2R84A

Crystal structure of purp from pyrococcus furiosus complexed with amp and aicar
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
334
structure length
329
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
molecule keywords PurP protein PF1517
total genus 104
structure length 329
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r84A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r84A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r84A01
1W96A 3V4SA 2VPQA 2W6ZA 3Q2OA 4MA5A 2DZDA 1Z2NX 4YJ2F 2V5AA 1EUCB 4O7LA 2ZDGA 2QK4A 3BG5A 3ORQA 4WD3A 4O7YA 2NU8B 1IOVA 1JLLB 2QF7A 2W6OA 1DIKA 4ZHQF 5BPHA 3R23A 4HNTA 3VMMA 5C1OA 1CE8A 2NU6B 3JRXA 3I12A 4O7VA 3RV4A 3TIGA 4MA0A 2R7LA 1AUVA 2W70A 3OUZA 1VKZA 5I47A 3V4ZA 4M9UA 3SE7A 2W6MA 4FU0A 1KJJA 2YRXA 4EA8A 2DIKA 2YYAA 2YRWA 3MWDA 4YAKB 2R82A 2YWVA 1OBDA 1GGOA 3R5FA 4O84A 3LP8A 2IP4A 2V59A 1GLVA 1W93A 2PBZA 4EGQA 4O4IF 2NU9B 3K5IA 4O7ZA 3U54A 1JDEA 3HB9A 5CB4F 3KALA 3U9SA 1UC8A 2R84A 5JVDF 5J2TF 4O82A 2I8CA 3R9RA 3TINA 4O4LF 3N8DA 1M0WA 1E4EB 2R85A 4TUYF 1M6VA 4M99A 3RFCA 2YZNA 2GPWA 1JDBB 2R7MA 3DF7A 3Q1KA 4O7WA 2FB9A 4MV1A 4YBZB 4FGRA 4MV7A 4M9CA 3ETJA 5FNVF 3QFFA 4MAMA 3TIIA 5JH7F 2CNVA 1CQIB 1A48A 4YJ3F 4O7NA 3U55A 4EA9A 2CNUA 1EUDB 1EYZA 3MWEA 2DLNA 2GLTA 2XCLA 3G8DA 4E4TA 5BPFA 3K5HA 5HV6A 2PN1A 2WYOA 1IOWA 1DV1A 5GONF 2V58A 1PX2A 4WBNF 2VQDA 4ZOLF 5K2MA 2YW2A 2W6QA 4HQ6A 4I55F 5IYZF 5C1PA 4TV9F 1T36A 4YAJB 4MV8A 3TQTA 3G8CA 5EZYF 1KJQA 2YZLA 2YS7A 4FFPA 5JVLA 2I80A 3VOTA 1Z2OX 3BSWA 4MV9A 4DIMA 4YB8B 3WO0A 1KJ8A 1A9XA 4IZOA 5LOVF 2GPSA 5HBRB 2CNQA 5H80A 3AW8A 1BNCA 4C5CA 1JKJB 4J6EA 2ZDQA 5DMXA 2P0AA 2FPPB 1VBHA 1OBGA 2C00A 3UFXB 5LP6F 1PK8A 4FFMA 1C3OA 4FFOA 4HNUA 4FFRA 1B6RA 4EAAA 1B6SA 5CAEB 2R6FA 2FP4B 1BXRA 2Z02A 2FPIB 4FFLA 3R5XA 5CA1F 1KBLA 4QSHA 4I4TF 3ETHA 3LWBA 5JQGF 3N6RA 2I87A 3R5HA 1GSOA 4XX0B 4XYMB 4C5AA 4FFNA 2W6PA 3VPBA 1KUTA 4DLKA 4IWYA 3ORRA 2XD4A 4O86A 4EGJA 4MV4A 1ULZA 3HO8A 3KAJA 4ME6A 4L1KA 4O2AF 5LA6F 3NUAA 1DV2A 2FPGB 1AUXA 4IHJF 2YZMA 4XYLB 2NPOA 2PVPA 2ZDHA 4NYEA 5J2UF 5CA0F 3OUUA 2Z04A 4I50F 5LXTF 2GQSA 4GGMX 1CQJB 1SCUB 2W71A 3MJFA 3BSYA 3JZIA 2R87A 3VPDA 4XZ3B 4ZQIA 4O7SA 3VA7A 4EABA 3E5NA 1VBGA 4FE2A 2SCUB 3RV3A 3U9TA 1KJIA 2NU7B 3GIDA 4MV3A 4TV8F 1KJ9A 2CQYA 3GLKA 3JRWA 4O83A 1EHIA 2W6NA 1KEEA 3AX6A 4O4HF 2DWCA 3WO1A 1WR2A 1GSHA 4MV6A 4RZQA 3JZFA 4O81A 3RUPA 4HNVA 3HBLA 2NUAB 2YZGA 4HR7A 2J9GA 1EZ1A 1GSAA 3TW6A 2OLSA 3BSSA 3BFPA 2R86A 1UC9A 3KREA 5JQWA 3WNZA 1KC7A 4O4JF 5C8YF 4O7RA 3VPCA 2GQRA 3K3PA 1M0TA 4IIJF 5D8DA 4ZI7F 4Y8VB 5KKNB 2YS6A 1I7LA 2VR1A 5BMVF 1E4EA 2HGSA 5LYJF 1I7NA 3KAKA 4EG0A 4IWXA 2X0SA 2VHEA 1Z2PX 2HJWA 2R7NA 2R7KA 4O2BF 1C30A 2YL2A 4EA7A 4C5BA 1CS0A 4M98A 2CZGA 4O7TA 5KX5F
chains in the Genus database with same CATH superfamily
1KTAA 2ZUFA 1AQYA 3WNDA 1UBMS 4IH9A 1XRQA 4Q0YA 2Y0PA 2ZSFA 1OWTA 1FYFA 1GTL1 1A0IA 3BJIC 2GS9A 4LZPA 1ETUA 3SQMA 4ZMRA 1HDXA 4L73A 4CHGA 4BVJA 1NXOA 3BG5A 3VAZA 1QR2A 3HLYA 5ALQA 3ITEA 5K8LA 3RJ9A 4EEYA 5TPWA 4XGRA 3CVJA 3CJRA 3BM5A 5AHWA 1UDBA 2LV8A 4LTDA 5C9ZA 2Y1WA 3INYA 2QI9F 4YFYA 4ZKDA 3OTHA 4DV0H 1J25A 3MJRA 3AR8A 3BREA 3ILYA 3B1YA 1BMFA 1Z8NA 2EJTA 1QXSA 2BGRA 1LSSA 2P6OA 2P35A 3D3EA 4AUMA 3I5AA 3W2GA 4AIRA 1XNRH 3L6CA 4R40A 4DUYH 2FWRA 3PC8C 3WKCA 3NGXA 4U7WA 1TE2A 4J9KA 3GA0A 3H5TA 3O8NA 3P2IA 5CDTA 4RGBA 5HVNA 1N2SA 4FHGA 2W42A 3NHYA 1Q1NA 4MYCA 3U60B 4Q7EA 4HDSB 5DNAA 2JA5G 2OC4A 3LUGA 2IV2X 1NTOA 2OH2A 1IUNA 2KBFA 3CM0A 3G8AA 4RU1A 3KT8A 1M6EX 4H0FA 5WRFA 3RV4A 4FDMA 3STHA 2OHHA 5AI6A 3VR4H 4IIFA 3BF7A 1GUYA 3FMVA 3QKUA 4UJ5A 4UHCA 2FSPA 3ORSA 3RTBA 2XRMA 2XECA 3GU3A 1ZIOA 4KIFA 3PW4A 1GL3A 1M8JA 2Q4TA 5EE1A 2P5YA 5KBYA 1WBBA 4ZTBA 3WLIA 4AMYA 2LD4A 4XB2A 1NXSA 2GUWA 3PNKA 2R25B 2J9FA 5F7XA 1ZONA 3A9WA 3N42B 2J9ZB 3GGCA 3S29A 1H9BA 4DR2H 1ULAA 2PCJA 3PB3A 4IXNA 3DMRA 4LTNA 2JIBA 5F9MA 5JSZB 2I9KA 2AK3A 2GD6A 4EG5A 4FLMA 3B1WA 1D09A 3NUZA 2QHXA 4IUCS 4CZ2A 3L9WA 3QY0A 4RV5A 4JLDA 1J22A 4K5QA 1PS8A 2ID8A 3ZY6A 1H5UA 3ZYZA 1GA4A 3F90A 1DUSA 3OCJA 4FYJA 2EFJA 4LGVA 2PGXA 1T8SA 3LP8A 1F2UB 3ZK7A 1UFQA 4EIWA 4QUIA 2NVYA 2QGNA 4KWCA 4CM8B 2RB4A 1XMQB 1UMBA 2X8AA 2Q5IA 1GTG1 1TMGE 3WNCA 1JZQA 1R15A 2W2TA 3CF4G 2C84A 1DGSA 2B30A 3MOSA 3RUFA 3C16C 1EX7A 1FRZA 2PHZA 4RL4A 3OQIB 2Y1GA 4L85A 4PC2A 3T52A 3FYUC 1F9AA 4MKXA 3O92A 2OD7A 3FROA 4L6CA 5HA5A 4TVOA 4UPVA 3GEEA 2D74A 1JKMA 4LZAA 4AL4A 4HT3B 1FP4A 3ZGNA 1ZIYA 1JLSA 3TOSA 1EWYA 3E22B 2ACWA 2AN4A 1XTKA 2HQOA 4QGFA 3A7EA 4KQXA 1KORA 4MINA 1M6VA 4A10A 5EMKA 1L5VA 1D1SA 4M99A 1C4XA 5DSTA 1S97A 3FUTA 2ASVA 1RHRA 2XITA 4LTMA 4BP9A 3II6X 4WXEA 4C05A 4ZA2A 4ZYYA 3H87A 2R7MA 2WHRA 1L5MA 2H48A 1LCIA 4PZ0A 3UUEA 4J8PA 4CLDA 3JSNA 1PL8A 4DV3B 3ZJUA 4US2R 3SVTA 1JXQA 2OMEA 2X0IA 3UWKA 2YU9A 1C8VB 4REQB 4EKGA 3K1ZA 3M3DA 4C4TA 1F2TB 3EXIB 1V5EA 1QPZA 1F6WA 3W8NA 1P80A 2XVXA 3KK0A 1L7NA 3SYNA 4FGUA 1IYZA 1UZNA 4CKYA 3HKCB 2DF8A 5FJ8G 1AXRA 2HTEA 3NM5A 4D5GA 1H0SA 2IHUA 5K8TA 1D0VA 1X2EA 1V5FA 2G70A 4PAQA 1T0UA 2C3PA 1M34E 3DKKA 5AW0A 5H9VA 4PSKA 5BOSA 1TAHA 3FPAA 4PTYA 4G8CA 3NRJA 3W2FA 4QPZA 6LDHA 2YFKA 1FVOA 1I2ZA 3CZRA 2UV8A 4GI2A 3GUCA 3VU1A 2QX8A 4OBWA 4BEVA 5IWCA 4B3HA 5LLTA 5AM2A 1FQOA 4ZAGA 4C6TB 5COQA 3EOBI 1BGWA 1NZFA 4H6XA 3O4HA 2Z2KA 3TKYA 2MMGA 4IIXA 4B80A 2JARA 4M0KA 1UP6A 4FW9A 4EPTA 1NAHA 4KXWA 1U8AA 2B4YA 3GEGA 4MYTA 1EUDB 1XPOA 1P0QA 3IXLA 1N5IA 1SFRA 3CX7A 5FDFA 2C98A 3AVVA 3ICQB 2XB8A 2OFFA 4RE5A 5D3KA 2Q3EA 2WP0A 4HGOA 3ZU6A 4J0KA 1AKYA 1YI8A 2OZLB 4OPMA 3QVVA 4OOFA 4J91A 4WVFA 5FBKA 3K5HA 4FXOA 1FFXA 3SVZA 1ZC4A 2WYOA 2BOVA 3LW7A 2BV3A 1EFPB 1CUZA 5KFYA 1VA4A 1YAJA 3JQBC 1KZ9A 2KI5A 1UKYA 4FNOA 3UM9A 5L7WA 5JDIA 4H6PA 3K0HA 3FBWA 4F8YA 3K6RA 2BEVB 1ZVJA 4UUAA 3ZJVA 1TZ2A 4I6GA 1X7WB 5K0ZA 1PGOA 3KQSA 5KNLA 5CFOA 1ZD4A 1SOAA 5FOUA 2V7QA 4QXMA 2NX2A 4B32A 2HHLA 3DJFA 2HRZA 4W5WA 3W3AA 3DAFA 4AJLA 1H4SA 4LSZA 3LUPA 1HY3A 2VK2A 2IV3A 4QGHA 4GLBA 1GQFA 2QRJA 3WLQA 1M6HA 2X5OA 2OBLA 1JMYA 1I2KA 1Q19A 1DHTA 3CX4A 4HMOA 3WL8A 4BRWA 3U4QB 1FF9A 3D4LA 4PHTA 3M0EA 4OQZA 4GKAA 4X91A 4ROTA 4RH3A 4XEHA 5A5FA 1E2IA 5LVAA 3QHAA 4AICA 1Q7CA 5HIIA 3RC9A 2H5LA 3H2GA 3S44A 2WDZA 1DXOA 4TS9A 1GUFA 2D1SA 2GASA 1B0AA 2ZUWA 4CETA 1ISPA 3EUAA 3E5HA 3P52A 4I36A 1ISMA 1N8SA 3CZMA 1SVOA 4RCZA 3T06B 4C03A 4EHKA 2FEMA 3DEHA 4QM7A 4J0CA 2WF5A 3USZA 1NMYA 4F4HA 5JBQA 4J90A 4M9QA 4LKOA 1GUDA 3BTOA 3I23A 4H7KA 2WQ7A 4HAIA 2PV7A 2RHDA 3MLEA 3JQAD 3I04M 4DQDA 2EFDB 2KB0A 3WLKX 2AH5A 5AKGA 3SIPA 1UMCB 1N1DA 4WK4B 3HJAA 3OQJA 3UKDA 1B0UA 3RVJA 4PG5A 4ZEOA 2B3DA 1VSVA 4EHIA 3IG0A 5JU6A 5IZ4A 2ECOA 2QVYX 4NEHB 1DZIA 1MHTA 1P77A 4KC0A 5FORA 1U7UA 3IUBA 2P7HA 3QF7A 4XOIA 2WIDA 3SEAA 1PQPA 2A6PA 2X7JA 2O2JA 3ESQA 3P9YA 4IDAA 1Y3IA 4B8ZA 3KHHA 1VCOA 5FD6A 2FPXA 3CJQA 3IIJA 4OFWA 2OXIA 1WZ2A 2FUEA 3RSOA 4ES6A 3PPYA 1CJMA 3LYAA 3CSUA 3I5YA 3V32A 2XDAA 3DVSX 4P53A 3EMDA 3O9MA 3CZPA 3FUVA 1YSCA 1J0CA 1P2VA 5JJ5A 2IY9A 2WLSA 4NEQA 3AXSA 5JC1A 3PJRA 3WGLA 1XJWA 2CXSA 4BN5A 2WUWE 1MNAA 5TMEA 5DX0A 5TS2A 1CWUA 4UUGA 3T1YH 1DXHA 1JKXA 1ULBA 4FSDA 5C5DA 4M7RA 4XIFA 1V25A 2F1IA 5BSKA 1KQFA 2WT8A 3A05A 4L0QA 4YY3H 5A4KA 5J1TB 3BTVA 3DZDA 4S1TA 4CDRA 1J21A 3HHEA 3ETNA 4MS3B 5ABPA 1SB8A 1BHQ1 2Q6VA 3T15A 4DR3H 4M37A 1IXRC 3U62A 1GPYA 3DFFA 2Q2WA 4FLFA 1TLTA 3LC1O 4CEIA 3ETHA 5AW4A 3NV7A 5FRDA 3NIDB 4MI9A 1S2GA 1N6IA 4GL2A 4P8RA 3DMGA 3N2KA 4IIEA 3EGCA 1KAGA 2ZUBA 2YHBA 4WBNB 1QVZA 3OIWA 4M46A 4P0PB 2QR2A 5CNMA 3HA7A 1Y5IA 5CVDA 1AV6A 3G59A 1FLNA 3C1TA 1YI0A 3L7JA 5HFJA 1E2BA 2I54A 3S1SA 4A3IG 2JJ8A 2B2XA 1XA4A 4WOJA 4CIXA 1PWEA 4XYMB 2FW7A 3ZCXA 3TLXA 1DKLA 4HG2A 4DW8A 3EIEA 3G6KA 2VSFA 1CFJA 3T41A 3PX7A 3DLPX 3RRMA 3TMYA 4FHFA 5FTWA 2CC2A 5KTOA 3ND8A 1KYQA 2LKDA 2DFNA 5GJBA 1QWSA 4JJZA 2MT9A 3LUBA 1OE0A 1O5OA 2L2QA 2IWHA 5T8KA 4XD7D 3EGWA 5A9SB 5K0GA 2HLPA 1A96A 1W4AA 3S24A 2ZYHA 1A3GA 2JHPA 5EQJB 2VN8A 4OGLA 1IVSA 1ILEA 4OHBA 3B1XA 3UOGA 2A86A 2AUTA 2ODPA 1VA5A 4POAA 4K1LA 3OTGA 4FJ1A 2Y99A 4GVPA 5J2UB 1N3BA 1E79A 3ND5A 1MB3A 4XYLB 2WEKA 1ZOIA 3IILA 3CUKA 1CZUA 1EK6A 2IZOA 2VSXA 5CIWA 4YYEA 4YCNA 2C5FA 2ORYA 3DD5A 3IMFA 4S0ZA 1FRNA 2ZWOA 4JP5A 2VDOB 4PQRA 4F96A 4DEVA 1U8TA 1BXGA 4N12A 1T5TA 4F5WA 2P1RA 3EE6A 1EKPA 2Q2VA 2XAUA 2I6TA 3MJVA 1YQWA 3NB0A 3DPUA 4YO7A 1EVLA 5EJFA 2QAGA 2D1QA 3DE2X 4PGFA 3OAAA 4R8KA 3VGPA 4DMCA 3PHLA 2ZWMA 1GGEA 2RBKA 4GECA 4HWGA 2EU8A 3L41A 1ZH2A 2I7TA 3CEHA 1F3OA 3DTNA 2LZ0A 4FUQA 2M6LA 3M6XA 4B40A 3M2TA 1D9XA 1P74A 4E5UA 3FG9A 1NBEA 1CW2B 2XCIA 1I2MA 3OURA 4NHEA 4YVFA 2V7VA 3T9BA 2P69A 1OTXA 4G8BA 3U13A 4LDQA 2ZE8A 4PC6A 4RUCA 1U02A 3BWVA 1C3XA 5IDQA 2FLKA 1LF0A 3B13B 5LYJA 3MWKA 3BCRA 3RBDA 1YB5A 1TK2A 5KCMA 3ZDQA 4PQEA 4WVLA 5KS8A 3HMKA 3L4EA 5FOXA 1FYWA 5CVJA 3AHFA 1UAYA 3NYQA 1X1QA 1Y6ZA 5EKDA 1QO7A 3BRSA 2X9VA 1JP7A 2Z3ZA 3LU1A 1VCIA 3U16A 1VDMA 3AVTA 2IWRA 2PM8A 1Q16A 4JI0H 3CKLA 3QK7A 1WV0A 5DXJA 5A4FS 3NBAA 3NYWA 4F9FA 3L43A 4NBSA 3L49A 1U99A 4K05A 2WG2A 1C1XB 1KJ9A 5DBEX 5KFZA 1Z88A 2BGJA 2R79A 4HKTA 4UJ3A 4F85A 2H00A 2XRZA 3LFHA 2FCAA 3BPSA 5DASA 1SD1A 4JJ4A 1QIDA 1SKUA 1NUSA 1ZK4A 3HBNA 5F1PA 1CUUA 3USES 4Q9DA 4BHTA 1BMDA 4TRRA 2HVQA 1TQ8A 3DBHA 1NJGA 4XJTA 4D46A 1E3EA 3G2MA 3ZE1B 2JLSA 5E7JA 2C92A 2ZJ4A 4B84A 1E62A 2XUDA 4IJMA 1P5RA 5KFVA 2QTTA 2CB9A 4BUZA 3AV0B 1XVUA 3WTCA 5IYDG 2GNPA 4DQ0A 1ENOA 4WZBB 5LBTA 1GSHA 9ABPA 3WIDA 3GGJA 3U4AA 3PT9A 5CCXA 2PANA 5I01A 3JZFA 3DXZA 1I7PA 3RFXA 2PWBA 1Y1RA 4X6UA 4M38A 3HBLA 1GT91 1B76A 4PYOA 2I55A 3COVA 1QNLA 2PRYA 5FA6A 3DEZA 3A8TA 2ZJOA 3W5JA 4JKYA 1FUKA 1U2DC 2CVQA 3I2YX 4BB9A 2RK3A 1WY7A 1M2VB 2GK4A 3OP4A 5FR1A 3B53X 1M83A 1J09A 5ALVA 3T61A 2E55A 1JI3A 4JA0A 1TD9A 3WFZA 3EF3A 3AG6A 4CNBA 4MKHA 4JV0A 3WMWA 3LRTA 4N5NA 4AZWA 2VPSA 1KKMA 2NZVG 4D79A 4DLSA 3ONNA 1MHPA 3CW9A 5EHIA 5GVRA 3F5DA 2D6FA 2BFDA 3T7RA 3BIOA 4B48A 3AXTA 4JBGA 3DW1X 4EDHA 3D3WB 4M4SA 1HNWH 4OQYA 4OLJA 5HF8A 1KO5A 3CEMA 5LNK6 4U00A 1XXLA 3C6MA 3FKQA 1NJ2A 1JG2A 3HU2A 5FP0A 3TOXA 1P16A 4DYVA 2ZXUA 2GR9A 2EFEB 2IE8A 5JEEA 5KFFA 2JI7A 5ICSA 1YBHA 3LS2A 3UBTA 4BPRA 3FSEA 1G5RA 4RTMA 1CY7A 1I7QB 3EVGA 3WGKA 2FMTA 1XTIA 2PL5A 1A5BB 5FUVA 5LUBA 1J2JA 5EG5A 2XWQA 4MV0A 3RU9A 1G3RA 1Q0HA 5LOVB 3ANXA 1Z2PX 4Q1DA 1W87A 2B1JA 3AJ9A 3T7JA 3OOYA 2PH1A 2JL1A 3LQKA 3MJEA 3OPQA 3AL2A 3GNLA 2EVWX 2E5LH 1UBTS 4O2BF 4Y1GA 1XPUA 4RNDB 4EDFA 1LPMA 4TL9A 3GIIA 1LW7A 3ER6A 3JPWA 5A04A 2QE7D 4LXHA 3SJ7A 4FGJA 3PICA 1CUDA 4W7IA 4C5BA 5TNXA 5C1BA 4NU6A 3KAPA 1CJVC 1T3ZA 4NS1A 1DZ3A 5J4KA 2XNDD 2CZGA 2X0NA 1KFKB 3EX7C 5FF9A 4S2UA 4F3RA 4DAEA 3DMTC 2GDJA 5DM70 3FTDA 5K7SA 5JNLA 2ZB8A 3T5KA 2GAIA 4J7AA 3NDBB 4GEGA 7ADHA 1IY9A 1UPUA 3JALA 3SSNA 2Z57A 3LD9A 3G6VA 4IIBA 2X0FA 2ZR8A 4PRYA 1J33A 3AQ4A 3CF2A 1U0FA 3HZOA 3AFMA 3LUJA 2Z0MA 1XMSA 2WF6A 3KJFA 4GUAA 3H18A 5H68A 4CLRA 3ESCA 4KI7A 1DIRA 1JPUA 1P2UA 2HK7A 3ASVA 3KUXA 2HT6A 4HGNA 1ESDA 1XNGA 2BZ0A 1ZHQA 2VUMG 3C98A 4MW5A 5EEGA 4DZZA 5KOIA 1AMNA 3C39A 4GVXA 4Z9FA 4TL8A 3UB3A 3AZQA 4F8JA 5FR2A 3KZXA 3WNBA 1PK7A 1E1RD 2VYQA 3OZGA 4OQNA 1G7TA 3R40A 4DEXA 5EE5B 4F04A 4FGZA 4HRVA 1ZBQA 2DY0A 1ZD5A 4WDQA 2PUHA 1XZPA 5C1OA 1ONNA 1QX4A 1TVMA 3UW1A 4MUMA 2QPTA 1DG9A 3GBVA 3HUUA 3ZE2B 3O4JA 1JX4A 4LDAA 2QTMA 1MR3F 2HCRA 3GEMA 1S03G 2Q6LA 3LY7A 4N1AA 4XQ9A 4YT4A 5I5EA 4PPYA 1JJAA 5IJ9A 1N0HA 4LYGA 4L07A 4OHKA 5HMLA 2V8OA 5K5EA 4B3BA 1QIEA 3TNJA 1D6SA 1LTHR 5HIAA 1GKUB 2QU7A 3MCTA 5DTMA 2JD1A 4HSGA 1BZYA 2WILA 3K4HA 1NQ5A 4KODA 4P84A 5A6SB 3T0GA 3KQYA 7AT1A 1IM8A 5HRCA 4NMLA 5KVSA 3PX3A 4MQ5A 3R76A 1Y5LA 2Z58A 1JLKA 2HXYA 3BOSA 1YASA 3V55A 2BDEA 2EGUA 4ZRMA 4EF5A 5E4JA 2PMEA 2C9OA 1UT8A 3C70A 1AM4D 3CNBA 1IY0A 2GO1A 3D7RA 4GWLA 1NFRA 4ZQCB 2J4CA 5F4ZA 3RFUA 2YC2C 2AHRA 1JIKA 3REQB 4OMFG 2J45A 2WU8A 1TJ4A 1YI1A 1USVA 4UCQA 4P7JA 4UZFA 2QX9A 2CN1A 3H1AA 4MTDA 1AQ6A 4LFBH 2EJUA 3LNCA 5AOBA 3HRIA 1KSGA 3RANA 3UN1A 3ZGVA 2EKQA 3DH0A 5DHFA 4QPJC 3CEJA 1F8XA 3AILA 5EA2A 2X40A 4UCRA 3I5UA 2PZKA 1MEOA 1SURA 1QIGA 2REQA 5BSWA 3DF9A 4UMFA 1DBPA 1GZ7A 2BKVA 1I8TA 2RI1A 3BXHA 4M76B 4M89A 1O6CA 4F4UA 3UV3A 4C0SA 1K9VF 2ZRFA 4I50B 4ZXFA 3RYHA 3C6YA 4MEJA 4ETMA 4YRNA 5C7OO 3GLGE 4O7ZA 4ZI3A 2H06A 2YNMA 5E9WA 4INOA 2W8BB 4UMEA 1J0BA 5AKXA 2II6A 2IYWA 1NVVQ 1EDOA 3MWMA 2X3YA 5ALKA 2G88A 2AFIE 3AYXB 5B37A 5GVSA 3O0TA 1RPAA 4BNKA 1IQUA 3KOYA 4BDTA 3KTDA 4JVLA 4B3JA 4O4LF 3N8DA 4I46A 3ZWVA 3MG9A 2X6TA 4DQNA 5AI5A 3U7JA 1HNNA 1W4BA 4ENWA 4FBLA 3GMTA 1ZNWA 2Q1YA 1G2QA 1ODCA 3GA7A 3IBYA 2MYUA 3JAKB 1W5AA 3NETA 4M1WA 4LYAA 3GDHA 5FPQA 4B82A 1H2AS 5COBA 2NADA 3GTJA 3UJDA 1MAVA 4HGQA 3T5PA 1TU3A 1BO6A 4UM5A 1UBCA 4E33A 4EHLA 3Q7QA 1QRAA 2C83A 1SAYA 2QN6A 4EF4A 4CMHA 1F4PA 1P62B 2LCIA 4PZDA 3F47A 1MABB 3HVHA 3IUPA 2VDWA 3JQCA 5HQ3A 1BS1A 3CTPA 5EJIA 2R6AA 5EI5A 4KPEC 3HFJA 1E2JA 2QN2A 4YBZB 3HI6A 3S1AA 1E79D 5IABA 4FGRA 3I6BA 4WTOA 5F2EA 3EXG1 1E3JA 3DKPA 1TO1E 5J4YA 1T3SA 4F6RB 4CEIB 1YC5A 1T4CA 2X6RA 4D41A 2WVHA 4XD7A 1SXJE 4QEDA 5H59A 3TEKA 2G83A 2WMOB 4LC1A 4NNJA 4Q44A 4U7HA 1USKA 3CLKA 3UJHA 1U0BB 3OFJA 1JXOA 1PS0A 2Z5GA 4PTZA 5IKXA 1UBJS 3A1WA 4DBLC 5ALPA 1Z5OA 1D2HA 2OORC 1XZNA 2F67A 3N2YA 4FILA 3ZE0B 3D1LA 4G5FA 2OR3A 3I9LA 1R6TA 6AT1A 1NVTA 4G4JA 1IMJA 1PQ4A 5TY0A 4ZIRA 3UAXA 5EFOA 1KDZA 3ZN2A 4W8GA 4YCCA 5K3AA 1WMFA 3DTVB 1T8YA 5D01A 1YB2A 2Q3MA 3MTQA 3MWEA 1SHZA 1XAHA 1W5TA 3GAFA 4QBKA 1ECGA 3PNBA 3ZCUA 4MS4B 1RP7A 2QL7A 1D2MA 4MXDA 1TUBA 3T3PB 3RFTA 3CF0A 1JDUA 1QHNA 4G09A 5BRJA 1DIHA 1N7GA 1E3QA 4PBCA 1H22A 4G07A 4N8EA 3T4XA 1RM4A 5I51A 2CDRA 5E6RA 4UE3S 3ZWBA 4UM9B 2YVQA 4RSMA 3SX2A 2QNBA 3ZJ5A 1CE8B 2NIPA 4WIAA 4U7CA 4YDRA 4CKWA 5LPNA 4GPAA 2COEA 2ZRJA 4OG2A 2HSDA 3IJPA 5EIOA 5BNFA 1BDHA 5CNKA 4WXMA 2DPGA 5EJGA 5D3QA 4X7RA 3UMSA 2IITA 1TXGA 4FJ2A 3AINA 4P83A 4LDPA 3MGKA 3FDJA 3T9FA 5BMOA 1Q7GA 3JARA 3LQRA 1JG7A 1W5SA 1F48A 1V16A 4KO1S 5ALIA 3RM3A 4EPXA 4MW6A 4GLXA 1FDOA 4I1VA 5K8UA 5KKAA 2ZTUA 1QCCA 4FDAA 4XCQA 3GT4A 2P2DA 3OEED 4EKDA 3MHTA 5IMBA 4RA9B 4RVNA 5T7BA 4MNTA 2W6JA 3K0FB 2CNOA 2HBZA 3GPDG 4J94A 1MUUA 1VL2A 3KVVA 3WXBA 3REQA 4R9NA 2F1OA 1HQCA 2IZ1A 5FWYB 5KFGA 3IBSA 3P2KA 4UFOA 5AH0A 2F6RA 4EQ6B 1R66A 1KAOA 3DNFA 1CKNA 5JVLA 1R00A 1TJ5A 2PO7A 2IW3A 2XNCA 3L7DA 4IXTA 2UYCA 1OA1A 2FI1A 4DBVO 4BMYA 1XJ0A 1C9JA 3NBMA 1EFKA 1E3MA 3CX3A 4XZ3A 5K0NA 2REQB 2XE8A 4Y18A 1FLAA 2B78A 5LQJA 1LNQA 4F3NA 2YBDA 1V41E 3PHCA 3U61B 2R2AA 1LPSA 4LG1A 2R6CA 1XZDA 1I4LD 3IOMA 4H1TA 5JY6A 3LO8A 4HX9A 2WB2A 3UAYA 2OXEA 4MVJI 1G20B 4N82A 4IDFA 1KK3A 3UJ8A 5K0JA 5L4LA 3A58B 3AV3A 1YRLA 3T9AA 5I5UA 1WVGA 4L51A 3VI4B 5C34B 4JCOA 1O96A 2SICE 3R5KA 3GQBB 4OAOA 2DRIA 3ESDA 4B33A 1ATIA 2QZJA 1XXHE 3PF8A 1DC7A 1V4YA 1SKBA 4A8JA 5K0EA 1FPQA 2P4UA 3AEKB 3D8NA 3PC4A 4KAJA 2K5UA 5ALYA 3U7RA 4IIYA 3CZ9A 4O2AA 1AC5A 1DQSA 3EUEA 1Z4QA 2J5KA 2R1ZA 2QTCA 1DKPA 2Q4OA 3K9LA 4REOA 2WSBA 4UD6A 1C3VA 2Y1FA 2X22A 4NVRA 4LGYA 4FYIA 4AB1A 1TA0A 2ZYIA 4MPDA 4NENA 1UJ5A 5IVIA 1PFGA 5E4FA 5BW6B 1C3OA 2QVZX 1TZKA 3DAOA 4JQYA 5BRAA 7YASA 2J0EA 4IDEA 2XTZA 4AMVA 4GI3A 1BXRA 3BD8A 4NBLA 1IIRA 1M66A 1T2FA 4BNTA 2I3DA 5DAAA 2QAIA 5CA1F 4PLGA 4CFSA 3BMXA 4NH4A 1D2AA 4WA8A 4A5SA 3GZJA 1WOMA 1U2ZA 4QOSA 4E30A 1Q20A 1JHRA 2BSXA 3F6YA 2E5LB 1LQ2A 1QDEA 2PSHA 4MTLA 1BN7A 4UHHA 5ENZA 3KUDA 4ENPA 4NWIA 1O87A 2HF9A 3EGVA 4MRRA 5IJ0A 3CVUA 3ZQJA 2X5XA 1IQRA 3FBTA 4J9QA 1BWRA 2JFPA 2ZR9A 4KLRA 4QIHA 3TAHA 5JRJA 4JSRA 4MWTA 3ASYA 4ZGBA 3NHRA 1EJ0A 1OSNA 2UVUA 1QIMA 2F9LA 4KJZA 1E7MA 3FHCB 2O8BA 2I87A 1AMUA 2F8LA 2ZI5A 2I1QA 2HIXA 3GJSA 3GGGA 4R83A 2B2NA 3OX2A 4NYMR 2ABJA 4A03A 1NI3A 2MDTA 3LCJA 4K88A 4B73A 1ZXLA 1XVAA 5LQSA 3G5TA 4UZSA 4FI3C 4YJKA 3ZI0A 5C8ZA 5FWXA 2FEAA 5KNBD 5EIBC 3PD0A 4CIVA 4FB5A 2W6PA 1HFWA 1FZQA 2Y0CA 2BP7A 3VR6D 1GGNA 4EI7A 2OKCA 1E6EA 2UVPB 3TTTA 5K0SA 4JL5A 2OHIA 2DYKA 2F62A 4DQVA 3ESAA 2HWUA 1SC9A 4UUMA 4ARBA 3KWJA 5EXEA 3FSGD 4MV4A 2R96A 1I7SB 3F4KA 3HO8A 2AD1A 2HCFA 4MUAA 3KT6A 4LFCH 2R00A 2X58A 3EZ6A 4R01A 4RV9A 1Q95A 1P5FA 3QXXA 1PYGA 5KHLB 4LSXA 4L3VA 2GD1O 2LKCA 1QK3A 2GEVA 2X1LA 3ENNA 3MWEB 3TZ6A 3T7CA 2GEFA 2VSNA 2KMLA 4NV0A 3I4FA 4Q43A 3R8CA 3UWMA 5B6PA 2BR3A 4BRUA 1TJNA 1I30A 5MFZA 1N3LA 3S5JA 4HY3A 1GG8A 4ARSA 4II3A 1AG9A 4CHTA 1UWVA 4K6KA 1H8HD 2P75A 4RTQA 2R4QA 2QE6A 1Y4ZA 3PWZA 2Z08A 4BLSA 3QOWA 3SU8A 2HK6A 2AOVA 1L1EA 3GRFA 1E4FT 2PBLA 3U17A 2O0LA 4KR9A 4DG9A 4F2WA 5A71A 3K0FA 4HGPA 3EIFA 4UBMA 3RTDA 4LHZA 3S70A 1G8FA 4U7JA 3K1AA 3DWEX 1XN4A 3ROEA 2YY5A 3FVRA 1IBMB 1I3CA 3CR7A 2DHEA 3HWRA 1T0PA 1NULA 1YF3A 2DR2A 3ZZ0A 4L8FA 4GLJA 1DRJA 3T7SA 4E70A 5AUOB 3G5LA 1FQWA 2HK9A 5FUYA 4C20A 3M6VA 2B1RA 4P33A 4HDQB 7REQB 3D54D 1P2BA 2HX1A 4EKYA 3FLAA 4QYIB 1XP8A 3K30A 1JFFA 2IYTA 1LI7A 3AK4A 5AW7A 1U4NA 2BY4A 1DL5A 2GA9A 2ZWVA 3TZKA 2OZEA 3CEAA 4XX1A 1WEKA 4N03A 3UMVA 1B2LA 1H9AA 1PJSA 1Z62A 5AUPB 3L7KA 2K2QB 4IM7A 1Q1ZA 4G97A 4ALMA 5HKKD 1DWOA 4G4GA 1GVHA 1W4RA 2OWEA 4R1UA 1SZDA 2C9MA 3IP5A 4P9NA 4NDNE 1PVOA 5CM9C 1BKDR 1F2VA 2AZTA 4G1FA 4G8JA 4MO9A 2YWJA 4GOJA 2IJGX 4QICA 3PSAA 3X43A 3SDBA 3QBVA 1UINA 1E94E 5C44G 1SVNA 2AT1A 4GZ3A 2GZDA 3B3AA 3PUYA 4L9SA 2FRDA 5KG1A 5LKRA 4XLTA 4KP7A 2XB9A 1BGXT 4RGYA 2D0DA 3OC0A 4LNHA 2WD9A 4GF5A 2AGOA 4O4HF 1H05A 3H1BA 4FOOA 4JU9A 2UDPA 5GWXA 5ELXA 1Y1VA 5ICEA 3UICA 3TRKA 3PDUA 4ZJZA 1YS9A 2ZJ8A 3ZHYA 2ZT7A 2KBEA 5IM5A 2Y9PB 4JP1A 5IBQA 3WRWA 4EUSA 2NUAB 1MO6A 1Z0AA 4OGWA 4CCSA 2GCEA 4HR7A 3UGJA 4IDHA 2OCXA 1V1MA 1TMKA 1XALA 1ZEMA 2WE7A 1UNNC 2XMPA 3PNLA 5DHRA 5BUQA 2ZI4A 4DRYA 1MX3A 3CISA 2QM0A 3MOIA 1GGKA 1G2PA 4UBLA 3RHTA 1O0BA 3CIFA 5J2UA 1SUEA 4FYPA 1WB5A 1UMKA 1Q84A 1VIVA 1WF3A 5C8YB 4DCPA 1SU6A 4PYIA 1NVGA 2ZTHA 3GJYA 1G7RA 5FHQA 2XGQA 3TQOA 1R37A 1XEXA 1GGVA 1QX3A 5JS2A 3B7PA 4O1MA 2VBGA 3KVYA 1J49A 1KP9A 4PQFA 1IWBB 4R8UA 1HE5A 1ISGA 1NR1A 2GQRA 2CNWD 3PL5A 4YJ3A 2Q1SA 3DR3A 4GO1A 3Q8KA 2GSDA 3HU3A 5FBVB 3PDIA 3BILA 4G6ZA 4YRDA 2O05A 3OE7D 2HHFB 3U40A 2EYUA 3DFKA 3FMGA 3T3MB 3ZY2A 4YT2A 4OJQA 3KBBA 3K9WA 4NCXA 1TAEA 1RIIA 4DMUB 2J3QA 1KTIA 4YCLA 5KKNB 1IPEA 1X80A 3LYLA 2ODAA 2HO5A 4D9NA 1EFDN 3GT3A 2TSYB 4P22A 3UWOA 5K4GA 1HNZB 1E4EA 1X7YA 1QO0D 3VH2A 1VL1A 3CXRA 4C1BA 4IJWA 4A8TA 1GGMA 1FC0A 3DOJA 4G2NA 1UZLA 3TSOA 3KXIA 1GPAA 3HS3A 1PEKE 3ZZTA 4D4MA 5AM1A 1QMGA 4FFBA 2X0SA 1QIIA 4WGFA 2YZKA 4PPNA 2VVTA 3R0QA 1T9CA 4YALA 1QFMA 3RQIA 4BX3A 3N2EA 1X9GA 3D6MA 1M8GA 3WIUA 1OZHA 3HZHA 3PNMA 4HHEA 4PLCA 1BHO1 4TZTA 1M1YE 4LYFA 3ZH2A 4CL3A 2AQHA 3BH6A 1AKMA 5A03A 4CIBA 3GFOA 3QUBA 1SWWA 3FF1A 1J8VA 4LWZA 2JK0A 1KYWA 4OHRA 3P9CA 3QYFA 4XI9A 2FPUA 3SM3A 1SPBS 2QVXX 4MEBA 4P08A 5LDHA 4CQNA 3EPIA 3KLOA 1PKEA 4M98A 1KTVA 3GIPA 2WOJA 5DGDA 1QCDA 5KFMA 4O7TA 1XHFA 3TGLA 2BR0A 1ORDA 1Y3DE 2XCAA 4PXSA 1I14A 2CV0A 1GNTA 2W00A 2F8TA 4DC9A 1H1LB 4U2DA 4WEOA 3O8LA 2X9LA 3BH0A 4U7PB 2FLVA 1MC4A 4GQBA 1VPDA 5FPKA 1O0SA 5KYUB 3A6FA 1EUCB 4KAFA 5IC6A 3PLAE 2TMYA 2VYND 2NXCA 2Y2UA 3FPSA 4IG4A 1TM1E 5KREA 1BJRE 4YJFB 2O8CB 1TJYA 3K35A 3ORQA 3CGWA 3DBLB 4CL8A 1ADFA 2KSWA 1OVMA 2ZSKA 3PNYA 1TVCA 3ZXSA 2F4NA 2DQSA 4D9HA 4F71A 4RW0A 1NDQA 2Y68A 4FIZA 4LNUA 4RKYA 1GN9A 1RIFA 3ZU3A 3NDPA 3HA2A 3HY4A 5JYBA 5CURA 1TEXA 1MMFB 4MI6A 2YZ7A 3QBDA 5H16A 2G7ZA 1E1CB 1DIKA 3OZEA 2W11A 5CFMA 1RNLA 1JVSA 3TEJA 2VNIA 4RIEA 1FRVA 5AYVA 1X1DA 2GBIA 3EB9A 3L0BA 4MUEA 4F4CA 3IT1A 4A2BA 1XZ8A 5D00A 5LIPA 1JR3D 1O6ZA 5K1ZA 1GHTA 1UEXC 3HVKA 2KJQA 1IDN1 1NVUQ 5L40A 2FPKA 4DV2B 4RXUA 1KI6B 3PUZA 4QD3A 4EK9A 2X5RA 3KIPA 4ND8B 2HIGA 3H1PA 3QF4B 3VBEA 1PNRA 1WUKS 4LYDA 3S2ZA 2IODA 4Q4DA 1DDIA 3GMDA 3I3OA 4QW8A 2BFPA 2CMKA 2MTBA 4RELA 4LMYA 3X3HA 1JHYA 2DM6A 2GOYA 1NOJA 4R8RA 3Q8SB 2YDXA 3LPAA 3IR5A 4Y3UA 1IWOA 3L4JA 3UVEA 1Y5MA 4DLNA 4EYSA 2OCKA 3OCVA 1W5EA 3C7KA 2EQ5A 3EHEA 4QXQA 1ZNZA 2ZUCA 3K5PA 3BMOB 1IBLB 4FU0A 3IVGA 4CCWA 3SWWA 4DV6H 3D81A 1W4CA 3OF2A 5HM6A 5DQIA 3WP0A 3LWNA 2I8AA 1LX6A 3DD1A 4OA8A 1QZTA 1AZSC 4Y2TA 3ZW9A 4EKNB 4NAVA 3CW8X 1LXCA 2O3SA 2UYGA 4KFSA 3WGJA 3ROXA 3ELBA 2DCUA 3OQHA 4U9IS 4LJ5A 3W3AD 4QZVA 3GFVA 3PFIA 4RH0A 1XU4A 3PGKA 2EX0A 1NWCA 4QOFA 1NMZA 1A9XB 1VQ1A 1KEWA 3R7DA 4TRMA 1UBSB 4PGGA 3WKBA 1SRRA 3HKBA 4EZIA 3K96A 5TGTA 2CMDA 4OMUA 3BJYA 4BIIA 1KY2A 4FZJA 1Z6ZA 3F6EX 4KUGA 3U54A 4X7PA 3G0GA 4JUAA 2WWWA 1TMYA 1VRWA 1S6YA 5LMCA 3TUZC 4MEAA 2X0KA 4ZAYA 1GT6A 2ES4A 4F7DA 4O82A 1O4VA 1SUSA 1YNSA 5D84A 2FN9A 4DZRA 3GJ4A 2GYVA 5DGAA 3Q9UA 1SKAA 1XF1A 5JLJA 3UJ6A 3EWIA 2HIVA 1CZHA 4U9HS 2F59A 4GG1A 4LHWA 5IANA 1E4EB 1YMUA 1WU7A 1Z0KA 2DFTA 2C8LA 4PWQA 3BB1A 4YACA 4BVHA 4F38A 2VP5A 4O4LB 1IC6A 4ABTA 3N43B 1ECLA 1MPTA 4DV2H 3CZ5A 1J6UA 1MJ5A 1E6KA 4Y6PA 1NUAA 1SC3A 3AP2A 4KCGA 3CVWA 2A5YB 3W5SA 4ETWA 4DL4A 3WHPA 2C4TA 5JXWA 1L8XA 1QHSA 1VJCA 3CLSD 1JHXA 5G02A 3M6IA 2IFTA 2W0SA 3B2EA 3DEIA 4GS5A 5HS6A 1KIMA 3WWEA 3L9XA 1LU9A 1XG5A 4YUWA 3CCFA 3PL1A 2FW9A 3GPIA 1DKUA 4ER5A 3B3FA 4DQUA 4M9CA 3WAGA 3BQ9A 2R93A 2PWZA 3P9XA 2ZVPX 4OAPA 3SBEA 2J3DA 3G0CA 2J33A 2W2KB 4BZXA 1DRVA 3PXCX 3D0OA 4JXUA 3F9CA 5D7NA 1L4BA 2GO7A 5H3HA 1ZRNA 3Q3JB 3V8PA 4CQLB 1U8CB 4JYCA 4AXBA 4A8JC 4BKQA 2AC7A 5E4YA 1PUXA 3HO6A 2AX3A 3AZOA 1V8DA 3NIBA 5BWTA 1RBMA 2EFCB 1J0AA 2FYTA 4FX2A 4HX5A 4WZ6A 3FYTA 2E1RA 1QDLB 5L1KA 1KFBB 1YZFA 2FLLA 3R77A 4RFSB 1V1JA 3E58A 2IZZA 3TW0A 3VHLB 1CJCA 2QZSA 4UTRA 2NPIA 2GD0A 4H7DA 1L5WA 1T5BA 1GNVA 1CS0B 1JUDA 2O1SA 1CKOA 2Q3JA 3OIUA 5IAEA 1IWPB 3TSZA 4ZV4A 1QP0A 2PSDA 2V4RA 2I6FA 3EPHA 4L5JA 4TX1A 4JLPA 4MQ6A 3VKGA 4W9RA 3UK0A 1VIAA 3VDMA 4QFDA 1M33A 2GTHA 4F93B 1TCCA 1AIPA 2FEKA 3Q3GE 3M4ZA 1VC2A 4FD2A 2E37A 2PN1A 1SOMA 4LF5B 1V9LA 2F64A 3K3VA 3FNIA 3HL4A 4KPFC 1H2YA 5KYYA 2DULA 1JDVA 1K92A 1V4NA 2IVFA 3GEPA 3V8QA 2KLBA 3U0BA 1AMOA 2BBTA 1JVNA 4U3JB 5IN5A 2QJRA 1W4ZA 3TW8A 5D1PA 1O89A 3D5TA 2RGVA 1Z4JA 3M33A 3FDZA 2CEKA 1U2DA 1EKFA 5C35A 1YZNA 2HA5A 3AF0A 1WH2A 5JI2E 5COAA 3J7AK 4MS3A 5EHQA 3COWA 3RYHB 2BMWA 2VL7A 3M34A 1S3SA 5EHXA 1JJVA 3TVTA 2XZOA 2B8TA 4J9VA 2B4KA 1KKLA 3O8RA 1RQPA 5CFZA 2L42A 4YAJB 2VHVA 4LQDA 2F4VH 4R1QA 1U2GC 2RH8A 2HSGA 4DJAA 4PZYA 3EVZA 2ZRPA 1XRRA 3DO6A 3OKFA 2E49A 1M6NA 4DM7A 4WBNA 4XWKA 4X65B 4YTEA 3HG7A 2VZ9A 2EP8A 3J81k 2UZ4A 3MCVA 4M83A 2DABA 3UQ8A 3Q8LA 1QOZA 5DBOA 4L6AA 4Q6BA 2X1HA 3WKAA 2I7VA 2A14A 3NWJA 4Z3OA 4FYXA 1R8QA 1JQ5A 1HX7A 4V0KA 3GLFA 2OCYC 2BMVA 1H6CA 4F3TA 3BE4A 4G89A 1E8DA 2Q1XA 5P21A 1FJ2A 3AUJB 3E8SA 1KY4A 5KT6A 3BQNB 4D9GA 5TPZD 3C5HA 4WPGA 4PX2A 1ZDMA 3DE1X 5LOVF 2QG4A 4RDCA 3VDNB 2BGWA 3A1FA 4JITA 5JXJA 1LFAA 2VDLB 5KZMB 3TFQA 4EH1A 4KIUA 2HRRA 3VR3A 3HEMA 2ODNA 4BB0A 2WIBA 3SC4A 1TPYA 1U1EA 1J5XA 3HWSA 2D5BA 2HIMA 4A3SA 1IRXA 1R4NB 3WL5A 2WJWA 4RNMA 3IMGA 1WDMA 3CO5A 3DEKA 2PX3A 2IYSA 1EGHA 2Q8QA 2XE6A 2Q21A 2WQZA 3C0KA 2HQRA 3KEOA 4IJKA 1F06A 1D03A 1Q91A 2AS0A 3C4VA 2ODWA 4ZHSA 3LFTA 1IU9A 4MR7B 3RAQA 2OFPA 4K6HA 4Z4EA 4C7OB 4C06A 1VSUA 4W5HA 4FPXA 5IBPA 3CR3C 2QW8A 3QG1A 2GRUA 2QUKA 4QQRA 4EF6A 5JISA 2QYTA 4LYEA 4IJVA 5BVGB 1E18A 1MOZA 4MR9B 4F60A 5JNWA 1ST3A 4YAFA 1GG9A 3A11A 2C0PA 2SCUA 2SECE 2XOKA 2R6FA 3VR4D 3WDSA 4YYZA 4HDNB 5KKCA 2MHCA 1IYEA 5IXYA 5FLEX 4JB3A 3IHLA 721PA 1AKUA 2J4FA 4ZOAA 1YA6A 1JIHA 1W5BA 3ZY3A 1W85B 4QEZA 1UJ6A 4HH1A 2ZJTA 1IDOA 2JAOA 3IUQA 4W1SA 2I9PA 2Q5FA 5C5JA 3EDRA 4EHAA 2O14A 4TTRA 3TZLA 2NYAA 4TUYA 2QRMA 5KOHB 3T7EA 5THKA 2BKAA 4RHYA 1YQEA 2IDJA 4B4VA 1Z39A 4YP1A 2QVBA 2QX6A 5A5GA 4PZPA 4CR7A 1ZGGA 1QP8A 4DL2A 3ZZNA 1K7SN 4BNNA 2Q7DA 1QFZA 2LIVA 3F3SA 5EERA 1QV6A 2FN3A 4O33A 3GZTB 1N2OA 4NRDA 3ZNQA 2ISQA 5B3LA 2CW8A 1HE1C 1IAQA 1JTVA 2O6HA 3B6MA 1YK0A 2IP2A 5DK4A 5E0OA 4FOPA 5HF6A 2H5EA 4ZYWA 3N07A 3CRQA 1P7PA 1RTKA 3LG2A 5A9TA 4F97A 3UPTA 2OGTA 1T2AA 4IWYA 3IEPA 3ORRA 3KZKA 4QFMA 3L77A 3I4NG 1K66A 2C9YA 1EXWA 5BWXA 2IPLA 1UPXA 3C2QA 3QMWA 4L57A 4EGJA 1XZAA 1OXVA 2YASA 5IDVA 1BC5A 3ZI7A 3IEUA 1Y7PA 2XMQA 5AM3A 3DJYA 3KAJA 4JI1B 3TF5A 3U6BA 3AR4A 1L5OA 4AU1A 1WLSA 3DG9A 1UBKS 4WOCA 1K1EA 4POOA 5JASA 1X1BA 1UBEA 3GPBA 2W2XA 3WKEA 3QY9A 2VLBA 3B12A 4J9MA 3DHVA 1UMCA 4LGMA 3LBHA 1LNSA 1XELA 1KVRA 4G5XA 4NBKA 3OJLA 3EEBA 3D6HA 2JIPA 2PU5A 3OSUA 2OWOA 2VPYA 4K6FA 4KE7A 2AOXA 1JPVA 3O3CA 3PE4A 4Q4HB 5F35A 2D13A 5HIJA 4Z7OB 4X64H 4PX9A 1HMPA 4F91B 3GDFA 4LOIA 4UCVA 2RE8A 2BUAA 3QVWA 3IVCA 1APBA 4CG1A 2ZVQX 4C7JA 5HW0A 4G01B 4HXFB 3WX0A 1N6PA 5GGYA 2JF0A 4OP1A 3FOAA 3UF0A 3T7IA 1KXZA 5LXTF 3RK4A 3WLSA 4ZDIA 1VL8A 3VZPA 4J2TA 5AJHA 1N36B 3H0GG 4M0DA 1HYGA 2JAPA 1GJRA 1J7JA 3H16A 4IJUA 2GBFA 4DWVA 2WQ6A 1L6IA 3I2HA 3QYJA 4LSWA 4EQ5A 5HK8A 2W71A 4J9SA 1QFXA 5I5WA 1LSOA 1OXTA 3MJFA 1JR3A 2XYHA 3A04A 4WKPA 3SS8A 2VYFA 3L7OA 4HMQA 4Z6KA 3RVKA 3A1EA 2VO1A 2ZJYA 2IOYA 4URUR 1GPMA 4FT2A 2GFQA 1XROA 1XEFA 1V3TA 3BFJA 3OSPA 3RYIA 2VP0A 3LX8A 5IJXA 3FGNA 2XMZA 4HDMA 3WK7A 4JNKA 4RLHA 5K6RA 3EGXA 3DMHA 1X8KA 4BKMA 5JFGA 2ORED 1MJHA 2QVCA 3N2GA 3DCJA 2AN5A 1U90A 4G84A 5HFAA 3RFFA 4C0BA 3FPGA 4HTFB 5LQAA 4WZAA 1ACMA 4L74A 5CIQA 2C88A 2X7XA 3EDOA 2WYHA 3UT5A 2JFQA 4DUPA 1PUIA 5FO0A 2QW1A 4K8RB 1KU6A 1SFOA 2Z8YM 4UCOA 1OLXA 2VHUA 4LHXA 3QEJA 5EGSA 4DMGA 3HO1A 4B3GA 4OL9A 2MSNA 3OF5A 1K0FA 4AY5A 4A3DG 1ZSNA 3L8FA 4IGEA 2AL7A 3N53A 4HLCA 4HZUA 3VDQA 4BGUA 1EHIA 5KOJB 4RK5A 2JRCA 4BZPA 1KEEA 4OF4A 3TEMA 4RMHA 4UHDA 3RIGA 5JH7A 2XCSB 3ZVKA 5DGIA 4M36A 1PNOA 3BK2A 1WKCA 1MAAA 1PFQA 2ZI3A 3RGZA 4L15A 2V4UA 3RUIA 3PE3A 1LBTA 4LECA 2A3RA 4Q16A 2OPHA 5EYPB 4DPMA 2D2VA 4QREA 3OMLA 1AB5A 4FS1A 1VJ1A 3FNEA 5NLLA 2A35A 4AKGA 4RSRA 4UAUA 2VJAA 4C7VA 5LP1A 1Z2EA 4KQFA 4DSAA 4Y2GA 5ADHA 4L4ZA 3BULA 3SZRA 2OK7A 4HWKA 4UD2A 1Y4SA 2VHTA 2PG3A 1TCBA 2FLPA 1JBEA 3BA1A 1Z0DA 4FSHA 4BO0A 3GB8B 4FT4A 5BNWA 3CPSA 1IHDA 3G7UA 4YIKA 4LCBA 3VR2D 3WA7A 2O57A 5IEJA 2H85A 3F2IA 4UEKA 2OO5A 3LWZA 1RQ7A 3GTKA 3D2BA 3IHKA 3WGZA 1N5LA 2WP8J 1HR0H 1WF6A 4KVFA 1ICEA 1UZUA 2Y3IA 3CRNA 3U4GA 1KEUA 4CFYA 1CEQA 3FJOA 4ZZ3A 4JI1H 5HZKA 4E5MA 2WAOA 2PE5A 4NCHA 2G5GX 3LECA 4TV9A 1YRAA 4I5IA 1U1CA 2QQ5A 4ED3A 3RAGA 1P0IA 1VI2A 1HE8B 1EK5A 4JLUA 3IN5A 2H5JA 2P2SA 2X4GA 3IV6A 4G8DA 1IHPA 4JJKA 5L7TA 4YWJA 5D8DA 2EL9A 5K0FA 3SD7A 2YOGA 4OJNA 3ZPXA 3ODGA 2GCOB 4QHTA 4AMGA 4UNNA 2NNLD 1KZGB 3D0KA 4FP9A 3TWOA 3TZEA 2R47A 5D1HA 4BMDA 2PRZA 2ZYGA 1SVKA 1Q0QA 1XKXA 5EZSA 5H81A 3SE0A 4EUFA 1FDVA 2Y9MB 3ZS8A 5KFEA 3RHFA 4BO9A 3H5WA 5K3FB 3SR0A 1YQXA 3WOHA 1ZJ6A 4QUDA 3WWYA 4ZK2A 1UF9A 1BCRA 1RADA 2X76A 3EODA 1NPYA 1ST2A 4KOEC 3KL4A 3S7ZA 4BRZA 4BMXA 4LNAA 5E6UB 5LZ4A 1N0UA 3I64A 4Q4JB 3NJ4A 3R8XA 5CEEA 4M1OA 4EJ0A 5KX5B 2IY8A 4M0FA 2O5VA 2XNKA 1Q7BA 3H1FA 4ECWA 2PV0A 3F9RA 1K8YB 2XUJA 1A69A 4K9KA 1FUUA 1PR0A 1U0JA 4GKBA 4COOA 4EW3A 4JFRA 3C0FB 1OMOA 4ZMBA 1M2KA 1ZM7A 4R3NA 3GJ5A 4D5EA 2I7CA 3OJ0A 3H04A 1OT3A 3NBYB 5KU7A 2YWXA 4MA5A 2DZDA 1CUEA 3AOGA 1N6LA 4MRVA 2WU0A 4YJ2F 2O8NA 3SICE 1DU4A 4BX8A 1EAYA 1NUHA 2AMLA 3LLSA 5K9ZA 3UT0A 2WTBA 1HZZA 2ZYTX 4O7LA 2W4IA 1QUFA 3IESA 3RSLA 5IDXA 3IAM6 1XD8A 3EVAA 1G21E 2Y4OA 4JHLA 3FKSD 4QLAA 5JE8A 4URZR 5LP6A 3FTPA 1DBWA 2DTEA 3DVAB 2W98A 1OT5A 1WVMA 1ZUHA 3QPUA 3SDSA 3C48A 3OTIA 1X3SA 3FB4A 2MU1A 4E6NA 4JI7B 1V2GA 2YFYA 1V9CA 4J0GA 3HA3A 3IOYA 4YQEA 4F4JA 5B36A 3WMRA 5HK9A 2RHGB 4ODIA 3ZVNA 4F46A 4A3CG 1ABEA 2XCOA 4RD6A 1J97A 1YIDA 5BPHA 5GP1A 3FHTA 1RYBA 2GRJA 3VMMA 2VDNB 3UK1A 2PZGA 2P4QA 4B3CA 1XP5A 2GBLA 3C5WP 3H0GA 1U3TA 2BBWA 4KIWA 3R75A 4FBMA 3OF3A 3R7BA 1RPZA 1FDRA 3CNHA 2MWMA 4NQZA 4GPIB 3UHOA 2BAGA 1LQTA 3LT1A 2VYVD 3C3CA 3HM9A 3DCNA 1GRQA 1XTQA 2G9VA 4MVJA 4YRGA 1C7QA 1JMKC 3BBLA 3IQXA 4GL4A 3KQOA 2JFOA 2WYVA 3LY8A 4FNGA 3JZ6A 4YQZA 4F72A 3NCTA 4IMPA 1MOPA 2QAGC 5FA5A 2BFDB 3X1MA 4FHZA 4H7EA 3LSYA 1X7HA 1PJTA 2QRNA 1XLTA 2G6BA 2UZ0A 3A26A 3PCRB 2WIFA 4JI8B 2FUNB 3G5AA 2WWTA 3VYSB 3CKYA 1SQGA 2OCLA 3HDGA 3MAJA 1DDGA 2YRWA 1JL3A 3ESXA 4LJ6A 3LXRA 4MI3A 4QHSA 5AJUA 1DAKA 3MWDA 4N3GA 3P5SA 4O2BA 4Y6GB 1NHWA 5CJPA 1E61A 5AD1A 3BRWD 4A6XA 3G9TA 1MCZA 4UU0A 4NU5A 1CYDA 4EEQA 1QDUA 3QE0A 4ISCA 3T99A 3MFHA 4WINA 2ZCUA 3CLTD 4H17A 4X92A 2DWPA 4M0CA 5HG0A 2FZCA 3ESBA 3BCSA 2G5CA 3BXPA 2DBRA 4RCYA 1KVTA 5T57A 3H40A 3BSFA 4Z5XA 1XD2A 4MDHA 1KC3A 3ZWWA 1ZG3A 3E61A 1FQKA 3NNSA 5E1OA 2C4NA 3A9VA 3KALA 2YIMA 3DMPA 1J23A 1E5TA 1J0XO 1RXUA 2HZ7A 4UEOA 4UNRA 4EG7A 3W2EA 3NWBA 2QT1A 3ZE6A 5DRYA 1ZP6A 4OQ4A 1HFJA 4J2OA 4MW0A 4OXRA 5JJIA 4KXQA 1IONA 3QHQA 4IIGA 1YB1A 1H69A 3L0SA 3RRNA 1RAFA 4I55A 2I6UA 4U2BA 1RCUA 4NV1A 2H4WA 4JJ8A 4RGVA 2R6HA 2GAFA 5EKSA 4YAKA 5BWBA 1IYDA 1M1XB 4OGFA 2C5SA 1L4KA 2ETVA 3CPEA 3SXJA 1V37A 1WTCA 3W78A 5B4UA 4O4JA 5L3SB 1PW7A 2R9VA 5BVGA 5C5CA 2V7UA 4EYEA 1PG2A 3ND7A 2ENUA 1AUPA 1K1SA 4GI1A 5EVCA 2DSNA 3DL4A 2O03A 2QQFA 3EISA 3IDZA 5GGXA 2VI5A 1K3FA 4B0PA 3R3JA 2J59A 2QEQA 1Y1SA 3OCYA 5AM5A 4EG3A 3K09A 2EJCA 2WD7B 2E4XA 1UOPA 1WXIA 2PKCA 4DDHA 1J8FA 2BBSA 2YY6A 1L5NA 4GKVA 4BNIA 3KKLA 3NS7A 4I6JA 5DF1A 1IJFA 3WLAA 2OT3B 3L1IA 4CM3A 3J80W 3GLVA 1XL0A 2INGX 3RRBA 2J9FB 2RGGA 3SR3A 4PIMA 4ZEMA 4M9RA 3ID6C 3RO7A 1ABBA 1MB0A 2GEKA 2VOJA 2VJMA 4O3SA 3O8QA 1XZMA 2C1XA 3H86A 4AYBA 5G4KA 3WXMA 3OLWA 4BMPB 5JD5A 3FRJA 1WAMA 3IRUA 3ZKWB 3U2QA 2CNVA 3SKYA 1QPBA 1R0YA 5TIIA 2Q4RA 2D8MA 1P1CA 2J1LA 1TKCA 2VPTA 4GRDA 2QR3A 1C1DB 3P9SA 3BQ2A 1DBQA 1RYYA 4AWXA 4CR6A 4EG1A 3LAWA 4AG5A 3GD5A 2R65A 2WBLC 1JQLB 5C3EG 5B3AA 1P1IA 3B6EA 3SNKA 1LBSA 3I37X 5KMGB 3U0GA 2F8MA 3D6NB 4UULA 3G8DA 3EQ6A 3WHIA 3KXPA 1OU0A 5CA1B 2X15A 1UEJA 3NW9A 3V1KA 4C4AA 2X8JA 2CL5A 2B8WA 3QKSB 1F1JA 2MMCA 4MR7A 3WGMA 1RRVA 1DV1A 2W8LA 4HNGA 3M5DA 4JBIA 4MQFB 3ZNNA 4YO8A 3THWB 2O3UA 2IV7A 3W3ZB 1Y63A 2CVFA 2CJPA 3PRKE 1AKEA 1KPGA 2NQTA 2H2WA 4G4IA 1NSTA 4KPUB 1OX5A 3UW3A 2EZ9A 4N3NA 2PKXA 5LMUH 1X1CA 5KNDA 1NWHA 4ZOLF 4L72A 3B1ZA 4CC6A 2AI3A 2VBIA 3QE4A 4YMGA 3OLVA 5HJ2A 3QKRB 4K6GA 3VJMA 1Z28A 5AW2A 5CBKA 1QYCA 3LMKA 1J2UA 1N7IA 3AEZA 4XYMA 2FKAA 1FMJA 1UBLS 5LN1A 5IYZF 1TYCA 1BA2A 1Z18A 1IG0A 4XPIB 3RTAA 4F45A 3QRWA 5ULLA 2UXDB 4PGAA 1N1GA 1I7DA 2H2FA 5HNKA 2JFNA 3ZHOA 2V7GA 2I4TA 2KWIA 5EZYF 3WK6A 3OZFA 2C4HA 1SEPA 4JDUA 4LH7A 5DYYA 3TRFA 2Q2NA 3LUDA 4W6QA 1NV9A 3PPIA 3W6OA 2CF5A 3PEYA 2JIDA 3DOIA 1GPJA 1UMDA 4M7OA 5T4BA 4R7GA 2G1UA 4FYWA 1L8QA 3GCGA 4MVJG 2VUIB 1O08A 2YIVX 3UAGA 3DEFA 1H3FA 1WEHA 1ZH0A 5DV9A 3SX0A 3G2IA 4CNQA 1USGA 2OFWA 4XLLA 4O0LA 3A27A 3TLYA 2PAFA 3P9KA 2XQFA 2FE4A 1ZA1A 1KXJA 4KFTA 2C2KA 4NYMQ 5B4TA 5LU9A 4JMLA 3MMXA 4G0WA 5EESA 3DLIA 1RAHA 2OCGA 1L5HB 1QMPA 3EDMA 1Y1VG 2W9BB 3OPYA 4EMBA 2FJZA 4YI3A 4DMFA 5HBRB 4WKOA 2EBUA 2GM5A 1NYTA 4D8YA 5E2AA 2FNAA 2CNQA 1JEAA 1D4AA 2A57A 1YS2X 3F5MA 3KVOA 3AY0A 3B2NA 3E2MA 3MWLA 1T34A 4I0WB 1L9XA 3AEUB 3S8YA 3GZNB 4Z4GA 4OK6A 4I5GA 5CDHA 3KQUA 2VTDA 3ONEA 4DOMA 2JLXA 4WXRA 3VKUA 4C5CA 1GPUA 1Z47A 1KAHA 4GP9A 4BWFB 3AIMA 1TVKB 2CXPA 2OQIA 3LI2A 4AO6A 3L46A 4UARA 3PHHA 5EKUA 1NKTA 3DB2A 3PC7A 2DY1A 2DAPA 2ODBA 3F8SA 1RPTA 3L6BA 4QELA 4X85A 5CTJA 5KYNA 5HOQA 6REQA 3URMA 5KCZA 2VT7A 3HTXA 4FFOA 1OXXK 3KFVA 4I1IA 4FFRA 5D87A 3SFZA 3ZWMA 1TM7E 4YRLA 2ZI6A 4Z1MD 1HI9A 3LOPA 4OH7A 3EPRA 1YZQA 4JKOA 1Z0UA 5I4KA 1E6LA 1K97A 5E9AA 5FWDA 4NZZA 1HT2E 2GN6A 3GG9A 4TTAA 5G1NA 4DARA 3P0FA 3ZIAD 5DLGA 5JUWA 1UQUA 3GP5A 3DFZA 3ECAA 3TAXA 4CLEA 4XEUA 1A7AA 1ZCZA 5JQGF 4CIWA 2ACVA 3RU3A 1CQWA 3BJEA 2JJ2D 3WLPA 3SEQA 3NWPA 2AR7A 3K0AA 2H17A 2RBEA 2C2XA 2FMUA 2GJ4A 3A28A 2CB0A 4DV7B 2R8HA 1GL9B 2OV6A 1ORIA 4M0UA 1DJNA 2PUTA 2AOWA 5FWYA 4FDTA 1YZ3A 1TW3A 4N18A 5EIAA 4RQBA 5FADA 4Q3EA 4DCOA 4GOMD 1E77A 1FNSA 3C8HA 5B30A 2Y1EA 2FX3A 3NGLA 2JLQA 4B6RA 2JIRA 2W4QA 3RS3A 2R6DA 3OFND 3PNVA 3O8OB 3ASUA 3N0RA 2ZUTA 2HMUA 4E7PA 2JHGA 4NSNA 5E9JA 1SQ5A 3NM6B 2R5FA 3U3XA 3FPHA 1A4RA 2P6PA 1U2SA 3TRDA 4EX6A 3PXDA 4M1SA 1EFAA 3D4IA 3A4LA 5DM4A 2C07A 1ZJ4A 2IOFK 1ECPA 2NVOA 3FNBA 2B61A 4PYLA 5I9TA 4A3FG 1EJBA 5JXHA 1E3WB 2X86A 1A5ZA 2Q4BA 3IEIA 2W9AA 4KBFA 1N9GB 3LVFO 5TVKA 1QRDA 2XVMA 3RC3A 3KR9A 4X6LA 1FP7A 5A4MS 2PVPA 4LVCA 2B3TA 1JNXX 2VHXA 1L5ZA 2Q2OA 1M2EA 4E22A 1E3DA 3C87A 3R3XA 3ZHQA 3WHKA 1AXGA 3C1UA 3JZAA 3S2UA 2FKLA 3TKLA 4Q4AB 5JJBA 4RB1A 4FZRA 4NBRA 3RF2A 2R1UA 3LQ2A 4AF8A 3S2GA 4ADSG 3EEOA 2LVBA 1O6BA 1XU7A 1U8YA 2WT4A 3K8OE 3G2QA 2EJ3A 1BOFA 3ICWA 5LBIA 3R74A 3IV9A 4HAXA 5C5EA 2CVOA 2QLFA 4GMXA 4XTCS 5HOEA 1KGDA 5E8RA 2WJAA 3VJKA 1QSGA 5A5VA 1DPGA 5HBGA 4JT4A 1SCKA 4FZ3A 2XIGA 1H4VB 4YP7A 2VBCA 3WRXC 3O4VA 1PSWA 1A95A 5I7SA 2FQQA 4JUZA 1TFRA 1QVAA 3OLCX 4BATA 1U3UA 1BHJA 3H2BA 1PF7E 1U9CA 1TGYA 3PNPA 4HQKA 4H2DA 4FE3A 4AN1A 3GYBA 1RTTA 1GTSA 1JIIA 1I3LA 1HQYE 1T1SA 1INLA 2F43A 3KJHA 5AKZA 4ZALA 5M3BA 1FFYA 3GBSA 5CYGA 5B6IA 4PZUA 1WCV1 2O48X 4RA6B 2HF8A 1E9VA 2ZW9A 3N70A 4P32A 4YXWA 3DPIA 2G6TA 2W2LA 3ETDA 4UU7A 1OX6A 4C0AC 1W6UA 2B4AA 3BMQA 3LWDA 3WA6A 2CFMA 2W2PA 1CUXA 3PFFA 1P4HA 1R6AA 2E0IA 3GIJA 3K53A 5A0TA 3O1LA 3LV8A 4FMBB 3T6KA 3IURA 2CVPA 1JEQA 3MQFA 1T1IA 4Q1AA 4UUPA 2BFOA 1PEAA 1LS1A 2AXQA 3F6RA 4U2CA 3HFSA 3PEEA 1C9NA 3WJ7A 1B14A 2CHQA 3E70C 3OLQA 4LV8B 3KJZA 4RB3C 2J9RA 4BFWA 3ANNA 2PMFA 2CFTA 3VR5D 5EZ5A 4CIAA 1G2WA 4RPKA 3BZUA 2GZ1A 5DT9A 4ZAFA 2E82A 1XAGA 2LWIA 4KBYA 5E25A 2A9FA 3WADA 2C3OA 3K9HA 3PZPA 1PQUA 1Q0RA 2ESRA 5MGBA 3A6JA 3H97A 3GLGA 2IK8A 4ZODA 4R8VA 2J3LA 3SFVA 3CTMA 2ZLBA 2V6GA 4LUCA 2JKYA 1EWVA 3NTLA 5K3DA 1YRQA 1U65A 1PD0A 1Z15A 4JYBA 5ER9A 1QGZA 4CM8A 4EFKA 1Z37A 1TYZA 3JX9A 1W8DA 1RHJA 1Y6GA 3FWNA 1MJGA 2MSDB 4HUJA 4PRZA 2XQIA 3DBRA 3HACA 4ARZA 4YUYA 3ENVA 2DBZA 1I1OA 4U39A 3S28A 3U1TA 1AJEA 3ZHSA 1NFFA 4I9UA 5LA6B 3RTEA 5FUXA 1GRNA 5ES3A 3SC2B 3WK4A 4HAYA 2XJ4A 4JCCA 4XYGA 5A3QA 2FR8C 1LK7A 4YRBA 1BMFD 1VTKA 2G25A 2PS3A 3FR7A 4UASA 2DCMA 4WSOA 1II9A 2OV4A 3PHJA 4I4LA 4KJXA 4LC0A 1DTSA 1DFHA 1U8EA 3D64A 4RMJA 1HR0B 5IYZB 5JECA 3WNZA 1C2YA 1PRYA 4M1EA 3STXA 4GX2A 4DCNA 5CAEA 1XD9A 3NYIA 4KUHA 4X20B 1Z8FA 5C8YF 5AESA 4F3KA 1K7CA 1DJMA 1NJ8A 1NU6A 1W76A 2C0QA 2HA6A 3R3VA 4FI3F 4MYHA 2K7FA 2IZ7A 2ASLA 3C14C 1DAFA 3H3XA 2Z4RA 4XGIA 2FVXA 1E96A 1EGQA 4EHBA 2PU7A 5K01A 1J24A 4J0MA 4EW6A 1NDUA 1G21B 3Q4GA 4YC7A 5C2JB 3B5EA 3NJ8A 2FV8A 1G5QA 1IZ7A 1WXQA 3ETCA 3H5OA 3IV7A 4IIJB 2ZQ5A 5F1KA 1V45E 1SXHA 2IYPA 2JLBA 5DNYB 3C3PA 3MJ4A 2I71A 5EMJA 1ZR2A 5KNBH 2F17A 1NY5A 4G9BA 3FI9A 3GDOA 1Z4KA 2GJKA 4HH3C 3FMFA 5ILGA 1CEEA 2DX7A 3CKMA 4BLTA 4X62B 5ARDA 1GQ2A 2OV3A 4CLHA 2HREA 4HWPA 3G7SA 3THRA 4IO1A 3BGVA 1DX6A 4RPGA 2BD0A 5AVSA 4ZVLA 4EO4A 3I34X 2Q5JA 3A2NA 3QXGA 3CF4A 4IF4A 2JA6G 2ONJA 4GW3A 3UYLA 1W7AA 2P30A 3BEOA 3NM4A 2DT5A 4EYHB 2N1BA 1UDAA 4HATA 5EE3A 2VLIA 2V1UA 4JV5H 2YXNA 3FPEA 4KPGA 4WZAB 4XPZA 4YV0A 5KG3A 1RT9A 1F8FA 1ZAUA 2XWSA 3ANSA 4G1BA 4K9DA 2ZOSA 4TRJA 3K1TA 2R1TB 4MWOA 2FPGA 2PX8A 2JAUA 5CLQA 1M2HA 1CD5A 2OUIA 2H1HA 4ZGGA 3AL3A 3OI7A 1V8PA 3HABA 3WWPA 3IULA 1QORA 1H23A 2OSBA 1TTHA 3IBCA 4FFVA 3V5NA 1YR2A 2CD9A 1RPNA 2RAVA 3K32A 5KWIA 4RLQA 1M1YA 3FNGA 3L4BC 5LJIA 1VRVA 1Z34A 4EB8A 4G1MB 5E4TA 4DAOA 1Y14B 1ZNQO 2A84A 2GJSA 4B6QA 4BQOA 3JQ8B 4ZVRA 3EZFA 5EIHA 2WAQA 5AQ1A 2CXUA 1E9SA 2HSZA 1IBSA 3HYLA 5CT5A 1SELA 2C2RA 1VHLA 2OAGA 3MMZA 4HEHA 4LF7B 1GPWB 2R3SA 3A14A 3NV9A 3DLCA 1T2VA 2G1KA 2AMFA 3ACBA 3BA6A 2FUG1 8AT1A 5JAUA 4YJ2A 3EPLA 3CXUA 3PQ2A 4YIHA 5IP9G 1BYIA 4CBVA 3DDOA 4IIUA 3ZZ1A 4EZEA 1G4HA 2OCIA 3DAGA 5E95A 1Q11A 2PWYA 4AZVA 2V98A 3BICA 1G8AA 3B1VA 2E2WA 3JRXA 4KX5A 4DTIA 3BT7A 2TECE 4CLOA 3AUYA 2F7SA 2FEWB 4OSPA 4E07A 1VL6A 5HILA 1N3YA 2ZATA 3PIDA 5D5QA 4I08A 3ZS9A 5KNDH 4P7BA 4ETIA 5G0TA 3IPYA 4JXKA 4KQCA 4TT3A 5TGZA 2HTFA 3FSJX 4N5LA 1G0NA 1CLUA 3JVUA 3FOCA 3N0TA 1RJQA 3WWJA 2CXTA 4JR0A 5D5PA 4CE5A 3VU8A 3VYVA 4CMIA 5AM0A 1N48A 1CYEA 1YCFA 1O77A 4YHHH 4GOND 3EBLA 4GZMA 4L7QA 2O8VA 3Q7EA 4LF9H 3GMIA 1B04A 4A92A 2O7RA 4F1JA 4CG0A 4DC0A 3D6JA 3B82A 1VECA 2GPNA 1RKXA 3D3NA 3WL4A 1D1PA 3H5AA 3PIIA 1YR1A 2IF2A 1X7YB 4G65A 5KYYB 1QLWA 3HYNA 2H4ZA 1A9OA 1COWA 3PXXA 4HNQA 2YWVA 5IAOA 1FTNA 2V7WA 1CUIA 1AUOA 4H7JA 1FNBA 4S2EA 4D42A 4Z7NB 2GF0A 1BRMA 2JG3A 2Q49A 5BW8A 5BWLA 1PK9A 1Z7YA 1T35A 1KH3A 2PBZA 1BCRB 1YR8A 2FTKE 5DM1A 1ADGA 3QUQA 2EJWA 4BJ6A 4H3KB 2NU9B 1FMCA 4P7GA 5BUCA 1YDGA 4AKEA 5KWJA 1SR8A 2A9OA 4QJBA 1CULC 5JHGB 1G63A 4IV0A 3GVIA 2FZEA 5C7YA 4O4IB 1U0RA 2GPBA 4JAVC 5E0KB 1OXUA 2P9CA 2IC5A 3F3KA 4J1SA 4L9AA 5JRZA 2YWHA 4BVLA 3B89A 4TSKA 2DB3A 4NZOA 5E3JA 1CDZA 1J9GA 4I8DA 3OZ7A 2E85A 1PNTA 3SXUB 1W36B 2AZXA 1ORRA 2HPZA 3LXMA 1T8WA 3HV2A 4TKVB 5BN5B 2H3EA 4KDEA 1XRMA 3BWDD 2JANA 1LFDB 2R8RA 1WCWA 4V38A 4WESB 5FUBA 2ZAOA 1L8AA 3L0PA 2W6ID 4E2WA 3AUAA 4UAVA 1V9SA 2ZRQA 3JR3A 5KUTA 3D8HA 3DF7A 3EZGA 2VJQA 1ANKA 1OXSC 3FFAA 4WHMA 4Z8XA 3O38A 3DAPA 2H9AA 4PFKA 5IYCG 4UBIA 1DTWA 4UDYX 1E9EA 1Y1QA 2W2OA 3AVQA 1EZ4A 4IQGA 3QG5A 4YAIA 3E7PA 1JU4A 2COUA 4EFDA 4RZSA 4B7CA 1GG2A 2ZRBA 4X1KA 5BSRA 3EXHB 3L8DA 2XQVA 3Q10A 1P91A 4QTYA 3N2KB 4ECZA 1U28A 5EWMA 5HKBA 1WXEA 4QVIA 1NURA 4M8SA 3PUXA 3S81A 1FUEA 1SU7A 2FHPA 4JH0A 4N3BA 3CUSA 1SUAA 4B3RB 3HJFA 2FFQA 3LC7O 4QECA 2HGXA 1NBME 5KFQA 1VL0A 3V7YA 4EG6A 3ITNA 4YMVA 3E9NA 3H99A 1TTPB 1QGUA 2NZ2A 3UIEA 3LY9A 1YFZA 4GPEA 2JFVA 2CK3D 1NIJA 3EAFA 4N65A 3BMOA 4KLCA 1GPDG 4J7UA 2XCLA 1CP3A 2Y4RA 4XA8A 4MUBA 1HYBA 1NW4A 3B85A 1GRRA 1DRKA 2PMKA 2Q6IA 1MG0A 3PT5A 5EP2A 2GI4A 2UU9H 1SCQA 5CJ2A 4JXZA 3ELWA 4D3SA 1T9GR 3TJRA 2JAXA 3W5IA 1D4FA 4MRAA 1M1YB 4B0OA 1FDUA 4N49A 1UKCA 1X70A 3D4OA 4Z0HO 5EJEA 3MTBA 2JGLA 2QMYA 1C14A 1R18A 3PX2A 3RSGA 5BN4B 1N5JA 5KQLA 3L8YA 3IQZA 1VBKA 3B1KA 3GLRA 4CQMA 1QK5A 1UANA 2HA0A 3ZHUA 1P0FA 2WU3A 5HPYB 2I4LA 3AM1A 1UOOA 5JDCA 3TL3A 4ML3A 2G07A 3RHZA 2BL4A 2XCPA 1VIMA 3DZBA 4C2BA 4RYLA 1H6BA 2HF2A 2QTZA 3M4XA 3QX9A 1IMOA 3N8NA 1N2IA 4CHIA 2O3JA 4O4HA 2Q41A 3VGJA 1GM5A 2NXEA 4J03A 1QVVA 3EXAA 4DJTA 2KS6A 1ZI9A 1CTQA 3LVRE 3DUFA 1O6FA 1R8JA 3X1DA 5JWOA 1Z5GA 4ECVA 3BMQB 2FQYA 4QT0A 4E5NA 1KBOA 1MENA 2IP1A 1FU8A 4W1QA 3F8WA 4EFBA 4G2TA 1XRPA 1T1JA 5BMVA 3AY3A 4ITVA 4Q3CA 1YDMA 4TLBA 4AQ7A 3I6ZA 1Z2OX 4N39A 4MWGA 2XV1A 3NORA 2DFVA 1BMQA 3E4CA 3SJAA 4TSFA 2P5UA 4ID3A 4ESOA 4C87A 1AGYA 3VHXA 2FW8A 2AFRA 1QG0A 4LF8B 1VIDA 5C53B 5HQTA 3PW2A 1ZN7A 3EEQA 1XE3A 3W6PA 1K6JA 5FH9A 1OFHA 1MZBA 5SYNA 4CCYB 1WOYA 1HV8A 1JV2B 3M5CA 4WFKA 3V2GA 3KTAB 4HN4B 4IEIA 3C85A 2EP7A 1NXTA 1QFYA 1FTGA 3KSBC 4LSAA 1ZRMA 3I9JA 2PZJA 4F6CA 2N0SA 1EVYA 2XADA 3U3DA 5K4AA 3ZV6A 3KKMA 5LWQA 3UGQA 1B43A 4MYDA 5T4EA 3H2SA 1CY0A 1PGQA 2C3YA 4C88A 1M9NA 2PKEA 3A4NA 3GH3A 1IQPA 4RWEA 3UAZA 4PC1A 3USCS 1O94C 3DHYA 3FKJA 2ZUUA 2B5VA 2BMDA 1EH5A 2FPOA 1TAUA 1C3EA 2WTMA 1AN9A 4D02A 1DBIA 2ZRMA 4KDRA 3TR6A 4BMZA 4OFXA 3VYWA 3JSAA 4R7ZA 1MC5A 4BZZA 4CT5A 1OPRA 5AVKA 3N6XA 4DREA 3RTXA 5FPOA 4REMA 5DYIA 3RREA 5TVGA 4BRSA 1R6UA 3RG8A 4M53A 2QBYB 1TT7A 5F9HA 4BWSC 3GT7A 1Q92A 4HLUC 2C00A 4NXMH 4GSYA 4YGXB 4IYJA 4RJKA 4FXPA 3LX6A 3TNYA 3K9CA 4DLUA 4EL0A 4JOCA 4EAAA 1KSJA 2B83A 1ULHA 3OPMA 5IM4F 2H8GA 2VNSA 1BU5A 4QQNA 5FPTA 3WRVA 2AIRA 1N2CE 3V80A 3CBQA 4LA4A 2A1IA 1YKSA 2AC4A 4DLAA 5KYWB 4H7IA 1FFBA 3L7BA 5AKLA 1II8B 1YZYA 3K0KA 2K7ZA 3V4OA 1NUUA 2P1DA 5EP4A 1YR3A 1CY2A 2AWNA 3EVDA 4A16A 4EM6A 4BV8A 1RM3A 1ZKDA 3K94A 4WH0A 2YJ3A 4BDSA 1KHTA 1XVIA 1E3LA 4FONA 3I30X 3G9ZA 3EGXB 3VNQA 4BY7G 3BWMA 4PFQA 4WFIA 1VP9A 4DUZH 1DG1G 2UXBH 1JLMA 2XE4A 4YUXA 2PJRA 3V1MA 2UXCB 5JRDS 5JWRA 2XRFA 1JEQB 2O54A 1VKNA 4LBYA 4DG8A 2PS1A 4M7EA 3DQQA 3WZ2A 3ZCPA 1RJRA 4G5SA 2X77A 3X1YA 5BOVA 5BRNA 3VYTB 4AJIA 5NULA 3RS2A 3G13A 5IF3A 3G88A 1N2EA 5KYKA 4DLKA 4H7HA 4WKGA 1CB0A 5AHOA 3WQSB 2FOIA 3Q40A 4NZYA 4O86A 3X1ZA 5BURA 1G8JA 3B6KA 4NCNA 3S99A 1NW5A 2QPAA 2PMBA 2PX5A 4OFBA 2CKZB 4FFDA 3SEFA 1UIMA 1ONSA 1A5TA 2V6FA 1W6RA 5DULA 4R0MA 4CM9A 1O8CA 8ATCA 4ZQFA 2Q8NA 1XZFA 1HC7A 3L7CA 4AYWA 3MMSA 1VSQA 5AK4A 4FFWA 3WLRA 1Y3BE 2EXXA 1IK6A 2G3YA 3VKWA 4DV0B 3ABSB 2GHIA 1U6KA 1OFUX 2D2FA 3AETA 3RIXA 3V48A 1OZFA 3IIMA 3MR5A 1NM5A 3O94A 2VPXA 3EY4A 3GGSA 3FCCA 2Z9CA 3OFVA 3JQQA 2C7BA 2PTGA 5CA0F 3OUUA 1OWNA 2VHZA 5ECYA 1E1QA 4DL6A 4OCZA 1GTRA 4QATA 2BPOA 4J0QA 4I50F 4KQGA 1UBFA 1UODA 2JEFA 4D74A 2LDXA 4R1SA 1DBRA 2K87A 1ILWA 1U1IA 4V0QA 2Z1DA 2GQSA 4MW4A 3G1WA 4W7HA 2FP4A 4GGMX 1KOLA 1Q0SA 2RAUA 3HM2A 4KV9A 4PRKA 1EKVA 2VPPA 1J2TA 3GI1A 3HXPA 4Y2UA 3UJAA 4AKSA 4BP1A 2VDKB 2BMFA 3LQSA 2PMDA 2V9PA 3AGQA 3DHEA 3RRYA 3ZWOA 4L95C 1ZH8A 3RAFC 3BERA 3V9AA 2OMKA 1P5ZB 7MDHA 1Y5NA 2PMZA 4RB0A 2Q4EA 4N54A 5DX8A 1GYFA 4OLFA 5JCJD 3W90A 5F9FA 4GSLA 5F4BA 2UYHA 4U2FA 3OO0A 7GPBA 1ZHHA 3QM1A 3H4IA 1CKNB 3U9TA 2X9GA 3QWBA 2OO5C 5JZMA 1E63A 2GWRA 3ZH9B 3GIDA 2AR9A 2XWJI 5I5TA 2EV9A 3EZNA 1QK4A 1OY1A 1E2QA 4EYIB 4GLWA 1JQEA 2N46A 2OP1A 1XYYA 1Z36A 2GVNA 3CY6A 3OMWA 3RROA 1XK6A 3Q7PA 1FIUA 2VJPA 3I8SA 4MTCA 2VHYA 1H0RA 4I2NA 1TLLA 1YONA 3ZLBA 5C7IO 3A9CA 5BUSA 3QLTA 4CJXA 2B98A 3RGXA 2W6NA 2W8KA 1KY5A 2P1ZA 1RRGA 2Z4SA 1D1QA 1LBQA 4MYUA 4QJIA 4RC9A 3U26A 3D3QA 2ATIA 4DNOA 3IP6A 2HDNB 5EPOA 2PUAA 4QDOA 2QTBA 2PUFA 1A5SB 4QULA 5K6TA 4GR4A 2RKWA 4B4UA 1MXFA 4JJGA 1GPNA 1ML3A 2BR4A 2DWCA