2R84A

Crystal structure of purp from pyrococcus furiosus complexed with amp and aicar
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
334
structure length
329
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PurP protein PF1517
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 104
structure length 329
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r84A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r84A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r84A01
2W6PA 5CB4F 3KREA 4IIJF 3VOTA 4ME6A 4MV9A 3VPDA 1KC7A 2YZMA 3AW8A 1GLVA 2V58A 3NUAA 2FPGB 3DF7A 1OBDA 1C3OA 4EAAA 3HBLA 4FFLA 2ZDQA 4DLKA 2YZLA 3JZIA 5CA0F 2YW2A 1WR2A 2R87A 1UC9A 5LYJF 2I87A 3VPCA 3SE7A 5KX5F 2W6ZA 3VPBA 3HO8A 2VHEA 4ZQIA 4QSHA 2YZGA 4C5BA 1I7LA 3OUZA 1ULZA 2CNQA 5C1PA 4FFMA 2QF7A 4DIMA 4O7VA 2R86A 3BSSA 4HNTA 4O81A 3K3PA 3TIGA 2J9GA 1A48A 1AUXA 4WBNF 4HR7A 2W6QA 2R82A 4MV7A 5DMXA 3MJFA 5KKNB 1IOVA 1W96A 2YYAA 3RV4A 4I4TF 3TIIA 4J6EA 2P0AA 4O86A 1BNCA 1Z2NX 4FFPA 4TV8F 2YZNA 2FP4B 1EUDB 5LA6F 5EZYF 1Z2PX 3TQTA 1B6SA 1VKZA 4YAJB 2QK4A 4TV9F 4ZI7F 2YRWA 4IWXA 3RV3A 1KJQA 4O4JF 4YJ2F 3R5HA 2YS7A 2R7LA 3QFFA 2DWCA 5IYZF 2CNVA 4ZHQF 2I8CA 2NUAB 3JZFA 2DIKA 2W6OA 3N8DA 3ORRA 1PK8A 2R7MA 2X0SA 5LOVF 1IOWA 4YJ3F 4O4IF 5J2TF 2GQSA 3KAJA 4FE2A 4MA0A 2GLTA 4FU0A 5CAEB 3GLKA 3BG5A 3G8DA 3ETJA 2XD4A 4MV1A 1KEEA 4FGRA 2W70A 2DLNA 4M9CA 1B6RA 4IHJF 3U9TA 3ORQA 1KJ9A 4FFOA 4MV8A 5BMVF 1E4EA 2CZGA 4O7YA 3G8CA 4O7ZA 3V4ZA 4M98A 3E5NA 4YB8B 5JH7F 2GQRA 4M9UA 3BSYA 1KJ8A 4XZ3B 1T36A 5J2UF 5I47A 1EUCB 4O82A 4FFRA 3I12A 4IWYA 5D8DA 2WYOA 2ZDGA 1PX2A 3BSWA 4HNUA 2FB9A 2V59A 1W93A 3KALA 1JKJB 1KJJA 2FPIB 2SCUB 3R23A 4MA5A 5BPHA 3MWEA 5BPFA 1JLLB 4M99A 3TINA 4MV3A 3OUUA 2R7KA 2C00A 2NU7B 1M6VA 2GPSA 3LWBA 4E4TA 2R85A 4O84A 3JRXA 2VR1A 2PBZA 4L1KA 4EABA 2NU6B 4Y8VB 2W71A 4WD3A 4O7SA 5JVDF 4XYMB 5C1OA 4EA7A 5GONF 2ZDHA 3RFCA 1E4EB 4I50F 4HNVA 1EZ1A 4O4HF 2PN1A 3WO1A 2NU9B 2W6MA 4EGJA 5JVLA 1DIKA 5LXTF 4IZOA 5H80A 4O7RA 2DZDA 3HB9A 1CQIB 3UFXB 4GGMX 5HBRB 3VMMA 5C8YF 1CS0A 3JRWA 2YL2A 4O2AF 1CQJB 1CE8A 1KBLA 2OLSA 1AUVA 3AX6A 4EA8A 1JDEA 1M0TA 2CNUA 1OBGA 2YWVA 4I55F 3RUPA 3U55A 4O2BF 3V4SA 4RZQA 5LP6F 2VQDA 4NYEA 3WNZA 1C30A 1GSAA 1DV2A 4O7TA 2R84A 4O4LF 4O7WA 4ZOLF 1GGOA 1M0WA 2IP4A 1DV1A 3BFPA 4XYLB 4C5CA 1SCUB 2Z02A 4MAMA 2NPOA 1EYZA 1GSHA 1BXRA 4YBZB 4O7LA 2HJWA 4O7NA 3U9SA 1Z2OX 5FNVF 3N6RA 4YAKB 3ETHA 2NU8B 3VA7A 4EG0A 3R5XA 2VPQA 3TW6A 2XCLA 2YS6A 3K5HA 1KUTA 5JQGF 3K5IA 3WO0A 1KJIA 4XX0B 3R5FA 1I7NA 3U54A 2CQYA 2FPPB 2YRXA 2W6NA 1UC8A 3GIDA 2GPWA 2I80A 2PVPA 2V5AA 2Z04A 3Q2OA 4MV4A 2HGSA 4C5AA 1A9XA 4O83A 5K2MA 4EGQA 3KAKA 1GSOA 3Q1KA 4MV6A 3MWDA 4FFNA 5JQWA 3R9RA 3LP8A 2R7NA 1JDBB 4HQ6A 1EHIA 4EA9A 5CA1F 1VBGA 5HV6A 1VBHA 2R6FA 4TUYF
chains in the Genus database with same CATH superfamily
2NZJA 3LXRA 3ASVA 1T1IA 4EI2A 1Q12A 1C9KA 1SIWA 1KMMA 4DNPA 1M1NA 4UARA 4HD8A 2Y0EA 3S5UA 4MTLA 2DUNA 4OHPA 3URMA 1AS2A 3E23A 1CFZA 1XYYA 4TLBA 2Q2TA 1KBZA 3IBSA 2CHEA 2VNAA 2AFHA 3GRRA 3E3OA 1Y9DA 4V0KA 3B3GA 1OXKB 5DVZA 3PW4A 3AOEA 5C5CA 3I6QA 1MG5A 5EN4A 3FF4A 1TRHA 4PO9A 5DHAA 2YJGA 1KY4A 1KYYA 3UBMA 4IUBS 2AMFA 2WDPA 3NDIA 4BX0A 1XWFA 1FTQA 3SF8B 3D3EA 5BT8A 5LL6b 3RB3A 3TIGA 3C8ZA 2JGIA 2BGRA 3QY9A 4PZ8A 1VECA 5ESXA 5BV0A 4DR1H 2JBAB 3G02A 4S1NA 2ZE5A 4FFBB 1G18A 1KE2A 1CRZA 2VJCA 4H7HA 3RI3A 4KQJA 3KUKA 4LHYA 3KQKA 4ARCA 2B9EA 1RHKA 2YOHA 1LVHA 5IDXA 4L9RA 4D41A 2ZJ0A 4DLNA 3IUEA 3UO8B 4ZTBA 5KNBD 1HO3A 5TDHA 4FONA 4TZ0A 1PZNA 2CNWD 4ARAA 4XB6B 3DMTC 1E3WB 1YC2A 2B94A 5BYKA 1MKYA 3CZ5A 5FTKA 5BVHB 1P5HA 3DE0X 2B3TA 3NONA 4DDTA 3G9ZA 1FMFA 3LQFA 4UNSA 4OQXA 1HYGA 2HIAA 5GQSA 1EFTA 4K3UA 1F12A 3I09A 3VKVA 4N76A 1AD2A 3IT0A 1GOTA 1MP0A 4FBUA 3U4HA 4RJIA 1T0UA 4BFCA 1PDWA 5ELXA 1XXHA 5CG1A 4O2AB 2IW1A 1XZDA 1N33B 3RWBA 3WL3A 2YY6A 5FXMA 2V7WA 3C4JA 2NU7B 1ZAUA 3R3ZA 2I78A 2C58A 5D85A 2GAOA 4OQZA 5IKXA 3RVDA 4LNUB 2O14A 2HC9A 4AMGA 2FCRA 2O8DB 1E1KA 2ZQYA 4KJXA 2ARKA 2I22A 2Y6UA 3U1TA 5C7IO 3ZBUA 4NJEB 1CHNA 3GQBA 3RSOA 2ZI6A 4FHEA 1CJVC 1HOXA 4NEHB 4NVRA 3B6IA 2Y99A 1CNFA 1QV9A 5CT5A 4BTLA 4L5AA 5C2JB 1OCEA 3A6LA 4C6RA 1N5IA 3RUPA 4BMSA 1X1EA 1DJLA 5BQOA 1M6VB 1ZZGA 5AVVA 2WJWA 4GRIA 5JARA 4B4VA 3V9AA 4DIFA 1QO0A 1NBAA 4O7TA 4RTKA 3I0NA 2NACA 2J6IA 1CR2A 4L07A 3WK5A 2O03A 3RU2A 5B3KA 5K45A 4D6YA 4DNFA 1N7JA 2ETXA 4PZYA 2XXBA 1YQGA 2PJDA 5SYAA 1SUCA 4B6QA 3A1DA 3A2LA 3JD0A 3IX7A 4ML3A 2F6RA 2HWXA 1YR8A 2JLQA 3CRRA 3GOHA 5J1SB 2W6ID 2P90A 2W2LD 1X70A 4BP9A 3W06A 4NCAA 2EW2A 4KUHA 3OX1A 5F1PA 1FTNA 1YJXA 3GDGA 1M2HA 3A14A 3EVTA 1LS1A 4WLUA 5A3QA 2PKEA 4DQVA 2PA3A 3NAQA 4N03A 1D4FA 1TFRA 2YUTA 3AR6A 3GJYA 2R6AA 2A33A 2R4QA 2FMTA 3AMVA 3AUXA 2JFYA 2R5NA 1X8XA 3DM9B 2YW2A 1X92A 1EAYA 4I1PA 2CZCA 1T5BA 2WJ3A 5J47A 1K1EA 4HX5A 2QP9X 3SQMA 2IP2A 3AB8A 3GF4A 1UXIA 4G4JA 2FWJA 4FCTA 3NDJA 4I7EA 4RACA 3GJ8A 4HNTA 2XUPA 3HWRA 3RAPR 4LFCH 1NVUQ 1Y1VG 5ES3A 3PVXA 3I5MA 1U9YA 2M6LA 4Q15A 2X6TA 5B1EA 4RMJA 1T9HA 4AQ7A 3DFKA 1M1NB 1OYWA 4E7PA 3RSLA 1S6YA 1ZW6A 1Q5PA 2ZM6B 4M8IA 2GHQA 3MS4A 3FTQA 1GJRA 2AL7A 2E4YA 1FOEB 1YC5A 2AFHB 1CUJA 1WPGA 3JWPA 2FLVA 4QQFA 1KDVA 3Q7RA 2ZYWX 4PZAA 3ZPXA 3EGDA 1ZD1A 2HQSA 3OIYA 4PIPA 4JYZA 2GJ4A 1U2ZA 5AK6A 2B2CA 2VSYA 3AU9A 3JQ7A 3FHOA 3PFNA 2OFOA 4QEDA 3L6BA 4NICA 2AX3A 1B8PA 3TFQA 3CZCA 2WHYA 4M36A 3ZJTA 3V8MA 1MQ9A 4ZODA 3EA0A 2VYQA 2MWMA 5LDDC 4QJIA 3CVZA 3E22A 2GQRA 1N56A 1A76A 4ND8A 4CHGA 3KQVA 3V34A 4F2WA 2O52A 2P9ZA 5CVVA 3VDQA 4M0UA 1T25A 5E4YA 4ARIA 2E48A 4C7MA 1T9DA 4LDJA 2YN0A 4XIIA 3BF8A 3PN1A 2RGXA 2XZDA 3CF2A 1BE8A 1F3OA 2Q28A 1X74A 5K05A 3JRXA 4NXMH 3FPFA 1R0LA 3IXQA 3VUEA 1Q20A 4L4SA 3SXUA 5AR1A 2QX4A 2OBBA 4BEJA 4NL4H 2N1BA 4R68A 4Y1GA 2CJPA 3WGYA 1VL8A 3OKFA 3S8EA 3AJAA 4C0BA 5LXTF 1LPAB 4WKOA 4OYYA 3OOEA 1SD2A 2VA2A 5FYDA 4D3DA 2W6CX 4ER7A 1B0ZA 1NVAA 2X0EA 2AVDA 1GNPA 4OH1A 3RRJA 1EVQA 1XXHB 2NZ8A 3NBZC 2IPNA 2XH8A 3L1HA 4UEJA 2JFBA 2I34A 1FXSA 3ORYA 3R40A 4EY7A 3OZUA 3IESA 2JIZA 3PA6A 1RP1A 4DSZA 2C77A 2AQHA 2P79A 3H97A 3P8ZA 5DHTA 5F52A 3V7NA 1NMQA 4F97A 4IIXA 2X42A 3U4CA 2GEBA 3BB3A 2IT1A 2ZJ5A 3WMRA 2G70A 4EFKA 5F7JA 1JX4A 3GQBB 3IR5A 4RZ2A 1I0ZA 4WI1A 4FKMA 3VA7A 4LK2A 5FR9A 1X9NA 1R0BA 4H7PA 4RL6A 2FW7A 2Q5EA 1I4LD 3W78A 1Z0UA 3SFVA 2ASLA 1QOQB 4CR7A 3QEMA 3JAWA 4EG1A 5CXQA 1GL6A 1JIKA 1GA4A 4ZEMA 1WUTA 2C8VA 1W7AA 4C0SA 2FEPA 4NOLA 3BMXA 1AURA 4PTZA 5EQFA 3HXMA 4Y2PA 4MWOA 4H0FA 1VCOA 3CZMA 1UEXC 1XZPA 1PG0A 2JHFA 1HNWB 4QYSA 5EE0A 4AYTA 4BTVA 1L7EA 1XZHA 5EJMA 1AZTA 3V8VA 3RS4A 4ZYTA 3KB1A 2C8KA 4IXDA 1E5DA 4D8WA 5B7PA 3HBLA 1VZ3A 1T9AA 5CFQA 3GLGE 5G40A 3PVZA 2E4ZA 1ZH4A 3C5EA 3ADKA 2BV3A 5EXEA 1X42A 3VYRB 5FT9A 2H5LA 1O95C 2XMQA 3T5PA 3VKHA 1MXFA 4WK4B 3UWKA 2G7MC 1UBOS 1VGQA 4BV2A 2ZTSA 3DHEA 5BW6B 2A1HA 3WXMA 3TR6A 2PSFA 5JD4A 3PC4A 5TQ0A 1BHQ1 3P2JA 3CLVA 4ZVUA 3I5YA 4NONA 3E2IA 3NGLA 1IMJA 3UH1A 4YUVA 1N36H 3VR6A 4Y6RA 4D82A 2DR0A 3ZZ1A 5C8XA 3I4CA 2QENA 3ZYZA 4KKXB 5E1DA 2JG3A 1OI7A 4JA2A 1RI4A 2X76A 3B51X 4RVGA 5I7UA 1TKAA 2DRIA 2MTBA 3IUBA 3W6UA 4HLQB 4HTFA 2CYBA 4UREA 5T5QA 4AJLA 3MT0A 4LQLA 2ZPTX 2R60A 5ER6A 4OHBA 1CUEA 4JI7H 2GNPA 5KSWB 3WB0A 2NVYA 3F90A 1FFDA 4LZZA 4YJFA 2V1XA 4OAQA 1OKKD 2BUAA 1M2JA 1USVA 3D8TA 3IALA 5HZMA 1T4BA 4GOJA 1N2CA 2DTEA 3MMZA 3WHKA 3V6LA 2P6RA 3U49A 2OG1A 3UMVA 3UOGA 4KREA 3EGDB 5JC8A 1X1QA 4EL0A 3FCEA 3JQ7B 2HHAA 4H18A 2XCQA 1WM1A 2HPHA 2HF7A 2IE0A 1KOFA 4HFRA 3O9ZA 1Z33A 5JWHA 3AVYA 1CF9A 4DDMA 1BFKA 4ZD6A 3U6KA 2J3JA 4G56A 1T6ZA 1KKUA 3D9QX 3U5TA 1ADCA 3E22B 4X95A 1BS2A 4ND8B 3FYHA 2WJHA 1QZXA 4P84A 4R40A 1J9ZA 3VHXA 1CJSA 2CLEB 1TUIA 2VDVE 3EIQA 3I0MA 4O8ZA 3QEKA 5JZ9A 4Q1EA 2FPPA 2LD4A 1AGPA 2OFXA 4DDKA 1T4CA 3OPVA 1XDGA 3A9VA 4F4UA 3A2NA 5AI4A 4JEMA 1RPAA 3RPEA 4FX5A 2AF3C 2BKAA 5FEMA 4ZXFA 2GD6A 5CDTA 2QLTA 3GW8A 5EPEA 3FGPA 1NPYA 3SXUB 3IA7A 2P68A 3P9ZA 1JP7A 2ZE7A 3CQ9A 1DXOA 1V3TA 3H5TA 2ATEA 1GVHA 1GAQA 2C9DA 1OGJA 2OC9A 1IBMB 2X9QA 2UYCA 4PGHA 4QXPA 3LY8A 5JNTA 2B6HA 4ACBA 2H18A 1QMPA 1HT0A 4G8BA 3IMKA 5DNVA 5JQGF 1PS9A 4E07A 1W5AA 3KJZA 3OQJA 2C92A 1L8XA 3ZCQA 4DY4A 2WWHA 3H9QA 1TTTA 1W94A 3BXGA 4PZ7A 3PJGA 4CF6A 2O9JA 3NB0A 2QQ0A 4XVRA 2FK8A 1EWQA 2OGTA 3JD1A 1G0OA 1ZUHA 3A32A 3DZHA 4CBVA 4BWFB 3QPWA 4HV4A 3HYNA 3KJHA 3H9EO 3SHOA 2VK4A 5EWFA 1U1DA 2GK3A 3I9MA 1GLGA 2GAFA 1FJHA 2QTHA 4MDHA 3H8VA 4L74A 3UTDA 5KHOC 4BVKA 4AMYA 5L9AA 3R4VA 1UKYA 2WU1A 4Q7QA 1V37A 1YHYA 1E7QA 4WA7A 3WLKX 1XVTA 5E7IA 4A93G 2OCXA 4PHFA 4GKVA 1KKLA 3QEMB 3JAWB 3WLJA 5A0VA 4NQZA 3FNEA 4RB3C 4H0CA 2QMZA 5KFLA 1GU1A 1H8EA 4JYMA 1TU3A 4X3OA 2LR0A 4AL4A 4NU0A 4NBTA 4HS4A 4F12A 1C9EA 3ZUGA 4CM8A 5H68A 1XJ0A 2ZBGA 3GXBA 2AJCA 4KW7A 4L85A 1TFUA 4G0MA 4ZCPA 4HR7A 2EAUA 3MA0A 5HF6A 3UKJA 3LO8A 2BPOA 3F4LA 3T5JA 1OZAA 3LQQA 2GO7A 2QQ5A 4GLXA 4MVJE 3WWJA 5DWQA 1IRXA 4APMA 4JCOA 3WRVA 4EHIA 2BFAA 4J0CA 4QXOA 1S97A 5B58C 2WIJA 3TLXA 1NZJA 1VKZA 2X8LA 4ALNA 3CZ9A 2QU7A 2FG7C 4EVIA 3L84A 2HLPA 3I4LA 2QTRA 4Y2QA 4B3XA 4BASA 3MR6A 1G3QA 3I62A 1XMSA 4D3ZA 1UBKS 4BXOA 1VI6A 1NKTA 5HFAA 2WR8A 4Z86A 5TQ0B 4P34A 1RRGA 1GNQA 2O3RA 1GCAA 4N49A 2EERA 3QOXA 1RJGA 2C29D 5JTTA 3OH8A 1O95D 1ZUWA 3NBUA 4Z1MA 3IOCA 3QX9A 1U1FA 2IYWA 2P2YA 4AW9A 4A3CG 2AMVA 5J5VA 3AR9A 5HRCA 3EAQA 3CF4G 3VHQA 1AKRA 1BROA 2WSYB 1JJ7A 2GD1O 4V02A 4UAVA 2XPCA 1I3MA 4HTFB 5DI3A 5CX4A 3F0TA 2ZSHA 1Q92A 5H5JA 4BWGA 3DV0A 3QPBA 2J4CA 1Q14A 5SY6A 3TSCA 3BMCA 1XPOA 3GFQA 1C3VA 3GCGA 1O6FA 4MTEA 4TQAA 1LLFA 3U7IA 3D5QA 4QVIA 4YJFB 2XITA 3U1VA 1R9TA 1XLUA 2DGDA 5ALMA 1NIPA 2YFYA 1NXOA 2RGEA 1U04A 4QL3A 1N2CB 2PH3A 3P9NA 4JV2A 4J7UA 2CDBA 4TMYA 1TTPB 4DYHA 5LLTA 5IASA 3H1GA 4Y6OA 4N0MA 4JC5A 2VTBA 3D3KA 2XGPA 1BTOA 1NF9A 2O3UA 3KEQA 2FQXA 2XJ9A 2Y0CA 2DBYA 4YAIA 2XECA 4GL4A 2IUYA 1B0UA 2MSCB 1P9NA 1FRVA 1TIPA 3RS7A 3AHGA 4A8HA 2YV3A 2UYHA 2I9KA 1JQKA 2UXCH 3NASA 1XA3A 1TU0A 4MR9A 3BL6A 4C22A 3BM5A 5DW3A 1P9WA 4O7WA 1RQ7A 3PK0A 3FBWA 4BP3A 3LBFA 1TJ3A 4C08A 2OV1A 2VJPA 4UUBA 1YKFA 3PEFA 1A71A 1ZMXA 4YCDA 4M9RA 5HEKA 1P0IA 4IIFA 2CHGA 5JFTA 1UAYA 2WE7A 5A4KA 4BP8A 2Z6QA 4K6NA 2DUUA 2ZJFA 3NV9A 1MJGM 2V55B 4ED9A 2BR4A 5AJZA 3T7CA 2FPPB 4DIDA 4HPJB 1T4CB 2H4XA 2J87A 1XDWA 1FDRA 3HM2A 1T3HA 2DFPA 3R6GA 2ZE8A 3KR0A 2H9YA 4YQEA 3GP8A 4H6PA 1BMFD 2WQ7A 3U80A 1XCPA 3U5ZB 2IYOA 2Q5LA 2X8AA 3FWKA 2AI2A 2EP8A 1ISGA 1FVFA 3WHIA 1DPGA 1QS0A 5JJCA 2V7QD 5FI0B 1NBMD 5L1KA 1JILA 2GPJA 3OMWA 2NV6A 1QFYA 1D2HA 1R6UA 4S12A 1NQXA 4NMLA 4LSZA 4XJXA 1A2OA 4NNJA 5EIBC 1WWKA 4EFEA 1GT6A 2PUJA 4X85A 1CF4A 1OC4A 3EWSA 1YRWA 1J22A 3PQ4A 2NN3C 5K8VA 1MBZA 1HDIA 4MCAA 3IL2A 1M2KA 1I2ZA 5JDIA 3U56A 4CR8A 1MTZA 3FRHA 1E99A 3JYPA 2EBWA 3TRJA 4RK0A 4I08A 1RQXA 2VAMA 4FFMA 5K1ZA 1NUHA 3DUFA 3L0OA 4UXHA 1OLSA 1D6JA 2GGSA 2B37A 1H0SA 1IOZA 3IQZA 13PKA 3VJLA 4RLHA 1A77A 3QLTA 5LZ2A 1V7CA 2FAXA 5ALRA 4YT4A 4KG7A 1HNNA 3MK31 1WBDA 1U3CA 2ZWAA 3BFVA 2M6SA 5AW1A 5JISA 3EVAA 3OU6A 5FPKA 2WFMA 2WJAA 4UXJA 4PX2A 2PXAA 1OBHA 1KO8A 2ZI5A 5CFOA 2IPOA 2NTYC 1EUCA 3EE6A 1SRQA 4TN5A 4NOKA 2PX8A 4XVQA 4CIVA 5IEBA 4E14A 3PR4A 5GMOA 3DEHA 5DNUA 5BNTA 1ICIA 2AA3A 4M0LA 2SNIE 3EZFA 3QVTA 3ZR4B 3PD7A 3BJIC 2ZRLA 4CM8B 3CZAA 1JR3A 2A5LA 3BS4A 3TZBA 2XYPA 1RP7A 3U48A 1HSOA 3LC0A 3FZYA 5PGMA 4BPRA 3G8DA 3IAUA 1PSZA 5BR4A 1Y3DE 5FOVA 4RB0A 1F2TA 1GQ2A 3U7RA 2XKJE 3KHGA 1G6HA 1P33A 4NI5A 3SWWA 4PLCA 4BO0A 5ALZA 3HXOA 1D0IA 2JHPA 4KL8S 1JAZA 1H0HA 1FBTA 3DV9A 4G37A 5IRCD 3USES 1MQSA 2QLBA 3Q85A 3BE4A 7REQA 3G8AA 3WWCA 4CMFA 5AHKA 2HM7A 2O7VA 2QVBA 3R5KA 2ZE6A 1KJJA 2YVLA 4UE6A 4AQDA 2GEJA 5TEVA 3THYA 5HIAA 4JJIA 1RTKA 2DBQA 3NC4A 1ISIA 1N8KA 4P3OA 3KFLA 4JB0A 1W1IA 1I0IA 5A5VA 1MJHA 5CIWA 1FDIA 3F9RA 1CFJA 4H27A 2GCOA 4X6LA 4PSCA 4QLOA 2GASA 1PQWA 2BLNA 1L1FA 1XD8A 1E9RA 1HYQA 5CA1A 5JAZA 2NNLD 4DCOA 4A2WA 1D4OA 3A6HA 3OOYA 1C7RA 3GC6A 3ZE7A 4J0IA 4IY1A 4YR9A 4DEXA 3WAJA 3RGXA 5DI3B 3GVIA 3LK6A 3DV0B 1KI7A 4XX0A 1Q83A 2A88A 2OMEA 1V5FA 2OG2A 4CI0B 3BMCB 3NVKI 1AUVA 4TT3A 3N2NA 2WSLA 3LCUA 4FE7A 1Y1TA 2WJZB 4V24A 5D6NA 1C41A 3ZDRA 2QY6A 3OA2A 2V6JA 3S24A 4Z2YA 4N39A 5CYOA 3EVCA 4NYMQ 4FPXA 2JFUA 1YIOA 1E6CA 4IJMA 1XK6A 1DG9A 4KNVA 4F4DA 2IDMA 2WA1A 1SKBA 4BIMA 1NJ5A 2W8KA 4ITUA 1WW2A 1ZRNA 4Q48A 5DBIA 5JO0A 1FU7A 5GOTA 1P8AA 5DBHX 1XP8A 3I92A 2P62A 3EF0A 4RTOA 1AH2A 1DTEA 1E2FA 4NPCA 4Q21A 1ZGGA 5LMUB 4WY2A 1D6NA 2VTBB 1GTVA 4QTZA 1LLQA 3THOA 3MYRA 3LRTA 2WTUA 4JA0A 1Z2CA 4BE4A 2B7CA 5TF4A 7ABPA 5JEEA 1M72A 1IHYA 4YCCA 5F9LA 1Z8HA 3BTVA 5JTUA 4JITA 5KFIA 4MR9B 2XAAA 1MT0A 4ZU3A 3FY4A 1ORWA 3W1BA 4GP6A 3RHFA 1RXCA 4P82A 3A1EA 1F06A 5FAXA 4QU8A 2I91A 4GYYA 1AXEA 5FEUA 1U7HA 1SYXB 5EWEA 4ZAGA 3UFBA 4Y2UA 2H65A 1P91A 3VFDA 4W5JA 2B6NA 1Z7BA 1KOGA 4QG7A 1AB6A 1JHAA 5D87A 5AP9A 3OLQA 3ZCSA 2GBGA 3K35A 4OHYA 2IU4A 2HIXA 4ZYWA 4CYMA 2IYZA 4G8DA 3PSAA 3F5DA 3LJKA 5L1IA 5CJJA 3ZS8A 2VDUE 2SHKA 4EUEA 2E5WA 5HBGA 1A0OA 3LWNA 3PGA1 2H31A 4Q4CA 1QS0B 3MHPA 1X0XA 4OXQA 1E4OA 2NX2A 1L4KA 5DE3A 1S2NA 5DJ5A 2P1ZA 5IXJA 5H59A 4I4TF 3DD5A 3ZDBA 5AQEA 2XF8A 4UVIA 3HKBA 5LL6P 4MVYA 3N0WA 4Y0VA 1UBNA 3LCCA 5L9XA 4FCCA 4TTSA 3FFAA 4DVJA 5EGSA 1AGXA 4DV5H 1LK0A 3QEOA 3LQKA 4CM3A 4KYVA 1NY6A 3AZPA 1KNXA 3W7BA 1GPYA 1NVDA 2BKUA 4RGVA 3ZEAA 1N0WA 2YS7A 4OX9B 1SD1A 1GY8A 3DNPA 5EIBD 2WVAA 3S44A 4AX8A 3GRVA 3DUFB 4UNPA 5JCOA 2XODA 1OLSB 2EJTA 4Q3CA 3DG9A 3R0QA 2PSEA 1B8VA 1RRKA 4HOYA 2IW3A 1F51E 1LCIA 8ABPA 2CK3D 4KDCA 3MRTA 3NIFB 4AP9A 1SQFA 1YKGA 1NHGA 3KQPA 1EGHA 4URFA 2BR5A 6REQA 5K3EA 1SC9A 2GN6A 3KQHA 2ZAYA 3P94A 4ZOLA 2FUEA 3T41A 3WWOA 4FN4A 3BGVA 3D64A 2Q7DA 3I4FA 2P3QA 4CUJA 2JLAA 2BM1A 1EUCB 4Q02A 1OE0A 1C7QA 3QX7A 4EO4A 2GRAA 4B4UA 2IJGX 2IHYA 1W5SA 1NA5A 4OAPA 1WULS 4NG4A 4GZ3A 4BWVA 2J30A 3L05A 4LSGA 2E4VA 3UPUA 1FYVA 4HYYA 2RDMA 4EYQA 1MO6A 3OD5A 4WESA 4LZOA 1F6BA 3QOYA 4EFNA 5CT8A 4LDNA 1UC4B 3QUSA 3VNQA 2V7VA 4ZEWA 4JT2A 3ZY6A 4WVLA 1GGKA 1SOWA 4DRYA 1YASA 2JI4A 3WJ7A 4CKZA 1YU9A 2HSDA 3FHTA 1E9FA 5ILGA 1F2TB 1U6KA 5DYIA 2W8ZA 2D00A 1LI4A 4YBRA 4QOIA 3IQGX 3ADOA 4D97A 3KYBA 3DOHA 3ZIDA 2BEJA 2IYNA 1LK7A 3HPQA 4M1YA 4IJQA 2DZDA 3L4BC 1T2VA 3PNQA 3U09A 1MABA 5HQ3A 4L78A 5FWNA 4KGVA 2LZ0A 3LCVB 4YMIA 1F20A 3THYB 1KSJA 5A05A 3PGKA 5I7OA 4HLNA 3PCRB 3CGWA 4IV0A 4RPLA 3GLHE 3E8MA 1GQOA 1H94A 3U60B 3R9WA 5G4KA 1GZ4A 4U7FA 2F8TA 3CA8A 2ZTHA 4F2PA 2GCOB 4Y6PA 4RTLA 1K7SN 1MF7A 1GAWA 5CA1B 1K7EB 1NTRA 1WCWA 4LF5B 3JYQA 3MTDA 2VWPA 5AHOA 1VL0A 5DT2A 1KK1A 2XUZA 3E84A 3OZFA 4ZC8A 3EGWA 3MGAA 1YQ9A 3AM3A 5FNZA 1GPLA 1UK9A 2W9AA 3LPDA 4XX0B 4LQ4A 4FB5A 3RAFC 1FMLA 2ZZNA 4GOKA 4B47A 4C7BA 1D1PA 4FHDA 4WECA 5IUKC 3NVAA 3Q2KA 4ZAWA 2O20A 3ZQ4A 1CUBA 3KQSA 3A0RB 1X9GA 1PNTA 2JFHA 3CEBA 4IWNA 4HO1X 4AJ1A 2Q41A 4A0SA 1KE1A 3ZGXA 3HUTA 1IQRA 4HDOB 4LDZA 1YQEA 3W1EA 4G5SA 1I13A 3WX0A 3N86A 1XTJA 5JFOA 1ULSA 1G41A 1D03A 3PT9A 1X2EA 3O47A 2PGLA 5FD5A 3FHJA 2FP4A 1GQFA 3RAJA 1IYDA 1VLLA 3QHAA 3BQMB 3ESBA 1UFOA 5BN3A 2IYXA 1D09A 2QMHA 2G0TA 1IZ8A 2W6ZA 1SAYA 1W19A 4AJJA 2BGKA 4QM6A 2AOWA 1F0PA 1QXSA 1XTTA 2GKGA 4TYNA 5HK9A 3HE3A 4GMGA 3AKCA 3UG6A 5AJWA 2PWZA 3GLSA 3HFGA 4UCRA 2XD9A 5CDGA 3DS8A 1X8JA 4FMCF 1X14A 3NTQA 2B4RO 1I30A 5CCXA 1WRBA 4BUZA 1N5KA 1QIIA 4U63A 3PW0A 4RH3A 4GGOA 1RAHA 3B60A 4HWRA 4UDXX 3CNHA 3DYIA 2YY5A 4W6QA 5T4BA 1TAUA 3VPGA 4N3GA 3OHSX 1K83A 3T5GA 2PXXA 4OP3A 3ROEA 3OHAA 3WJAA 3GJRA 3OJWA 1JA1A 1KJQA 2RH4A 1AUPA 3KWFA 3EQ8A 4ZI5A 3GJZA 3MJRA 4GH5A 1AHIA 1KU6A 3LL4A 2PR7A 4PQEA 3I39X 3OCXA 1RWXA 2ZYDA 3EN0A 1X87A 3X2SA 4CQMD 1MA0A 2G09A 1ZNZA 4I0WB 3AG5A 1ZAKA 2D2EA 5DAAA 4LXQA 1Z18A 4M0MA 2QXTA 1CZKA 1Y3CE 3HKBB 4JR0A 3D0RA 1ZMRA 2FLLA 2X4DA 4DTCA 3IVGA 3TTYA 2E0IA 4EHLA 1NRXA 2FMIA 2D5LA 2GVDC 1GZ5A 3SIXA 3RG2A 3SY8A 5IAOA 4PXYA 3MFYA 2ASEA 4GLBA 3H6HA 2A0FA 2H85A 5H82A 2RH8A 1DOAA 2W22A 1RWWA 4J1TA 3ICQB 3QXCA 2IC5A 1Y8RA 1JJFA 4JBXA 3UUWA 2XV1A 4CCAA 4MKZA 2ATIA 1U28C 5I5UA 1ONSA 4JMPA 2IVZA 4CDRA 1YSCA 4TLEA 4JKYA 3KT6A 1N7IA 2VZLA 1OYYA 3L7AA 6REQB 3MJHA 1V3UA 2VHZA 3ZHZA 4OL9A 4EGSA 1TADA 1UWVA 4ZOLB 4KRYA 1D2RA 1QVWA 4EMBA 2LGJA 4L0DA 2B63A 4O7RA 2OGUA 2PEZA 4CU5A 3H86A 4D0LB 1I5RA 2PZBA 3UGQA 3GBPA 1HNXB 4QQKA 3BD8A 4FYVA 4AT1A 4OHOA 3B89A 4AUEA 3GEBA 4WESB 3ANXA 3AF1A 4QDUA 4JH0A 4WZAE 2NMVA 2VAVA 2IGTA 2C7BA 2C4TA 3EOBI 4XLLA 3TF5A 4ZA2A 4ED1A 2QTNA 3I76A 3AR2A 4R4JA 3Q7QA 4GPAA 1TU4A 1YE5A 4B3TH 2G71A 3IMEA 1T9BA 4TMVA 2APJA 4WFJA 3RVSA 1ZIYA 3QUQA 4X8LA 1N1GA 1NX9A 2FQQA 3BHMA 4E08A 1ATIA 3C8UA 4PW0A 2YS6A 1AMUA 4UHFA 2VP3A 5J58A 1MABB 5HQ3B 1V6AA 3RTGA 4CF3A 1ZD3A 1IWBB 4C2AA 4BMCA 1KY5A 1XDUA 1T1RA 1J39A 4ZK6A 1ONOA 2AVNA 2NTVA 3MCUA 3H0GG 4JR2A 4NDAA 1PR9A 1GUZA 1TYAE 3W5DA 4KXXA 5L1LA 1IWOA 2C99A 3EEOA 4MS3A 5G4KB 1ZJ6A 2POQX 3ERCA 1DTSA 3WIOA 1UFRA 5HIJA 3TBHA 4X7BA 5AJUA 2AWOA 3IRUA 1NN5A 3JWHA 2CMDA 3TQQA 4MV9A 3DBVO 4ZANA 3TLBA 4MDEA 4XGRA 5HRAA 3GX1A 3UB3A 3PW7A 3DJFA 2QR2A 2PT9A 4NRDA 2JA2A 3ZE6A 4X65B 1QGUA 3A1SA 3ZDQA 2FW6A 3DOIA 1UR5A 2X2FA 4FCWA 4XQGA 1P2GA 3X1DA 4WKBA 2JFNA 1T3SA 4M0DA 4OYHA 3AI2A 4XYEA 1UP6A 3H5RA 1W8IA 1TWAA 3T5DA 5A5GA 1L1EA 1N34H 1M8FA 1QMGA 1VL1A 3R77A 4FFSA 3FFWA 1IEWA 1GT91 2CY0A 1XV5A 1EESA 4GWKA 4C76A 4Q1CA 4C0LA 3IP9A 1DTWA 4L0MA 4NLLA 2FP4B 3QVMA 2LV8A 4Q3BA 3T1VA 1ZK0A 3OCVA 2CNNA 3P4XA 5BN3B 1A9TA 4E15A 4QUDA 4CKCB 3QVOA 1FFXA 3ZOZA 1WRVA 3OZIA 1YRHA 2ATCA 3F8TA 2GCGA 2CV0A 3S2ZA 1FXWA 3O82A 1RAFA 2GZHA 4KZKA 2QMUA 5HJEA 3RVKA 4Y1RA 2QL7A 1WCYA 4ZZ1A 3SOZA 2QRQA 5IS2A 1OZGA 4BB5A 2GN1A 3JQ9A 4MUBA 1Y7HA 4H1HA 4YGYA 4NFSA 4KPEC 2JI6A 1QB8A 1FX1A 3DYBA 3E0QA 4M8NE 1GCIA 1E7MA 1Y3FE 2ZSFA 4IS3A 4L8YA 2CE2X 4D6PA 4DPLA 2REQA 1OAOC 3V4ZA 1YB1A 2VRWA 4J7CA 3OZGA 2GESA 4BQEA 1WB4A 1KWKA 3JSLA 3U3OA 2Q2WA 3UCEA 1XTZA 4BAUA 2C9BA 3RLFA 2B4KA 2GK6A 1YS6A 1PTJC 4NENA 4ARVA 2FKNA 3PEUA 4YP7A 4FC7A 4AROA 1KSGA 1QFMA 3H2ZA 3QXGA 2ENWA 4XUDA 3L0YA 1EUZA 1PVDA 1XZNA 2FWAA 4RANA 2O2JA 1ST3A 1VHQA 1NXPA 3EGCA 3JATA 2G08A 3HTXA 2QUJA 1BMTA 3CO0S 1CNMA 1K3TA 5KC9A 1EVIA 4JD5A 4N0PA 4EJSC 1XTKA 4YMVA 1RKQA 3GLIE 4WUTA 5EY5B 4LHSA 1RJWA 3BGWA 3HDGA 3FPBA 1WVIA 3GFSA 4G41A 1SO8A 1XAGA 2MMCA 2IS4A 1RCFA 4HUJA 4X63A 4RELA 2DBVO 5AXCA 2MU1A 3BTUA 3NR2A 2IS2A 5AUNB 3QA9A 1IG0A 1DAGA 3GEHA 5CM8B 2ZB3A 3NTXA 3O3NB 3MQ2A 1EP1B 1V2HE 1A2QA 1F17A 1NI5A 1Y8RB 3T3IA 1UKAA 4CTJA 3UUEA 4Q9NA 2EJ2A 3EOZA 1L5MA 1MX5A 4V0ME 3EOAI 2OCBA 1MORA 5CITA 2C5FA 4IZ6A 1X1TA 5G4LA 3LNTA 4A10A 1I7DA 4TROA 4F91B 1KERA 4D02A 4RZ3A 3E9MA 2F62A 1Y82A 1DXHA 4NCHA 3DWGA 2A78A 3T4PA 2Y67A 3T7RA 3G9XA 3BIOA 1BMQA 1ECBA 5A2QW 3KOYA 5ALQA 3DC7A 4QEKA 1G2PA 4P53A 4II3A 3W4KA 3WWIA 5C7YA 1RI5A 3GOQA 2HGWA 3SNHA 2WWYA 3G2IA 1L4UA 2JD1A 2PD6A 1I2KA 5FWDA 3B52X 2XVYA 4CL2A 1WNTA 3W7VA 4KIFA 4BOYA 3C87A 4G86A 2ZUFA 1U8EA 4F92B 5HE8A 4KQGA 3PFHA 5AMXA 3GH1A 2A5DA 3EMVA 1G8FA 1DAKA 2FWRA 3IVXA 5DLFA 2W6PA 4C78A 1P4AA 4TOIA 2QQEA 5IK2D 1TJNA 4YIHA 2GJ9A 3UN1A 4YAGA 4HNGA 4B3IA 5IX8A 3AWDA 3L7CA 3ZNNA 1LVUA 3IDAA 4UD2A 1UH5A 1GN8A 5F64A 2XZPA 1WD5A 2P5TB 3STTA 1UC9A 3DZDA 2RF4A 3A4LA 3M9XA 2Z2ZA 1P2SA 1PWYE 3NNNA 3H4IA 1HT1E 3UA4A 5JXGA 1RZRA 1TA9A 4YQYA 1Z0DA 3P2OA 3WNCA 3Q7IA 4KNWA 3LDGA 4MRAA 1EVJA 3EIHA 2V3VA 4IH4A 4MS3B 3IMFA 4YRLA 1T6NA 1FRQA 1BYUA 3RB6A 1X6VA 1XCMA 3RC8A 5BVGA 4QYIA 5HF8A 3SMQA 4IDAA 1CR1A 3DDSA 5F5LA 4S24A 2C1EA 3HSKA 5EQJB 5JAPA 4DBLE 1W36B 1QGUB 1I4EB 2CWWA 1U0TA 4XFKA 2QM0A 4OOEA 5G0VA 4FZVA 2E4WA 1HTBA 4CC6A 4LJ5A 4RPCA 4GUDA 3GD5A 2UU9H 3AUSA 2VRNA 4R2MA 1FFGA 4WGGA 1ZCFA 3AQIA 4LV5B 3COYA 3LCRA 2KB0A 3R9KA 1QUFA 3NNSA 5FBWB 4GZLA 3GLKA 3CNEA 2JJ2A 3KQWA 3W3AA 2HTFA 1DTWB 2QVZX 1B42A 1JDVA 4MVJM 3WKBA 3I53A 5EOVA 2CZGA 1XK7A 1Y42X 3IS3A 2JNWA 1FFXB 2WD9A 2XOEA 3MINA 4M2LA 1H0RA 4C7XA 3M9WA 3DWIA 4L15A 4B74A 2QZSA 1S0UA 1VMAA 3BXHA 3C3DA 4FIZA 1ZQ1A 5FF9A 1TOAA 3DFIA 1IB6A 2CLFB 1O0SA 2FZ4A 4EQ5A 4Y1RB 4MV3A 3F78A 3JVEA 4HGZA 3EZ7A 4QTTB 3G85A 4UTNA 4MGHA 3ZDDA 4LTNA 1V11A 3ULKA 3HV0A 3KC2A 5ALEA 1QNLA 4U7DA 4Q3OA 5JZVA 3TW4A 2AOTA 3HVHA 1HE1C 2YVKA 3GEMA 1YR1A 3OEED 1XQ9A 3GDFA 3W9BA 3ZK7A 3D6UA 2REQB 1PJBA 2FN3A 4O4HF 3BABA 1JIIA 2EIXA 3W5AA 4DJTA 3ZXIA 5LQAA 4DL4A 4QRIA 3AUJB 3P19A 1MA3A 4OLJA 2WQZA 4NENB 4PIMA 2D0PB 2VRCA 2FEOA 3GLQA 2AH5A 4BZXA 3MFIA 5AVKA 4KYIB 4KC0A 4MW1A 4JVMA 2P6PA 5KG3A 1WLSA 2HBZA 3JATB 1YL6A 3EXIA 4D92A 3EW7A 3F73A 4RIEA 3RVOA 5AVUA 2EU8A 3C41J 1OBCA 3TOZA 2DMRA 3H18A 1E6WA 4CHTA 5CBPA 3Q87B 3EHDA 1WL8A 2R2AA 3C7AA 2XYGA 5ICGA 4JEUA 4QUEA 2QTBA 2AIRA 3D6NB 1ARZA 4HL6A 2IBSA 3ZQ6A 1NSTA 1G4AE 1P1IA 4Z0PA 3J81k 1W44A 5IM4A 2C7RA 2G28A 1XZAA 4C4RA 5GGXA 4A8PA 3BJZA 1A69A 3JSAA 4TV8A 1K66A 2HSGA 2JA7G 3QLEA 3D0KA 1LI7A 4Q5IA 3U39A 1OXMA 4G5XA 1B16A 1YBVA 2JCVA 2NXEA 3PC8C 1O2DA 4FFNA 5FL7A 4D57A 2GEDA 1NR1A 4S0XA 3WB1A 3FTPA 5T14A 2CEAA 2QT0A 2FA9A 1X7XA 2VPZA 1FW6A 2WF9A 5H02A 3BMOA 3LGXA 1FLDA 3L8ZA 4DMFA 4BNJA 1O6BA 3A1WA 4OLFA 3M6AA 9ATCA 2BFMA 2GYYA 3ROKA 1BZYA 3K4QA 2O0KA 3M5DA 3VR3A 1NVTA 4YRTA 1DG3A 4KH0A 3WGIA 5G0UA 3OKAA 4ZQIA 1VG8A 2O2ZA 4QSHA 2BY4A 3LL7A 1FLVA 1TAQA 3OY2A 3RRXA 4BNWA 3FFTA 4Z51A 3VDMA 1HLFA 1C5KA 5KTMA 3NPAA 5IP5A 3OT5A 1PJ4A 2HA7A 4DZTA 3JW8A 1U3VA 2JCBA 3B3QA 1DQSA 1AUXA 5CCEA 3ZGLA 3MJFA 1CP3A 2FG6C 4YMGA 4ZZ3A 1G2IA 3BHJA 5I7WA 4FSHA 1A9QA 2XMGA 2G9NA 1LC0A 4TLDA 2V0GA 2YZNA 3GR6A 4YRCA 1I1NA 3H6KA 4WVFA 3JQBA 2XJ4A 5D84A 3HDTA 2QMYA 4QQ8A 2QMOA 2AE1A 2QUAA 4O08A 1E8NA 1CY8A 3RR5A 2DOKA 2X8BA 4RY0A 1PBNA 4R2XA 5I9TA 4XWYA 1YZ3A 1NASA 1F2VA 1AQ6A 3RAGA 4Z4IA 3ZHYA 1XQYA 1KP9A 3DLTA 2BRUA 1QVZA 3ITEA 2QD2A 4FJ1A 4LDAA 2VZ0A 2IY8A 1QP7A 1VDMA 4AYXA 5BVGB 3IH5A 4QYIB 4UUQA 4RKYA 4EKDA 1NW5A 4OJKA 1U3UA 2H4ZA 1JSXA 2WMDA 2ZUUA 4D4MA 1TYZA 1R8QA 1D2CA 1JIUA 1XE3A 1JHVA 4JXJA 1WX1A 1RCTE 2HRCA 2ZU6A 3GL9A 2EJCA 1R2QA 2VP0A 2HMAA 2O07A 3TR0A 1JHQA 3N05A 2J9YB 1JZQA 3KZCA 3KTAA 2LUOA 3QVKA 1ZQ9A 4IZIA 1F4PA 3H11A 3L8CA 3Q40A 4IUYA 4K9QA 4BVHA 1NF8A 3QJGA 1NLZA 1DUVG 1ZVMA 1GPDG 1QIHA 3BERA 1E6LA 4NV0A 4JSTA 3DDOA 1TJPB 3ZCRA 5F76A 4JV0A 3C14C 1LS6A 2WZDA 3QVGA 1NQOA 4FZ3A 3UJAA 4TLLB 2Q2UA 3FD8A 3O8CA 4Y6QA 2V03A 3ZZ0A 4AUMA 4RTJA 4BO7A 3ANYB 3EAGA 2XW6A 4DV3B 1OXUA 1C0LA 3CNLA 3MINB 4BU1A 5EKTA 3P0EA 1SCDA 3THSA 4XVCA 4Z54A 3CISA 2WPDD 2JHAA 2OYCA 5ALFA 4KYTA 2RFLA 2AGOA 1WXEA 5KNCD 2OBYA 4WPGA 2J9FA 4DL3A 1E9SA 4M7PA 1QP0A 3G2LA 3A6DA 5LYJA 1MPTA 2QZ4A 4E0BA 3RIYA 3AHCA 3T5HA 5BWBA 2P91A 3E3AA 1P6UA 1V11B 3WISA 3HXLA 2EX0A 4QTXA 3GU3A 3DLAA 2R68A 5FD8A 2FFBA 4KN5A 4A36A 2AOTB 1MFZA 1DXQA 1VPDA 1W0JA 3SEQA 4FGLA 1XEXB 2PRZA 4E32A 5FBLB 4X00A 1YVDA 3OTWA 4UPDA 4ZKDA 4ZZ0A 3WHLA 4NEGA 2YNMA 3DB1A 2ONZA 1NM5A 3L7KA 2QDXA 3DD1A 1T0BA 4LX0A 1XMOB 3KEGA 5IUJC 3TTUA 4YRGA 1CYEA 2LDBA 2UUCH 5FX2A 4YP3A 1P0MA 5A62A 2V7BA 2AW3A 4J2OA 5DTJA 4TSFA 3EXIB 3DZFA 4UFOA 2MYNA 1GSOA 4DA7A 4IDHA 1OPRA 1FUEA 3T4EA 4JHXA 3U2QA 5KYWA 5CBPB 3FX2A 2CXRA 4QXMA 1H2BA 4RHXA 5E9QA 1XU7A 4R6XA 1QP4A 5E38A 3EPJA 1TM1E 4HDSA 1BVHA 2AXQA 4O3QA 5GY7A 2ATLA 1G19A 2D2IA 3NUZA 3SG0A 1E3TA 3FA2A 4DLKA 2WF6A 4ND5A 4P4NA 1LJUA 1XHLA 3BWYA 4TV8B 5HR5A 1UKEA 4LJ6A 4D4KA 4QASA 3RAEC 1KGDA 5HGJA 5FORA 2XWJI 5K09A 1YRYE 4RXUA 4O1MA 2P4QA 2J5QA 1GADO 3AGPA 3FZNA 2D4AA 4H60A 1Z5VA 2WWIA 4ZO8A 1MHPA 1J23A 3CVYA 3RIGA 2COIA 2RK3A 1X7XB 5I01A 4YRKA 3DHVA 1QWSA 1S10A 2JVIA 3BMOB 3BF7A 4NAUA 2HT1A 4LKRA 1A5SB 1JEJA 1NJ6A 3VNUA 4Q18A 2PM8A 4GVLA 2EGUA 3G68A 5E1OA 2ERYA 3TJRA 4KQ1A 4FM9A 3FSGA 3M6VA 2X23A 2QU8A 4CDMA 3PHHA 2WUWE 3ND8A 3T3HA 1VSTA 3LKZA 3UWMA 3CM0A 2XT0A 2PGDA 2CLOB 4L3VA 1S2OA 1F4VA 1J8YF 1E3QA 1T0JB 1K06A 4MZDA 4F60A 1RXYA 1QV6A 1RQLA 4KXUA 1Y3IA 2R7MA 4A5SA 5LOVF 3K1TA 5CFMA 4G3IA 3NKFA 1A5TA 1EBFA 1XDBA 1FUUA 4UD6A 5J4VA 2Q5QA 4B80A 3K32A 3TOSA 2CXNA 4MLZA 1VKHA 4J9KA 3NH9A 1ZFNA 1PHRA 4A16A 1QONA 5KT4A 1MJ5A 4LDRA 2AJLI 2DHDA 2R8HA 1MNQA 4HX9A 5KNBH 2WAAA 1RYZA 4FJ2A 5DNYB 3UENA 2V9PA 2YUIA 1N2OA 1KH3A 1YFJA 3OP4A 2PTHA 4PU0A 3PFKA 3RKRA 5JHHB 5FFNA 5DX1A 1SK8A 3WMXA 1ZL0A 3VTFA 4BLWA 2HWYA 3K71B 5E7MA 2F43A 5MN4A 2BF4A 2FK2A 5AVSA 3QX3A 3EDCA 3QIVA 1JLRA 1C81A 1Y4ZA 3GLFE 4PFSA 5GONF 4PAMA 4D8YA 4DR5H 1G60A 3CSDA 6ADHA 3IDSA 4R5HA 1A2BA 1S8FA 2Y93A 3QKWA 4OMUA 5B36A 4ZT4A 3EQ2A 3KLPX 4N5LA 4TL9A 5HXAA 2BI7A 3A1FA 4ND7A 4B7CA 1VSUA 4ETWA 4F4JA 4IILA 2D8MA 3PWZA 3KTAB 1YWGO 1J56A 3GHHA 1U8UA 4JWTA 1OF1A 3H11B 1XROA 3MERA 5CA0A 2Z4SA 2XNDA 1J06A 5I60A 2QJTA 2VPIA 1ATZA 3A9TA 3BWBA 4OVKA 3N2EA 4B34A 2M32A 1T9KA 1T34A 1I3LA 1SCNE 4K0KB 1G38A 3WC4A 2HEIA 1K3FA 2JLUA 2QTCA 4L0CA 4C4ZA 2WMOB 2H54A 2UXDB 4FYHA 3QVGB 3LUDA 2Z02A 1LPOA 4ETSA 1UOQA 5CVCA 3H3FA 4AZSA 1YFLA 4PXSA 3KSBC 4R1PA 2FPXA 1U80A 2OHXA 2PGNA 2X41A 4PLTA 3CVJA 1GRQA 1U2EA 2ZUEA 1U9IA 4HZIA 1K2WA 4JI0H 2J9FB 3UOAB 1VPVA 3JTMA 2I1LA 4OYRA 2Z04A 4AJ2A 5LYJB 2HMSA 4O83A 3E8SA 4OUKX 3G2QA 3RFTA 3EYWA 1JR2A 3E15A 1US8A 2W9BA 5D1NA 1DMRA 3DEJA 1VIYA 3KSRA 4ZVRA 4RKWA 3OFNA 3AC0A 2VXBA 5AKHA 3F8NA 3HOYG 3HCWA 3ANTA 5FBZA 1GLVA 2HG8A 4QWBA 3W1WA 1SG0A 3W6ZA 3ICVA 4FUTA 1C8VB 5ECDA 3FIJA 4HMPA 4CNBA 2OENG 1VBFA 1Y5IA 2E82A 4W5OA 1T8PA 4QUBA 4DRXA 3BDIA 3PYXA 1EK0A 2I62A 3REGA 1ULZA 4IIVA 1DQRA 3RSGA 3EIEA 1PHPA 4YV0A 3KJXA 3SKXA 3ZV4A 5KYWB 5ALIA 1GYFA 2A14A 1VDZA 3DZBA 3OM8A 3KHRA 4GR4A 1G8PA 1YQUA 1WMAA 4URYR 2XB8A 1JQ5A 1A48A 1MDBA 2A9QA 3ZBQA 4HDSB 3LHFA 4RYDA 1YR7A 5BSUA 3TIIA 1EKVA 3BZUA 2I7TA 4D7AA 4KQ9A 2HSZA 5KDLA 1R8YA 3IV9A 3K0FA 4UU1A 2QE7A 2XKAA 2QV0A 2O3SA 4GNKA 2MSWA 4Z4EA 4AP6A 3WFZA 3GILA 4H7DA 1HOTA 1JG1A 3FRIA 2Z6UA 1U1EA 1RHRA 2HDKA 2GPAA 4R1OA 5KWIA 2ZRHA 1OASA 2WU3A 3E1KA 5K0JA 3JZFA 1KDRA 2J09A 1HT3A 2QTAA 4DMHA 1U8AA 3K0CC 4W1RA 5L4SA 2PWPA 1TCAA 2Y2UA 4E6EA 2GK7A 3A06A 4FE2A 5HKKA 2JW5A 3U61B 2PKYX 4KB5A 4J9QA 1KQPA 4A0FA 1FSZA 3PRHA 4IOJA 4ZCLA 3SJUA 3DJYA 2IHTA 4TWJA 3CZQA 1T5HX 4ECSA 3AT1A 5JU6A 3RVQA 4JBWA 3V6KA 5A1TA 2RAPA 2WM3A 5T6MA 5LCXA 3LHSA 2B4YA 5F12A 3V9PA 4DYVA 1C9JA 3OPXA 2XE4A 2QVLA 1G3UA 3GEGA 4PG6A 2VUMG 2HSWA 4DDHA 4M54A 2WM8A 4GEGA 4CIWA 1PP4A 5DLQC 5HJ5A 2XGMA 4PSKA 1DOZA 3PC3A 2PIAA 1E58A 3AVUA 2COKA 5CFRA 3M1AA 3SN6A 5CNJA 3OX3A 1E77A 1N57A 2F8SA 5KCZA 1H3EA 2KLBA 4PWQA 1PL7A 5KQMA 4ZEXA 3M34A 1DAMA 4J9LA 3BQ2A 2V97A 3MILA 3U7HB 4CTKA 2G36A 1UZLA 4GP9A 4QIWE 4IG4A 1JXQA 3K8YA 5IZCC 2NU9B 2PUEA 2C9CA 5CB4A 4LFAH 4WX2B 4JJFA 3ZZTA 2AEFA 1QF7A 3RSSA 3HSYA 4L95C 3TMYA 4BKPA 2INGX 2YL2A 3F5MA 1WU8A 4OJMX 4JLWA 2ZRAA 1YRBA 4HX2A 2ZI3A 1XVLA 3A2MA 3UTCA 3R0ZA 4GMDA 3TGWA 3JYHA 1TLTA 3MS7A 3VAZA 5KYYA 1GUYA 2PLAA 2GM9A 3PR2B 4M0CA 4KPFC 5EMLA 3ELYA 4C6TA 3IT1A 3O9VA 2F43B 3TRIA 2BFEA 3K9WA 3SQWA 3RYHA 3X1XA 5FUWA 3V8RA 3VO8A 1NRWA 2X0FA 4MEAA 3ZDFA 2PXCA 5KI6A 2AG0A 3DNFA 3DSRA 3NQ41 1ZH0A 1DAIA 1VJ0A 5DB4A 4BNIA 3G0HA 1GZDA 5ALPA 4ER5A 3KLMX 3JQPA 2JCSA 1B0AA 2HO4A 4M1WA 1CNEA 2H51A 2VAWA 2WYUA 4RKEA 3FWZA 3O7WA 5CA0B 8AT1A 1IHPA 1CY4A 5FWXA 1L5NA 4H6WA 2B69A 3PPWA 5IC6A 4C7OA 3P9KA 1E3IA 2R92G 2LDXA 4OFZA 3AJ8A 3HOUG 1VE9A 1GFSA 4IJUA 5KVAA 1K0FA 2C2OA 4AXBA 4E2XA 8OHMA 3UUGA 1X7WA 2GERA 2FUCA 3BWEA 3VZDA 2I2DA 3L07A 3V4VB 4ECVA 4KQXA 3W79A 5CHEA 4NAHA 1Q7RA 3TI9A 1P7ZA 5I8PA 2VDRB 1R4ZA 2CFOA 4NXNH 3BICA 2XZLA 4E31A 2VP9A 3RQSA 3OE1A 3TTWA 4J9RA 1US8B 2W9BB 1LDBA 3VC1A 4XOIA 4MYRA 3QNMA 4N6GA 3A10A 3C48A 2KQUA 1CEXA 3A25A 1TYBE 1T2NA 4IHAA 3TO5A 3GTQA 1ZC4A 5C8ZA 3V4FA 5CAEA 1XFAA 3TGPA 2P9QA 3TG8A 4I1UA 1X7YA 1XKXA 2P5SA 3IRVA 4O86A 1L4YA 3NPMA 1OWOA 1JAXA 3HZOA 1XZIA 4WFQA 3E5HA 4UM5A 5BYJA 3P9YA 4PYIA 3GJXC 1I4WA 4DSAA 2QRLA 4QYWA 2CUNA 4LY6A 4FYIA 1OLUA 4IGFA 2YRFA 3I2JA 2VK1A 4DRXB 1FUIA 4QNNA 2VF7A 5L40A 4XQ9A 4P0TA 2KSQA 3UJ7A 4ES6A 2KW5A 2B35A 4KWCA 3U4GA 4YJ3F 3V8PA 3GO4A 4JLDA 4QUJA 3IA2A 3WOVA 3DR3A 5E7JA 2QSUA 2DU8A 2HDHA 2XT6A 3DQZA 2SECE 1HE3A 3AF6A 2HPZA 1A7AA 3K0FB 3ORQA 5BWVA 3EVZA 1RZVA 5G1NA 3WNVA 3Q7PA 4PINA 3MGCA 3GDOA 4HYTA 4Q8EA 4QECA 4DANA 3WIEA 3PXGA 3EIOA 5D8DA 4ZXPA 3EXHC 5B1DA 1GPAA 1L3CA 3WADA 5ECYA 1SVKA 4NBRA 3F6YA 2E85A 4M0KA 4MO9A 1JUDA 2R93A 1YZVA 2II6A 3GNTA 1H1TA 1HR0H 1U4SA 2VYVA 1I2BA 2EC5A 4GP7A 2AYYA 4DREA 4GLLA 2NTNA 1X3SA 1K6IA 2REOA 4O1IA 1LDYA 1JLKA 2YV2A 3M83A 2VR1A 1H9CA 2ILVA 1IBRA 2WHRA 2X5RA 1UDCA 4RGYA 3IXLA 4F4HA 2VEDA 2JJMA 3FOCA 4ZRNA 1WCV1 1OXVA 3RANA 3WK6A 3SHWA 2C9ZA 3FCOA 1ZJWA 1COZA 1FKAH 4RTSA 1N3LA 4JAVC 3EZ2A 3SNKA 1OV4A 2Z83A 3TZKA 1JFTA 4KTVE 4JK3A 3CLRD 1F1BA 5D5PA 1H69A 3HGTA 3PPYA 4Y9SA 1CG6A 1PKXA 5EE3A 1WOMA 3MR2A 4WKCA 3JS5A 5JS6A 2VWGA 4FDLA 4RIGA 3I83A 3O4GA 4CKCA 2FV8A 3C98A 3I2IA 3LCMA 2XMSA 4LE2A 1TDJA 3KFXA 1QHNA 3PZPA 3OLVA 1ACMA 4N82A 2FRXA 4WL0A 3I42A 4BVBA 3V1NA 1PR2A 1BXRA 2ZB2A 4O7NA 2HNAA 2AC2A 1ZBDA 2WYWA 1YD7A 3LC2O 5CB4B 2ORVA 1O58A 5E2AA 4AWBA 4DQ0A 2OCDA 3BN3A 2ZPAA 4R16A 2XB6A 3C74A 2GPNA 4YALA 2NOAA 3PIIA 3FPHA 2BM0A 4G5RA 5KYYB 3AY3A 1GZ7A 4H15A 3TRHA 3U0BA 4YCLA 3WIBA 4C6TB 1LFDB 3UANA 3IVCA 1UMDA 2RB5A 2BFEB 4A3LG 3RYHB 3W04A 4EBCA 1SBIA 5FD6A 1MJGA 3BFJA 3KJNA 2DWQA 2WSSA 4R84A 4B44A 1TKCA 3CSSA 3H5AA 4RZUA 2V58A 2J9XB 4TXLA 5KT5A 3K09A 2BGLA 2F55A 4UOEA 1P3JA 1LPNA 4MUNA 1UDXA 4I3HA 3SEAA 1JR6A 1L4EA 4BLRA 2ECPA 5FWXB 1MZBA 4IDGA 1KK0A 1T5IA 1NVFA 4LXTA 3GJ5A 4C7OB 3UC5A 4C0HA 3HS3A 4MUKA 4M1EA 4XRRA 4W1QA 3Q0TA 3IODA 1Y1LA 4Q39A 221PA 1KNQA 5DYGA 3SR4A 4PGAA 1IBLH 4C1BA 3GMIA 1PFUA 4TZTA 3EWNA 4HVLA 3IG0A 2C88A 3ON5A 1KYQA 1X7WB 2W2TA 4OHFA 4DCMA 2ZUDA 1A8QA 5L3RA 1CVRA 1UJMA 4WA8A 1P39A 2ROQA 4DMMA 4AI6A 4HB4A 3KQUA 5EZYF 4Z9XA 3MTJA 1WB9A 3A11A 4FD2A 5A04A 3G2HA 5TR9A 2XEDA 4XLZA 4L5JA 3WNDA 3MBOA 5I5XA 3FNIA 4BFZA 4KR2A 2CLKB 1Z8FA 2VOJA 4XPZA 1Z2AA 2JJQA 1ZK2A 4IQ4A 5EVJA 4BS9A 4DT1A 5BV2P 3GFBA 2RIRA 4EX6A 1NF2A 2QN7A 1PJ2A 3ILHA 1S9HA 5CAEB 2H1RA 3RR2A 4GGPA 4PX5A 1X7YB 3QKIA 4MW6A 1JN0A 4OJNA 5CXSA 4AFNA 3U9TA 4RTNA 4CN8A 3ZCVA 3LCJA 2UVUA 2G82A 5KUTA 1IZYA 1JG4A 3E53A 1JHZA 2JASA 1OLUB 4TQRA 4JI3H 3IMGA 4URHA 1SK9A 4A1OA 4JJEA 6AT1A 3QE2A 3B85A 3S5JA 4BQQA 1KQFA 1QYDA 4WLFA 2Y66A 1E2GA 4UHJA 1HTWA 4DSUA 1PJCA 1WLYA 2XMPA 1FDSA 1OUMA 3OSNA 3RODA 2ZXFA 1OFUA 3QMMA 2H57A 5LNK6 3UPTA 1LBIA 2OPHA 1G5IA 3LDHA 5KG2A 4QD3A 4ZPXA 5BWWA 3WGJA 3MTAA 1PYOA 4QUGA 1R0RE 1UK7A 2H9AA 4LC9A 1XMIA 1CHDA 3OQ1A 2PCLA 3UF0A 3OQ6A 1FEZA 1E79A 1CQPA 4OFWA 2EJUA 1M8GA 3MT9A 2X8WA 1ZI8A 4XGIA 5IVIA 1QRDA 1UF9A 4E22A 1KL7A 2GXQA 4CODB 1URPA 1C7EA 4ZGGA 1JSZA 3V42A 1AKMA 2XUQA 4QUKA 2OK8A 3M3DA 3HA2A 1O6GA 2HCFA 3N58A 3BXEA 4R1NA 1IZ7A 3JALA 5EJ8A 1KZ9A 1HYBA 1FDTA 3N9IA 4FYJA 1EP2B 1JPNA 3W8DA 5KT6A 5EJ9A 2IP4A 5BR7A 4W82A 4GOMD 4IDQA 2H2GA 3FCSB 3HEAA 4AK9A 4ZCTA 2ORED 2BW0A 3S6JA 4URZR 1RRVA 4LGVA 1YKSA 1B6TA 1XZFA 3M4XA 1PQ4A 2R1UA 1EVKA 1R5BA 4WERA 5M34A 3RE1A 1TM2A 5IPFA 5EGNA 3GTMA 1PEDA 3HJBA 1I94H 5EHZA 3NUQA 4X8OA 1KAGA 2EWWA 3BE5A 5H3CA 4NX2A 1GPUA 3L9WA 4E5VA 3R6WA 3KHTA 1BXRB 4R98A 8LDHA 3LX5A 1QDLB 1CDZA 1WDWB 2YCLA 1JQBA 2OCIA 1D9ZA 3ZLUA 5L6LB 3Q6NA 2QRJA 4MWSA 4QRDA 4MR7A 4OO3A 2ZCUA 5I7FA 2JLVA 4JGIA 4YPFA 5KX5F 2JJ1D 5BR8B 2HHHH 4OHXA 3MTBA 4BX3A 1GNLA 2PUDA 5JZBA 1UMDB 1WW3A 2YZ7A 5DGTA 4KEAA 2AB0A 2X5JO 2OORA 2C9MA 2R86A 3RS8A 2QW0X 1JFSA 3H2HA 3ODPA 4B87A 3V1KA 5HS4A 3RIMA 1GKLA 3OZCA 4HRVA 4HH0A 4EY4A 4YJDA 2D06A 3G2PA 4Z9AA 3OO0A 1WA5A 2A1TS 4JEIA 4EBFA 1KTIA 1JKIA 5BYAA 4YMUA 4FGSA 3OCZA 3NOXA 4C20A 4H9GA 3NHMA 1SBTA 4MYCA 1Z8NA 4Z9FA 2GEVA 4HPWA 1RWBA 5FBVB 3E2PA 3L7DA 4IX1A 1CJMA 1J0BA 4L5YA 4EY3A 5K0ZA 3UY4A 4OA8A 5KU7A 3WBKA 3M4IA 4D0NA 4WZAA 2VPTA 2PZEA 2GWHA 1M2FA 1GAXA 2MINA 2OY0A 1LFAA 2X0NA 3EFHA 5DTEA 3SVTA 3RNLA 3G8CA 4BGEA 1FJXA 1QLJA 4MLDA 2R5WA 1UUFA 1YJBA 5I47A 4GKJH 1Z5WA 4CEIA 5FL3A 2VTEA 4JCCA 1C29B 3S70A 1YV9A 3PIRA 2G72A 4DEVA 3HU5A 5BSKA 3QH4A 4HAWA 4WOJA 4MWTA 4DT1B 3D8RA 3ZU3A 3TUIC 4O29A 1L1RA 5HS6A 1ZGCA 3UJNA 4W1SA 2OM6A 3FDZA 3A6FA 4QQRA 3C7DB 2IU0A 4EATA 3L3BA 1E63A 1D5CA 3QU7A 3HVRA 4FBTA 3DZ8A 4CTNA 3VDXA 3QBJA 4MSUA 1AO0A 4QPNA 1FTGA 1V9PA 3PFBA 4E94A 4OGFA 2BM9A 2UXBB 2VJBA 3UNXA 3PC7A 1DT3A 2VBIA 2GF0A 4QUIA 1DE0A 2NUTA 3RW9A 1V7PC 3DTVA 2W2VA 2CNBA 4CCYA 3W7AA 2CXSA 5IT0A 3RTBA 2F17A 1ZK1A 5LD2B 4Z5XA 5CVUA 1M2WA 4JGGA 3EXG2 3QE4A 3PG5A 3ROPA 4HGQA 4RJ2A 1EFRA 5JNWA 4BY1G 3O21A 2IHBA 3U55A 3TRDA 3CLSD 3ROGA 1ZR4A 3UXYA 2R8IA 2PX4A 5D5QA 3S29A 4XDGA 5DGAA 3HP4A 4KLAA 1XTSA 4ZV7A 5KWEA 1SXQA 1A5ZA 2XTJA 4B3FX 2FRVA 3GH3A 1X77A 3S2EA 1YTLA 4LF4H 2FE1A 1Y4SA 4PG8A 5DNEA 3H2JA 2AE2A 1D7OA 2X0IA 3R5XA 3TW6A 1L2ZA 1L5ZA 3VNVA 4G89A 5EWGA 3CMCO 3P5SA 4FS2A 2BGWA 3RUAA 3W5VA 2VYCA 3JQAA 3DAFA 4BYMA 4LWOA 5KYGA 2CLDX 2P7IA 4BAGA 3GIKA 1MPXA 1TCUA 1RVV1 2EJ0A 4DN6A 2PZFA 1R3DA 1PLLA 3JALB 1LH0A 1H2YA 4KAJA 3LWDA 5EMNA 4Q3LA 1JDBB 2JH3A 3OEHD 1RLTA 3UK0A 2GCNA 1EINA 4TYMA 2PRKA 1VBGA 4F1WA 2C9OA 3DCYA 2AC7A 3FUUA 1TD1A 1UM8A 5CB0A 4M1MA 2Z9BA 521PA 4PC7A 4GZ6A 3L01A 3O1HB 3EDRA 5F5XA 2CLMB 1Y4AE 4JVOA 4DLPA 2CNDA 2GK4A 3ZGYA 1G8YA 1NT2A 3MD9A 2YW9A 1P3Y1 4C0XA 3I1JA 1DHRA 3KBBA 4JODA 3Q10A 2NG1A 1YRQA 4EG5A 3KXKA 3GK3A 3F9CA 6YASA 1N2EA 1NR5A 2ZBUA 1QGAA 3ZJVA 4YMWA 5EHGA 4MQUA 4WNAA 4HRYA 4X84A 2C54A 4JGBA 2G88A 1E3JA 2WAMA 3IB6A 4S2UA 1RJPA 2R82A 4RK1A 1QKKA 4S1TA 3NBQA 3VZCA 4BKQA 3ER8A 3BC1A 3OZ7A 3TFWA 3GLIA 4R8UA 5DN6D 4GC7A 1RE1A 4IH9A 4EAQA 4BMZA 1JWAB 2QRHA 4MR7B 3R2JA 1R0XA 3U0GA 4ID9A 1J6UA 2UZAA 5LVAA 4KDEA 3OLZA 1M1YE 2BZSA 1WSDA 5D1OA 2DVMA 4FMDF 2JCYA 2FLKA 2DWCA 4PO1A 2B5OA 1XEXA 1FPQA 4H2DA 1VGVA 1P9LA 1PFYA 3GLRA 1L7NA 1B41A 1I4OA 3OX4A 4PG4A 1E62A 2X0RA 4HDRA 3WRXC 3ANMA 3CEJA 5FPOA 3TXXA 2DM6A 4EBDA 3HCEA 3DTTA 4DMRA 3RIXA 2XGOA 2G7ZA 1M5TA 2IDZA 1OB5A 1NBIA 2M05A 2WB4A 3K05A 3AF3A 1ZINA 4N7RA 1YDHA 2BGJA 1JZTA 3CEMA 5JH7F 3M6FA 1Z29A 1H2HA 4R0NA 3C3JA 3RC3A 3GTGA 4HFJA 4R3NA 3PXBA 1CPYA 4V03A 1P7WA 3OJLA 1ZGHA 1GSIA 3WV4A 4DR3H 2GJSA 5IAAA 1GYRA 3U1BA 5BT9A 5KG7A 2ZBRA 3AUYA 5KT3A 2IYLD 3ENZA 3D8UA 4RFVA 3SYRA 1SU4A 2EYQA 4WZAB 1MVLA 1QKIA 4G4SO 4BNYA 4IS2A 3L49A 4JJ4A 1RBYA 2MINB 3WGKA 1YDFA 3VYSB 2WTBA 2A1TR 1Q7TA 1E4FT 2ZSUA 1X0VA 1GNRA 4HNVA 2OPBA 5B2ZA 1ADJA 3WTCA 3K6RA 2XHZA 4CEIB 2WY2D 3E3MA 4RK6A 3WGUA 4CKWA 1SWWA 2J3MA 1FF9A 4YP6A 4ID3A 4J91A 5FOXA 4S35A 1M76A 2XMRA 3EDYA 4D43A 5T41A 4U8GA 1E9AA 5B2EA 2LP4Y 1OILA 2XB9A 3SE0A 2GJKA 3FDZB 2D5CA 2OO5C 2VPWA 2G06A 4KITB 5TT0A 3JQ6A 2Z3ZA 3U6BA 4IXNA 2WIAA 3CR7A 2BBWA 1K6MA 5IKMA 2NQTA 4Z8YA 3ZZUA 3JQ8A 1SBHA 4JROA 1QQAA 2IH5A 4CV3A 4YI5A 4DUPA 2EFHB 5TGDA 3QE9Y 2QP3A 2QVYX 2NUTB 1DSSG 4J9NA 1DEXA 4L8VA 2XMCA 3DTVB 4ITVA 4CCYB 4JBLA 1I1MA 1GP2A 1EXNA 1XNQB 5CFPA 2XUAA 5C31A 2C2KA 2J7PD 4RULA 2EL7A 1SCAA 3RVJA 1J9EA 2PVPA 5KREA 1B04A 1LEHA 5KIAA 3N87A 2ZTVA 1E2DA 2ZLBA 3C3EA 2OM2A 2LXNA 3EZ6A 2IA6A 2C9YA 4GXQA 4A8TA 5CLGA 4AS3A 3PGXA 4QFDA 4KQEA 5GP1A 2QX6A 1ZO8A 2QAGA 1H6BA 4DIOA 1JHYA 3AP1A 2YMLA 1UKVY 4U7WA 2FSFA 3AHEA 1JHOA 1ORRA 2MSDB 121PA 4O3NA 4O5OA 1RJFA 3Q8LA 2Z2KA 3E9DA 1RBZA 2XGQA 3VR2D 421PA 2M9MA 2QRVA 4PY2A 2GNAA 3C3YA 3DZGA 3JQAB 2DHRA 5KZMB 1YZLA 3T7JA 4D4HA 3WG9A 4ILKA 1TJ5A 4DV6B 2UVRA 5IAGA 1QRUA 7YASA 1VRVA 3NHYA 4PQFA 2A67A 3IDZA 4EQ6A 1DRUA 1KYVA 5AW4A 1E8MA 4ZDWA 3NBFA 9LDTA 3BB4A 2OCLA 4RUAA 1LQ2A 2O7NA 3NHAA 4Y0AA 5CLIA 4LPSA 4KIUA 5T67A 3CRVA 1USIA 1A3CA 1KJZA 3O4HA 2QLFA 4WOCA 4LOKA 2C07A 2B5VA 4YB8A 2JAXA 4TKZA 4ZQFA 4DL7A 5KFQA 1RZ3A 3K5WA 3CMMA 5T8KC 2DQSA 1NGSA 4KMSA 2QT1A 2FWNA 4YO7A 3II6X 4WNAB 1E2BA 1FIUA 5TMBA 4BTEA 2JCGA 5KTRA 1AE1A 3TB6A 5JWRA 1P6XA 4EPYA 4OMFG 2PX0A 5DEIA 4RZHA 4QFCA 2H2WA 1EXDA 5TF0A 1S2MA 1U2PA 3AL2A 5LLDA 2XD4A 3GLGA 3V32A 3KQQA 4AURA 2XR1A 1IBKB 4NYJR 1QVRA 3GLIB 4R8UB 4R0VA 4IV5A 5IG2A 1R0YA 1TMGE 3U9LA 4ND1A 2TMYA 2VDNB 1H65A 2R4UA 1NG1A 2JRCA 4UCWA 1VYHA 5D1OB 2ECFA 3OCWA 3C5CA 2DCUA 4TL6A 1LU9A 3KK0A 5K01A 1YNOA 4J0KA 2ZSKA 4ASUA 2ZTUA 3LKVA 3K4PA 5JAIA 3JAMW 4M99A 4RD4A 5JROA 1QX3A 4JI5B 3QFSA 4R8SA 4IW3B 1Z0JA 1N9KA 4DCGA 2BBTA 4HDRB 2RG7A 3GVPA 5EJ2A 2UYYA 4X41A 1SVMA 3OOJA 5K8CA 2YJ3A 1ZESA 4MVXA 4O63O 4F4XA 1DAFA 4TYQA 1ECPA 4I1VA 2I1QA 4YRDA 3GG9A 3OE7D 1FLNA 3H1BA 2WOJA 1V25A 3FCYA 2C31A 3ZXSA 3PHJA 2C95A 3IJPA 1JHMA 1E2MA 1PL8A 3LOQA 3N59A 2J3KA 4B4OA 5JAHA 4YYZA 1JJAA 3A28A 2B7BA 4OI2A 3FTEA 1OW3B 3PQ5A 2D74A 1JBEA 4JL6A 4MAAA 1XMQH 4CQNA 2FGKA 3OSPA 3LGSA 5K51A 4GZMA 2DCMA 1AHNA 3AKDA 1S3SA 1M75A 3WNZA 2ZYTX 2Z95A 1GFZA 1MC4A 2AEEA 4XWKA 3ONWA 3ESDA 2JFFA 1JA0A 4BPBA 2X5NA 5EXDA 1VTKA 4PNEA 2C7GA 2K2QB 3O5AA 1JVNA 1M1UA 1A72A 3K2IA 4J2HA 4HGRA 4CKWB 4I3FA 1G2WA 2GM5A 4OXXA 1O5IA 3UH0A 3QZ7A 2FSVC 1ZHHA 2YVAA 3HR4A 2EIYA 1UOEA 2FN9A 2ACWA 3T5TA 4X9XA 2AXNA 2EZ9A 3X1KA 2BGGA 2VSNA 1EM8B 3T54A 4OHUA 2FOLA 5I9MA 4OHKA 3JQ8B 4Q44A 3PUKA 4OK5A 4UHKA 1Z06A 2DX7A 3N8NA 3S8MA 4ICIA 1S0NA 1SGWA 3MJDA 5I5EA 4P08A 1AO3A 2HO5A 2FGJA 4IR7A 2I2FA 2WAOA 1BEZA 2VDQB 1HE4A 3MFQA 4NECA 4D9JA 6PFKA 2UUBH 5CT4A 2HVQA 4I8IA 1X13A 1ESCA 3UHJA 2NU9A 3ZLVA 3LPLA 3LBNA 4B8ZA 10MHA 2BGTA 4DV7H 2W48A 3ICPA 4MVCA 2YWRA 1P77A 2QAGB 1V5IA 3SBOA 2Y9PB 2J1LA 3WGGA 2I4RA 4QAJA 5DMXA 4M1OA 3R0JA 5FDFA 3IAFA 4JIMA 4L7VA 3ABIA 1E66A 3EF1A 4YMTA 1R0CA 2EP5A 1HMYA 5CX1A 4LI0A 2QRVB 3O1LA 4O2RA 2HXYA 1A8UA 4NCIA 4G0VA 1ZW1A 1JNXX 5IT4A 4TV9F 5DW0A 2O2DA 2WW8A 1E92A 3LQSA 2GB4A 3EG5A 2PEYA 2C8JA 4OBXA 5GJWC 1NF3A 3K1JA 2FF5A 3AJRA 5CVJA 3ZW8A 4F2DA 1MOQA 4EQ6B 2X2PA 1GILA 2YDXA 2ENUA 1ZN2A 3HRKA 4CMHA 4F4FA 2AJDA 1AKWA 4OQEA 3SSAA 3IMCA 1SUEA 1KZ6A 2G76A 5EJ7A 1DIGA 4X66H 3T3EA 1E7YA 4II2A 1ADGA 4F1JA 3A7DA 1K3UB 1WVGA 5KMGA 4P2GA 1HRDA 1V8BA 4TN1A 4AIRA 5JNSA 1QNFA 4YB8B 1KJ8A 3BORA 2YHBA 2DH6A 3PXEA 3DOCA 1FYDA 1L0BA 3GMDA 1TZ2A 2J0QA 4HAZA 4RHYA 4CDNA 3PW2A 1S2DA 2XKBA 2PVCA 1QTRA 2Q5IA 3KT0A 4FLEA 3GCWA 5ESWA 5CUQA 1P17A 2G4CA 4MVJA 2WT9A 1KEWA 2PL9A 1IONA 3RK0A 1GTRA 1Q1EA 3GLGB 4P86A 2YHIA 3VPSA 4RLQA 3MIIA 1I3NA 1T91A 3QWAA 4GI5A 4UVDA 5DNDA 3DMFA 1TM3E 5C34B 4C87A 3LT5A 5DQIA 4EQZA 1Q95A 3NO4A 5DCLA 1AJEA 4R9VA 5E2IA 2HJRA 5AOBA 3T1HH 2RGYA 3ZUPA 2IEBA 4BL5A 1ULAA 4EOGA 1W0CA 3P0RA 2ZQ5A 4HPXB 1GPNA 4YMLA 3S99A 2BH9A 2E9SA 3BRCA 3GFRA 1DG1G 4DHEA 5KNDA 3B7GA 1J00A 2WG1A 2GYVA 4B75A 2J3QA 3BQ0A 1COWD 4E09A 3RFXA 5K8LA 1T2UA 2G25A 5IJ9A 3KV3O 3LAWA 3HBMA 3FZQA 4QGGA 1V9SA 3NWJA 1KSFX 1TVMA 1OGIA 1ZMOA 3RRBA 4TMKA 2LWIA 4MAMA 5KFFA 1FVOA 4RJTA 3ACDA 3JSXA 4TTJA 821PA 3ZHOA 3EIWA 2A30A 2DYKA 3QLVA 4LVCA 1KI2A 2B4QA 2EJVA 2F8MA 3ETHA 5BO5A 2R96A 1J20A 2AR9A 2I7VA 1L5RA 1RD4A 1ULUA 2NVWA 1IIRA 2ONJA 3AHJA 4RA9A 2BHTA 2CC2A 3R9XA 4MKIA 3N5CA 2XNCA 4EHAA 1XCBA 1UK6A 1S3FA 2R8BA 3ER9A 1MAWA 2PUGA 3VRHA 3EIXA 1WXDA 3PZRA 1A9XA 3AR7A 1XC7A 3IVAA 3MGGA 1NW3A 4CJXA 3BK2A 4JASB 3ZE2B 1U3GA 3B2EA 4Q0YA 1J24A 4TUYA 3KKOA 3VHRA 3N07A 3V7WA 3OT1A 4P54A 1NQAO 5B6PA 3FTCA 5NULA 2GHTA 3T1OA 4BEBA 5HZKA 4TMZA 1XEFA 2Z58A 3TZLA 1FQKA 3T35A 1QTIA 4M0EA 1PZGA 3W9YA 2YZLA 4A0HA 4ND2A 1HEYA 3HABA 3FB4A 4X7PA 3H42B 5HZHA 2NV0A 1ODIA 1N2GA 3TMAA 5D7NA 1WZEA 2FDCA 4CUZA 2GUGA 1VCHA 1V0JA 3HMQA 1HZZC 1J21A 2I7XA 3CLRC 1Z88A 2V5VA 3BACA 4NBUA 3HWSA 2IHUA 4C14A 1GL3A 1S68A 3EY9A 1OJLA 1UZMA 3DKRA 3FI0A 5JD6A 2IEZA 2Y1GA 3BXPA 3TCXB 4FLMA 3WYNA 2JATA 2XTAA 5JXWA 4F9GA 1BU8A 4DWWA 3ZXYA 4HMOA 4AY4A 4RL4A 1PR1A 2RCNA 3NTOA 4GMXA 1T10A 3CH7A 4M38A 1PD0A 3N2IA 1ZLYA 1B2RA 1XZJA 4DR6H 1UPTA 3E27A 1SY7A 5T3UA 2XE8A 5TMEA 3FKJA 1T9ZA 3TVDA 2PL5A 2OO7A 4ZHQF 3ZJ4A 2CUZA 5DEOA 3DXFA 3FPJA 2BSAA 4OHZA 1V47A 1PBTA 1QP8A 2XGGA 1JYFA 1YJ8A 2DPLA 4X45A 1QZUA 3IHWA 1A2KC 2GLTA 1KO7A 1E2UA 5AD1A 4UUNA 3GFTA 2WNIA 1DQNA 3KOUA 5BWUA 5CX1B 3ESZA 3IKLA 2GLXA 2UZ3A 3BYZA 5DYNA 2GXSA 1YCGA 1T3NA 1NDHA 1U02A 1N25A 1WZUA 5F2KA 1N2BA 1HQKA 2HQBA 3FYUA 4MQEA 2O8CA 4I5EA 5DT9A 1HDEA 5CFNA 1O9GA 2IZ0A 4PGFA 1ZIPA 2BHSA 3TLMA 4Z4GA 5I6DA 3DMDA 1POXA 3FNQA 3E9EA 3GAZA 5SICE 1C1XA 1E20A 2QUZA 4RH0A 4WJLA 4MB0A 2HQOA 1ZAYA 6LDHA 4OLBA 4IDBA 5GV7A 2JEJA 2CXPA 3ECCA 1KDZA 2RHCA 5KMGB 4OQQA 5ILQA 1E5LA 2Y1FA 3P9SA 1YS7A 2ZWVA 1H9AA 4UBOA 2O8VA 1XEWX 5D3QA 2WF5A 4GPD1 4Q47A 2AMJA 5FJJA 4DUZB 2I2AA 5I5GA 3SS9X 1DRJA 3GYGA 4WCFC 2B25A 1ADBA 3V55A 2BYTA 5DTRA 1DINA 3P0JA 3LT1A 5LP6F 3R7AA 3EA5A 1RADA 2XGSA 5CPBA 4BX9A 2YHIB 4QT4A 5CW1A 1SU8A 1QPGA 4KO1S 2B2XA 4IGIA 5F9FA 5HDBB 1V1MA 2B8TA 2BSQA 4HTAA 4B3MH 1TYEB 1G6KA 2R7AA 2DWPA 3M6IA 5BV7A 2ASDA 1YAJA 3VR5D 4R3UC 3EA4A 1ZGBA 2UUAB 4OHCA 3IBCA 3CKMA 3VKWA 3TTSA 3Q4GA 1FQJA 1C2YA 3WWZA 4ZO6A 1FMTA 3B7WA 5I48A 1KFCB 3HEMA 4LF7B 3R6DA 1ENOA 2R00A 3BKWA 5G0TA 5F3RA 2HRQA 4RPHA 1SOMA 1NU8A 5F73A 5KFUA 4R1LA 5IJ9B 3FJ1A 3MN1A 3R3VA 1HRKA 5JQWA 4N8DA 5AKZA 4I1IA 5JXJA 1CIVA 4LZWA 4W7IA 2X86A 2VXCA 3H1EA 4TVOA 1GA1A 1MAUA 3FUVA 1VMKA 2I55A 4K86A 2OV4A 4MULA 1TIKA 4D9GA 3WL6A 4P8RA 1RT9A 5ENVA 4RA9B 4NDZA 4F8YA 3R9XB 1XZ8A 1JHRA 3QIAA 1AXRA 4PAQA 2OXIA 1WXXA 4ZDIA 2K87A 1A9XB 2VH2A 4NH4A 4GXRA 5CLLA 3MXOA 5J2UA 3ITDA 3OUZA 1ABBA 3AFOA 1JAIA 4RAQA 1Z36A 3EBPA 2JZCA 1L5VA 3O2NA 4TUYB 4RV5A 3OT1B 1AY0A 4UMEA 5EJ5A 4Y18A 1NFQA 2ZJAA 4J7XA