A 2EOXA 4KHPE 2CPNA 3JAMC 4NXNE 1PJTA 2EPCA 2LO3A 2EPRA 1IBME 2YZTA 4BBYA 2LBSB 2EMYA 2EPKX 3VYXA 3ADGA 2ENCA 2JXPA 2DIXA 3K6QA 1PKPA 1YZ9A 2RQLA 1FJGE 2EOOA 2EPPA 4M2ZA 2R1FA 1SFEA 2IHR1 2I9IA 1A1IA 4DV3E 4DR3E 2JVAA 2EPAA 4GKKE 2EZ6A 2FV4B 2JP9A 2KONA 3MSWA 2LJUA 3ADIA 4O4KA 1N33E 1EH8A 2GLIA 4WSGA 2FTXB 3TQMA 2DRPA 5A69A 3HTXA 1IQOA 1TF6A 3EPLA 4HEIA 1AH5A 2EN2A 2EM3A 2YRHA 1YYWA 1T4LB 5FLXC 5A2QC 2UUBE 2EPNA 4R8OA 2EL4A 2V88A 4BC7A 2N3HA 3JTZA 1L4SA 4LF5E 2JR1A 1XNRE 4X66E 2V86A 3KZZA 2L92A 2L3CA 4ZYEA 3OMLA 4JI4E 1NEIA 1UILA 5KL7A 4R03A 1PJQA 2EOQA 4BHCA 1DGCA 4WX9A 1A1JA 1UHZA 2VE7C 1MGTA 2GHFA 2EMLA 3T1YE 1X5WA 2A25A 5KL6A 1X48A 3HXLA 4R2DA 4LFBE 2JPAA 2EM4A 4LF8E 3EPHA 2EM8A 1IBKE 4KZSA 1YYOA 2LJHA 4JI5E 1DQ3A 3J81C 4TUIA 4M0VA 5A6BD 2EOFA 2YTNA 5AC5A 2WBUA 3L00A 1YSAC 3C6KA 4DV5E 3F6HA 3KZYA 4WXDA 3IWBA 2ODRC 4N4RB 2CSHA 2EOIA 5ADZA 5KL4A 1HR0E 4GZNC 5KL5A 4WYQB 2LUPB 4RH8A 4TUGA 3BIDA 1QNTA 2GPIA 5AE1A 2E5LE 3J80C 4F9BB 4OOGC 3F6GA 2UXCE 2EOMA 1A1GA 2RSIA 3M99B 3VK6A 1A1HA 4JI0E 4DV7E 1X6EA 5AE2A 2RTXA 4MLQA 4F54A 5KL3A 1JK2A 4DR4E 2D9HA 1RMDA 1RQ0A 2YTJA 2EPOA 3EQ1A 5BR8E 2NUGA 4LTYA 2EMZA 4DV6E 4B3TE 5A6KA 2YTDA 4P78A 3C6MA 4AQYE 1PJSA 4LF6E 2YTPA 2VQEE 1QU6A 1EH7A 3BGHA 4GEQB 2EM0A 3J7Yp 3FIGA 2UXBE 2RS6A 3JU0A 1MEYC 2VRDA 1STUA 2M9AA 2JY9A 3AUZA 3P1XA 1FKAE 4R2QA 4NXME 4DUZE 4JV5E 3ADLA 2EE8A 4X64E 5A6AA 1WHQA 3RMPA 2NA2A 4DR1E 4DKKA 3IWDA 2NUEA 2EM2A 5AE3A 2EL5A 2EOZA 3THOB 4DV2E 2JOXA 3ADJA 2EQ3A 4LF7E 2YTGA 5A6JA 4LFCE 2M7QA 4DR6E 2DMYA 4NHRA 2V8QB 2B7VA 4I8OA 4MLVA 2EM7A 2YRKA 1KYQA 2YRMA 2EPXA 1HNZE 1IMUA 4IS1C 4Q28A 2LV2A 2RPCA 5IWAE 2EM9A 1F2IG 4F9CB 4F2JC 4DV1E 1HNWE 2LT7A 1WHNA 2EM6A 4B3ME 2L33A 4WFTA 1TF3A 1YUJA 5A6BA 4JI2E 2EN3A 1KJKA 2V89A 1I94E 4P7DA 1A1LA 2EN4A 3DF6A 2UUAE 2WZOA 4IJDA 4DR2E 2I13A 2EL6A 1N32E 2YSPA 5IV8B 1HNXE 2JYAA 1XNQE 1IQSA 3VHTB 3EPKA 5LMUE 2ENAA 3LLHA 2YTQA 3C4TA 5LMNE 1DI2A 2EPUA 2BB8A 1T39A 4F9AB 4JI3E 2DMIA 1UBDC 2VF1A 2JOBA 2L2KB 1BBOA 5AASA 2EMWA 2EPMX 4GKJE 3ECRA 5CFFE 2LCEA 4M30A 3H09A 2HHHE 2MKNA 2EOHA 4DMIA 4F6MA 1XMOE 1J26A 2NUFA 3EPJA 2M1SA 3QG5C 3THNA 3J7AG 4R2AA 2EN6A 2L6MA 2L3JA 2H36X 5KL2A 2HC5A 2ENHA 1J5EE 1X49A 2YTEA 1WRJA 1PDAA 4WXCA 3ZOQB 2R76A 3OTOE 1T4OA 1EKZA 2Q8UA 2V85A 4DV0E 3C4BA 5TSEA 2G7HA 2BBGA 2JWOA 4ZYHA 2EWLA 2YU5A 1B69A 2KHXA 1Z1BA 4DR5E 4JI1E 1AAYA 1X6HA 5LL6R 2WBTA 2L8TA 1RC7A 2B9DA 1X6FA 4Q35B 5T6JA 5LLQA 1N34E 2MDGA 4DV4E 2YSOA 1N36E 2KOUA 3LMLA 4BS9A 3T1HE 2PRTA 3KWRA 2EN7A 1XMQE 2EMCA 4X9JA 2DLKA 1T38A 1A1FA 1P47A 1GZ6A 2YTIA 4LFAE 2YU8A 2HGHA 2DGCA 1LLMC 4X8WA 2WCC3 2ZM6E 2HJJA 2EM5A 3AV0A 3HQ1A 1G2DC 4DUYE 2DSYA 4O43A 5IT9C 4WPYA 2F4VE 1NCSA 2LE2A 1YFHA 1YYKA 4O24A 1JK1A 4K0KE 2B3TB 2LUQA 3HPZA 2ADRA 2EPZA 1T4NA 4NZVA 5AC4A 3IWCA 4JI6E 2NABA 4BCAA
chains in the Genus database with same CATH topology
4NHRA 2JXPA 5TSEA 5IXMB 4KWYA 4RHBB 2N8XA 2R76A 4RH8A 4Q35B 5IV8B 4N4RB 3BF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHR A;  2JXP A;  5TSE A;  5IXM B;  4KWY A;  4RHB B;  2N8X A;  2R76 A;  4RH8 A;  4Q35 B;  5IV8 B;  4N4R B;  3BF2 A; 
#chains in the Genus database with same CATH topology
 2K4V A;  2CT1 A;  2DB2 A;  2YWQ A;  2EOY A;  4O5G A;  2V87 A;  1BB8 A;  4YHH E;  2MKD A;  2MC5 A;  3HPS A;  4R2C A;  4M9V C;  2WBS A;  2MDR A;  2EMA A;  2ODR D;  1UN6 B;  4WSP A;  4BHB A;  4L5N C;  4YY3 E;  2J7J A;  3MHS C;  2MC6 A;  1ZU1 A;  2EMF A;  2L2M A;  2CTD A;  2YTO A;  2UU9 E;  2EMX A;  2E72 A;  1SR9 A;  5F3W A;  1N3G A;  2YPN A;  2YT4 A;  1EH6 A;  1GTK A;  2EMH A;  3BBG A;  4BC9 A;  3DJW A;  1O0W A;  4ZYD A;  5IXM B;  2EJ4 A;  2VQF E;  4J8Z A;  4L8N A;  4LF4 E;  2EMG A;  2E1M A;  2L2N A;  2V83 A;  1A1K A;  1ZBT A;  1X47 A;  2FGG A;  2M4I A;  2RS7 A;  1G2F C;  3BF2 A;  2B7T A;  4R2P A;  4BMJ A;  4JYA E;  2UXD E;  1ZBQ A;  2EMI A;  3MHH C;  2EQ1 A;  4JI7 E;  4X65 E;  2ELY A;  4JI8 E;  2EOR A;  4R2E A;  4HTG A;  2LTS A;  2EOE A;  3UK3 C;  2K7I A;  2ELZ A;  1X3C A;  1GQE A;  2EQ0 A;  2EN8 A;  4R2R A;  2DLQ A;  1YUI A;  4RHB B;  2EMB A;  2EP3 A;  2LRS A;  2N8X A;  4LF9 E;  1TN9 A;  4B3R E;  2UUC E;  4F6N A;  2EOS A;  2RSM A;  4X62 E;  5DNY A;  4LU9 A;  4B3S E;  4DR7 E;  4KWY A;  2YTF A;  3VYY A;  2LTR A;  4R2S A;  2F8B A;  1BBG A;  2EMK A;  4FK5 C;  4ZYG A;  2LVH A;  1YPN A;  1ZAA C;  1ZR9 A;  4OX9 E;  2EPL X;  1IBL E;  2LMZ A;  2EOJ A;  1WXR A;  2N3G A;  1WJP A;  2EN1 A;  2EOX A;  4KHP E;  2CPN A;  3JAM C;  4NXN E;  1PJT A;  2EPC A;  2LO3 A;  2EPR A;  1IBM E;  2YZT A;  4BBY A;  2LBS B;  2EMY A;  2EPK X;  3VYX A;  3ADG A;  2ENC A;  2JXP A;  2DIX A;  3K6Q A;  1PKP A;  1YZ9 A;  2RQL A;  1FJG E;  2EOO A;  2EPP A;  4M2Z A;  2R1F A;  1SFE A;  2IHR 1;  2I9I A;  1A1I A;  4DV3 E;  4DR3 E;  2JVA A;  2EPA A;  4GKK E;  2EZ6 A;  2FV4 B;  2JP9 A;  2KON A;  3MSW A;  2LJU A;  3ADI A;  4O4K A;  1N33 E;  1EH8 A;  2GLI A;  4WSG A;  2FTX B;  3TQM A;  2DRP A;  5A69 A;  3HTX A;  1IQO A;  1TF6 A;  3EPL A;  4HEI A;  1AH5 A;  2EN2 A;  2EM3 A;  2YRH A;  1YYW A;  1T4L B;  5FLX C;  5A2Q C;  2UUB E;  2EPN A;  4R8O A;  2EL4 A;  2V88 A;  4BC7 A;  2N3H A;  3JTZ A;  1L4S A;  4LF5 E;  2JR1 A;  1XNR E;  4X66 E;  2V86 A;  3KZZ A;  2L92 A;  2L3C A;  4ZYE A;  3OML A;  4JI4 E;  1NEI A;  1UIL A;  5KL7 A;  4R03 A;  1PJQ A;  2EOQ A;  4BHC A;  1DGC A;  4WX9 A;  1A1J A;  1UHZ A;  2VE7 C;  1MGT A;  2GHF A;  2EML A;  3T1Y E;  1X5W A;  2A25 A;  5KL6 A;  1X48 A;  3HXL A;  4R2D A;  4LFB E;  2JPA A;  2EM4 A;  4LF8 E;  3EPH A;  2EM8 A;  1IBK E;  4KZS A;  1YYO A;  2LJH A;  4JI5 E;  1DQ3 A;  3J81 C;  4TUI A;  4M0V A;  5A6B D;  2EOF A;  2YTN A;  5AC5 A;  2WBU A;  3L00 A;  1YSA C;  3C6K A;  4DV5 E;  3F6H A;  3KZY A;  4WXD A;  3IWB A;  2ODR C;  4N4R B;  2CSH A;  2EOI A;  5ADZ A;  5KL4 A;  1HR0 E;  4GZN C;  5KL5 A;  4WYQ B;  2LUP B;  4RH8 A;  4TUG A;  3BID A;  1QNT A;  2GPI A;  5AE1 A;  2E5L E;  3J80 C;  4F9B B;  4OOG C;  3F6G A;  2UXC E;  2EOM A;  1A1G A;  2RSI A;  3M99 B;  3VK6 A;  1A1H A;  4JI0 E;  4DV7 E;  1X6E A;  5AE2 A;  2RTX A;  4MLQ A;  4F54 A;  5KL3 A;  1JK2 A;  4DR4 E;  2D9H A;  1RMD A;  1RQ0 A;  2YTJ A;  2EPO A;  3EQ1 A;  5BR8 E;  2NUG A;  4LTY A;  2EMZ A;  4DV6 E;  4B3T E;  5A6K A;  2YTD A;  4P78 A;  3C6M A;  4AQY E;  1PJS A;  4LF6 E;  2YTP A;  2VQE E;  1QU6 A;  1EH7 A;  3BGH A;  4GEQ B;  2EM0 A;  3J7Y p;  3FIG A;  2UXB E;  2RS6 A;  3JU0 A;  1MEY C;  2VRD A;  1STU A;  2M9A A;  2JY9 A;  3AUZ A;  3P1X A;  1FKA E;  4R2Q A;  4NXM E;  4DUZ E;  4JV5 E;  3ADL A;  2EE8 A;  4X64 E;  5A6A A;  1WHQ A;  3RMP A;  2NA2 A;  4DR1 E;  4DKK A;  3IWD A;  2NUE A;  2EM2 A;  5AE3 A;  2EL5 A;  2EOZ A;  3THO B;  4DV2 E;  2JOX A;  3ADJ A;  2EQ3 A;  4LF7 E;  2YTG A;  5A6J A;  4LFC E;  2M7Q A;  4DR6 E;  2DMY A;  4NHR A;  2V8Q B;  2B7V A;  4I8O A;  4MLV A;  2EM7 A;  2YRK A;  1KYQ A;  2YRM A;  2EPX A;  1HNZ E;  1IMU A;  4IS1 C;  4Q28 A;  2LV2 A;  2RPC A;  5IWA E;  2EM9 A;  1F2I G;  4F9C B;  4F2J C;  4DV1 E;  1HNW E;  2LT7 A;  1WHN A;  2EM6 A;  4B3M E;  2L33 A;  4WFT A;  1TF3 A;  1YUJ A;  5A6B A;  4JI2 E;  2EN3 A;  1KJK A;  2V89 A;  1I94 E;  4P7D A;  1A1L A;  2EN4 A;  3DF6 A;  2UUA E;  2WZO A;  4IJD A;  4DR2 E;  2I13 A;  2EL6 A;  1N32 E;  2YSP A;  5IV8 B;  1HNX E;  2JYA A;  1XNQ E;  1IQS A;  3VHT B;  3EPK A;  5LMU E;  2ENA A;  3LLH A;  2YTQ A;  3C4T A;  5LMN E;  1DI2 A;  2EPU A;  2BB8 A;  1T39 A;  4F9A B;  4JI3 E;  2DMI A;  1UBD C;  2VF1 A;  2JOB A;  2L2K B;  1BBO A;  5AAS A;  2EMW A;  2EPM X;  4GKJ E;  3ECR A;  5CFF E;  2LCE A;  4M30 A;  3H09 A;  2HHH E;  2MKN A;  2EOH A;  4DMI A;  4F6M A;  1XMO E;  1J26 A;  2NUF A;  3EPJ A;  2M1S A;  3QG5 C;  3THN A;  3J7A G;  4R2A A;  2EN6 A;  2L6M A;  2L3J A;  2H36 X;  5KL2 A;  2HC5 A;  2ENH A;  1J5E E;  1X49 A;  2YTE A;  1WRJ A;  1PDA A;  4WXC A;  3ZOQ B;  2R76 A;  3OTO E;  1T4O A;  1EKZ A;  2Q8U A;  2V85 A;  4DV0 E;  3C4B A;  5TSE A;  2G7H A;  2BBG A;  2JWO A;  4ZYH A;  2EWL A;  2YU5 A;  1B69 A;  2KHX A;  1Z1B A;  4DR5 E;  4JI1 E;  1AAY A;  1X6H A;  5LL6 R;  2WBT A;  2L8T A;  1RC7 A;  2B9D A;  1X6F A;  4Q35 B;  5T6J A;  5LLQ A;  1N34 E;  2MDG A;  4DV4 E;  2YSO A;  1N36 E;  2KOU A;  3LML A;  4BS9 A;  3T1H E;  2PRT A;  3KWR A;  2EN7 A;  1XMQ E;  2EMC A;  4X9J A;  2DLK A;  1T38 A;  1A1F A;  1P47 A;  1GZ6 A;  2YTI A;  4LFA E;  2YU8 A;  2HGH A;  2DGC A;  1LLM C;  4X8W A;  2WCC 3;  2ZM6 E;  2HJJ A;  2EM5 A;  3AV0 A;  3HQ1 A;  1G2D C;  4DUY E;  2DSY A;  4O43 A;  5IT9 C;  4WPY A;  2F4V E;  1NCS A;  2LE2 A;  1YFH A;  1YYK A;  4O24 A;  1JK1 A;  4K0K E;  2B3T B;  2LUQ A;  3HPZ A;  2ADR A;  2EPZ A;  1T4N A;  4NZV A;  5AC4 A;  3IWC A;  4JI6 E;  2NAB A;  4BCA A; 
#chains in the Genus database with same CATH homology
 4NHR A;  2JXP A;  5TSE A;  5IXM B;  4KWY A;  4RHB B;  2N8X A;  2R76 A;  4RH8 A;  4Q35 B;  5IV8 B;  4N4R B;  3BF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...