2R84A

Crystal structure of purp from pyrococcus furiosus complexed with amp and aicar
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
334
structure length
329
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PurP protein PF1517
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 104
structure length 329
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r84A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r84A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r84A01
3U54A 1IOWA 2I87A 1M0WA 2YZLA 5C1PA 2W70A 2YL2A 1B6SA 1T36A 2GQRA 2IP4A 1BNCA 1VBHA 2R7KA 4MV1A 2W6PA 3R5FA 2Z02A 1KJJA 4DLKA 3ORQA 1JDEA 2NU9B 3TW6A 1CS0A 5FNVF 4EABA 4MV9A 4O2BF 1M6VA 4O4LF 3AW8A 3BFPA 4IWXA 3AX6A 2W6NA 2YYAA 3ETJA 5JVDF 4EA8A 1EUCB 4WBNF 4FFOA 4O4IF 5KX5F 3U9SA 2R7NA 3ETHA 1PX2A 2YZMA 2PBZA 4YB8B 4FU0A 2R86A 3Q1KA 4MV8A 2CQYA 2YS6A 2HGSA 4HNUA 4HNVA 3JZIA 5EZYF 4WD3A 2CNVA 2XCLA 4MAMA 2GLTA 3R5HA 1OBGA 5CA0F 3MJFA 4I50F 3RV4A 1I7LA 1AUVA 4EGQA 4O7VA 1JLLB 4M98A 3GLKA 2R82A 2NU8B 3RFCA 4QSHA 1DIKA 3HB9A 5H80A 5J2UF 4YBZB 4ZQIA 1UC8A 4ZI7F 5DMXA 3WO1A 2NU6B 4YJ3F 4E4TA 5C8YF 3TIGA 4MV6A 1EHIA 1KEEA 4FFPA 3GIDA 2YZGA 1GSAA 2GPSA 2R87A 1DV2A 5CA1F 5CB4F 2VHEA 4FFMA 5K2MA 3N6RA 1A48A 4MA0A 4Y8VB 4ZOLF 2I80A 5LP6F 1PK8A 1Z2NX 3LWBA 4IZOA 4HR7A 4TV8F 3MWEA 2GPWA 2GQSA 2WYOA 1OBDA 1W93A 3BG5A 2P0AA 1EYZA 4O7ZA 3Q2OA 2CNUA 4FFLA 3BSWA 1CQJB 4FFRA 2V59A 4XYMB 5C1OA 2XD4A 2VPQA 4M9CA 1KUTA 2V5AA 2NU7B 4O7YA 4O4HF 2I8CA 2VR1A 3G8DA 3UFXB 1KJIA 5J2TF 2W71A 3VA7A 1UC9A 1E4EA 2V58A 2FP4B 3VPBA 2PN1A 2X0SA 1KJ8A 5HBRB 4DIMA 2YRWA 2DWCA 4FGRA 2HJWA 4O86A 5IYZF 4IWYA 2FPIB 3KAKA 3BSYA 1EUDB 1GSOA 2R7MA 2DZDA 5BPHA 2W6OA 3OUUA 4EGJA 4FFNA 4HNTA 2PVPA 3WNZA 2QK4A 2YZNA 4O7WA 3HO8A 3BSSA 1WR2A 4EG0A 4TUYF 1KC7A 3DF7A 5JQGF 1IOVA 2FPPB 3KAJA 5LA6F 4IIJF 4I4TF 1BXRA 3OUZA 4HQ6A 4XZ3B 3U55A 2DIKA 2FB9A 4O7LA 4O4JF 4NYEA 1B6RA 1GLVA 1JKJB 4ME6A 2OLSA 2QF7A 3LP8A 4M9UA 2DLNA 3VMMA 1Z2OX 3TIIA 4XX0B 4O83A 3R9RA 2FPGB 3RV3A 4FE2A 4YJ2F 3R23A 3TINA 5LXTF 3VPCA 5JH7F 2W6QA 5LOVF 1I7NA 5BPFA 1C3OA 3V4SA 1GSHA 1EZ1A 4M99A 4L1KA 2R6FA 3SE7A 4MV3A 4O7RA 1KBLA 4EA7A 1ULZA 4O7TA 5CAEB 3ORRA 3JRXA 5HV6A 4RZQA 4J6EA 3KALA 1Z2PX 3K5HA 2SCUB 4O81A 3VPDA 3R5XA 3JZFA 1KJ9A 1C30A 2R85A 3U9TA 3NUAA 2ZDGA 3HBLA 4ZHQF 3VOTA 1JDBB 1SCUB 4TV9F 2Z04A 3K3PA 4GGMX 1A9XA 5KKNB 4EA9A 2NPOA 1CE8A 2YWVA 2YS7A 1VBGA 2YRXA 2ZDQA 4MV4A 2R84A 4MV7A 4O7NA 3KREA 4YAJB 3RUPA 4O7SA 3I12A 3WO0A 1E4EB 2NUAB 5I47A 2W6ZA 2YW2A 4I55F 1CQIB 3K5IA 2C00A 4O82A 3MWDA 1VKZA 4O84A 4EAAA 3TQTA 5D8DA 1KJQA 1M0TA 3JRWA 4C5BA 1GGOA 2R7LA 2VQDA 5LYJF 2CNQA 4XYLB 5GONF 2J9GA 4MA5A 3E5NA 5JVLA 4IHJF 3N8DA 4O2AF 4C5AA 1DV1A 2W6MA 2ZDHA 4YAKB 1W96A 4C5CA 3V4ZA 3G8CA 3QFFA 5JQWA 1AUXA 2CZGA 5BMVF
chains in the Genus database with same CATH superfamily
4CG3A 4M7PA 1REQA 2XCUA 1QSGA 2GCPA 4K3UA 1JJIA 2QBYA 3AUTA 5HIKA 1L9KA 3DMDA 4MV0A 3TD9A 4HNRA 5KS2A 1N9GB 3G68A 3EGDA 4L3VA 4RIEA 1M6VA 5LBIA 5JTUA 1USUA 1C9EA 3GYBA 5IDWA 1SPXA 5JVDF 1KS9A 5G2OA 3OKFA 3MMZA 2QMZA 1Z6QA 5AM0A 4FKBA 4ZMRA 4BNNA 1JFVA 3MG9A 1SUEA 5ALQA 1W1IA 4RA6A 2EU8A 4I8IA 4D45A 4YT2A 2J3QA 3KZKA 1TOAA 4X1OA 4BX9A 3PNYA 1VRVA 3JPYA 2WIKA 2C29D 5JHHB 3I73A 5ED0A 3JATB 4NENB 3EZLA 2G80A 2B7LA 3D7KA 2Y0PA 2G6BA 4C2MA 5DEIA 4BX8A 4URXR 3C45A 3OM1A 4BTLA 4KDCA 4GNKA 1E6MA 2GLTA 4HGRA 2GCOA 4AROA 1JLLB 2BI7A 2OV4A 4RLSA 5EWJA 1WUJS 2E82A 3I2GA 4NCXA 1KFCB 3JVEA 3PDIA 1C2YA 1EFTA 1IBRA 4LC9A 1DDGA 1G3MA 2EJ3A 1I2DA 4KE8A 5HGJA 5BRAA 2EW1A 1Q0LA 4DEVA 3FDZA 4APMA 1EVYA 2QT9A 4ED1A 3NKVA 4H3SA 5ADHA 2V97A 3ZXUB 4J3NA 4WBNA 1ORVA 3B3QA 1P29A 1RQNA 3O75A 5CCXA 4G0ZA 2OHHA 3JD3A 3RGZA 1E7QA 4WKOA 3MK31 4IRDA 3FR7A 1DRUA 3TF5A 4EATA 3T0FA 3VKGA 3RGGA 4DNXA 3RIXA 1U3FA 4E1VA 3A70A 2J33A 2SKEA 4CMDA 4UM5A 3SEAA 4ER3A 1M34B 1L7AA 4A73A 1JJAA 1WUIS 2AOTA 1QFSA 5JUMA 3BWEA 1WWKA 4JWTA 3RRYA 3PNPA 3M70A 4KPEC 2IHJA 1YZNA 4EIWA 5KFJA 1OWNA 1LDMA 2AC4A 3O8QA 5U1PA 1RJDA 3WLMA 3LX5A 3O47A 3T1OA 3RD5A 2YZNA 1FP4A 3GGOA 2EBHX 1DOHA 4RYLA 1XRQA 1JVNA 3SNOA 5BO5A 4DA0A 1HBJA 1ZQ1A 3VKWA 2G71A 1C7ZA 5C5JA 1Z4KA 3OX2A 2XUOA 1WKCA 4MW5A 3BK7A 1LLUA 3DVRX 4X1IB 1JFFB 4NULA 2CLMB 3UYLA 4L8WB 4KFTA 2B2XA 4O1HA 4Q9DA 3FDJA 4QWMA 1Z7BA 5FPHA 4M87A 3RUFA 4MUFA 3KQLA 4IDAA 3V6HA 2CUKA 4TQSA 3LHKA 5A1TA 1P3DA 1KMHA 2QG9A 4C30A 5FADA 2XWBF 4K8RB 1M2WA 2DHEA 2CZQA 4XM2A 1ZH2A 2RGBA 1FRFS 1Z2PX 1VL2A 2XMQA 3JRNA 1U7XA 1KC1A 4FJ2A 5KFXA 4R9SA 4B0PA 2XZPA 2Y68A 4G5GA 5KFGA 4CCYA 3VYUB 3FGOA 2XUHA 5GJBA 1NQ5A 1RYBA 1J42A 4DR7B 2QR3A 4MIOA 4DRZA 3U3MA 4MR8B 3OOSA 1YS7A 1GPWB 4BGVA 2OCPA 2RC6A 2LIPA 1PUIA 2J7PA 5C8DA 2JA1A 2GM3A 3SE0A 3TQTA 3JQQA 5JSKA 3I2HA 1IG0A 1QRTA 3ESXA 3SXUB 1SHLA 5EJ9A 2QZJA 1UK8A 3LOPA 1K6EA 1BXRB 5K51A 1NXPA 3TZKA 3IBGA 2XTNA 1QGYA 5ALYA 5BSKA 3TSOA 2DPHA 2C3UA 3G2LA 1YVDA 2D0PB 4IXTA 3IQDB 2I87A 5EJ7A 1JEDA 3L84A 5CP8A 3GAMA 4Z9YA 3VR6H 1NKSA 2RKWA 7REQB 5CH5A 4ESOA 4E2WA 2HLDA 2ZCVA 1ZA2A 3HOZG 1MFZA 3AIMA 3C3AA 5JBNA 3F73A 1ZGAA 4A1FA 1T5BA 2QX7A 2XDQB 3HE3A 4BQSA 1C9JA 2Q2UA 1PJSA 4HQ0A 4F4UA 1CP3A 3KOYA 2HI0A 4BPRA 3TMAA 1U0OC 2XYHA 5IH7A 4UCQA 1N32B 4FD3A 2Q3CA 4J0IA 2X6RA 5FUYA 1GOTA 5AXBA 1JALA 3PIIA 1ZJ4A 2V9WA 7ADHA 4BS9A 2BISA 4HDMA 2R8YA 3UXYA 2C03A 3JQ7B 4YRSA 4EFEA 4UU8A 4CM4B 3GLKA 1DC7A 5JECA 2RHLA 4TLDA 3EDQA 3HB9A 1AZSC 1KF0A 4U00A 3T61A 4EKDA 4HAVA 2GH1A 2W9AA 4G2NA 3EXAA 1JQDA 4A27A 1FFAA 2IEGA 2LCFA 4U02A 5FBHA 2R1UA 4O1IA 1J0CA 3E48A 9GPBA 4UD2A 1DKRA 5AOAA 4CEJA 1YBAA 5T4FA 4B3JA 1J97A 2IF0A 2H8KA 4BZXA 1MJFA 1N9KA 1VMAA 2X41A 2CFSA 3TTYA 3PKIA 5IJAA 2Q8PA 1Q1ZA 3WMEA 4KXWA 4LF7B 4OFXA 1NVTA 2I78A 1JPJA 2RGUA 2QTNA 1KKLA 4YMGA 3IVMA 2PU5A 1TVEA 2W4IA 3H99A 1YS6A 3A6HA 2H17A 4UU7A 4GBMA 5IJ9A 1YCGA 4UUMA 3UAVA 1TCUA 1B76A 1IL0A 4DR2H 2BE7A 1X0XA 1AHHA 3OKPA 1XEAA 2SHKA 3QU9A 4ERXA 3U4DA 3RR5A 2B8EA 3E4CA 5IMSA 3BSYA 4I6JA 3NAQA 4Y6PA 3A4NA 3C1OA 3BB4A 1TLTA 2PVPA 4AG5A 3ADPA 1IHYA 3INNA 3B6JA 1DQZA 3DMFA 2Z2JA 5K8TA 3USCS 4LGYA 2RHBA 3TDNA 1KAMA 1ZM2A 2YQZA 3V1MA 3P9YA 5A6SB 2XCTB 5JDIA 1K6IA 2D0DA 3PC3A 3MT7A 1M0SA 2VZEA 2WD8A 2GZMA 1SELA 1YWGO 2ZZKA 2CKMA 3N2KB 4D9MA 1PO7A 1AURA 2YY6A 1JI0A 4MWOA 4OREX 4AJNA 3HR7A 5LOVF 4DL5A 4KQ1A 4ZK2A 2VNJA 1RXWA 1R74A 1RLTA 4R5MA 2WVJA 1KBLA 3ANXA 3FSGA 2SCUB 2V7BA 1SVNA 1N6KA 1OU0A 5KFEA 3NHFA 2IBKA 4UVHA 2RGDA 4RTMA 3N6XA 1K3UB 3KJGA 4M37A 2Z3VA 4GXTA 2PGIA 1QPZA 3OX3A 4LJ5A 4HGPA 1VHLA 4ID3A 5BT9A 2RDJA 5MN5A 1POXA 4CR6A 4ZT7A 5B1DA 3ROMA 4C20A 1Z6GA 3N87A 3MWDA 3HJUA 2OCLA 3EQ6A 3REFA 5E95A 4JNCA 4LRUA 3L0IB 3E8MA 1LBQA 2YKGA 1PFGA 3PVCA 2AR9A 1PDOA 2V4QA 1S3FA 4X20A 3RWMB 5EMHA 2XQGA 1J9ZA 2KPOA 4ANFA 1K3TA 2ZU0C 3EIWA 2I54A 2YXLA 2JBAB 2ZIAA 4DV5H 3TSAA 3DOJA 1Z2DA 2R6ZA 3EZYA 4PTLA 1QNFA 5DE3A 3S2YA 1Z15A 4CM8A 4NARA 1QAOA 1S8NA 4ARSA 4RB1A 1S1CA 2POQX 4C0JA 1ULTA 2BFCA 4D8YA 4MX8A 2FZ5A 3HBAA 3ABZA 4YCMA 3K16A 1X7XA 5DG7A 4A4DA 2ZB4A 2GCIA 3H5AA 3TOCA 3K70C 2AKEA 3WWZA 1JJVA 1QYWA 3CZRA 3N8HA 4IWXA 1UJMA 3C5CA 2NU7A 3OIDA 2VXYA 4MS4B 4GHWA 5K3SA 3MERA 3DZKA 1Y33E 4BVBA 4DM3A 2R8BA 3PNKA 4DREA 2I6FA 4JYPA 3FMAA 2WRZA 3VU1A 3U19A 4YCJA 4G1FA 3MLBA 1E8MA 5JDCC 4UHEA 2WB2A 2HK9A 4V3CA 3SXPA 5FPQA 5HCUA 3EB9A 2RGWA 1C7FA 3SOPA 2P2CA 5GTDA 4OX9Y 3TAUA 4WEQA 1PVVA 3QYFA 1BMFD 3M2TA 2C28A 3I39X 3W2HA 4F2HA 5K8VA 1E69A 4QKQA 3CZQA 2JFUA 3FNEA 4YXWA 4J43A 4XJTA 3GAZA 5IAKA 4LRYA 4LZZA 4G1CA 4JXUA 3WMGA 1NV8A 4Q37A 1H22A 1DELA 2BCGY 3H8VA 5CAEA 4M86A 2DLDA 1KOFA 3GLHA 3O8LA 5LCXA 1NIJA 5T4BA 3I6BA 3BRWA 1NNUA 3K9WA 4GVPA 3MF4A 2A0WA 3BXGA 4GW3A 4I9FA 4LSXA 3JQAB 2ZSHA 3LFUA 1JG4A 2NZ8A 1EFRA 4BNGA 1YRWA 3RVDA 5FLEX 4OLAA 2FPMA 3QFTA 3WLIA 1Z6ZA 2WU8A 3PFWO 3NDBB 1XX6A 4F1JA 1UPAA 4BJ3A 5IW8A 1JXAA 1PNQA 4HD8A 3UJNA 4QDUA 4Z53A 4RB3C 3ETDA 3WAGA 3B5JA 4JB0A 3LCMA 3W8FA 1TO6A 1XJQA 2AQ4A 5JZVA 2IUYA 3F3SA 5AHWA 4K81B 4H6WA 3LQFA 1XPJA 2A84A 2ZZMA 4M7OA 5BSRA 2M1XA 4JYCA 4L3WA 1V45E 1T4MA 5BWCA 1G2IA 1US8A 3M49A 3B8HA 2QAGB 4IUDS 1V3VA 1E0AA 3UAZA 4C88A 3TFQA 2ZUDA 2P2GA 4K05A 3A58B 4C4TA 5KNCH 3TKLA 1XTRA 4O4IB 4JU9A 1MJGA 5F9MA 2AOUB 3KJEA 4YRGA 2UZIR 1I32A 1SWWA 2X5XA 3SDBA 1NW4A 4LFAB 3LRPA 2BGRA 1QWOA 4JQZA 4CNBA 3CZ4A 1IAVA 4FZ5A 4KL8S 2CNDA 5KYXB 1PG0A 1FK8A 2Y8EA 4BZPA 1GA6A 5EJMA 4U2KA 3NYWA 1Y5LA 4M1QA 2YRXA 3LE8A 4J1SA 3RS7A 1XNGA 2ZPUA 4M1EA 4ZWNA 4URHA 3L02A 2W22A 2EZ4A 3WO0A 2YYYA 4Q0MA 4G1VA 4WLVA 3Q0EA 4LJ7A 1B2LA 3W8RA 4UXJA 4PO8A 2WSMA 1FQWA 3MQ2A 2W58A 4ISBA 3UUWA 1OPRA 2D0IA 1TQ8A 2G40A 1NRIA 4Z5XA 4FNAA 2GPNA 5FYDA 3UXHA 5KFUA 4ZVVA 1VJCA 4FE7A 4DR7H 1J8FA 3BEDA 3LX6A 1RCTE 1IEQA 1AKQA 4UMVA 2FE4A 4ZJPA 2JA6A 3MTDA 3ZY2A 1C29B 1DFHA 2IW1A 3CUVA 3EIOA 1USWA 4QIWE 1EBBA 1SUWA 2HNBA 2VNHA 3R5JA 1EGQA 2ZT7A 1SA0B 4A6XA 2BMFA 4KXYA 4GLBA 1U2DA 4RVHA 5EKTA 1KIFA 4YAGA 3KXKA 3QK7A 2VRCD 2W7PA 2WAOA 5EIOA 2IY7A 4I55B 3OF2A 2Q2NA 3OWOA 1HOTA 1XVUA 2WDPA 3HN7A 4BQRA 2BTEA 3SNKA 3AI2A 1TQ6A 4KN9S 4R01A 2E4XA 5K3CA 2AF3C 2ZYHA 3NDIA 1RI2A 3M6VA 2RHCA 4ZAGA 1CS4C 4GDMA 5AK4A 1WKVA 2C58A 3MSXA 3JYPA 2FSIA 5F7XA 1WHSA 3COYA 1D2EA 4L0CA 1H4SA 3B6ZA 5KFPA 2RKOA 1N32H 1DAKA 4QWCA 2YWGA 3KTMA 5AIBA 3LS2A 1DX9A 4KYIB 1A71A 1AOXA 1JDZA 4LKRA 1Z0IA 1HK7A 1R2QA 4GYJA 2PD4A 5EYPB 1JJ7A 1PJLA 1OLUB 4U2GA 2YXEA 5E38A 3MJSA 1X80A 4KU4A 2P40A 4C78A 2R44A 2OG2A 3E7XA 3LVQE 1JWLA 4E2FA 2V6MA 1W30A 4HR7A 1BD3A 4QDXA 4PICA 2VC2B 5BY2A 3L06A 2QXYA 2W6IA 1V6AA 1E3WA 1E4OA 1HR0B 2OG1A 2QIOA 4BO2A 3D3NA 3KB8A 4GM0A 3W9UA 1HDYA 4GZLA 3D8SA 4EUNA 4QYSA 1K08A 3KSUA 3KWJA 3BBLA 1QYRA 1V5GA 3C3MA 3PDCA 4MQ6A 5J2UA 5DXFA 1T10A 3FYTA 4Q05A 1I2KA 3KFVA 5ES4B 4NICA 4LF7H 2N3ZA 3ONFA 5DXJA 2DZDA 4H7IA 4O8ZA 1RE1A 2IU4A 4NHOA 2IUUA 2ZQYA 3IMCA 3Q0TA 4FWBA 2XNJA 1GUFA 4KHZA 2XRZA 4KNVA 3IAUA 5D00A 3LTNC 4L95C 2HDHA 2CDRA 1S3IA 5ARBA 1DDIA 4RHUA 2Z1DA 3OJCA 3JAKB 3F8NA 3SZMA 2QQFA 4FFVA 1PFVA 1OFVA 2Z4TA 3DAYA 1GPAA 3VMMA 4AJHA 4R9VA 5H9VA 2BTQA 3EWSA 4AICA 5L1KA 4YMWA 3RANA 2PL9A 4M0JA 4D8UA 1EIZA 4NZ9A 1JB1A 1GKYA 4YECA 4DZTA 3IIIA 3N59A 3BERA 3OTGA 4OMFG 4RZQA 1G2PA 1UKEA 2UVVA 4RJ2A 4LUCA 1BG6A 2HSDA 1E8NA 4EVIA 1IEVA 3FZNA 2HA3A 1OX5A 3PZBA 4PY2A 5REQA 5BV1A 3QVOA 4MUNA 2BQUA 1JXQA 4UCWA 3NVMB 1WZCA 3UJ3X 4EZBA 3UK6A 1GL9B 2VSNA 1II8B 1NJ5A 1XA0A 3H2ZA 2C97A 4EM6A 3UUGA 3CIFA 2UVPB 4O4JA 2HA0A 3JSNA 2CXQA 3WGOA 2WKPA 1JTFA 2WT9A 1AF7A 5ITZA 1AKMA 4ZJUA 2JS7A 2ZBVA 3UC9A 3Q8LA 4Q12A 3DMTA 4CL8A 2H1LA 1HYHA 5IBQA 4P35A 4TGLA 2Y66A 1TGYA 2WNIA 2NQ2C 4UTPA 4JB3A 3LO5A 4F8YA 3VAZA 1SQGA 2BFFB 2P3LA 4AYBA 4BAZA 5KOIA 1U6KA 2GN8A 4CTOA 1PZGA 3C7CB 1SKYB 3N76A 3A37A 2RBGA 4M83A 4M8NE 3T4UA 5BR8B 5TT0A 4A5SA 4CTKA 5ABPA 4DGQA 1LJ8A 4RD2A 3O4RA 2DUNA 4NJEA 4YA6A 2LGJA 5T41A 1YJQA 4MPDA 4FXOA 4C03A 1TQHA 3R3VA 2B2CA 4LC1A 4CUKA 5IYZB 4DL4A 4C7OB 4TN5A 2PCJA 3ILXA 1S2LA 4JUIA 3WRYC 4BNJA 4TMTA 4MKFA 3S1AA 3M9LA 3KQUA 1E58A 5JSZA 2AJCA 4MW1A 2WZCA 4KRXA 3NT4A 1PX0A 3KIPA 1XCJA 1Z7YA 3PTLA 5EE9A 2XMRA 1E2GA 4Y2RA 1UBTS 3BHIA 3GUCA 3QX9A 3CPEA 4P5EA 5IKEA 2IT1A 1XRLA 1OE0A 4MS1A 3DV9A 3IT3A 1GGKA 1VDMA 3T4EA 4PLWA 3U16A 4BNDB 2BSAA 2NU8B 4CGZA 1OYVA 4DJAA 2Z1NA 3MB8A 1G8PA 2PGJA 4BX2A 1JAIA 3MTBA 5KMGB 3EXFA 3UWKA 4O2BA 3CF4A 5HIIA 3HUUA 1LSOA 4YJDA 1O95D 1R0BA 1ECGA 3X0DA 4GX1A 2XPCA 3KL4A 2PL1A 3UGQA 3JYNA 1LF5A 1I7SB 4FS2A 4RX1A 5DTEA 4FSHA 2HLHA 3CO0S 3QKRA 5L7TA 2CFOA 2DWUA 5FUWA 1GILA 2YOFA 3RUIA 1KZYC 3D3QA 1UMCA 1R6DA 3PUWA 3EZNA 1FMCA 2H4FA 4V02A 3U7GA 2IHZA 1H0RA 4M0DA 3WNBA 1MO5A 2QXUA 1W0CA 4HLUA 3LL4A 4X3PA 1E4EA 3T5GA 2FP4B 3ZY3A 4HDAA 1ZK4A 5IRCD 1SUIA 3UJCA 4O86A 2K2QB 1IB6A 1T35A 2BFEA 3H86A 2XJ4A 4L9SA 3KB1A 4MR7B 4TTVA 3ASUA 5AR1A 1GTVA 3GVCA 5JRDS 2FX3A 1IEWA 1WMEA 1DTEA 2N9UA 4NMLA 4AJPA 2XT9A 3Q40A 4DT1A 1QONA 3N0VA 4DYHA 3E3NA 4ED8A 3PB3A 3L01A 2VRWA 1KP2A 5CNIA 2ZRIA 3GJQA 2OLSA 5I48A 3OA2A 1SXIA 4AMBA 1XZPA 1Z74A 2XGSA 4BVJA 1S8OA 4B3GA 4Q6WA 3HG7A 1Z4JA 3DO8A 4X61A 4L1KA 5DNCA 3ADBA 3EBOA 2DBYA 2BY4A 4Y0VA 4PNZA 4RPJA 1VLZA 1BCSB 4WK2B 2MSLA 2IYZA 3LUFA 3QPVA 3TQQA 3R5XA 4UTNA 1RWOA 5A3VA 1LWOA 4OXNA 1C3VA 4W7IA 1Y7PA 4DSTA 1EP2B 3PI7A 3N0RA 2RHMA 1G63A 4OKSA 4Q93A 3H2HA 2BZ1A 3G0DA 5CX1B 5CH8A 4EKGA 5DW0A 3MFQA 5CFNA 1GU1A 4M7EA 3FJYA 1GCAA 2GFIA 5DXAA 1YDEA 2Z95A 1XZCA 4R7TA 1Y6ZA 4PSAA 2GKGA 5K4GA 4R1UA 4LXGA 2XVMA 2C83A 4JI6B 1TK3A 3AHCA 4FOSA 2WR8A 3ZVLA 1W76A 5AVWA 3GJSA 1T6XA 3MB5A 2J6CA 5TQ0A 5CDGA 3CLRD 4B4UA 3IRVA 5BVHA 1NUHA 4RE5A 1ODTC 3OZEA 1IN6A 1IH8A 1Z39A 4Y0AA 2HNKA 3GRAA 4NL4H 1R4NA 4U9IS 4CETA 2ZUTA 3JW8A 2XVAA 4H7HA 5FNVF 1UFVA 1SZCA 4REQB 4BMOB 4EI8A 4BWSC 5BQOA 2CL6X 3H19A 1NW9B 5JASA 2V7QD 4KJXA 1V9PA 2AJBA 1TB4A 3KYDB 2CD9A 1J9EA 5C5IA 2WIBA 1NVAA 1PEYA 2IU3A 2J9FB 3FIJA 1FNCA 1J8MF 1S2GA 3CLRC 1A96A 1J0EA 4KWTA 5JQGB 4BEJA 4UCOA 5AKIA 2C04A 2IFTA 2H29A 3LY9A 1ZLYA 3KOUA 2JAUA 3HEAA 2VA8A 3COWA 2H1CA 1L5FA 4QPJC 4Z4EA 3WHLA 3I2JA 2XBMA 2NSLA 1K66A 3GIIA 4F2GA 1KIAA 2XX3A 3WWPA 4C4YA 3CUWA 1U2EA 1Z45A 2F8TA 3MMPA 3B2EA 4P4UA 1SCQA 4I7EA 2ZCJA 5IJWA 1C3LA 4BU0A 4WXEA 1ZXLA 3HCDA 3HBMA 2AIRA 3ZV5A 1NA5A 1CU1A 3EAFA 3COPA 3PQ7A 1ODSA 3VZQA 1WUYA 2H1VA 3OF3A 2FSPA 2WAQA 2E4VA 4ZOLF 3AM1A 2D06A 3WHIA 4V0RA 1Z2NX 4URZR 1TCCA 3UWOA 3AF1A 1AY0A 5JR3A 3NONA 5F9NA 3F8WA 3W77A 1GHTA 5DIFA 5ALTA 3V7WA 2YICA 1ONOA 3QQ5A 4BVGA 4P0QB 1U0SY 4AG6A 4OEHA 3DNFA 2FF7A 3DSRA 1T9BA 1UBHS 2PZFA 3GJZA 1ADGA 1ZEJA 5KOYA 4NAVA 3X44A 1I3MA 3UAGA 3WGTA 3CX4A 3H1AA 2WKRA 5KFLA 3QF4A 1UBGA 1EAMA 1RAIA 3RB6A 1FQKA 3KUXA 4MYRA 4Q7LA 2OK7A 2ZYTX 2LKDA 4QU8A 1HR0H 3ESRA 2A3RA 2GLXA 3MJTA 1E4YA 3ZPXA 5JCJD 3S8MA 3ICCA 3NHMA 1IK6A 3RF7A 3CO5A 2B0CA 1Z6YA 3LUJA 2PKQP 3AJ8A 3MFYA 4ED6A 2V54A 1R6TA 5ITSA 4RLQA 2DABA 4BO7A 2X0RA 4WOJA 3WX0A 1ZCFA 4YV2A 1WF3A 3JAMW 1JEAA 2QN8A 1J8QA 1G21A 1ZGJA 3M4ZA 5DT2A 2X0IA 4YAUA 5IXYA 3TIFA 4ND8A 4DL3A 5CM0A 4FE2A 1B0PA 3HM2A 3TW0A 2RGXA 4EJ2A 1L7NA 2W7OA 3AEKA 4F5ZA 1X9GA 1TFUA 4AKSA 2XKBA 4GRIA 2FV8A 3N7TA 1X15A 1UM9A 4PLHA 1SC3A 4V3BA 5FXMA 2OBNA 1BKSB 1YMUA 4DXAA 5EJ8A 3NBYB 3UJAA 3MS4A 3WTCA 2ZYIA 1JDBB 2HF7A 3MQFA 4MV4A 3PN1A 1TC1A 1TM5E 2YCHA 2WJYA 1TM4E 3K92A 1XLTA 1IC6A 3GOQA 1TTPB 3JWHA 3R24A 3AR8A 1WBJB 3ZWOA 1LPNA 1U7OA 4JHLA 4ZCRA 1ZBDA 4GMFA 4Z2AA 4IIHA 3EYWA 3CS3A 3CVXA 3UCEA 1OZFA 3E6AA 3TXAA 3GX1A 3P52A 4N3GA 4R6XA 2VHUA 2X8JB 4E5KA 2JJYA 5IM4A 5ENZA 1F6BA 3SP1A 1JIIA 1EVQA 4LV8B 4BBPA 4EBFA 5M29A 3RAFC 3K4HA 3SDZA 5BMOA 1L4HA 1Z3IX 3ANSA 2H7CA 1UODA 3QOXA 1C7RA 4CEIB 2FA9A 1ZD3A 1LQUA 4PSUA 1P7WA 3CRVA 5DOZA 3LBIA 3QVKA 2QM8A 4FBUA 3U54A 1B3BA 3L5KA 1TWCA 3N8NA 4B7AA 2GBGA 4NQRA 1Z8DA 5HUQA 3H1EA 4DL6A 1ZHHA 4KWIA 2VHXA 2Q7DA 1ZD4A 3UAWA 3NDJA 3IEPA 2W83A 2OBFA 4TWAA 2OAEA 3IDAA 4UJ5A 4IMRA 4XQ0A 2C7QA 4NZMA 4CCSA 2WJPA 1QGUB 5DPMA 1IOZA 3U6KA 3AESA 4K9SA 1W49A 1UP6A 3AG5A 3SYNA 2HR1A 5BR8H 3ECCA 3WQQA 5I5YA 4BQOA 2ONYA 3R77A 3C24A 4PLVA 4RULA 4J94A 3A9SA 4U9HS 3LKZA 4CT4B 3NIGB 5ENDA 4QGFA 4NOKA 3DOCA 1OI7A 2JL1A 3T1TA 2AOVA 4EKIA 4Y6RA 4HSGA 5COAA 2DFVA 2P69A 2WM2A 3SSOA 1ORWA 3WQSB 4L85A 3ICWA 1SGWA 1U3UA 3GLGA 4AO6A 2FR8A 3B1KA 1DZ3A 1V9CA 2GF9A 4IUBS 1JKJA 4EG6A 3DLHA 4X1KA 1FW6A 1P2SA 2WFAA 4C1BA 2PQ6A 3OECA 3KHRA 4F2DA 4YR0A 3RUEA 4YCBA 5LWHA 4O63O 4PAQA 4PEVA 4RLHA 2ODPA 4GUDA 3T1NA 4G67A 5I60A 2AQKA 3CE9A 3HUDA 2D4AA 5AHXA 2B3TA 5JCOC 4BJ5A 4F9GA 2HSJA 4P4LA 3QP9A 1W581 1GPBA 5IP7G 3ENWA 2ZPTX 5ESDA 3TLCA 2O2HA 2VYVA 4I2NA 2WWWA 4QBKA 3HABA 5T67A 2C4KA 3W2FA 4QNNA 1UPFA 4PO3X 1LQTA 2JGLA 1SQ6A 2H1SA 5AIAA 4NE2A 3TWOA 3NWJA 3AO0B 3GHHA 4BV3A 4OXRA 3OAAD 3MILA 4GU5A 3G02A 1Z2EA 5ISMA 5IAAA 3EF3A 1UEXC 1GSOA 2AU0A 1WMSA 5BPHA 4RNNA 2JLYA 4D9EA 2R3SA 4PLTA 4YR7A 4YJGB 3B82A 3L7KA 1DCTA 1O94C 3BK1A 1WXFA 2WP8J 1D4FA 3RSFA 2Q28A 4TV8A 3GN2A 1DXQA 1ZGBA 4M7WA 5HMMA 4FFDA 1X7YB 3X3HA 1MD9A 2COGA 1F2VA 5FHRA 3BH6A 5HQTA 1NMXA 3EFOB 3GLHE 1KE2A 4CKCA 3ZE9A 1GPLA 4YJ2F 3THXB 2ENWA 3STYA 2DKNA 4Q9KA 4C05A 2Q9BA 3QQMA 4K1XA 3JARB 1JHZA 3HC7A 2XB4A 4MPRA 1EVLA 2H9YA 1MOQA 1T43A 5JSFA 4QDKA 3EXHA 1ZH8A 3HKCA 5E4YA 3ONDA 2UZ3A 1CRLA 3FHJA 1AK1A 4ZQEA 5CGQB 4YX9A 3OZIA 2BEVA 5LYJA 1OAKA 4ECAA 4UXHA 2Y67A 1X19A 2AOWA 4FD2A 2PZ8A 4BMVA 5B2EA 4FINA 3FWYA 3T9FA 4TKMA 3RU3A 3OIWA 3RAGA 1EE1A 3F8TA 2PM8A 1ZJWA 3IKJA 1CNFA 3WK4A 4PN7A 3WS7A 1JZQA 3GTQA 1ULBA 5ILQA 2OXTA 3TKAA 4ECQA 1ZNYA 4MI1A 4MA5A 4LY0A 3O2QB 2IHNA 2QRKA 1R66A 1VSVA 5KQMA 1AXEA 3URKA 2GD2A 4IZHA 4UKDA 3A32A 3K53A 2QVLA 4PO1A 2AYZA 3ENKA 2UU9B 3B20A 2ZSFA 2C5EA 5D5PA 3WP1B 1AKRA 3R7WB 1A4RA 1DAMA 3HFGA 3I05A 4BNXA 3D59A 3C6KA 2PMKA 5ER6A 2C84A 2SKDA 2OLKA 3O3MB 3DCYA 4FWTA 1FVIA 1RADA 2V7WA 1QGZA 3W3ZB 3W04A 2BCJQ 2PG3A 4ZAFA 2V0GA 4JI6H 5J4VA 1WB6A 3R74A 3WGZA 3A9VA 4EHFA 1OH5A 1UBCA 3EPIA 3SSNA 5CT8A 2HVQA 1GWNA 2R4TA 3RBDA 4QPCA 4IPTA 2IODA 5JNWA 2H48A 1U0RA 4UMEA 3V1YA 4C06A 2VDMB 1N0IA 3ZDFA 3U9SA 4I9NA 3SEQA 5CDHA 3DBIA 1U1GA 1FMFA 3ITNA 3SQWA 5HKBA 2WJZB 5HBRA 4INAA 5JW6A 5TMDA 3VZSA 4F4HA 4UULA 4URVR 3K35A 4KAFA 3RODA 4EY4A 3AHEA 1M6YA 4PCAA 1EVKA 2ZOSA 3RV4A 3L18A 1XYYA 5EHIA 3G1WA 3REQA 4JT2A 1R3UA 2QVCA 2BMVA 3ZYCA 3TI9A 2L82A 4HXGA 1PT8A 5BUZA 1Z34A 4PV7A 2FVYA 2KI5A 1QHIA 1JGTA 3TUIC 4PVCA 1P2VA 4KVAA 5C37A 3PCTA 4DIDA 1DIGA 4NOMA 2IHYA 3WVNA 2W5UA 4PONA 1ZQ9A 4MA0A 3I0NA 2WHPB 1NF3A 4L0QA 5P21A 4A3BG 4CMJA 3NXSA 1RD4A 3SU8A 4HAIA 2YXBA 5KYYA 5JS2A 3TR0A 2ZSIA 2GM4A 5FR9A 3AM3A 3LHSA 4BFVA 1JBQA 1UANA 2LXNA 5BR4A 4KFSA 2AH5A 1A77A 3AW9A 4KHPB 4J7XA 2Q5LA 2XD4A 1T3TA 3SAJA 4DWWA 5L4NA 2EVWX 4R8RA 2OSBA 3EN0A 2WPDA 3HZHA 1HT3A 5J47A 4HRVA 4FYWA 1FF9A 2DT8A 1W2GA 3QMMA 3EUAA 3A1VA 2PN1A 5A2QW 3Q7SA 4L73A 4DJDC 2GETA 3TMKA 2ZIWB 1U5BA 4MVJM 5HKOA 1UOEA 4QFBA 2W6OA 2XA1A 2ETVA 1VHDA 4RK1A 4FB5A 3O8OB 3HZRA 3R4CA 3RYIA 1CUFA 3E7PA 5EVJA 3RFXA 5AVZA 4LZNA 3N2NA 3OQVA 4K9LA 5L3RA 4IIDA 4IGKA 1TM7E 2COUA 4IIGA 2AHOA 5TF0A 4UCRA 1P9NA 3RF6A 2GLUA 2BGWA 3QE2A 1PU2A 2J30A 5BYAA 1YIOA 3KOMA 2R65A 2WWXA 4BIMA 2VP2A 5B7GA 3VQTA 5ELXA 5AJTA 1XAJA 4O83A 2J1LA 3ANLA 3GA0A 3H7IA 5JCPA 1Z18A 4X6UA 5AKGA 1H3FA 3HLKA 1NBMD 4B87A 1C30A 1YA4A 3BH0A 4RA9A 1EK0A 4K0RA 2J48A 1NVVR 4DSUA 1GU7A 2X0NA 5TVKA 4I9GA 4JUCA 1IBCA 3KHTA 4UTRA 2OFOA 4MA4A 1TJ4A 1XA4A 3ACCA 4KO8A 3WRXA 2WJJA 4YB8A 3HVHA 3PX2A 5EJAA 2ZWAA 2WICA 2I91A 5I7VA 1M2VA 2ZJFA 4BNKA 1U9IC 3I04A 4OXXA 4BE7B 3BA1A 3M1YA 1U7ZA 1HDOA 1QTQA 1CY1A 4D4MA 1THZA 3GUHA 1CUJA 4Y98A 1WP9A 2PZMA 5CB4B 4XPIA 2XR1A 4FLEA 2BFWA 3GDWA 1B43A 3KPJA 1NSYA 4IDHA 3OFNA 2FYTA 3W7VA 3C0KA 1LV8A 3VYSB 3UGKA 1IXKA 2PBRA 3DZBA 1V8OA 4K9QA 2R62A 5B4UA 5DW3A 4O3QA 4BO5A 4KQGA 3NTVA 4DLUA 4PN3A 2G28A 3VJMA 5U4XA 4AZWA 5HFJA 5FO1A 2Y1DA 3B6IA 3G89A 3ZLVA 1P2UA 4F4JA 2VHYA 4S0XA 3QHQA 2R8PA 2I4IA 1MQAA 1KY5A 5JAUA 2CL5A 4H77A 4B3CA 2NSDA 5AYVA 1QLWA 3D6AA 1O0SA 4RKQA 1EUCB 3SF8B 2H8GA 2FMFA 1QJCA 4KR6A 3SZUA 2V5UA 4CQLA 2W8BB 4FYMA 4AB1A 1HRKA 3RTEA 5JEEA 3ZQ4A 2FNAA 2LWIA 3EUEA 2M2IA 3HXKA 2ALZA 2C99A 4HB0A 5KHLB 4IDEA 1U98A 1QYXA 4CN9A 3PUZA 3ZW8A 1X7DA 4QOSA 4D8VA 4YMVA 3MMNA 3NRCA 1ZC3A 4CFSA 2C5FA 2Y0CA 1HE2A 1D7OA 4ZAYA 4QD3A 4NYIR 4BVAA 2B4AA 4AYBE 3B1ZA 4O0MA 4PGFA 4QM7A 1V6SA 5HNKA 4KPUA 2EQAA 3JVDA 4R8VA 2X86A 3NBFA 3A2LA 1HT2E 3K09C 3HKEA 2YRFA 2JRCA 2KBEA 3VU9B 4NHEA 5JALA 2JHFA 7MDHA 2HBYA 2H4WA 4OQ4A 3K9CA 1RJRA 3JALB 4B8ZA 3FYUB 2ACEA 3SLKA 3GZ4A 2VKTA 1XK7A 4A8HA 1TUEA 2K4MA 2OPHA 3QUCA 4HCJA 5A5GA 2NVUB 5JISA 1T0JB 1Y8RB 1MV5A 1X1BA 3B1WA 4FM9A 4TLEA 2QSUA 5EE0A 3TS1A 3K9HA 4XJXA 4LQCA 3PFFA 3NEYA 3V8EA 4CM3A 2UZ1A 4IQFA 4R1QA 4RDIA 4ZJZA 3S2ZA 5EWMB 3T5AA 3U3JA 4AWBA 2P6UA 1OZHA 3EVDA 3QMPA 4HRXA 2HRQA 1NGSA 3WBJA 1HDXA 1P62B 1TE2A 3GMTA 5E2BA 1OZAA 4G63A 4TVBA 1NYLA 3DONA 4GXQA 4KWCA 1GIAA 4KQCA 4XM1A 2VK4A 3I1YA 1ISPA 2JAPA 1NVBA 2HPHA 3K70D 3X1KA 3EWNA 1PS0A 1FU8A 2EFDB 4PG8A 3TL3A 2AA3A 1B73A 4IO1A 2IIPA 4GX0A 5BN5A 5HDBB 4EVSA 2DAPA 2YXNA 4JP5A 1NWCA 2YHIA 3CSDA 3Q7IA 2SICE 3UJ7A 1A1VA 4C7BA 4CHIA 3IIKA 1Q7RA 4OA8A 4L15A 1F60A 2O9JA 3KD2A 4DLWA 1SY7A 4ZT4A 3R5KA 4KTTE 4YRDA 3N0TA 2PS1A 4BTEA 3CLKA 3ORRA 3IE2A 2PS3A 4DM7A 2ZIGA 1FMTA 4BRSA 1U90A 2X4IA 1C7EA 3ESAA 3GIWA 1EUZA 3HVUA 5KYUB 4I46A 3T5LA 3H11A 3RYHB 3OOJA 2P62A 2QM3A 2BELA 5LA6A 2DHRA 2DJIA 4JLAA 4M0LA 3OQJA 5L4LA 4IRUB 4N5DA 1E5VA 1FSFA 4ZAXA 1U0EA 1IMOA 1E5DA 4JEIA 1NOKA 4D9NA 3TQCA 4ROSA 2D2FA 3KCQA 4F6RB 1VHJA 3TTUA 4R8UA 1U1EA 3TRKA 3LLMA 4PZZA 2GEJA 3O8DA 5FTKA 1K75A 3P4XA 4RGVA 1KFKB 1TAQA 1SRQA 3ASYA 3R7BA 4AIRA 2ZYAA 4ZI2A 4HQFA 2BP7A 1BSVA 1C3OB 1HLDA 3DFKA 4Y9RA 3D7SA 3FX2A 2EJUA 3ROZA 4GR4A 1YZFA 2IYFA 1J1ZA 2AL7A 4YRMA 1TYCA 2UU9H 1ML3A 4LY3A 2J8ZA 3HVIA 4F50A 1MLDA 4IAOA 1K8YB 4IJ6A 4GMHA 1QFXA 4XI9A 5KFKA 2IL1A 3EODA 3OEHD 1CY0A 4WVFA 3ZYZA 1WCWA 1S2IA 3A4IA 3IQFA 2WHXA 3A1TA 4F0JA 1Y14B 3TY8A 4R6WA 1MRNA 3WHKA 1W8DA 3NBKA 1PD1A 3CUEF 1QLJA 2HIHA 4JELA 3WGLA 4URUR 5IAOA 1Z25A 1YZUA 3RK1A 1Y7LA 2OYRA 1OIVA 2BJHA 1TCBA 3WO1A 2BW0A 1ECFA 2V7TA 3IP1A 5FWAA 1A72A 3E8SA 4WBSA 1CJCA 2H5EA 1OAOA 3BS4A 3D8NA 1X87A 1LBEA 4DDWA 4LQDA 3JYLA 4DLLA 5D2CA 4O8CA 1XVVA 3WWOA 2ZXEA 2GMWA 1TMGE 5DISB 1U3GA 4US1R 1ID8A 3KEOA 5BN4A 5DK4A 2QSJA 2PRSA 2HZ7A 4V24A 4EARA 4J16A 1SVWA 1QF6A 2CNUA 3H9QA 2BEWB 4OU4A 3IUJA 3CF6R 2J4CA 1FTYA 2NACA 4F3RA 4UEKA 3AEUA 3O1HB 3U1TA 4UFPA 3QPDA 4YYEA 2IHVA 4KYTA 3SBOA 3H40A 4F3NA 5DT9A 2HV8A 2ZR0A 3FSEA 1V4VA 3BJZA 4HTAA 1QTIA 4FGUA 1UBUS 3RSLA 1D6MA 4BXXG 2X0FA 4QYTA 5BR1A 1VBKA 1WQ4A 2CJWB 2R8JA 2OQIA 4KHPH 4LXIA 4P36A 2YASA 1UJ2A 1KC7A 1P1RA 4DLBA 1V1MB 2G83A 3P27A 1D9ZA 1MG5A 5AM4A 3C3DA 2Q6LA 4D6YA 2YOHA 3PF9A 5CM9C 1B0UA 4KE7A 4BATA 4UATA 2GSDA 5A5FA 2WAQE 5JOQA 1I33A 3DBOB 3OE7D 1PR5A 4K9MA 2W0MA 3VZCA 5DWVA 1QC5A 5KFSA 1E9EA 2H16A 4ZVLA 1Q1NA 4UM9B 2GN2A 5DNWA 5ADVA 3HP7A 4ARVA 4KCGA 3X1DA 1G9SA 2O0JA 5IZCA 3TD2A 4KV9A 2CLLB 3IT2A 1MZBA 5IMBA 3E7DA 3QVTA 4DAEA 4EF4A 1KI8A 3VPDA 3IUMA 3U7EB 4QGHA 3QOFA 3CFYA 1BYUA 3P4YA 3CUUA 3NUAA 4KN5A 3IYLW 4XIYA 2E5WA 2C7RA 3RKRA 2B4QA 3IUPA 2QYHA 4WI1A 4HXYA 5DGTA 1N8NA 1Y3IA 1YTLA 2FKNA 1G9TA 1C9KA 1VGQA 1PGQA 3GQCA 4HGYA 3D7MA 4JSYA 1IMJA 4X71A 4G65A 5EESA 2QGZA 3O8RA 4B82A 4XUGB 1YZQA 1SIOA 4PCLA 5BP7A 3CCFA 1L2ZA 1ST3A 4DLXA 1N34B 1G21E 4KR7A 3K1AB 2AX3A 4W5NA 2AFRA 4AAYA 2VP9A 2JA6G 5JVLA 3HN2A 1H2EA 4AS1A 1I4OA 3H8JA 1G2QA 4G09A 4E14A 4YRNA 3SKXA 1UWLA 3F5FA 1N6NA 1C1DA 3OUTA 2KBFA 2R6AA 4LF8B 1YB6A 4W1PA 3OQIA 3IB6A 1FVFA 2ETXA 3B3GA 2JLWA 1P1IA 1GKLA 1TWHA 2EBFX 1UXHA 3BSFA 2Z02A 2HMWA 1Z36A 3SQMA 5A71A 1BS1A 2OCAA 2O0HA 3WMWA 1YZTA 4EO4A 4XE5A 2GXSA 2ZWPA 3F6CA 1I0ZA 3K9GA 3DEIA 4ENTA 2GHIA 3B3FA 1NFFA 3WYDA 5B64A 4YRLA 4HBGA 1BW9B 4PPQA 3ADKA 1SK9A 2ZRFA 2XH8A 4KVZA 4EYSA 4HPJB 1PX2A 4N8DA 2FZEA 1MC4A 1K4MA 3QSGA 4EEZA 3NKFA 4XGNA 4F4ZA 1XXHE 2FK3A 1ENYA 3UN1A 4I0WB 3PGJA 4HAOA 1RNLA 3BXOA 4V38A 2WE8A 1MIHA 1U8EA 2A1UB 1SKAA 5CVDA 1VSQA 3G0CA 3KU4A 5CYPA 5LP1A 2X58A 3BMOB 4YH1A 4UREA 3V2UA 3BCRA 4GRDA 1V11B 4Q47A 2HB6A 3MRTA 5CT5A 1E6WA 2J5KA 3RIZA 4ZTBA 1V26A 4YIHA 3UG6A 2RGVA 4XUEA 2IXEA 1NUAA 1QIHA 3BEOA 1SEIA 3DO5A 4WFJA 5GZ6A 4ESVA 1P9LA 3AETB 4D4GA 4QJBA 2JIZD 2C57A 3RS9A 5DHRA 1WXGA 3D7NA 3H1BA 3ZLUA 4DGSA 5EUCA 2HHJA 2G9QA 1NM5A 1CUHA 4I19A 2OM6A 2GA9A 2H4XA 4F46A 3MYYA 3ONNA 1NHGA 3G13A 2GGSA 1GNTA 4IH9A 2GA8A 1A2OA 1AS3A 2ZRQA 3AUUA 5ICGA 3PFHA 4JBIA 3DOIA 3WRWA 1KJ8A 3VSDA 1VPWA 2BEKA 2W8ZA 3GV8B 4UE3S 3GLGE 3PIRA 4YUWA 4FNOA 1QUEA 3BJRA 4JB2A 4GQAA 4JDUA 1SVIA 1L8XA 3MWGA 1Q44A 4K1LA 2YCBA 5KG2A 4MCJA 3KSRA 3BJMA 2IYAA 3WWDA 5HF5A 3L1JA 4ED3A 2A9RA 3GTMA 5K3EA 1EUYA 3U0VA 3R76A 3NUGA 3CZ9A 2BEUA 4PWQA 1KEEB 4M9UA 3IVGA 4HDQB 3MWMA 3EDOA 3ZZ0A 4JLOA 4BWGA 3AQIA 3R9RA 1TTTA 1FSGA 2PFSA 3PI6A 1V4YA 2H2FA 4RPKA 3TPFA 1PZEA 2XY4A 3DVSX 4K6MA 3I5YA 3WE7A 5D6OA 4YCAA 4X45A 3PW4A 4D74A 3BVPA 3SC2A 3A26A 5CTAA 4TMZA 4XXHA 3W5SA 1HYEA 2VNIA 5KQGA 4NCBA 3ZE7A 1AN7A 1U6JA 3BF8A 5IG2A 1XYVA 3FPAA 3HN6A 3X1MA 1GY8A 2NPOA 1ZUHA 5TC4A 4MV7A 3FUXA 1JLKA 5KNDD 2NUAB 1MEJA 4RVDA 2W6ZA 2XUFA 2WNSA 4W82A 1M10A 3IDOA 1K2WA 1F3LA 1E20A 1K1EA 2EBWA 3WXBA 4C2TA 4L8GA 1DBIA 3KEQA 1DJOA 1VJGA 1O8BA 3TTVA 3CQZA 4S1VA 3E2PA 1FX1A 4E5PA 1XZFA 1SOVA 4EUHA 3KQYA 2IYNA 1B8NA 5FFNA 2GXUA 1Z47A 2C95A 3HLTA 1J99A 3E05A 2F9MA 1MU0A 3LA6A 3KG2A 2QTVB 3OZWA 4AXXA 2I62A 4IMJB 1JLSA 4D43A 3B89A 3QVUA 2Z3ZA 4HTFB 3ZGOA 3NDPA 4E1BA 5TV2A 2WIDA 1ZOOA 3T5HA 5JZSA 4DIEA 2M1ZA 5DULA 4EYOA 4M0CA 4RNOA 1PZXA 3STVA 4U0KA 4TVSA 2VO1A 3LP6A 5ALMA 2PKEA 5FWXA 16PKA 1SCAA 2QXTA 2H4HA 5CG1A 3KLOA 4IF6A 4QL3A 2CBXA 3Q9SA 4AJ2A 5EN4A 3L8DA 5BORA 2QR2A 4HB4A 3PXGA 4ZOCA 3LFHA 5I5UA 1VP9A 4GGOA 1V8PA 3W5UA 5HILA 1T3ZA 5H16A 4TMXA 5BMVA 4JUFA 3PX7A 1ADFA 2XB8A 3J81A 1DRVA 2V1XA 1ZISA 1XTTA 1RQLA 2ZI6A 4S0ZA 4CF5A 1DMRA 3DV2A 2P9ZA 4IS2A 5KTNA 3SBDA 4ZCLA 2CLKB 3ZQJA 4K9OA 3CF4G 3GWZA 4IKPA 1NBIA 1OX4B 1LY1A 2OVBA 3VH4A 1H9AA 2GPSA 1AV7A 4Q34A 4RK5A 2RGYA 1DB3A 2IOQA 2V96A 2CF6A 4CN8A 3H1TA 1PL8A 4K9RA 4V39A 4QULA 2PTHA 4G4SP 1Q0QA 2C61A 4ENWA 1SD1A 3T5DA 4L72A 3SVLA 1JT2A 1CS0B 5I7WA 3PR4A 2F9FA 4QYIA 3VV3A 3DNMA 1DLJA 4OBBA 4QDTA 2NADA 1HL3A 2OBBA 4JR2A 2VP6A 1JTVA 5LB2A 3EPPA 4GWLA 3PEUA 3SGLA 1WCIB 5A62A 3V80A 3MLEA 1X1AA 3ZHZA 2M98A 4B83A 4OOFA 2EF0A 1VE6A 2DE0X 3IJEB 3LGSA 4YAFA 3EPKA 1THMA 1S5PA 3PDJA 1T0UA 5AI9A 3U7FB 3FZYA 3RWBA 3QI7A 3KE8A 1JEYA 4G5FA 4KR9A 3GV0A 3OC6A 5LKRA 1AUQA 1NWHA 5JFOA 4RK6A 5AK0A 2OSVA 4OI4A 4F2PA 1QG6A 3EXIA 5CCDA 2X5KO 2CMDA 4ZEVA 2DLNA 4HVLA 1C7JA 2C78A 4RBNA 2FF5A 1QQ5A 2CVHA 5FPYA 3E9NA 2EC5A 1M1YA 1UWVA 5SY6A 1M0EA 1G7RA 3GIMA 1J8YF 3PBKA 3ZE8A 3RG8A 3F1KA 5I7UA 3H9EO 3V1NA 3FH0A 1ZESA 3GAFA 4TYPA 3C39A 2GFHA 1H65A 3R44A 3M89A 3P20A 2UYYA 4KMMA 3TXXA 5A3RA 3K2IA 3P9QA 1PYDA 5AI6A 3KREA 2HRRA 1E3QA 2AB0A 1YUNA 1PRYA 3B1YA 1WXWA 4ZHSA 1RM5A 4MKRA 5CD1A 4G4JA 3VNUA 4QRDA 3A2MA 4FJ1A 4EAAA 2JAQA 4E5YA 4H6XA 4CG0A 2A0UA 3I4NG 3UKJA 5FV4A 4RJJA 5DNDA 4RF4A 4XYLB 5AVUA 1SKBA 4OJYA 2WT4A 3FR8A 3GRYA 5C4MA 2HXSA 2O7NA 3LV8A 2JFPA 2RKBA 1U2DC 2WAYA 1M2GA 2XJ9A 1NRJB 5KREA 3GLQA 1KEVA 4GPBA 1BEZA 2UAGA 1XAIA 2JLSA 3O90A 3IA2A 3AXTA 1IHPA 1M1XB 3J80W 5CLGA 3L7OA 3R6WA 1N34H 2PMFA 3H6HA 4NS1A 4UC0A 4TROA 3DFZA 1GLNA 1YR7A 1SUDA 3ANTA 4NH0A 1ZNWA 3KZCA 4QU9A 1DRKA 2H4ZA 1KAOA 3TE7A 2XQKA 4I8DA 5DOVA 2VDOB 2X7XA 4CMBA 1PT7A 1XTSA 3V48A 4R3WA 4MMYB 4D79A 4LF8H 5I9BA 4PZ8A 2BH2A 3WHPA 3IELA 4BNLA 3KJFA 1NC3A 3EW7A 4RUAA 5HX7A 1I1HA 3S44A 2H2HA 2CLFB 2ZSUA 2B63A 4UBOA 3PRHA 2WYWA 2A92A 3S6JA 3OLYA 2P4QA 2X8WA 3TXYA 1FL9A 2Q1XA 4RORA 4Z51A 1LRLA 3ZV4A 1DGQA 3FB4A 3BIFA 1S7CA 1IJBA 3GT4A 1T4BA 2CJYA 1L5YA 4X1YB 3NAGA 5EJ4A 1E1RD 2B69A 3LVBA 3ZZTA 4YBZB 3PNMA 4QEZA 3H9UA 3Q5GA 1CJKC 3L4SO 4XA8A 3RVNA 4QGGA 5K0NA 4QT4A 5L3SB 4PC7A 5ANRB 3G1UA 5LLTA 1P6UA 2X1HA 3Q12A 1Q1BA 5IVIA 1YHNA 2PO5A 3VVLA 3P71T 3ZUPA 621PA 1FNBA 3R0XA 3GILA 3THOA 1WX1A 1L8OA 3EW9A 4YXFA 3WYFA 5JD4A 2OHJA 2KLBA 1W52X 2PXAA 3EC1A 3LLCA 1XPUA 5DBFA 5GV7A 5TQJA 2BKUA 5IULC 2OVFA 1FFWA 5IKMA 4MRPA 2X42A 2HNAA 1VE9A 2PVCA 5E3JA 3EQ2A 3VKUA 1CRQA 3EH1A 4LXQA 4O4HF 4BVLA 4HDSA 4G89A 5JAMA 3LPCA 1UUFA 3AHJA 2F3UA 3U17A 2NZUG 2G88A 4A6EA 3CN7A 1RHJA 2FDCA 1QU2A 3KAKA 1WABA 1U5CA 5JIBA 4TRRA 4YR9A 4LWQA 3IJRA 3FPBA 2HHFA 5ALPA 3A0UA 3RAPR 3LL7A 3T5KA 5EIXA 4P5PA 4EB3A 1WTCA 1AE1A 2P2SA 4IDCA 2O14A 3BZUA 3FCYA 4ARCA 1LPSA 5KYVA 4KOEC 2GILA 9LDTA 4RAOA 1ZN8A 4OL0A 3DE5X 1VLQA 1T0BA 2EX1A 5JMTA 4G4SO 3MYRA 2I3DA 5ICSA 3IMGA 2VDWA 4WN9B 1MIOA 3I8SA 1E5XA 4XCXA 2V6BA 4ERNA 3WAJA 3RRMA 5C51B 4GC6A 5C80A 3OJLA 4LHEA 4NFLA 2DWQA 2ZRDA 3TSCA 2L0XA 1NDQA 1NTRA 4B5LA 4M9QA 4CE5A 1XCMA 4BLSA 5L53A 3D6FA 3E82A 5B1HA 1WAMA 4IO0A 4JOQA 1W5FA 5H70A 2FX5A 4LYGA 1Y9ZA 1CCWA 4QWAA 3LQ4A 3MQ4A 4KQ6A 3TAHA 3BA8A 3F46A 4Q9LA 1GZSA 3FCAA 2YCLA 2CMHA 3DMTC 3LWZA 1D4ZA 3I9LA 2XMPA 5EE3A 3GL9A 3VNRA 5CK4A 4ZZ1A 4MUXA 1T26A 3B78A 2NUPA 4EPRA 1BDHA 4LJ6A 5CA1B 2YHAA 1G7SA 1F12A 5LYJF 3AINA 2OZLA 4ES6A 2I29A 1VIAA 4CF6A 4WH0A 2JFOA 1VYTA 4NJOA 2JCSA 4DTCA 4Y6LA 3E5NA 3WV4A 3GCZA 4KREA 2II6A 4BKQA 1NE7A 3H87A 5D1NA 2C4TA 2AI1A 1Q1GA 4WKPA 4MYSA 1DKMA 1N6PA 5CDSA 2YUIA 4N1AA 3M9MB 4OPMA 3M4YA 2NVOA 1J07A 2AZ4A 1K68A 4JYAB 3EXEA 3OESA 4R2MA 1E3LA 3IHTA 2ZTLA 4JGBA 4UCFA 3TQFA 1E6EA 2VHTA 1AK9A 3AJEA 4QJ5A 2QPOA 1YACA 2RC5A 4IYRA 4ZTUB 1GT91 4RABA 3C6XA 4G25A 2P1ZA 3GQVA 1RRVA 4ZVRA 3UOGA 1O94D 3WBFA 5DGHA 1HEUA 1TVCA 2RDMA 4X54A 5AW9A 2O5RA 4WBNF 4ZCPA 2IUFA 4GR9A 1KXJA 5JZBA 4Z99A 3GEPA 3TM4A 1VMDA 1YRYE 1XNRB 2CHEA 1M2OB 3I0MA 1T1JA 1WCV1 4RHEA 2G7MC 1E1LA 4Q4AA 1DKLA 3H2GA 2BTOA 2XODA 3KLMX 3BTUA 3UGTA 2ZAYA 3LC7O 2O2IA 2AG0A 1NLYA 4ZREA 3E5RA 3EY9A 4QECA 3CB2A 3KQKA 2H59A 1YRBA 3RC9A 3ZHQA 5JLJA 5AI4A 5EQJB 3DE6X 1RW4A 5I4BA 4JUAA 5J58A 4TKVB 2ZSAA 4PHFA 2IBMA 4CDMA 2FG6C 2GUWA 1UJCA 3DUFA 3ETLA 1UDAA 1VCMA 2GAIA 5JC8A 2XXBA 1T4CA 3L7BA 4BCBA 5AQEA 2PZAA 4RKFA 1ECBA 4BP3A 1BX3A 4ZO8A 2OOSA 1QOPB 1JYEA 2EKDA 3W3AD 3NVDA 4HLUC 1OFIA 1X1QA 1OR8A 2Q1WA 5CFLA 4UOQA 2JFZA 5DG8A 3PGXA 1D3AA 2XBLA 2QL6A 1PT6A 4DVGA 4TRJA 3BFXA 3VTAA 3OHMA 1R6VA 4QLAA 4NIMA 4CMIB 2JFXA 3T41A 4F4CA 4LBYA 1FSSA 4OATA 3IQHX 2QD5A 1XVTA 3D6TB 1G0NA 3THYA 1AQ6A 1C3XA 3SI8A 1QM5A 4C6RA 4AW9A 3A3PA 4OQQA 1U8YA 4L4RA 4RZSA 3LFTA 2PKQO 2FUCA 2B92A 1J6UA 3IKTA 2PRJA 4UHBA 1MDFA 3T1HB 4U8HA 4ITRC 2VL7A 1GFZA 2X0KA 4WKCA 2WM9B 2V0NA 5DBHX 4CKWB 3EGXA 4YAKA 4JV0A 1PSZA 3M4XA 1F14A 2GKSA 4YLYA 1BA2A 3MW8A 3W8DA 1T5OA 4PLFA 1C5KA 4NZPA 1W2HA 4LZWA 1GRCA 3L43A 1Y8CA 1FYWA 2J6IA 3H4VA 1LVUA 3O4IA 3FTQA 6REQA 1XVLA 2XWJI 2CW5A 5JBIA 3UB3A 4AJOA 4DR5B 1XZAA 5HNEA 2F8LA 1YVPA 3S0JA 1BE6A 1XNHA 2QL7A 2VNSA 1UC4B 3IR5A 1RRCA 1M1ZA 1PJ4A 1Q0UA 4MQEA 4FFBB 4UXIA 3HOXG 2BMAA 4C7JA 3D8BA 3N2EA 1P31A 3AFIA 1F8GA 4B47A 1IB0A 5FP0A 4XAQA 1QFJA 1WR8A 3K31A 4DR3B 3VTFA 3G8YA 3SQDA 3U40A 5HOEA 3TDMA 3CW2A 4EMBA 2ZAOA 5KQRA 4C3ZA 4NYJQ 4O02B 4HWOA 1W36D 5DCLA 2AI2A 1GLGA 2GWHA 2EQBA 4I3GA 1YR1A 2WW8A 1SBNE 3Q8XB 3HB5X 3B1VA 4FN4A 2IZOA 3RT1A 3R7DA 2XKAA 2GESA 1LC0A 4OB8A 5DM0A 2QZ4A 4WLEA 4Q4JA 4GVLA 5CW2A 1D1SA 4BQQA 3OBBA 4CPDA 3ER9A 4XDZA 1UT8A 3I8OA 1XZIA 3J7AK 2MIIA 4BC1A 3KV1A 4DMUB 1NTOA 4RACA 1CFJA 1W36C 3VJLA 1V8FA 1TEHA 1LLQA 2BSXA 4QXQA 1PQPA 2PNJA 4NBRA 1N36B 1F7VA 4XGRA 1VQ1A 1R0YA 5D1OA 1S10A 2BFBB 4F6LA 3EA5A 1EE2A 1WZNA 1UEJA 1E66A 1NP7A 3ZOKA 4OYHA 1SQSA 2FPWA 4U7PB 5IWCA 4XVCA 3DBLA 4PXAA 3DV0B 4A0RA 2QMUA 3BUSA 2PK3A 2YFYA 3N2YA 5B6PA 4WXMA 4E7OA 3NTQA 4G1BA 4DCNA 3T35A 1VLLA 3Q1KA 5LVAA 3F5SA 1H3EA 4IXDA 5JNSA 3DDOA 3PPXA 2CNVA 3HJFA 2NP7A 3ICEA 3DVLA 4EJ6A 4Q7JB 4O5AA 1HOXA 5BQ3A 3ZHTA 1OBGA 4BOYA 3JAWA 5G53C 3NBXX 4YRQA 4R83A 5FD8A 3B60A 2BC9A 2P91A 5KG1A 1YRHA 4R3NA 3KXDA 4BNZA 1CUWA 3OM0A 3FZQA 3P0FA 3WICA 4R3UC 1U6IA 2QTRA 1ML4A 3H9JA 1XQWA 5ERXA 3H18A 4QYMA 4MH0R 3KJNA 3NTOA 2R4QA 1UP4A 1VRCA 5FL7A 1EVEA 3S28A 3D8UA 3BICA 4ZAZA 3KYIB 2B4YA 4OHFA 3PFNA 3VRHA 3IIJA 4CM5A 1FZTA 2FI1A 1UDBA 1A9RA 4LYFA 4FT2A 1J00A 3BK2A 4KFUA 2JDIA 4BY1G 2IWRA 3IVAA 4PGHA 2HMAA 1DEXA 1RJ9B 3OCUA 3VAYA 4XQGA 1CSEE 2XOXA 4G0VA 1II0A 3LUHA 1XE3A 4D8TA 4XYMB 1D0SA 2RGNA 4U39A 3IDFA 3BCSA 4F2WA 2V5AA 3HOWG 2O3SA 2AR7A 4MJ3A 3RJ5A 3GUYA 4MLCA 2GK4A 3NTXA 3AKZA 5KFAA 4P7FA 1E4GT 2ADOA 5DYYA 2MYTA 1HURA 1MO3A 5TXGA 2PWYA 4W5JA 3A9CA 5ITWA 3P0HA 1MAVA 2XTAA 1ESCA 2VA3A 3AKEA 5LB4A 3O3NB 1VMKA 1JL3A 2P9GA 4G9BA 3ESDA 1CEQA 4A5OA 1BMQA 2IXAA 4HWTA 3PVZA 1B6RA 4GRAA 1DBPA 1YHYA 1Z2CA 2GM9A 4GFDA 2ZYUX 1KWKA 3PW7A 1G60A 3KUUA 1R4AA 4D3DA 4WKGA 3BB1A 1O1YA 1XZLA 2RI6A 1XZDA 1LC3A 2XZLA 3AH8A 3TRIA 2JFFA 2FGJA 2EHJA 3DBHA 3FPJA 4YV1A 1EPUA 4KYUA 2ZQZA 1GU0A 3RWOA 3ACDA 2JCBA 3IJPA 1J22A 3LUPA 1RCUA 4KQJA 2JIOA 1KPHA 3TR6A 5KFQA 2PT7A 4P33A 4I50B 1FTQA 4Q7KA 2Y0SA 1VZ3A 4ECWA 2VPZA 2I4LA 4LJLA 4D0GA 1U7WA 1VG8A 3HKDB 2NXEA 2Z83A 3MCAA 5T6MA 3TZHA 2YW2A 2P8SA 3FCOA 3VI4B 2P9CA 3DAOA 2F17A 2MYPA 4BWFB 2UVUA 1GGOA 3OLXA 3TL2A 5D85A 4AYWA 1ZITA 4Y9DA 4AP5A 4DSNA 4LRWA 1TYBE 1G8MA 5MN6A 3B9PA 1HPLA 2Q4EA 2ZDHA 3EMVA 1GAJA 2CXOA 1BMTA 4D4KA 4DV4B 1J0AA 4S35A 2R6CA 1YI8A 1TRKA 5MGBA 4I8XA 2CHUA 4B3DA 4JMPA 1SZPA 3UCXA 1RWQA 1RM4A 2Q1TA 1PAUA 4J3JA 1BDBA 2NNWB 1OKKD 3FNGA 4WA7A 4YPVA 1B0ZA 3B9BA 3JR7A 3AFOA 3VNBA 5FUVA 1MVLA 4U2CA 2QRJA 3G17A 5DLDA 2VJLA 2FGKA 2RH4A 2AQIA 4GKVA 1MH9A 1S7GA 3GD7A 1UBFA 3H84A 5DASA 3IO5A 3GTLA 1T3NA 4JYAH 4ECXA 3RC2A 1W5TA 4XOUA 4ZDIA 1NULA 5BURA 4IQ0A 2FR8C 2I7XA 4WD3A 1MO2A 3ZHBA 1HYGA 3E23A 3WG9A 1ZCJA 3WGKA 3G2KA 3PNQA 1ZL2A 2OHXA 1V7ZA 5D1PA 1JSRA 4QQNA 1T94A 4I1SA 1V7CA 5JMWA 4AC9A 3HYTA 3LBNA 4UHDA 1XNRH 5LLDA 1RAFA 4M76B 3ICPA 2J5QA 2X9VA 2VWQA 5LD2C 2A0FA 4YWJA 1IVYA 5EMLA 3GEEA 1DIBA 4K5QA 4AZ0A 4XX0A 2GT1A 4P83A 3DE7X 4FXPA 2CXRA 4C4XA 3GBSA 5MN4A 3A6EA 2N46A 3PCRB 4MUAA 3MM4A 1EE9A 2CDNA 1I0IA 2FLNA 2D59A 2RHDA 1TF7A 4QUBA 4BZWA 3WGYA 4ZGBA 5EC8A 4D0LB 3VR0A 1U0FA 1DEAA 2X9GA 3KEFA 4OQYA 1GRVA 3MMXA 3GEMA 5TRTA 2QLLA 1VHTA 3AF0A 5AICA 1F6DA 4Q5IA 3QRWA 3GH1A 2FFRA 1L5NA 4BMZA 4ETNA 1YFLA 3R3WA 1DDOA 5CGZA 1V16B 2IP1A 4PYLA 5C8YA 3DC2A 5KHOC 1Q0ZA 1ZJ5A 4PLGA 4QE3A 3EVBA 3NVKI 4F96A 4F85A 4DMMA 2UYGA 1E1CA 1YKGA 3ZIUA 1DAHA 3AIOA 4PLCA 3NC1C 1E9BA 1M83A 2BM0A 3ZWNA 4ARAA 1VCNA 4H2DA 4A2BA 3C15C 5B3JA 1NOIA 1DZIA 2Q5CA 4WJLA 3LP8A 3MUFA 3CB4A 3G5AA 2C92A 1KBZA 3GLTA 2P0YA 4HFMA 3CLVA 4N0DA 4BAUA 5TGDA 2I66A 3BBPA 2CJPA 4OSPA 5E1MA 3T1HH 4NWIA 1BHO1 3AKCA 1JEQA 3ZVNA 4R8LA 2R8KA 4HFNA 3SE7A 5JJ5A 2QRZA 1CV2A 3F6PA 1WXHA 3UNXA 2HCFA 3G9UA 2Q5IA 4KVGA 1H0SA 2REQA 1XEXB 2ZJ5A 2B2NA 3D6UA 3KT0A 3NTUA 1V51A 1ZRNA 3SJUA 3K0FB 4A23A 4RETA 1NX9A 1SCUB 3RVQA 1XRRA 3T8YA 4Q0YA 4ITUA 1L9XA 5AI8A 5TGZA 3SYLA 1CQPA 3KWMA 1QOQB 4ZEMA 1Y89A 4DR5H 2D5CA 4M60A 2XITA 4KQ2A 2CVQA 3QWUA 3W8EA 3E0QA 4NYMR 2C20A 3BGOS 3U44A 1VKZA 5D3MA 1Z9BA 5IJ0B 4PIPA 3QX7A 1O4VA 4Y9UA 4ZT3A 2B82A 2A8YA 1FDIA 1DUIA 3EQ7A 1W7AA 1JHDA 1CUCA 4TT3A 1L3CA 1A9OA 2P9YA 2YYSA 4HUJA 4HNSA 3NLLA 3PG5A 1CKNB 5AJYA 3MPUA 2IITA 4DR3H 5E9JA 4XUCA 2A4KA 4BBSG 1M1YE 2Z6QA 4Q3KA 3DB2A 5TF4A 5AOBA 1M7GA 3WR5A 1WY7A 2PUHA 2NPIA 4M0FA 3WYNA 2CL0X 1C7IA 2OWOA 2UYQA 1MTZA 3V4OA 4JJ4A 2IP4A 1HFEL 3KEGA 1S2OA 4Q4DA 3N2IA 2J6HA 3CZCA 4JJFA 1KQGA 4F5DA 2ASVA 1J1UA 1JDEA 2R6GA 1UNNC 3BXZA 4IG4A 4CG2A 4Q1BA 3UMJA 1KAGA 1FFXB 2Z09A 1EX9A 2G9UA 4QG7A 5DM70 2VPWA 3FF4A 2ERCA 4GZ5A 4UD6A 5C7OO 1A9XB 1JX6A 4JB8A 3FWHA 3QVSA 5FORA 4TTPA 3E2IA 3BZBA 1JAZA 3M9NB 5ERGB 2PVSA 1TAEA 1N36H 4FEEA 2GNOA 5AESA 2A5DA 1CY2A 3O93A 1LRKA 2AYXA 5KTTA 2XOEA 1F2UB 4QW8A 3ILVA 3ETCA 3EASA 3BDVA 4WXPA 3FVWA 3DP9A 4MRRA 2Z98A 1OW3B 3JQ8A 4N7JA 1KJNA 1XHEA 5LZ9A 1E9SA 4WRRA 1SUBA 1DIKA 5J2UF 3HU3A 3LLUA 2C4UA 3SZ3A 1LWNA 2H2IA 1YIAA 2PSFA 3BXHA 2BHTA 3KFLA 4HUQB 5E0OA 2VYCA 1EHIA 2J7PD 4W5HA 4M0EA 3PR3A 3PUVA 3CE6A 1SBYA 1G5IA 3LKBA 3PR5B 2YWFA 1TYDE 2AFHA 1QK3A 2ID7A 3N6RA 3R7NA 4BZZA 1N7JA 1ZM3A 3UYKA 1PK8A 3DPUA 1RWNA 1ZFNA 3ITKA 3CX8A 4CDNA 2P35A 4UNQA 4GKAA 1JHQA 1TD9A 2J85A 2JFWA 2Z57A 4Z3DA 4E0BA 1EDEA 5EXEA 2BYTA 3MJDA 3N2GA 4Z6KA 1J8DA 2OGSA 4U6QA 1T1EA 3V3TA 4A6PA 4RVOA 4MI9A 5AW1A 2HLDD 2KMLA 1KO8A 4NCNA 4EQ6B 4GH5A 4PCVA 3JQ6A 3LZCA 1D0IA 3TL6A 2VI5A 2HDKA 2B78A 1D04A 4MWCA 2VSQA 2A1TS 3C6MA 4Z7QB 1E3EA 1F38A 4EG0A 4MTCA 4DJ5X 4DG8A 4RIFA 1FVHA 3OUZA 3H4DA 3QBJA 2FZLA 3RVMA 3CLHA 4MW7A 2PD6A 1SVLA 4O4JF 3ZI4A 4F7DA 3R7FA 3VR1A 3PF8A 1SZDA 4JITA 1APBA 5E6RB 3MINA 5KWEA 2W8KA 1P7VA 1ZNXA 5JD3A 1OI4A 4H1HA 2QSZA 5BV0A 5T8KA 2JA8G 4YY3H 2MYNA 3WRXC 1G3RA 3FHCB 3PX3A 3K8ZA 3OURA 4R5HA 4YJHB 4R9NA 3ZGZA 2HU7A 1TEVA 2YMMA 4WHXA 3ZIAD 4EP1A 1XZQA 4L22A 4TUYA 4O7NA 2XYQA 5A9SA 2C2XA 4J3FA 4O3FA 1HZZA 4QVIA 5DQGA 4XVHA 4TSRA 3HGQA 4IIJB 2CE7A 4TTJA 2EIYA 3OX4A 2Q6TA 3C6QA 2HEIA 5HFNA 4YMTA 5AW5A 1OYYA 4IDFA 1ZIOA 1CERA 3G5UA 2FLKA 3VDRA 2C2RA 2ZJ6A 1F4VA 5GVRA 2EG9A 1CF9A 3IEKA 1JDUA 3KWLA 3C16C 3QE0A 2F1JA 4RPIA 2QUIA 4DIUA 4TQUS 4XQ9A 1Q7EA 5AHKA 2XCRB 3CEHA 5H0IA 4O5OA 5F9FA 3A05A 2YVQA 4DV1B 5EEGA 1JQLB 3OPYI 4L2IB 3PWSA 4GEGA 1YVEI 3HTXA 4GOKA 8ADHA 4ZQHA 3MTAA 4DIKA 1FTSA 5HXAA 3ZZNA 3ZDCA 5DYTA 5BNTA 3MIZA 2JNWA 3LBHA 4GNRA 4O2BF 5IX8A 1NI3A 1EVIA 4DV4H 3S4YA 2G70A 1P6QA 2AMLA 1KFJB 3DJYA 4HG2A 3T12A 1NVEA 1DOZA 4YALA 4L7VA 4YCDA 3PUJA 4BFTA 4WNAB 2EW8A 4DCPA 5DHUA 3ZTYA 5EKSA 2F43A 1ISGA 3FSGD 3DMRA 2XCPA 2C5AA 1RABA 4RAYA 1C9YA 3TPCA 1NI4A 1R6XA 1M8PA 3ESQA 2XKJE 2J5RA 2Q6KA 2W98A 1GPUA 3NRBA 2BGIA 4OFZA 4NG4A 4BFYA 3GDFA 1Y4DE 5JDIC 4OQDA 1WZIA 2WV7A 5F76A 4EJFA 2A7XA 4RJTA 1I5EA 5E7JA 3GJYA 3OPYA 3TKYA 4L74A 1PI3A 1L1FA 3KKNA 1OA1A 4HAZA 1KSHA 1PP4A 5LWQA 5IC4A 1YZLA 1E9VA 4B35A 3I4LA 4O4LA 1BHQ1 2YZGA 1FPQA 1ADYA 1JQAA 4LNUA 4C87A 1J5PA 1Q7GA 4CNQA 3U6BA 5BVGA 4OAOA 2O20A 4JDPA 4RANA 4TS4A 4DUGA 1XDSA 4D3SA 5A9RA 1P5JA 3KQQA 1Z0DA 4GPIB 1XQ1A 4FX2A 6ADHA 5A3SA 3TO5A 1LPAB 3RKSA 3FXAA 4MQ5A 3UHFA 1VKRA 1Z37A 1DTSA 5BUQA 1V4NA 5FTWA 5F9LA 3D3KA 3UWDA 1IULA 4X7RA 1RBYA 2HYDA 1P33A 3IUQA 4LFCB 4Q03A 3TJRA 1KI6B 2PUAA 1FJGB 1CB0A 2ZJOA 1ZUD1 3OI7A 2AKAB 4ZQFA 3LMLA 2OWEA 2AUMA 2RGRA 5EJFA 4X64B 1USIA 4IIBA 3ZDAA 4TTSA 3C8ZA 1I10A 5CFRA 1KZ1A 4QPZA 5IT9W 3VOAA 5KG5A 2YMPA 2A3NA 1BGVA 5BN3B 3BWCA 5AM2A 2PYZA 2DIKA 2X3UA 4RQAA 4ED0A 4LA4A 1HV8A 3RPEA 2VT7A 4OHXA 1YMQA 2C2HA 1AB6A 3AMVA 1NONA 1T24A 3EC7A 2GZAA 3WMRA 5JSQA 3EIXA 3TEJA 1GZ3A 1I6MA 4YK7A 1V6CA 4GC7A 4HPXB 5IWAB 2NU9A 3JPWA 4OGLA 1GD1O 2Q3EA 1EDOA 4AO8A 1YK1A 2AQ8A 1MEOA 1B8UA 4RGQA 3RIEA 1H1LB 1J2UA 1W88A 1ZAKA 2IBSA 3UV6A 1I2CA 3TRJA 5A1JA 4YXWD 2ZVQX 1MX1A 2QX9A 1CY4A 3Q41A 1IZ8A 4TX1A 1ZSNA 3AVQA 1ICEA 3OCWA 2D3TA 4I4TA 1KDPA 2F3RA 3D31A 4I5IA 1UXJA 2DRIA 3VFDA 1CQIB 1EAYA 1F5NA 1B74A 5A4JA 1QVRA 2P2DA 5K7SA 3A31A 3RU9A 3V7FA 2ZUEA 5DNEA 1RBZA 2XXJA 4P4TA 2L42A 1EFRD 3EC2A 4WVLA 4PR3A 2P65A 1KDOA 2CLHB 2QMQA 3VBEA 1N8SA 3QJ5A 4DF3A 4UM8B 5MDHA 4PANA 3KU1A 4MB0A 5H1YA 2ZSJA 2QMEA 1V5FA 1FRVA 5F73A 3SM3A 2B7BA 3BQ0A 4ZHQA 3LYHA 1ZAYA 4NU8X 1B6SA 2BKVA 3KRTA 1VZ2A 4FS1A 4R2HA 5HCIA 3F78A 3KUDA 2E21A 3FSRA 4QBFA 3IAXA 3T3IA 1KJJA 3BA6A 1DWPA 4Q02A 5KWSA 3GROA 3PDWA 1Z12A 5K3FA 2XF8A 2DBVO 1QMGA 3W5BA 3A3NA 1YTUA 1MAWA 1UZUA 1G1MA 4V1CB 1O4WA 4PZEA 5F3WB 1FQOA 1GPMA 4G01B 2VUIB 1WJGA 1VGRA 2NG1A 4MEAA 1Q92A 3OP1A 3GPBA 4GZMA 1FFEA 4GEKA 4MK4A 1TJ3A 3R6DA 5HK9A 7YASA 4H31A 5EI5A 2ODAA 4QEKA 4LDPA 4QEDA 4C2BA 1P74A 2XCLA 1YQWA 3JQ9A 3GDEA 3VVMA 3ROFA 1KC3A 3DTYA 3EZGA 2YV5A 2HHCA 2X8AA 5ALDA 4D9HA 4LTMA 4R1PA 1OWOA 3NHYA 2Q9AA 1ENOA 1M76A 5JH7B 3WWJA 4U2FA 4RDHA 3LPLA 2JI9A 4L8LA 1JQ5A 1PT9A 3ND5A 4C14A 4Z7JA 1W2WB 5IU6A 2BF7A 3PZPA 4M21A 4UPDA 4L7QA 4OQZA 3VJKA 1TLLA 1K7XB 3H5NA 2QRMA 5BXQC 5K09A 4YIKA 4E5UA 2CV1A 2N0SA 3NHJA 1X1SA 2DTEA 4NDNE 4BHTA 4RM2A 3AJDA 4JR0A 2G4VA 3G6VA 1FLDA 3ANNA 5ELMA 2O4UX 4TKUB 5E6SA 2RG7A 1UDXA 1JMYA 3PJFA 5I7AA 2IZ1A 5A0TA 2KLHA 4CCAA 1PR6A 3W90A 5A04A 4RZHA 2P6PA 1CQJB 1A9TA 4A0SA 5HTKA 4IR1A 3K0EA 4KQXA 2JGNA 4ZA2A 5KFOA 2P2NA 2NWQA 2BM1A 3K6SB 3RJ0A 2PYDA 4CIYA 3DF9A 4O2AB 4AS2A 5AJXA 2G4CA 4UUOA 3CCBA 4FCWA 3H42B 1HG1A 4UNNA 1L4MA 1USVA 1UFKA 4V2UA 1K6JA 3Q2KA 4RKYA 1E2IA 4A3CG 2R5NA 1BXGA 4ZOQI 1SN7A 3ILHA 2R4UA 3NGMA 2ET6A 3NI2A 1RPJA 3OU7A 1OCEA 2IYPA 5JBQA 1W85B 3I6MA 3V4LA 2YN0A 1P81A 5JUWA 2V3VA 4JJKA 1DWUA 1TJPB 3N1UA 4RFSB 2WWIA 1USKA 1AG9A 1L8QA 4C3OB 1CZNA 4FYVA 3CVVA 3WL8A 2VLBA 3JAMA 1N77A 2QORA 1QDLB 2FPGB 1MQ9A 2IIQA 3H1PA 1ZIYA 5IM4F 1E5QA 1F06A 1T6ZA 3ZUGA 2JGFA 1ZKMA 3H0EA 4OQXA 3IKVA 4IEFB 1JV2B 3WKDA 2XLBA 3OP4A 3TJZA 5HBGA 4BLPA 3D7LA 4O3SA 4BMYA 4BAGA 1KDRA 2WF8A 4UBIA 3TPZA 1SEPA 1PGOA 3SC3A 4K86A 4OUDA 4B84A 2X5NA 4MQMA 4DMCA 1Y5RA 4UQLA 5F7ZA 4FKZA 4X6XA 2OGTA 1T3HA 3L7MA 1H2XA 4OI2A 1AA6A 3ZK8A 3G7NA 1YAJA 4EG4A 2H5IA 1UZMA 1SCBA 4NEHB 3CIOA 3PW2A 2W6ID 1V9SA 1IBKB 3CSUA 3W6NA 2HCJB 3VH1A 3LDFA 4MCAA 1FSPA 3W79A 5KFWA 1E7WA 5TMBA 1AZLA 4Z9XA 3MGCA 3H4IA 2JHAA 4A93G 3RK4A 1P0PA 3GF4A 4AN0A 1E2FA 1D1QA 1QG2A 3OSPA 5JLAA 2CNWA 1B7GO 2JF0A 2JA7A 4RXUA 1P8JA 4OQEA 3IAS6 3T4XA 3E9QA 3IT0A 4XRGA 1QHYA 1KY4A 2O8BA 5CLLA 3HJTA 5E7QA 3LTEA 3S29A 1IQUA 4IDDA 4YV0A 1Z0FA 2I03A 3NWBA 3UZUA 4ZVPA 1Z3CA 1OLXA 4P6VF 1BVHA 1JNYA 2Y0SE 3GB9A 1GCIA 2PUVA 3T1YB 2B83A 5TR9A 1WF6A 5TQ2A 4XQCA 1NW5A 1ZSVA 4W9NA 1BZYA 3KSMA 4OIFA 2PPLA 1XJ5A 4DV1H 1Y42X 2ZBQA 2YW9A 1DJLA 2B63G 3NYIA 3T7RA 1V7QA 3TNLA 3K0HA 1A2QA 4NENA 2VDPB 3CW9A 5EWGA 1WY5A 4RFLA 2PIDA 4TSFD 4PW0A 4XIGS 3OEYA 3DTVA 1BGWA 2F6RA 2CFMA 1DINA 1IIBA 4KO4S 1KEWA 1N2XA 1FMLA 2A1HA 2B98A 2Z2XA 2C2MA 4UCSA 1JLLA 2IC5A 5LMUB 1DT5A 3OOHA 3NYQA 4G56A 3GU3A 3TNJA 2Y1XA 2HU2A 2C2DA 5JNLA 4ENQA 2D2EA 2VF5X 1CT9A 1CUVA 1FDRA 4B85A 2CXUA 1SXJA 1UMDB 1T9AA 2MINB 1RLJA 3PHBE 3IB3A 3JY6A 3A28A 2CUZA 3EEOA 1GL3A 1K8XB 2VSXA 4ZDWA 5C7YA 3VPAA 3QVGA 2FZVA 1K5GA 4CIVA 2W2KB 3C8HA 2YN2A 1DTWA 1WSDA 4OJTA 1OBOA 5IKXA 3R9XA 3ZWVA 1JPVA 4B71A 4D9CA 5B36A 4KFRA