2R87A

Crystal structure of purp from pyrococcus furiosus complexed with adp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
334
structure length
334
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGAKGGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
molecule keywords PurP protein PF1517
total genus 100
structure length 334
sequence length 334
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r87A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r87A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r87A01
4FFRA 3JRXA 4ZQIA 2DIKA 2HGSA 1EHIA 3N8DA 4M98A 1I7NA 5CAEB 1JDEA 2W6QA 3E5NA 2FPIB 1VKZA 5JH7F 5KX5F 2NPOA 4GGMX 3TIGA 3GIDA 1ULZA 4EA8A 3R5HA 5LP6F 4O7TA 3HO8A 3SE7A 3R5FA 4O86A 4XYLB 3WO0A 3BFPA 2PN1A 4HNUA 1Z2PX 2W6ZA 4EA9A 2W6OA 3BSSA 3VA7A 5BPFA 4O4IF 2QK4A 5JVDF 2QF7A 3RUPA 1JDBB 3K5HA 4HQ6A 5GONF 1EUDB 1BNCA 2NU8B 2Z04A 4XZ3B 4C5BA 1GLVA 1WR2A 4Y8VB 1KBLA 1C30A 2YZLA 1KUTA 3K5IA 4I4TF 4MV3A 4YAKB 5LOVF 2V5AA 4I55F 3Q1KA 5C1PA 2FPPB 3ETJA 2YS6A 1KJ9A 2GPWA 4QSHA 4E4TA 3BSYA 1M0WA 3RFCA 1Z2OX 3KREA 2R82A 1DIKA 1B6RA 2R7LA 1DV1A 2V58A 2X0SA 4O7ZA 3BG5A 4O7LA 2CNVA 3DF7A 4EG0A 4WD3A 5I47A 3U9TA 4O7WA 2YZGA 4MV8A 2CNQA 2I87A 1KC7A 1CS0A 4FU0A 4YJ2F 3OUZA 4DLKA 2DZDA 4HNTA 1JKJB 4O2AF 3OUUA 1VBGA 2NU6B 4TV8F 3MWDA 5IYZF 1PK8A 2R6FA 2CQYA 1KJQA 3G8DA 1AUXA 1EYZA 4EA7A 4MV7A 3V4ZA 1GSHA 2GQRA 5HV6A 3U9SA 3VPBA 1GGOA 4MV6A 3WNZA 4J6EA 3LP8A 5FNVF 1T36A 5C8YF 3ORQA 1PX2A 4M9UA 3K3PA 2YL2A 1UC9A 3VMMA 2R7MA 5H80A 3TQTA 1AUVA 1UC8A 2R7NA 5BPHA 5JQWA 2Z02A 4MV4A 2V59A 4O84A 1I7LA 1KJIA 2PVPA 1M0TA 3UFXB 4MA5A 1KJ8A 1W93A 5LYJF 4FFMA 3I12A 4YAJB 4O7NA 3KAJA 4FFLA 2R87A 2NU9B 1A48A 3ORRA 1A9XA 4YBZB 2ZDHA 2YZNA 3TINA 3QFFA 3KAKA 2YRXA 3R5XA 3R23A 4M9CA 4EAAA 2YRWA 2C00A 4YJ3F 3BSWA 2R7KA 1OBGA 5LXTF 4IIJF 2HJWA 4O7RA 4FE2A 1M6VA 1VBHA 3KALA 2XCLA 2YYAA 4IWXA 1BXRA 4TV9F 2IP4A 4O7VA 2XD4A 5K2MA 2SCUB 2NUAB 4M99A 4O2BF 2NU7B 3U55A 3NUAA 2GQSA 4C5CA 2P0AA 2ZDGA 3WO1A 1B6SA 1GSOA 2DLNA 4MV9A 4IZOA 3GLKA 2DWCA 1GSAA 2R85A 4FFNA 1KJJA 3MWEA 2GLTA 5DMXA 3TW6A 4ME6A 3TIIA 1W96A 2OLSA 1KEEA 4O4HF 4YB8B 3JZFA 2ZDQA 4C5AA 3VOTA 4XYMB 4FFPA 3Q2OA 5EZYF 3AX6A 4FFOA 5JQGF 5CA0F 2W6PA 2FP4B 1EUCB 2YW2A 4DIMA 5D8DA 2VHEA 3JRWA 3LWBA 5CB4F 3RV3A 5BMVF 1IOVA 4IWYA 3RV4A 4ZOLF 2CNUA 3V4SA 4EABA 3JZIA 4I50F 1IOWA 2YZMA 2W70A 2YS7A 1Z2NX 2W71A 2R84A 2VR1A 4EGQA 3HB9A 1CE8A 2I80A 4EGJA 1CQIB 1E4EB 2WYOA 4ZI7F 4O7SA 2W6NA 5KKNB 1CQJB 2PBZA 5CA1F 2VQDA 2CZGA 2W6MA 1DV2A 3G8CA 4O83A 1E4EA 2R86A 2I8CA 4HNVA 1EZ1A 1SCUB 4MA0A 4NYEA 3VPDA 1JLLB 2YWVA 5HBRB 4MV1A 2GPSA 3MJFA 3R9RA 3ETHA 4ZHQF 4O4LF 4XX0B 3U54A 3AW8A 4L1KA 4MAMA 5C1OA 2J9GA 4O7YA 4IHJF 5J2TF 4HR7A 4WBNF 2FPGB 5J2UF 5LA6F 3N6RA 4FGRA 1OBDA 1C3OA 4TUYF 4O81A 3VPCA 3HBLA 2VPQA 4O4JF 5JVLA 4RZQA 2FB9A 4O82A
chains in the Genus database with same CATH superfamily
1ST2A 3L77A 3SD7A 1ND6A 4XM1A 4LFBB 3FPGA 2OO5C 2FWMX 4NK5A 4FB5A 2HGSA 3BQ1A 4R1MA 4RY2A 2NO4A 4AP9A 1EHIA 3WGZA 5HG0A 1B93A 3PXXA 4RA9A 3DHYA 1ODLA 3K09A 1EDOA 5FNZA 1CUUA 6Q21A 4B79A 3O4RA 5L4LA 5LL6P 2WVHA 1VPDA 3CRW1 1V4BA 2KLHA 4LN1A 4TMTA 4HUQB 2XCUA 5CFNA 3HXKA 3G2QA 3ND7A 4J4BA 5TV2A 5JH7F 2AOUB 3Q7EA 5IEJA 1XCMA 5U4QA 4QDJA 4GLLA 3H5VA 4IDOA 1HE2A 3A36A 4FS8A 4JGBA 1ZPDA 3FWYA 2VPSA 1KXZA 4RTQA 2OB1A 2G07A 2Q6LA 3R0QA 2HGWA 1JEAA 1PAUA 3H84A 3TG8A 1KI4A 4LRUA 4N47A 2XVXA 2AN1A 4BL5A 3ZLJA 2ALJA 4NCHA 5LP6F 5C35A 3DZHA 4W5HA 3SE7A 2AXQA 2FPGA 3R5FA 3HR4A 2H85A 4PTYA 1EWVA 3N7UA 5BQOA 4BAZA 3FAZA 1QG2A 2BMWA 3UMMA 1XCJA 1U8YA 1J00A 1UFOA 2ZJ4A 3MBOA 4NF2A 1EUCA 5KQLA 1RAHA 2XJ4A 5MGBA 1IXSB 4LKRA 1FE8A 2PLRA 2WJAA 2N75A 2D1SA 3N7AA 3AG6A 4GSYA 1I7PA 1SBHA 2J9XB 4YFYA 4CM1A 1NBOA 1WAMA 3DUWA 3KR1A 1KSGA 5D6OA 3V2UA 5G4KA 3ZWCA 4LRQA 5JC8A 3QTTA 1X7YA 4YJ2B 1Y1LA 4QOIA 2AJ8A 3JV7A 5L53A 2VSNA 3RRYA 2BJVA 5FX2A 1A9SA 4QT4A 4IDDA 4YDRA 4L9WA 5AVUA 3PR4A 4YP9A 3QKUA 4DEYA 5HRCA 4IMJB 4QDOA 3IHWA 5IKMA 1QTQA 1PRYA 4BX3A 2OG1A 4YPFA 3CA8A 2SKCA 5T41A 2H57A 2I7CA 2AVNA 2C5FA 3N07A 4J0CA 4QVKA 1YVRA 1J2YA 2V4UA 3RTBA 2HSEA 3AEZA 1E3JA 1T1JA 1M34B 3E22A 2WW8A 3HXPA 4HWSA 2RIRA 4TYYA 3G1TA 4K87A 2HUPA 4GL4A 4DA0A 3FPBA 2H1WA 4JYMA 1AO0A 4YHHH 2OHXA 2P11A 5JPIA 1WR2A 5JASA 1D03A 3LIIA 1KBLA 5IM4F 1KMNA 2XWSA 4BWVA 3PVSA 5BWOA 1LSJA 2WKRA 3U3RA 1UXHA 4PLGA 3VKFA 2BGGA 2CY0A 2CE2X 2BJHA 3DAAA 1Z9BA 2XGGA 5DZSA 4B85A 1E61A 1N2IA 1E2KA 2Q5LA 2ZIAA 3RIGA 1QDUA 4MWCA 4JR1A 5IDQA 5KG5A 1S8AA 3CR7A 2QTGA 4KV9A 4DR7B 4N5HX 4LFCH 3RTXA 1NN1A 1X1DA 2Q3HA 1UKEA 4O63O 3RJ5A 2H2WA 2WC1A 1ELOA 2JJQA 1T0HB 4C6TA 1IHPA 3ETJA 5FIUA 1V4NA 4PZ8A 3DBOB 5FPRA 1G7TA 3VZDA 3RB4A 5G53C 2IIQA 4YJDA 4D46A 1TUBB 3PQEA 4BO2A 4ZEVA 1OYOA 2WEKA 2RI1A 4TLLB 2QLTA 1SHUX 3PC3A 2XSZD 3COYA 4B7XA 4NV0A 2HIMA 1NJSA 3NM4A 4AX4A 5BOSA 3LVQE 5AW6A 4W9MC 1I2LA 4A3EG 3G5MA 3T3DA 4BVAA 3Q4GA 3LT1A 1AS3A 3MJ4A 1NWHA 1F12A 2GZ1A 5CFMA 1NQTA 1Y34E 1IY0A 3HTXA 2YBEA 1M34E 1C5KA 2AJTA 4EFNA 3CR8A 4PINA 1DHRA 4EG0A 1VKNA 2XMSA 4GICA 1ORVA 3ZLVA 4R8KA 1YS6A 3LA6A 4A92A 1LW6E 2VJDA 3SOPA 4I5DA 2R1ZA 2O2YA 4LZWA 3DV0A 4TZ0A 2QA5A 2O8NA 5JEEA 3PW0A 2AGQA 2WU8A 1B41A 3EY9A 3HPQA 3SZ3A 4EZEA 1IOZA 4BS9A 1JG4A 4NENA 2P90A 1L7XA 1F5NA 3EB9A 2IYRA 3FMGA 3ZNNA 4M86A 4GRIA 2J0EA 3EGXA 3DBHB 5KYYB 1XRQA 3DDHA 5BUQA 3CW9A 4GP9A 3TI7A 3ZKAA 2OHJA 3BL5A 5E1MA 3FBGA 2O05A 5M3BA 4G5XA 4JUDX 4ARVA 1WUJS 4ZYYA 1LVUA 3DV0B 1KMQA 3H4TA 4I99A 4TWJA 3LHDA 5FD8A 4AF8A 3D54D 1MAWA 1VM6A 1Z25A 2ZM5A 3FUVA 2CNNA 1SXGA 3SXJA 3ZG6A 3C3WA 3ESCA 1YRLA 2QI9F 4RQUA 3WGLA 4Z5XA 1KSHA 3M8KA 3I9LA 3TOVA 4OFBA 3V4VB 3VSAA 5JPCA 4ER3A 4QUBA 5KJ6A 2I2AA 4ZK2A 3RGXA 1QHFA 1SUSA 1LI4A 2XW6A 3EGVA 4YLEA 5EZYA 4E5KA 3GFPA 4IP0A 3PRHA 4BVBA 3GCDA 2ZPAA 4IIXA 3THWA 5KTOA 1GU7A 3VKWA 1WBJB 2ONJA 1A5AB 2HLNA 5T14A 2EZ9A 3G8YA 4DV1B 3JAKB 3LSYA 3GRYA 1UBHS 4X8LA 3UV3A 4F96A 2BMJA 4GOND 5T3YA 5FR9A 1SOVA 2XE4A 3D3WA 4X8OA 4AY6A 1DQRA 1M74A 4YCCA 3U5ZB 3INTA 4BPBA 2O1XA 4TKUB 5LJLA 2IH5A 1CUIA 4N5NA 5JBNA 1LZLA 4NONA 4BC0A 4NH4A 2XEXA 3U3DA 5GONA 2Q3BA 3LBIA 4AJEA 2NM0A 4JUCA 3IAFA 4MWGA 4YBZA 1L5VA 5ECDA 5JCPA 1EXMA 2P2GA 3ES9A 3FYDA 4OQEA 3SKXA 3QEKA 1IN6A 3LH5A 4EG6A 2CLFB 2P2SA 1RXIA 1WXIA 3P26A 5T6BA 4IHAA 1GZ3A 3AFOA 4DMCA 5KYKA 2C4TA 1POWA 3K9BA 4CMFA 3H1TA 3G7UA 2FMUA 1NQVA 3IR5A 4OGWA 4PS1A 5REQA 1N3BA 4X41A 4U7GA 1R10A 4PHHA 3IVRA 1EP3B 4HX5A 4U63A 5B55A 3KFXA 1GJRA 4GOXA 2Z02A 2HQRA 3K0EA 1CR4A 2I03A 3X2EA 4HPJB 4BV8A 1AS0A 1GDTA 1JX6A 3EAFA 1D1SA 4RIFA 1ZOSA 3KHTA 1IMJA 5AI4A 1K5GA 3L40A 5A03A 2GEBA 3EDCA 4TYNA 3ND8A 5I45A 3TD2A 2ZBEA 3BH6A 4XYGA 1NW3A 2HIAA 4BKUA 4F5ZA 4Q4DA 1DAKA 1P6UA 3GFTA 4R81A 4CLOA 1BVHA 3MINB 1ZCAA 2B4QA 3G79A 4BMSA 3LX5A 3NM6B 4IOMA 3WJ7A 4C6HA 2EFDB 1KT8A 1HXHA 4IYJA 1GA6A 4D4GA 1XB2A 3PXUA 4F3YA 2GF9A 4G0UA 1J39A 1U02A 1E3DA 4RSRA 2IWRA 3COJA 2CUTA 1W93A 4FFMA 1XCPA 3DWGA 1JVBA 1TAQA 2Z2JA 3INGA 3PQ7A 3QHQA 4OBWA 2HPVA 1MZPA 2AR7A 4CM4A 2X4IA 5HKOA 4XX0A 1KI6A 5HZKA 2C61A 3QVLA 1N9KA 5EUCA 3KAJA 2HSZA 3IT3A 3SHWA 5CB4A 3PC7A 4LZPA 1P2VA 4OOEA 5AJVB 2V0GA 3HY6A 3TB4A 1M2KA 5HQJA 4ZV4A 5FBVB 5E7MA 1AY0A 1Q7TA 1HFWA 1XZMA 1NASA 4KQGA 3J80W 4HDSA 2OOSA 3AO0B 2A1TR 2O5RA 3IP3A 2O3RA 2NSLA 2I9KA 5ALWA 5F52A 5I7AA 3MOGA 3QWIA 4BFZA 3TQRA 5IX8A 5KO2A 1M6VB 3BIJA 1FMCA 3S1LA 1HOXA 5D3KA 4LC1A 1YRQA 4DUYH 4U7HA 1A7UA 1P3JA 3AY7A 4H7PA 4S1NA 5EYPA 1TFUA 3WQHA 4L6IA 1NXSA 4NY1A 3HU2A 1XMQH 3AR9A 3IT0A 1DAGA 4INPA 5EIHA 5EZQA 2PL3A 4FE7A 3OPVA 1TKCA 1CU1A 1X3SA 2VOEA 1M0SA 3G0CA 3NORA 3PR1A 3TOZA 3V33A 2VUHB 4QA9A 2A9OA 1Z68A 1VBHA 5EHIA 2E48A 1J99A 4CCYA 1KSJA 4P0TA 4JXXA 1IZZA 1SXJB 4GMFA 1MOPA 1JBQA 2Y68A 4DUPA 2L42A 1K75A 2Y76A 5ALEA 2FSPA 2Y0CA 3ISTA 4KR7A 5KCZA 3E0XA 3R76A 3QEBZ 4AECA 3SM3A 4DUZH 4WRRA 3IE0A 2L19A 2R00C 1SG6A 1BSVA 2NUAB 1NBMA 1VE5A 2PXAA 1KPHA 1BX1A 2AQ8A 3DMPA 4EELA 4BKRA 3K94A 3DWIA 1X9GA 1XAGA 3N7TA 2G70A 5AVQA 1HDCA 5TJHA 2W9CA 4L9AA 5LPNA 2LRHA 2EWVA 3NC4A 1SO8A 3O2NA 3PR2B 4MMZB 5G3ZA 4DNPA 4JJAA 1ESNA 3T7JA 3CX6A 3R7AA 4AWXA 1LK0A 2F43B 1OV6A 3TL6A 1L5OA 2XRYA 2ZJ0A 3NFYA 3WO1A 1ZHHA 3RGGA 2CKDA 3B1JA 1DELA 1YCDA 2JFHA 3EXG2 3U81A 4F1KA 3OKAA 4OLAA 4IHJB 1YACA 4RFSA 2IV7A 1GGMA 4J1SA 4IZOA 3E6AA 1W36B 5I8ZA 3KDSE 3AY3A 3T5GA 3I9FA 1K8XB 2OLKA 3WWDA 1ZM4A 4FS1A 1KI9A 2CFSA 2IZ0A 5EESA 1HNWH 3ZZMA 2WAOA 1KJJA 1OXTA 3HJTA 2DWPA 2GKSA 3I0MA 1VJGA 4E11A 2F3PA 3VZSA 1PVDA 1BIFA 3WXMA 4L3WA 1R0RE 1YRBA 3A1UA 2QMHA 2QAJA 4G6ZA 2I76A 4MGIR 3QV1A 4EGSA 5L7YA 1RADA 2GZMA 3S2GA 2ZM6B 4HYYA 4AYXA 1VE1A 2ISQA 2UZ0A 2M6KA 2PTGA 3T9DA 3H17A 1YSCA 5FBQB 4XCVA 4BGEA 1EIZA 3NTVA 5CJ2A 1YCFA 2ET6A 2HO5A 5ILOA 3J7AC 2UXCH 3BA8A 1BXZA 1PG0A 3A4YA 3SZMA 2Y93A 4QUKA 4EJ0A 4KODA 1VLQA 3X2FA 2HRQA 1YVUA 2X77A 5JO0A 2VRCD 4P0PB 3BRSA 4L5BA 4FFPA 3IVAA 3LE8A 3MMZA 4IRUB 4PLPA 3V4LA 2JIQA 1CVRA 3ZWAA 4C20A 4ALJA 4OUDB 1S4QA 5A4DA 4JV1A 1JEEA 1BS2A 4XWYA 5AM0A 4ZTUB 2ZBPA 3W4JA 2CC2A 3HKDB 3H20A 3DYBA 1IOVA 3PQ5A 5KFRA 1G8SA 1D6JA 3TLAA 1MD9A 1VSVA 1R18A 4YV1A 1O94D 5JD6A 3PUVA 5JYBA 4C2TA 1NHWA 1TQ2A 4Q4HA 3LT4A 3OKPA 4DQNA 3STUA 1B00A 3FI9A 1Z0KA 1KWKA 2W48A 1R6VA 2WINI 4C3ZA 2XRFA 5JOQA 2W8KA 4EEYA 5C3MA 4BIIA 2EKLA 4P54A 4H17A 4RF3A 1GZUA 2B21A 3GJZA 3BWVA 4BGVA 4BNNA 1I2AA 3GVCA 4MWEA 1IN5A 4N9QA 4EJSB 3WP1B 4DIUA 4EJMA 4S04A 5FP0A 2XMCA 1E4FT 4NK4A 1TEVA 2G9ZA 1D5WA 2VAPA 5CDFA 3U80A 1M2HA 4MIOA 4HEHA 5DHRA 3WQSB 1XDSA 1Z36A 2EBUA 2EF1A 2NAPA 2WJWA 5BQXA 4H6XA 5KFXA 2W4IA 4D9EA 1I2MA 3WGNA 2XA2A 3J81A 4QYIA 1IXKA 4R1PA 1IQ0A 3BXEA 1QIJA 1NE7A 5H3HA 4DR2H 5DXJA 3T9EA 1Y1WG 1GXSA 4YR2A 2FYTA 4JR0A 5IUKC 2AI1A 5ICEA 2F67A 1TTTA 2MSDB 2WD9A 3H8SA 1TTQB 2B7BA 3V32A 2GCOB 4MK4A 2UVVA 3WGOA 1ZLXA 4BFCA 1I1OA 2H9AA 1RRCA 3VU3A 3QPAA 1EK6A 1FS4A 4S2UA 1KVSA 3VZRA 3AIKA 4DA7A 1MAAA 4YRSA 2BDUA 5FBRB 3ZK8A 2ZYDA 1XYVA 1YFZA 5AI8A 2H4XA 1VL6A 3LYAA 4GPEA 3U4AA 2QVGA 2XZDA 2GK3A 3RVRA 1BMFA 1F8GA 3PJEA 1FFSA 3OC0A 4YUWA 4HDMB 5T57A 4KREA 3FPKA 1ECFA 3HKEA 4M0UA 2J41A 2V7VA 3HDVA 3HB7A 2YYZA 4MTLA 5EJIA 4EY4A 5C80A 1AO3A 1Q95A 4Y0AA 5FPYA 3FCCA 2DHEA 3I9NA 4L02A 1BXKA 4UUAA 4I3GA 3ZVLA 1RTTA 5FUMA 5JSHA 2XKJE 1M6WA 2QTWB 3JAWB 5JR3A 3GMTA 1TKRA 5ES3A 5TPZA 1XI2A 1B8VA 1MB9A 1QHHB 4E5UA 1JH9A 5EVJA 1U2DA 1FDUA 3F4KA 3PKJA 1ZNYA 3PPWA 1P7VA 3U4HA 3KXIA 1W76A 2EJUA 1OIWA 3MGGA 5DGHA 3DG9A 2ACKA 5KG4A 1TQDA 3CWCA 4TM5A 3OX4A 5AW9A 3ZWNA 5FPOA 2GCNA 1K3UB 1T2DA 2BBTA 2GN8A 1JFVA 2V7QD 4J0MA 3IUJA 3JXEA 2HXGA 2F8LA 2H7CA 1E2IA 1YIOA 1SKQA 1FFDA 2COUA 2GRUA 3DCNA 2FWIA 2D2VA 2WJJA 4YP7A 5J2UF 4AKIA 4Q4AB 5L1LA 1R5BA 1Y1TA 2Q2WA 3KJFA 4WN3A 5DQIA 4RLFA 4TSKA 3U1VA 3R7NA 1REQB 1KZGB 1U2GA 1DOHA 1ZKDA 2HJGA 2NU7A 4QU0A 1KFCB 1XGKA 3EZFA 2OO5A 3EEOA 1F0NA 2UXDH 1JKFA 5F9LA 2XD9A 4PXAA 3VR1A 1WO8A 5FWXB 5H81A 1YA4A 2B82A 2ODBA 1QF9A 3RG2A 1B42A 4HUQA 4KYVA 4YCJA 4DREA 3GXOA 1Z63A 2ZYHA 2Z1MA 4LMBA 3T0FA 1IBMB 2F48A 3M6WA 5DLYA 3OFKA 3GL9A 3N3BC 4XIFA 4AB1A 1SB8A 4MVXA 2YTZA 4K28A 4RPJA 5EMJA 1I6MA 5THXA 4GC6A 2A2ZA 2J32A 1P5HA 5C1DA 5FB3A 3VNAA 3BTUA 3CV3A 2C4HA 2DVMA 3U3XA 3RHTA 1JSCA 3I4MG 4B75A 3WP0A 1MGOA 4HWRA 1JILA 3JPYA 4KGVA 3WHPA 3BRCA 3DEIA 3GP3A 4K3UA 1U0EA 2VUMA 2G76A 3AR7A 4OAQA 4LCEA 4J0QA 3HKBA 3EPHA 1E8DA 1ISJA 1NDHA 3P9QA 3CZ5A 1KERA 2M2IA 4O4IB 5BNFA 3DBHA 1WSWA 1ODSA 3VXKA 5KT7A 2LV8A 3X43A 3EVEA 3O4JA 4OGFA 2A5YB 5CM2Z 1E89A 3DL7A 3DT9A 4ZYZA 2ACVA 3DZKA 4O4HB 2R5NA 4HQ0A 5JWRA 4GKKB 2D3WA 1NOJA 2EBFX 1XU7A 2A4MA 4IXTA 1EEHA 4YMGA 5AQ1A 3GLHB 3H2SA 4FFSA 5EMKA 1P29A 2F3TA 1XJ0A 2D1TA 4WNCA 1P16A 3GD5A 3QFCA 3R5HA 5EIBD 5C7OO 3AV0B 4UCUA 3I2IA 3TOXA 4WFJA 3SWWA 1H1DA 2DKOA 3QZ7A 4JYCA 1IM5A 1TIPA 2VNSA 2ZWVA 1IQRA 1DC7A 4UU7A 1D4FA 2GD6A 1TKBA 3Q8WA 4ZQEA 4ZI5A 4CV1A 3TLCA 4DAEA 1CP3A 4FB4A 1LJ8A 6ABPA 2QZSA 4D82A 2P9JA 3EEQA 4RVFA 3ESZA 3IPCA 2XMDA 2RGUA 2PUJA 4WNYA 2ZRJA 3ZIAA 3L8MA 1PJ3A 3G0IA 4M8IA 4P7BA 3VH2A 2OP0A 4O4IF 3AOEC 4R3WA 5TT1A 4Y2JA 5FFNA 4O0MA 5B1SA 3CSUA 4UVIA 2GZ3A 4L51A 4ZN6A 2QBYA 1P18A 3B9RA 4BJ3A 3JARA 4DCOA 3P0FA 3KR0A 3K5HA 4W5WA 1UF9A 2CFMA 1FYWA 2K87A 2XCOA 4PU0A 4BZZA 5MHTA 2TECE 4MYCA 5EUBA 4H3KB 4XZ3B 3X3HA 5CXQA 5I9LA 4CC6A 3KJIA 3RFUA 5LU8A 2ROQA 2O2CA 4PTZA 4IO0A 1I2DA 5FH9A 3BMCA 1ATZA 4MHTA 3ICEA 2FRDC 1ZVVA 1U1IA 2R25B 1CWUA 4CV3A 4BX8A 1Z7YA 3GUVA 4MTCA 4AMZA 2QUIA 1GUZA 2IX3A 3UQ8A 4D7AA 2AK3A 1N6OA 2FEAA 3TZQA 4CCSA 4NE9A 4ZVRA 3WSVA 3GFRA 4PZDA 4WZAE 2H4YA 1Q0ZA 4Q48A 4JOCA 4J9PA 5A9TA 1I6WA 4JP3A 4YRKA 1XA4A 4EWLA 2VK8A 3K1ZA 2AN3A 1E4YA 3BWYA 3N3AC 1E62A 4H4DA 4QZVA 2VT6A 4UM9D 4PBSA 4V1CB 2YV4A 2XHEA 3TLGA 3G49A 4JP1A 2ZUFA 3OQMA 2BKUA 3K6SA 1WUIS 3LOUA 3LF1A 4J0FA 1JP7A 1T6NA 3R0ZA 4ZP1A 4YC7A 4P7FA 4RD2A 4WCVA 2OBMA 3CZ9A 1UAYA 4CL3A 3ZHQA 3VFDA 4D6YA 2QYZA 3BL6A 3E7WA 3KREA 4MPDA 5GGYA 1JG6A 4F4XA 4AULA 4NMWA 1DIGA 4AMUA 4KR9A 2IFTA 4DZZA 1G5QA 3ER6A 1UBNA 1DTEA 2AFIA 2J5XA 3LD9A 2VDNB 3OH8A 4OATA 4QPPA 1NBEA 3S8YA 5EDWA 1KK2A 3OZBA 2HHFB 1Y3IA 5HF8A 3RAPR 3HL0A 2HBYA 4ND7A 3HZZA 3NWPA 2FDRA 1WSBA 2FFRA 1UR5A 2Q4EA 4Q6BA 3SG0A 8ATCA 2ONZA 4DN6A 1KMIY 2ZPUA 1RE0A 1TO6A 3FD8A 4FU0A 2BFFA 4YJ2F 4X1IB 3U61B 4ARSA 4MVWA 2WB2A 3IVMA 4UHJA 4FMDF 5CDSA 2DZDA 4UUOA 1NLMA 2BGNA 4DLUA 5TJ9A 2R8JA 3B60A 4RXMA 1CNFA 1HT0A 3D4BA 2W57A 1I33A 3NALA 4PFJA 2H06A 4UUBA 4TZTA 4DV0B 1GO3E 3ZLUA 1XLVA 4AUNA 2Y77A 1E1YA 5D1PA 1F0KA 3RUDA 3EGWA 3IEMA 2QD4A 2WQ7A 2FF5A 1N2HA 4ETMA 1D2MA 2FPXA 4G0MA 4EHKA 1LKZA 3OBBA 5GP1A 3U19A 3I45A 3O4FA 4U0KA 3FYUC 2Z1DA 2A4KA 2O19A 1R3DA 3VJLA 3MZ0A 1JQLB 1GGFA 2QJFA 1YS4A 1Y9DA 2WRZA 3NPMA 3HWSA 2X42A 3NOOA 1O6FA 2WSMA 2NX2A 2H6EA 2XVZA 4RLQA 4E94A 3NZEA 3N53A 4CHGA 1T4MA 4ZVPA 3SJAA 1R4NA 2VYQA 4CKCB 2ORYA 3MRVA 3MTGA 3WGHA 4BGUA 3WOHA 3TTUA 4RIEA 4G97A 1DADA 2Q46A 2QNRA 3GAFA 1D1PA 3T61A 1VHDA 3LRXA 2QYHA 1Q22A 2VDMB 4L72A 4ZDJA 4M7WA 3I05A 1CEXA 3FRIA 3ZE8A 4PN7A 1GKUB 3FWZA 3MTBA 5F1PA 2QRKA 4CEIA 1JDPA 3RODA 4L5AA 1LNQA 2ZJ7A 4Q5IA 3RB6A 1NUHA 2BE7A 1G1AA 1U8XX 4JLNA 4A0GA 3OJXA 4AUEA 4UTNA 3KDPA 1ZESA 3LGSA 4P58A 1IBSA 2ASEA 3GLFB 1XELA 3ORQA 2WSYB 1GTRA 1DFHA 3LMLA 1YMVA 3DEZA 4YASA 4YP6A 5M04A 1LS1A 1SKYE 2O7VA 4GF5A 5KI6A 4YAIA 3KB8A 4HPXB 1M2OB 1QO0A 1C0IA 1SIOA 2JZOA 2BL4A 2CNDA 2C35B 1U0FA 4OQNA 1Y8RB 2A0XA 2X5JO 3FFWA 4HQOA 3GJXB 3GLFA 1G63A 3RYIA 3N8IA 4B4OA 1BMTA 4QWEA 2WUFA 5KTTA 1J06A 1HZJA 3E7FA 1NSYA 4FDTA 3R6TA 4Z2YA 4EZBA 5B2EA 4FBUA 1CJSA 1VIAA 1I4WA 1NY6A 3E58A 1L1EA 1VMEA 2O7NA 5ALUA 1VSUA 3EVDA 3GHHA 4ISCA 1BXGA 2JDID 3MTQA 5DNDA 1V16B 3EEFA 4RGYA 3AEXA 1EP2B 2R8GA 1WCMG 1UBGA 2VSFA 4HNHA 4WBSA 1DKNA 4N5IX 3ND9A 4KUGA 3WLAA 1N7IA 2II6A 3DE7X 3O9VA 5CPFA 3ZGVA 4E5VA 5CURA 4XOIA 3G82C 1P2GA 4PM4A 4BMXA 4F4JA 3ZGZA 3QXJA 5EXPA 4GLXA 2P1ZA 3EVTA 3ZWBA 4RAZA 4C7KA 4QW9A 5JJLA 2XDQB 4CR8A 1P7WA 1Z29A 3IR7A 3OECA 4PZYA 1QYXA 2FSSA 5B6PA 3WK5A 3B7WA 3W2TA 4PLHA 4FS2A 3CH7A 1Y3CE 1PS0A 1Q1ZA 3Q7QA 4A5OA 1VCHA 3HL4A 3W3AA 1G3RA 2B20A 2WTNA 2C03A 4GR4A 4UAJA 2ZI7A 3K2IA 1CHNA 5F77A 4MRAA 5AW3A 1X39A 3WMXA 5AHRA 1OQAA 3GEIA 5TLSA 5ALIA 3DR3A 1L4KA 4RPCA 1FNDA 4EJ2A 5CXSA 2V8OA 3KTDA 4YCBA 4BP3A 1M1YB 2KJQA 1KZ9A 5CYOA 5DK6A 2HYDA 2X7XA 4YXWA 3NQ41 3MUFA 1CUCA 1MX1A 1T2FA 4A3FG 2EL9A 3FZYA 3LU1A 4LSWA 1ONNA 5KVQA 1FP2A 3F78A 5BW6B 2VJBA 5DP1A 4ASUA 3VR4H 3STTA 4KE6A 1JHAA 2JLZA 1PZGA 2J4FA 5KHOC 3IO5A 3EQ8A 4N8SA 3VUEA 4PNPA 5KSOA 1ENYA 1YCGA 4XM0A 3TLJA 4CM5A 2HT1A 2NVBA 2ZI3A 5EWGA 3NM5A 2J30A 3QK7A 3BB1A 2GA8A 3PTAA 1GZHB 4F04A 1R6UA 3CEMA 4LZNA 2AXNA 5NULA 4W5OA 1OX4B 1OBHA 1P2DA 5DM70 5JZVA 2VSOA 1OTHA 4JL6A 4LJ7A 3DE3X 3ZXYA 1YB1A 3DC7A 3GGGA 5EJ7A 2VK4A 4C3UA 1B26A 4PHGA 4HDQB 3TRFA 4L0QA 4EI2A 3VYWA 2FVYA 1LSSA 3LWNA 1P9RA 2YVQA 3GJ4A 2ZQ5A 5COAA 5K3FA 1AU9A 2ES4A 2QRGA 1MO5A 2AE2A 3C1OA 3EAQA 2EEPA 1FLAA 4NXNH 3BXZA 3NGMA 3EHDA 4JLPA 3CKKA 4WNIA 5AP9A 4CQMD 2GQSA 2R44A 4QDTA 3O5AA 3RBVA 1DDGA 4HI0E 4H59A 3LLVA 3BJYA 3KU1A 3P0IA 5E9AA 5E9QA 1DO8A 3KKQA 4HTFB 4HXGA 1CCWA 1GNTA 4BNIA 1JR3A 2PT9A 1FP4B 1GPMA 4KO4S 4YJ3B 1RBZA 2OZKA 2DUWA 1ZLYA 2XUJA 3D1LA 3Q7SA 2EJTA 2LKCA 2XY4A 2ONYA 4QWBA 3TLKA 4PX3A 4PPNA 4BRWA 2VUGA 2HVRA 3LC0A 1S3GA 2GCOA 4MTEA 1E9DA 2GEDA 4PY2A 3LLCA 5G40A 2ZTLA 2I3BA 2D06A 4BNVA 5KJFA 2RDIA 1PFYA 5KVSA 4DNOA 3WMGA 1OLOA 3QE3A 1QX3A 5E6RB 1YZYA 3VU0A 4AMGA 4M8LA 4AROA 1IN7A 1EZ4A 1URPA 2QDXA 3UZOA 1L5FA 1WEKA 3D9QX 3EIOA 4RM2A 1QK4A 2C07A 4ITVA 4Q9AA 4M38A 4Q39A 5AT1A 2DTEA 3EZLA 4N5MA 4K2HA 4BJ1A 1SWVA 4FFDA 2GDJA 4JS0A 4G89A 3R41A 4JB0A 4JQYA 1NU6A 4I1VA 5ER9A 1R4ZA 4C29A 1BE1A 1ISPA 4IGEA 4D97A 1V7ZA 1RWNA 2QAGB 4L5CA 4YJGB 4Z7QB 1GOTA 3HVUA 5D84A 5ALVA 3TXAA 3KTMA 5A6SA 3PJGA 4KJXA 2X8AA 4ER0A 4POOA 2IBKA 1HYQA 4MW4A 1PR3A 1QRAA 4LWOA 2H4ZA 3WKAA 4EG8A 4ZI7A 1US8A 1XU9A 2ONCA 5D1OA 2AZTA 4IUDS 3UPTA 5JAPA 3L84A 1JEQB 4HBGA 4BX0A 3VOTA 3M4XA 1UBUS 3PNBA 5E3IA 1JIXA 1V1MB 1T3HA 3KUUA 3A2NA 3KYJB 1VE3A 2P8SA 2QVCA 3TLXA 4E4RA 2ZSFA 3L0ZA 4DIMA 2PKCA 2HCBA 1G5RA 2QY9A 2ZSDA 3BA1A 3BJMA 3B1ZA 4X90A 2JAPA 4KXNA 5ES4B 3U13A 1EGMB 5FEMA 1UM9B 2B2CA 1B3RA 2BMVA 4BFLA 2J87A 1BX3A 2RGAA 2YOGA 4OHRA 4W7HA 1LS6A 5A62A 5BWMA 1ZHOA 4QC2A 4K88A 4ZOLF 3AR8A 3E4CA 2WYVA 3OP4A 4B3RB 4EHIA 1TKAA 3V55A 4PONA 1LK7A 2JFPA 3Q2IA 3QQMA 3RREA 3SZRA 3RS5A 4BMCA 3EGEA 1A5TA 2Y05A 2VUMG 2Y1LA 3O3MB 3OZRA 4TL7A 2BEWA 3TRDA 4PDBA 1KY5A 4UNQA 3OA0A 2XRMA 3AVOA 5EPUA 3UV7A 1Q0HA 1ULHA 4CIAA 5EL0A 3RYCB 1EUZA 1KETA 5KQPA 5IF9A 3HHEA 1E59A 2I1QA 4U4AA 1B0ZA 4JBHA 2QRNA 2I80A 1WJGA 2Y1GA 1KK3A 4A8TA 7MHTA 3G5AA 3FGNA 2GXQA 4HZUB 2FXIA 3RDPA 1CUJA 3KPYA 4BNZA 1F4VA 1SUWA 4PNHA 3I6QA 2V54A 1Q1AA 4N8DA 3DBIA 1GPBA 1W2GA 4LMRA 2NYAA 2OCYC 2IF2A 4DE5A 3CVYA 4NJOA 1G1MA 1TL7C 3B2QA 2J46A 1WY5A 1GPNA 3GY0A 4J9LA 3OLVA 4XYMA 3OFNA 4Y6PA 4FEAA 2ZETA 3ASZA 3VYTB 4ED2A 4JUFA 2E2IA 1XQVA 3VHQA 1CE8B 1NUSA 3TFQA 4KW7A 1GT6A 1UDBA 4PAMA 4TYWA 3CNBA 4KMMA 2I6QA 4X62H 1CS4C 5AOBA 4D3YA 5FWYA 4Q01A 3T54A 2Q0XA 3VTFA 5FV4A 3R8CA 1V7CA 2EWWA 1HM5A 2ZRIA 4BO6A 4C0JA 4JU8A 4Y6GB 1QHEA 4ID3A 2QAGA 2VPIA 2RGNA 4R51A 1CZUA 2CN1A 1ICEA 4ITUA 1TJ3A 3GJ5A 1ML3A 5T67A 3S27A 3WRVA 3W7VA 1HA3A 1Z6QA 2ZJ5A 1ZNXA 3M6FA 3PWZA 3UFXA 4JV5H 5JXHA 1ULAA 4R8MA 4JI3H 1U7DA 1PZXA 3IEKA 3KL2A 1XG5A 4OKIA 4QREA 3SZOA 4X3CA 1SXIA 3IEPA 4WK6A 1XA3A 2RIPA 2ZE6A 2CVFA 1DB3A 4PR0A 3TNLA 1KQPA 1NN0A 1RW4A 2HVQA 2YXNA 4FSXA 4S35A 3RBXA 1IULA 4PAGA 1OTYA 5TQ2B 5DI9A 2E4XA 1J8DA 1ZH2A 1K06A 4Q9HA 4KR2A 4IHJF 1MO4A 1N0WA 1Z6ZA 2NVYA 2E5FA 3EPIA 4X61A 1WBDA 3BHMA 2DECA 2D5CA 1EUYA 1QS0A 4M0DA 4D43A 1T1IA 3T3GA 4JIGA 3CONA 4YALA 3IS3A 4UUPA 4HB4A 1DAMA 4XQGA 5JMPA 2QQ5A 2FY8A 1VBMA 4WZAA 3D4OA 2ATXA 2YZ2A 3F90A 4D98A 2VEDA 1DQSA 3KXDA 2HIXA 3QXGA 4LBZA 4CLOB 5HZMA 1OBDA 4R31A 4O4JA 5KQRA 1D4ZA 1B33N 1ZUNA 4CF7A 4DV3H 2NT4A 1T13A 4LDJA 4MQLA 2E7ZA 4WIAA 1CUFA 3AWDA 2IA5A 3W8NA 3A6EA 4KN9S 5CLFA 1OLUB 2K2WA 1Q3KA 1E2UA 1GAJA 2EG5A 3OUTA 5L3QA 2FDCA 1ZU5A 3EPJA 2RGNC 2WWFA 5DO9A 2HIHA 3DBVO 2WVGA 4OM8A 1IJEA 2Q41A 1TZBA 3C2QA 1C8BA 3KQMA 4JXUA 4KFRA 4Q0YA 5ALRA 2BYTA 4RVGA 1XA0A 1R6TA 3G6XA 3G02A 1UAGA 3OY7A 3G7NA 4ZV7A 4DEXA 2EFGA 1L7NA 3S1AA 1SIBE 4U2KA 1PEAA 1SK9A 3RYTC 3WLHA 1SAYA 4EG7A 4IFIA 4UHDA 4ECTA 1EI9A 3C7KA 5JCOA 1QIMA 1EE1A 5CAEB 1SHTX 1K1SA 2VCHA 3D81A 3H9JA 5ITZA 1GNRA 3DLAA 3SJZA 1YUBA 1OD6A 5L1KA 3P2IA 3U3MA 2QTVB 4AJ4A 1RXEA 5EKTA 1EWQA 3WGIA 1OXXK 3E35A 4RV9A 3IPXA 5TQVA 2XB9A 2PG3A 2EEZA 3NBYC 3NFRA 3W90A 1K66A 4KXUA 5AKXA 3V9PA 4MWBA 5CH3A 1PWEA 5KWSA 4GGMX 3RYHA 3WLMA 1IZ7A 4UHHA 3T5KA 1CIPA 3I83A 2IUTA 2PVCA 3FSGA 3LTEA 4WOBA 3NTLA 4PLWA 4WZAB 5ARCA 3RRMA 4DR4H 2N9UA 4WTOA 1GQYA 4YR7A 3U31A 2F1HA 1RC0A 3CB2A 1CEYA 5DWVA 3DWFA 4WZZA 2H2IA 1W0JD 2JDIA 3T9BA 3HH8A 3HU1A 3UK2A 1HH4A 2I2BA 3AZQA 2UXCB 4NPHA 3NHLA 4O2AB 4DR1B 4HFMA 2VBFA 2JCSA 5EP1A 3L3BA 4IH4A 2RONA 4KFTA 3O91A 4Y3UA 1NNUA 1V6CA 2NXEA 3M4NA 1HL3A 4KXYA 5ESXA 4AG3A 4EKYA 3M6IA 2IBSA 5KT5A 5L9AA 2JEFA 3PE3A 4I6GA 1VJCA 4R3NA 4EO9A 2FZKA 4DL5A 5EJ2A 5AW2A 1GWNA 1UKCA 3PR5B 2DC1A 1WB6A 2PX4A 4TQ9A 3SSNA 4FI3C 2FWRA 1JDBB 3C3JA 3WL5A 4KPUB 2CJWA 4JENA 2NIPA 3F9RA 3E4DA 1W0KD 1RNLA 2DLCX 1CRLA 2ADOA 4M0MA 1RU3A 2P4UA 3T1HB 1CKNA 2R8RA 1B8PA 3AFNA 4ND6A 4PC1A 1V0JA 1N3IA 1J5PA 3HM2A 3EX7C 4GLJA 4K9SA 3K70B 1EG7A 5AVYA 4XE5A 5I7HA 3K05A 3B1WA 3KSUA 3UMSA 2OHVA 3WYFA 1UZNA 3BUSA 5AOCA 4LHYA 4DC0A 2JJYA 3H2ZA 3HOVG 3PEVA 3FJ1A 4MDEA 1E6UA 1I3OA 5DTEA 1Q20A 5CVCA 4DMGA 1R8JA 1T25A 4W5NA 3C6YA 5FTNA 1WCIB 4YMLA 5PGMA 2I4IA 3E9RA 4TV9B 2WHEA 1OBVA 2YVAA 3CUSA 3GTMA 4QE3A 5TS2A 4KGZA 4DR2B 5E6SA 4WNAA 1XRRA 1X9NA 1C14A 3FPLA 4I8DA 4FZVA 5E38A 1GUFA 2O8FA 4DL6A 2FCRA 2WA1A 3ST7A 1W49A 3TMYA 3WAJA 2O8EB 2W8ZA 1MAHA 3J81k 4IG4A 5D3MB 3VKUA 1CF9A 2C82A 1MW9X 3LBFA 3IDQA 1GFIA 4QSHA 1Z6PA 3TTWA 4P8RA 4TV9A 3OPNA 1M0WA 3HXLA 1FRFS 1JH8A 1RHUA 2RMKA 1QHIA 1Q91A 1ZA2A 1Z2OX 1FNCA 3UCEA 3UQYS 4EHDA 4AQ7A 4UPEA 2EJ0A 4UBKA 5EFZA 4FI3F 4EVRA 2HSWA 3I01M 2GZRA 5ILGA 4CPDA 5JUWA 2H1IA 4MI6A 1WF3A 4E5YA 4YAKA 5CFLA 1DSSG 3VV3A 4O7ZA 3BG5A 1L8QA 3CZPA 1CIJA 1VHQA 5ELLA 4CVNA 2FEKA 3RC1A 3TTVA 1XQXA 1N2CE 1TVKB 3NTUA 1XC7A 1M66A 4YRDA 3PC8A 2O8DA 2GD1O 4MV8A 2OZEA 4M8KA 4YX9A 3A7DA 3SFVA 2FKAA 3F5QA 5AK4A 5CEFA 1IAQA 2A1UB 5DDIP 4EG4A 1G6HA 5JAZA 2XC9A 3RC9A 5AKHA 4CM7A 4PICA 5KCMA 1KH3A 3TQSA 5I5YA 4D8XA 1D09A 5CEEA 1E3IA 2ZAYA 2GHTA 5T4EA 2UUCH 1UWVA 5FFFA 4UXHA 3TWOA 3VNUA 3GYBA 3H8VA 3M4YA 4TVKA 3B9QA 1K4YA 1L5HB 2D2FA 2KSQA 3IAM1 3DAYA 3IBFA 3NDRA 4FLFA 4N7RA 3HA3A 4NOMA 4YDSA 3ZK7A 1J4AA 3H8WA 4IDAA 4QO7A 4BB5A 3U5TA 3NVMB 2WB1E 4Y2XA 4QEDA 4D8WA 2Y1WA 4ECXA 4E6PA 1Q15A 2GD0A 1RM0A 2NSJA 1X1QA 2E89A 1UANA 2P75A 2WZBA 3K0CA 4MS3A 5K1ZA 3W2IA 3ZHCA 3DDOA 4BTLA 3WKCA 3DNMA 4DDUA 3DMYA 2GM3A 2W2KB 1IB6A 2F3RA 3E23A 3EZGA 4XJSA 4YDQA 5KNCH 3HDQA 4RDIA 5FLMG 1GZ5A 3CTMA 5A71A 1DKPA 1JQBA 3VR6H 5CPBA 2CXNA 5FL7D 1SOMA 5B1IA 4D9BA 3BYZA 5AD1A 1A8UA 3UOGA 4IGIA 3WGGA 4MINA 3TR5A 4AKHA 4C0BA 2ATIA 2V4RA 2WTEA 2ZT5A 3GEEA 4JLBA 3BOSA 4ARAA 1TLTA 4Q44A 2NTVA 4OQQA 4QW8A 1JIVA 2C0QA 2HY7A 1QXSA 2C4KA 4MUFA 3W7AA 1GGOA 2X41A 4RA6A 3FSEA 4J6EA 4DGSA 1GPH1 3LP8A 2YHBA 2RBKA 1QZTA 2DHRA 5DISB 1NLFA 4A3KG 2ZUSA 2FX5A 5B1YA 4GVLA 5JCJA 3AUFA 5F98A 4IVRA 1EWTA 4F97A 4AJJA 1NNEA 1YV9A 2EU8A 1CNMA 2HNKA 5CIQA 5HK9A 2IITA 3THXA 3EJWA 3FDFA 5IANA 3IR6A 5ALNA 2GI4A 3AB7A 1XDNA 3YASA 2BKLA 3PDCA 1HGXA 4HQLA 5AXDA 2H5LA 2I33A 4EHHA 1SU7A 4BO0A 1QGDA 3JQ8B 4KSCA 3ZIDA 5JI2E 1E0SA 9LDBA 2PE5A 2FLWA 5EEGA 3UJ9A 3WKDA 1L5ZA 2JD0A 4JBIA 2FSVC 2H4HA 4OI1A 2QOEA 1FL9A 1T1RA 3O83A 3R0IA 3H4VA 2DQKA 2QN8A 5HDQA 3G9XA 3T41A 1FOEB 3X2SA 3SHQA 5U9CA 4ECRA 3NANA 5IFLA 1CFJA 3D6VA 2P2NA 3FYTA 1J9ZA 4DDTA 5FL7A 1U3DA 2FWNA 3ZY2A 4CFZA 3TKYA 4R2MA 2R92A 1SQ5A 2YHIA 2O2XA 2BM0A 3G68A 3HCEA 1BEZA 5FRDA 2QTAA 2QN2A 4RJKA 3DQZA 4H4CA 4YGYA 5BSFA 2ZJ6A 1V1JA 1XOIA 2QX9A 4AQYB 1RJWA 3PUJA 3JWGA 2GTPA 5E4FA 2ZRCA 1EFCA 1VE9A 2OVBA 4MB0A 2WU3A 4Y9SA 2JGAA 3T0IA 1KZYC 2ORIA 4XLLA 1HKHA 3A9TA 3FXAA 3V5NA 1X80B 2NU9B 1DRKA 2P79A 2Z5LA 3AEYA 1GZ6A 3DMHA 3FWNA 3MUEA 4MVJE 4Z0HO 2VSQA 4I0WB 3TBFA 1OFGA 2FGKA 2XYRA 1TMOA 1A9XA 1R16A 3C6BA 3NIFB 4OCZA 1A4XA 2MU1A 1A9TA 2RH9B 1FFAA 4HAZA 1XXHB 4JP8A 4O8CA 4TWAA 4EI8A 3ZZ1A 2ZW9A 3T5MA 2A94A 2W42A 3AHEA 3JQ7A 5SYNA 4DAAA 1LPPA 4Z49A 4YCAA 2FN9A 3BCSA 4EYIB 2DFTA 5TDHA 5JWOA 2G4CA 3ZCVA 1EVYA 1A95A 4S0ZA 4UAVA 3LX8A 1CF2O 1R6XA 1PT8A 2GF2A 2FW7A 2A14A 2AH5A 3CZAA 1WOYA 5I9SA 5J63A 4M0JA 1E2HA 2C00A 1G60A 1GG9A 3HU3A 3Q1LA 5AVKA 4A7PA 5EGNA 3TY8A 5JMOA 2CCJA 4QULA 4WPGA 3MPUA 2VZ8A 4BVJA 2IH4A 1P73A 2H7VA 4RVSA 3V46A 4LF4H 2FDXA 5ETJA 4YUZA 5ALDA 2RAVA 3HUUA 4JL5A 2O8BA 4KO2S 1MIHA 2V97A 4GU5A 4PO3X 1LTQA 2I4RA 5AWFC 5E2IA 1DUIA 4X6UA 4ZVOA 3U09A 3O26A 4KHZA 5K3OA 3BT7A 5K7SA 2W2NA 2QX7A 5DNCA 3BAFA 5I3ZA 4MLCA 3K5WA 4O7VA 4F4WA 2PUWA 1IJFA 4ESHA 4F6LA 1T26A 1XCOA 2PGDA 3DDUA 3NDJA 4Q1FA 1OROA 2SCUB 3WK4A 5IKEA 4XFJA 4KE9A 1RD4A 2O8BB 1JL3A 3DDWA 4J9MA 1HG1A 2VQ3A 2JCVA 5DCWA 2VBIA 4CF4A 4DCTA 4WL0A 5DNUA 1KOFA 1N25A 3BQMB 3MCWA 4M89A 1KF0A 4AY2A 1LU9A 3SYTA 1XL1A 5CM8B 3N0XA 3UJDA 3UQZA 1X19A 4WJZA 3VTZA 4E0BA 4FNMA 1JDZA 4RY9A 1A9PA 4IRDA 1UC4B 3OO1A 2J0UB 2XX3A 3K31A 3R3XA 5F9HA 1CKMA 5C3UA 4KE7A 5JUMA 3SHVA 5CG1A 4UW9A 4WKGA 5FKJA 1E77A 4D9GA 1RWMA 2BN4A 1A76A 1H4TA 1LX6A 5MFPA 2V0CA 1G41A 3O8DA 1ISSA 3ITEA 4HH0A 4A6PA 5ALPA 3HA5A 1VGVA 1QIGA 1UZAA 5LBTA 4CN8A 4ED3A 4BN5A 4U7JA 2F3QA 2Z0MA 1M5UA 3GK3A 4FZ5A 2B8NA 1QP0A 3GLKA 1RYYA 2VNIA 2X2PA 1GPUA 2XYPA 3HJNA 3NO4A 4LY0A 1SVLA 5I5SA 1R9JA 5CT6A 4I2NA 1V4VA 1WHSB 4ZYLA 4DB4A 4ZALA 5KYWA 4D9IA 3H2HA 1AKWA 2B2NA 2G6BA 2JJ2D 3CUUA 2O4CA 3C4JA 5IVHA 1JS1X 1H4VB 3RT9A 2WHPA 1W59A 3GN1A 1A9ZA 3L5OA 1TT7A 3PLAE 3KB2A 4AVYA 3OZIA 4OM7A 5DNEA 1FDSA 3D3EA 3WNCA 4QUDA 1IIRA 1QKJA 2PS3A 5DNAA 3S5UA 3H18A 5A4KA 1BOOA 5FD5A 1UKAA 2CD9A 3L2OB 3MJVA 2ZIVB 4TL9A 4ZJUA 1VKHA 3ESXA 3LX6A 3QPDA 5HILA 2QI9C 3KYDA 4PO1A 3OESA 4LFCB 4DLNA 1E66A 4KMSA 3BQ9A 1DBRA 2NV0A 4ZANA 4X9XA 1MB0A 2DSNA 2WMOB 3P9IA 3LLMA 2H3HA 1RI5A 3KSZO 3NWEA 3RSOA 1ORHA 3EXHA 2BCJQ 1DUSA 2GAOA 2IPNA 3LAWA 1KA9H 4RK6A 2W6PA 2ODTX 3SI7A 1C7JA 3COSA 2IPAB 3C0KA 3JQGA 1G21E 1UPFA 3GC6A 4M3NA 4HLQB 2A33A 3A3YA 5D8DA 5A5GA 2EX4A 3L8CA 3N8KA 4ZC1A 5KU1A 1KMHB 4YHBA 2EJCA 3IKLA 4MJLA 3V1KA 3LT5A 4J76A 3T34A 4YRMA 2YHUA 2VJMB 4GLFA 4NL4H 3PDHA 4EHNA 2PX8A 2LDBA 1N57A 2FP3A 4UMFA 1XHEA 1AZTA 3WLPA 2VTKA 1SUPA 1W1IA 3FFXA 3B12A 3PE4A 1V8FA 4QNRA 3IAEA 3LCVB 1KTIA 1MOZA 5K0JA 2GEJA 4B3JA 1H94A 1E9SA 4MPJA 3GTLA 3KU4A 2W71A 1W4CA 3L05A 1R15A 2ATEA 3BA6A 7REQB 8ABPA 1PUXA 2VR1A 3LTNC 2QTHA 3QW2A 1N2GA 2WOJA 1A5SB 3UAZA 2ABJA 3MINA 5KFLA 4EL0A 4ECYA 3QWUA 2GBCA 1DX9A 3BWCA 4W82A 4UU0A 4JA0A 1ONBA 3IFSA 4G09A 4K9QA 2A1TS 3IOEA 5EP2A 3W5VA 4Q3OA 3EMBA 2JKYA 1J8MF 3DKIA 3G0DA 5AM3A 3M4ZA 1QX4A 3C16C 4HGYA 2G1JA 2GAIA 5KOYA 3NC1C 4WOKA 4ZARA 2QTVA 3VTKA 4CMDA 2J67A 2BSQA 4M9QA 1KYIA 2G1AA 3FLEA 2GLXA 2ZJFA 1P1RA 4PANA 3EQ7A 3KUDA 4JXJA 1IMOA 4UTXA 5DGTA 3V1YA 2PWZA 4O83A 1JLKA 2QMOA 2HCTA 5KHLB 2W7OA 3WHLA 3TM5A 3FLBA 3QSGA 3ABSB 3BMNA 2R1TB 4KXQA 1K86A 4Z3KA 1CNEA 1WZNA 1QVAA 2R79A 2R97A 1MF7A 3L49A 3H1PA 4F06A 1QUEA 5B1EA 3F8NA 2DWOA 3NRBA 4ECVA 2A86A 4F85A 5P21A 2PKEA 2YUTA 3MTDA 4UBIA 2QUKA 2QLLA 4B6OA 1KFEB 4DQDA 5IZ4A 4KK4A 2QQ0A 4KKXB 5FJJA 3PP8A 3OD5A 3BN3A 3CG4A 2HRCA 4Q4HB 5SY9A 1JEYB 2I91A 3AQIA 5J2TA 1SC1A 1I0ZA 1ZN7A 2IXGA 4Y8VA 3VPSA 4BV9A 2A1IA 4LF6B 1CQPA 1O97C 4FKBA 4P7GA 1J0DA 3RUHA 3UIEA 3GFBA 4N03A 3TBHA 2H7YA 2QG6A 4V0RA 4ZCSA 2VJCA 1L5MA 2PJZA 4CT5A 4H16A 3EUFA 3ZS9A 3SN6A 1BVRA 4GKVA 3WNVA 2P6OA 2BTOA 4MRMB 5AYVA 3ZNOA 5A2QA 2UUAH 4LJ4A 4BO3A 2QPLA 5IMSA 2WQ6A 3DZIA 3A1EA 2GFHA 1V6SA 4ALLA 5HNKA 3IQEA 3A37A 5J43A 4WBNF 4KE8A 3TL3A 2AZMA 1T29A 2C2MA 2ZI4A 2BP7A 4LVOA 4LH6A 1TVCA 1R00A 4I9HA 1IXZA 1PDWA 1TUBA 3VSEA 1C1DA 4DSNA 3H2GA 3L79A 3O82A 1I3MA 3MR6A 1U0SY 2QUAA 1YR3A 3CISA 2R1TA 3DNFA 1U7ZA 4FW9A 1IRIA 2JLXA 3ED1A 1S2LA 4BLSA 4Z53A 3KXYT 1SOAA 4WFKA 4OLBA 4DLBA 2XR1A 4GI7A 1NVDA 1ZZGA 3NDPA 4I3HA 4DV6B 3FVQA 4QGAA 5EGSA 2KW5A 1YL6A 4EHBA 2IHNA 2VPQA 4QJFA 1K1QA 1GQRA 1ONSA 2AIRA 2H5EA 2C9CA 4RZQA 2W90A 4FT4A 2PWPA 3CXRA 2J9FB 3Q3JB 4AN1A 5HKKA 5LZ4A 2XWQA 2E5LH 3AF2A 3ITDA 2YWXA 2WYUA 1X2BA 1CRQA 4JZKA 1WWKA 1ZM3A 1LBTA 2WJGA 4GQIA 2OFXA 3CKLA 4K9MA 4U6QA 3L6DA 3W5SA 4UCXA 5K8LA 4JI7B 4I4TB 1D6MA 2HLPA 4NS4A 3UMJA 4KGXA 1I7NA 2GNAA 2P9TA 3BA9A 1JYFA 3ZTWA 4GYWA 4FOTA 3CPEA 4MRNA 4FQ8A 5ADWA 1M6YA 3KQTA 3F6CA 3M89A 3B3FA 2H0QA 4ETIA 4D02A 3GLQA 4LY6A 3W8FA 2ZYIA 4A2AA 2NWQA 3L8EA 4RD3A 5LBIA 2VHWA 5SZJA 3VMFA 5G0UA 1EHYA 2Q2TA 4UFNA 1CJVC 1PZNA 1XTKA 4MHSA 5DGDA 4C30A 3WFIA 5IN4A 5DNVA 1HG0A 3WYBA 3EMDA 3UC9A 5EXXA 2MYNA 3DQQA 4LEIA 3FDSA 2CUNA 3I5AA 4KQMA 1NW4A 3OQOA 2OHOA 1AHHA 1ZNWA 4DA6A 4XUGB 5JBIA 5GJBA 2ZYRA 3HEMA 1H2RS 4N5LA 1JFTA 3REGA 4XJXA 1UDAA 1ZWKA 3WB9A 1FRZA 2J3HA 3KKNA 4R8UA 4QYXA 1FVHA 1Y33E 2L2QA 3IMKA 3A1FA 1OXKB 1KH1A 3AUUA 4MVJA 4R2HA 5BV0A 3KV3O 3NOQA 1NXTA 2BKVA 2I62A 1JHUA 2QD2A 4KI0A 3H40A 1A9XB 3VPAA 4BDSA 4LJ5A 4M1MA 4WFQA 3ZJTA 1T4DA 2YCLA 1RWWA 3V42A 1P4SA 3BB4A 3LY5A 4IW3B 3UWKA 5JAUA 2HADA 2OLJA 3DUFB 3RHSA 3SZUA 4BU0A 5FTLA 1T5IA 4BBZA 5DRTA 4CMIB 5JSYA 1WXWA 2VPXA 1RZVA 1MQ8B 4II2A 3UATA 1K5DA 3HY4A 4ZVVA 4H08A 2FGJA 1NW6A 3AL3A 4ALNA 4GKJB 3AY0A 3KJEA 3OE7A 3WLSA 2JARA 2CHVA 3A26A 5CT8A 5L40A 4L74A 2B6HA 4QUGA 4L5YA 3EXG1 3WGQA 1E1QA 3MUOA 3N76A 3WMFA 2DPJA 5HKLA 4OYYA 2NSYA 3VVMA 1IOLA 5JAQA 4YJHB 2D0OB 2VDOB 4W5QA 2HKIA 4CEHA 1P1KA 2WAAA 3OPMA 3GEPA 3PZBA 4G4JA 1XJCA 3QWBA 1MB4A 5BN4B 1BHJA 3DL0A 4XPZA 5LWHA 3CLTD 2C29D 3WR5A 3F5SA 4P3XA 5AFSA 4CKWA 2YZLA 3NU1A 3NVDA 1RYMA 4R6XA 4L6AA 3V2HA 1BFDA 3NCHA 3D5TA 4UXIA 1K08A 3ADBA 3AG5A 2ASJA 1XZBA 4B32A 4ECUA 3PI6A 4YUVA 3ETEA 2V5AA 1DPGA 1G19A 5HKKD 3ZXXA 2OXEA 3B53X 1HNWB 3CIFA 5KSWB 2NVUA 5KYVA 4QBIA 2Y9PB 1ADFA 1W2HA 2XUZA 2ZRGA 3OOHA 4AKTA 2FEPA 4EQ6B 3PGLA 4MO9A 1P2UA 3M1LA 3PPYA 3WISA 4DIKA 4UPDA 2G36A 1PR5A 1GGVA 4ENTA 2PLAA 3ZI4A 3SP1A 1MH9A 1S2MA 4XJTA 3GTJA 1XCGB 4QRIA 2GN1A 3H3XA 2MYTA 4Q4JB 4WX2B 4NWIA 2OV1A 1PN3A 1YRHA 2FWJA 4Y0NA 5T64A 3DVAA 3JD3A 4KIGA 2KYRA 3QVMA 2BQUA 1X77A 1X70A 2R48A 3OOJA 4RXTA 3MSXA 1VYTA 5ESWA 1NXQA 2UZ3A 4UJ5A 4NTZA 4ZQBA 2DFPA 2Y99A 4J9SA 3CZ4A 3GAZA 4P92A 4B3HA 3W3ZB 2PEZA 2TMKA 1FYVA 3GZJA 3NOVA 1SU6A 4TWIA 2BQRA 4LQLA 2OXIA 1VJRA 1S7CA 5AJXA 1W4RA 2R65A 2YZGA 2ZUWA 4AC9A 4MQ6A 1CC1S 1L3BA 2R3SA 4YP5A 3RVLA 5J3JA 2VYVD 1YQUA 3DFMA 3OUZA 1CVIA 2WAQE 3FJYA 1JFLA 3OZXA 4CIVA 4E08A 4F8YA 1II8A 5CT4A 1R9NA 1COZA 4X45A 4ZT3A 2QB5A 4L73A 5ED4A 1EFAA 4LDZA 3RVSA 2HVSA 1OFUA 3IIMA 3TO5A 4G1VA 2QIPA 3IOMA 3OCCA 4R41A 2ZTSA 1SZPA 1GGEA 4GOKA 1KKUA 1UFQA 3EG9B 3LKDA 4LTNA 3W9BA 4M83A 3EBOA 1L4NA 1TXGA 2B3TA 3ETNA 3NNDA 3EUEA 4TXLA 4ZI3A 5J2UA 2EX0A 2G9RA 4PVCA 3A9SA 3EW9A 2X6RA 1D1TA 5AJTA 3PN1A 1JEOA 3TOSA 1N2CA 5HA5A 2CQYA 1RBMA 2AFHE 4RSHA 4CM6A 3ILVA 3FLMA 4LVUA 5KT4A 3B1VA 3I9V6 5BN1A 2B69A 3W2FA 4MA4A 1QJCA 3WWIA 4BMZA 2B4TO 1GAQA 3U0BA 3TNFA 3D6MA 1MEJA 4MV7A 3O0DA 4LK3A 2CMFA 4YT2A 5K5EA 4LOJA 1H9BA 3ERCA 1XRNA 5LYJA 3L1IA 2ONKA 4Y67A 3UJ3X 4FD2A 4DQLA 5KUTA 4CL0A 5KEIA 3PUZA 3PNYA 3C8ZA 4J2HA 3QELB 3IHKA 2CHQA 2D13A 2WFLB 3T8YA 1YNOA 3ZI0A 1M76A 3OX3A 1WS6A 5LZ8A 3EEIA 4MV6A 1JKMA 1EJ2A 4J8PA 5CW1A 5TF0A 4P2GA 1N2OA 2GR9A 2P9ZA 3Q15C 2G1KA 3PC2A 3BFKA 1M67A 1VE7A 4CLXA 4S1VA 4HO1X 3C43A 5I5VA 4JI0H 2ZYVX 4PTLA 4HMPA 3UK1A 3OQIB 2Y1FA 3NATA 5JDCC 4N7JA 1VA5A 4JEHA 4B81A 2ZPTX 5KFPA 1RR6A 2FUG6 3DTVA 3F3YA 2WLSA 4RWZA 5IAEA 3WMWA 1OLXA 4AF7A 2ZIXB 2R6R1 5EOVA 1UC9A 2FPRA 4J1QA 4A2CA 3AR3A 2YZ7A 1XMQB 4ALMA 2C95A 2VRCA 2E82A 2PIAA 2IVZA 3R8XA 3DFZA 4OREX 3ZV5A 3SR3A 3RPEA 1UC8A 4BNUA 3OFSA 5JS8A 2WTFA 1VL8A 1SB9A 1I3LA 2XTJA 3E7XA 2J5BA 4BV3A 2W8LA 5A5DA 3K0HA 1T5TA 3OTHA 2WSBA 4LI3X 4J16A 4BKQA 1QRSA 4U2EA 2F8SA 1ETHA 1XZQA 2XKAA 4BDTA 4BWFB 1EMDA 1NBMD 2Q62A 3BGVA 3QG5A 2XCAA 5JU6A 1OYVA 3QI2A 2X1HA 1Y42X 1I2BA 1T5OA 1Z8FA 1OTXA 2BBOA 5LMUB 3FR7A 4EGFA 3QKSB 5EZSA 4ZO6A 3W5IA 5J58A 1EK5A 4II3A 4Y0VA 4L4YA 4DXHA 5HZGA 2PGLA 1OE0A 2CGEA 1N5RA 4J2OA 3NHAA 3OY2A 4BKOA 1QO0D 5CG2A 2VQFH 2ANBA 3H2IA 2J7PA 2UXDB 2C3YA 4EW2A 1RMYA 2JIPA 5MDHA 2BFAA 5C34B 2C8LA 4TM7A 3L7AA 1N8NA 2G9VA 3HJUA 4DCUA 4DRZA 2AGPA 2ODPA 2NVOA 3ELUA 3NI2A 3O0TA 3DD1A 4UNNA 5H83A 4WJLA 3PD0A 2F8TA 1KP3A 4XX1A 4RJJA 5A02A 4TKMA 3KSDO 3GJ0A 4Z1MA 2GVZC 3RVDA 4MARA 3UGKA 4RHEA 1ZG3A 2HA7A 5C7LO 1Z5WA 1F2VA 2YY5A 3FCYA 1TFRA 7MDHA 3ADCA 3GXBA 1D0SA 3T5BA 1E1CB 5FWNA 3VR4D 4AS2A 1EX9A 5SYMA 4KQCA 3R7WB 3SICE 4M9CA 5JHHB 3R5TA 1H2AS 1XROA 5JH7A 5A7FA 2C4NA 2O2HA 4F71A 3SDBA 1Y81A 1RQXA 5FLEX 1Q0UA 2XGOA 4CQNA 1IM8A 1DT3A 1H2WA 3O3NB 3WMRA 3HEAA 4KVAA 4G8JA 4C03A 1NSTA 1Y9ZA 3FZEA 3EXFB 2O59A 1G2WA 3K2QA 1CJKC 1JRLA 3FPFA 3QEMB 1NIPA 2FG7C 3O9ZA 5IJ9A 1U5BB 4BNLA 4EFDA 1CYEA 2XCLA 2YYAA 2Q9AA 4OXIA 2QMEA 3OQIA 3KHRA 5KTNA 5LNK1 3EVAA 1ZDMA 4XVRA 4G5YA 4Z0TA 2YMLA 5CB6A 5CFRA 4ZK6A 2XE8A 1RI2A 2DY0A 2QN9A 3EC2A 1QU2A 1KS2A 3KD3A 1PGQA 2RI6A 5BN4A 2YVUA 1EUQA 1LI7A 2BM1A 2Q5EA 2XUDA 2PS0A 4GP6A 5CDUA 2KSWA 2PH3A 4M99A 3RSFA 3TCXB 2XRZA 1RPZA 1FIUA 2FPUA 3RM3A 3SKYA 4KEAA 1IDN1 1SQ6A 1TI7A 4AUMA 1DPFA 1JA1A 1YIAA 4NSNA 3WWCA 4UFPA 4IKOA 3JAKA 3EXHB 1Q21A 3RFTA 3BE4A 5IAGA 2CT8A 1SBYA 4G37A 1BCSB 2VYCA 3EQ2A 3P2JA 3SR0A 5MN4A 1JFSA 5CYPA 2KHZA 2R6CA 3PDUA 1D4AA 2PK3A 4LE1A 1O75A 1BW9A 2BHTA 1EM8A 5FQOA 2PGOA 5FYQA 5L6LB 3ZGOA 5FOTA 4KHPB 3Q8XB 3QVVA 4JD5A 3U7JA 1GPWB 2PL5A 4XDYA 3H6GA 5AI0A 5G0TA 2DWCA 1E60A 2IY8A 3LLUA 4NHOA 4EGCB 2LCIA 2FZLA 2G67A 3OZEA 2YXBA 3OIWA 4NCBA 2UVDA 3K2EA 5C4XG 3PBKA 5KG1A 4NJMA 4CE6A 1YUMA 2NAFA 2XXJA 4F6CA 5GZ1A 4BNHA 2FLNA 1QYVA 2ZE7A 1C1YA 5IP7G 1XTSA 2ZROA 3GDEA 1S97A 3AR2A 3QZUA 1DU4A 4RCYA 4XR4A 1DG1G 2E18A 2Y1DA 5HJ2A 3UM9A 4BUZA 5EVCA 1JHOA 4KLZA 2ZJTA 1O6GA 1U1CA 3M6MD 1I36A 3OE1A 3PGKA 4HZUA 3HXOA 2Z5FA 4D0RA 2AR0A 4F9GA 1LBSA 2DE0X 1K0FA 1L6IA 3H5IA 3G17A 2QGFA 1AG9A 1QSGA 1T9KA 3U26A 5IJXA 4GI1A 4TL8A 4MQFB 1XXLA 1BCRB 3AXTA 3DZDA 3F5DA 1H0HA 4I4CA 4OJMX 3JZ6A 1EP1B 3O8LA 4R7GA 5BURA 3OETA 3R2JA 4K26A 1PE0A 1W4LA 2HDHA 3CH6A 3MS7A 4I66A 4TS3A 3PCXA 3AY6A 3AZPA 4NBKA 3WTBA 5DI3A 3WDKA 4Q43A 3Q3IA 5BNIA 1QHNA 5BOVA 3Q2OA 4W5RA 2P62A 1LRJA 2X5RA 2YIVX 1T2NA 4N3GA 4I1RA 4B6SA 5KOIA 3QU5A 1F4PA 4ZDWA 2E3JA 3O95A 5LR6A 3CF2A 4JL8A 4NNJA 1CY0A 4XGKA 2Z95A 4B7CA 1B0UA 1C3LA 4RFSB 1IZ8A 3WWJA 1E9BA 5ERXA 3UT5B 1YU9A 2CNUA 1Q1NA 1T9ZA 3DPIA 1E2BA 1YD7A 4RUAA 2FKNA 4Q1VA 4LV6A 4TSFA 2B63G 2YQ5A 1WDWB 1FNNA 3RYHB 2ZUEA 1H65A 2AG0A 3H0KA 1GHTA 1SC4A 3PG5A 2X7HA 1K6XA 2O8CB 2F3SA 4IO1A 1RWPA 4L5JA 4BZQA 4WACA 1JR3D 2PHZA 4Q4CA 1AKNA 3MAAC 4RF4A 4YMIA 5TIIA 3WA7A 4GXRA 3A8TA 3KEMA 1G4AE 3F8TA 1ZD4A 1IHYA 3IO3A 4KVGA 5DHQA 3TR6A 4BQIA 1EP9A 1FFXB 4M1OA 3IESA 3BMNB 2FXVA 2X0FA 2EP7A 4EB6A 2C9YA 5BWUA 3R9KA 1EDZA 1JA0A 2CLHB 2VQ6A 1RAIA 4G23A 4X94A 1TU4A 4GDMA 4J3FA 1DKRA 1JU9A 1A8HA 1XCBA 4LQDA 4RHCA 3UXMA 2ZCVA 5ALOA 3U17A 4JWKA 2VP4A 5CA1F 1J24A 2WUWE 1MT3A 1L1QA 3QMWA 2CNWA 5FUQA 3DW1X 2WYHA 2XSZA 4YBRA 1JG3A 4YJ3A 5CGZA 4MWSA 1LRLA 1AVTA 3JQ8A 3OURA 4OH1A 4S1PA 3NBZC 3L0YA 1RRGA 1UXGA 4MJ7A 4CWAA 5FA6A 1CQIA 1CZLA 2BR5A 2JK0A 2IHJA 3AHJA 3AIMA 3WIDA 3FKIG 1FDRA 3HA7A 4IS3A 1MTOA 2C5HA 1SCUB 3GUCA 5A5VA 3WRXC 4UPVA 2G77B 3KWMA 3KYCB 5BVGA 1Y14B 4V0MA 2G3YA 1PJ2A 1BGVA 2FQYA 2MDTA 3ZWDA 4B48A 1T36B 5IBRA 1ODJA 1M2WA 1PF7E 4FONA 4ADSG 4MP3A 3MJFA 1V41E 1YONA 4V0ME 3URMA 3CVWA 4QRHA 2Y92A 3C8HA 2AEEA 4HNAA 1X92A 4Q82A 5EP4A 3ZBTA 1KP2A 2PUEA 4O3FA 4W6QA 3ZDFA 4K9LA 3TGLA 2GQ0A 1E1RA 1IFXA 3H1FA 4Q7EA 3DONA 1CLUA 3F1LA 2IX9A 3OM9A 2AC2A 3OE4A 2WU1A 4FTWA 3PWSA 4L1KA 3P9YA 1M6NA 4EW1A 5HCNA 4CL2A 4EENA 4N49A 5HBGA 1FFXA 3FCSB 1XZLA 3FUWA 1LY1A 1AKMA 1E2EA 2C5EA 2JRCA 2NZUG 4GMGA 3GJYA 4LYDA 4OYHA 1RK6A 1KAQA 2NQ2C 2XITA 4JX9A 4HLUC 5FBLB 2V7EA 2ECKA 3OCWA 1BD3A 4QYIB 3H8JA 3SHOA 1GV1A 2BMEA 2YYSA 3VNQA 4LJKA 2ATCA 4CN9A 5LA6F 2Q5OA 2DU8A 1RLTA 4LWPA 3SE0A 2C8JA 5JD5A 3NIDB 3FZQA 2OILA 3EYAA 1WCV1 4LMPA 4O2BB 4HD8A 1WA5A 5IH3A 5JSKA 5I01A 4YT8A 2V7QA 3VC3A 3TQ1A 421PA 4OX9Y 2RAUA 3PXBA 1N78A 2HU2A 3PFKA 5DX0A 2R5WA 4O29A 1TRHA 4XVCA 3BVPA 2Z8XA 1TJYA 3CM0A 2JEJA 2WNSA 3BILA 4WKCA 1J7KA 2FB9A 2P2YA 3OLYA 1NVEA 4GXNA 1Z4KA 4JLKA 1RFLA 3RG8A 4U39A 4JI4H 3SX2A 4F91B 2Q3CA 1IB0A 4LAFA 4FFRA 1FVIA 2CW7A 5DBFA 1QWSA 1XLTA 3G8BA 4IQFA 2HCRA 2XZTA 5JNVA 1KIMA 5LQUA 1MGPA 3N8DA 5CDTA 4LV5B 4HYEA 4PXSA 4LE0A 3MFIA 1H6AA 3ZWQA 1O95C 2C5LA 2EAUA 4DIEA 3CLRC 3VZBA 1DZIA 2HREA 3AKZA 5DGAA 1RTKA 3KIPA 4LFBH 4IIDA 5FO0A 3AUSA 1WZCA 4RDXA 3K30A 1VKZA 2P9FA 5EMLA 3OBIA 4C7JA 3SMQA 3QZ8A 3EBLA 1F8FA 1V6AA 1MPTA 2LP4Y 2AQ4A 2BF4A 1E2MA 1FUKA 2FRXA 2NPOA 1RRFA 5EMMA 1OZFA 5IW8A 1Y8AA 5FPKA 2M98A 1T9AA 2V6GA 5AVOA 1BVUA 3FHCB 3B8HA 2UYYA 1AQJA 1V3UA 1WW3A 1DNPA 1ZX1A 3GLGA 3EOBI 2QUJA 1AZSC 3W8EA 5GVSA 3MAGA 1XEAA 1X80A 2NU9A 4G65A 3S8MA 5BR8B 4HB0A 2PMZE 1KC1A 4E7OA 4JI2B 4C7OB 4PWZA 2H0RA 3LYLA 1M8GA 2AEMA 1P1IA 2H16A 1E1KA 1O89A 1RYBA 1IYZA 1ODCA 2XMZA 4K3VA 1P9WA 2ZBDA 3F6PA 5HTKA 2HMUA 5A05A 4YIHA 2G0TA 4IIGA 4B4UA 1S1CA 5DQGA 3D8TA 3HLKA 3UUFA 4MHOA 4BV2A 4PNZA 1JDVA 3CCFA 1GPLA 4AK9A 3OMWA 4BY7G 2DQ4A 1BX0A 2ZWOA 4DF3A 5KNCA 3DBRB 4F4DA 1I24A 2W2QA 1I4LD 4FHCA 5ALKA 3TLYA 4F9EA 1K8ZB 3AEQA 1H23A 3KHGA 1E5TA 5AM4A 3D3QA 4IQ8A 2JIMA 1PFUA 2Q5FA 2YC4C 1TWFA 4Q0MA 2JCYA 4AJOA 5B4UA 1T0BA 2YW9A 3BXGA 4MS4B 5B53A 3SU8A 2AC4A 3EFOA 3P8ZA 1IYEA 1MAVA 5AI6A 1EVIA 1CR0A 1OZGA 1YMUA 4M4SA 2NU8B 4UFOA 2HU5A 1EFLA 1ZK4A 5I3CA 4A3GG 1OOEA 2VWPA 1BC5A 3K96A 5G41A 4FGZA 1A1SA 1PW7A 4ER7A 4YPOA 3INYA 2O5EA 2PL1A 3K09C 4KXVA 4V38A 1QHHA 2O4UX 4R2JA 1U80A 1PT6A 4JKYA 4FN4A 1U7PA 3DBLB 4X7RA 3LQSA 4WHMA 1OZAA 3ADOA 1C0EA 3E22B 3QXXA 3ZUPA 4AJLA 5DLEA 4B83A 4QJ4A 4I4TF 4C78A 2VF7A 4R2KA 2HHLA 2D2XA 1R0BA 5LL6b 1I01A 1TC1A 3GUZA 3AGQA 2WUVA 3G23A 4L27A 1UBSB 2YR0A 1RM3A 2ZEJA 4HS9A 3TUIC 2J6BA 3ZQ4A 2F1OA 1G8KA 1HKUA 1XALA 2ZQZA 4UJ3A 3WK8A 1V5EA 3H4BA 2J08A 1NP6A 4CE5A 3KOZA 3W5AA 4QELA 3G2HA 1BW9B 2CL6X 4GX0A 3R5KA 4MTDA 3OKCA 2XF2A 1BMDA 5BSTA 3BSYA 1AQNA 1Y8CA 1P1BA 1HDGO 2O20A 2Q1UA 4CMKA 2X5XA 2I4LA 4AJIA 3PJRA 3WIBA 4EATA 3WV5A 1QPZA 1HR0H 2EFHB 2UXBB 1XTVA 5I7SA 4BNFA 2IU4A 2XWBF 4NYJR 2ZRMA 3GI1A 4WK4B 2QYOA 4HV4A 3NMUF 2XA1A 3CVXA 3A6PC 1U2QA 1S5PA 2R6GA 4O7LA 3G2IA 3HI4A 2X5KO 5I47A 3PUKA 2JHGA 2AFRA 1CY1A 4L3OA 5E2BA 2RDJA 2RHGB 5JSUA 2P2CA 2HHCA 3HLTA 3UJ7A 2RGYA 1N6RA 4TTAA 2XCPA 2VSYA 1VHLA 3C6KA 1VYUA 5DYGA 1TYCA 3D0QA 3RCBA 4FGUA 4KK3A 4NYMQ 3V8QA 1GZ4A 1VLJA 3KPVA 3IQHX 4LF9B 2JD1A 4DLKA 3ND5A 1EFVA 1SUDA 2ERYA 3QQPA 4RH3A 3RAFC 3CVZA 3GVHA 4B3RH 1U98A 4BN4A 4ZHQB 3L7DA 4A91A 1HOTA 1FTQA 3EIFA 4X1OA 1ZGGA 3D2CA 4K5QA 4TKZA 1ZUWA 5BVGB 3ZEIA 3GMDA 4YAWA 3OSUA 5T4HA 4KWTA 3T0GA 2P3OA 1RJ9A 1SRRA 2XIGA 3JWEA 4XIIA 3E3NA 3I8XA 3GW8A 1UPBA 3A4MA 3DOCA 2G5CA 3ET5A 3EZ9A 1F0YA 5KNCD 3QPWA 1U8EA 4IVQA 2HM7A 3A9CA 3W6UA 1BWQA 4J1NA 2Q07A 4YVFA 3U7HB 1G6OA 4PLYA 3DT8A 3A1NA 5AJYA 4IDNA 3QNUA 5CA0A 3K7EA 5FAKA 4W5TA 1YR2A 2VZLA 1XVAA 3GT7A 2X0EA 1AKVA 1AV6A 5IT9A 4Z99A 3DV9A 3AYXB 4OVKA 1S2DA 4K6NA 4YAFA 1OT5A 1SCAA 4PC3A 5BNZA 5JDIA 5JEDA 1GTJ1 4FUTA 4PZZA 4EA7A 5FOVA 5A4FS 1WXXA 5GM2A 1V26A 2HIGA 5C8YB 4QOJA 5CA1B 5CEJA 2XTZA 2I4MA 1FUYB 3I92A 2ZRNA 2NUTB 3E5HA 4QPDA 2VJAA 4E5SA 3ZWWA 1BRMA 2IKQA 4JI7H 3OCZA 3PC8C 4DARA 2W37A 1IRXA 5T8KC 2ZUTA 5LN1A 1LD3A 2A8YA 1NQOA 1X1SA 4EG1A 4G07A 3EXAA 2C5GA 2ZT7A 5B37A 1BDHA 2WFAA 3L04A 1CFZA 3ICOA 1XSEA 2BR4A 2VS1A 4JBXA 3QBJA 3F0TA 3UPUA 4LHZA 2V98A 4NKRA 4RTNA 2GCPA 1VHWA 1KZ4A 1K8YB 5FPPA 3TQCA 4QGSA 2DUUA 3FMFA 1A88A 2EIYA 2D0DA 3A27A 4O02B 4A2QA 5BWNA 4TQAA 2Z2ZA 2J7PD 2AFHA 1FFEA 5FR2A 3UAOA 4BGDA 3O74A 3N74A 1T0JB 4GPIB 3A2LA 2DTDA 4U2GA 5H80A 2J5QA 2BE9A 4REQB 1OLSB 1Z16A 4HYQA 2NNLD 3I2FA 3JVUA 4I14A 3WMEA 4N48A 2XV1A 5J1SB 3LQYA 4NCNA 3QTLA 4AN0A 5HVNA 2O3JA 3DFFA 3GQCA 1JLMA 1YQQA 2OPBA 3N2KB 4G24A 2R93G 3L18A 3P9PA 4LV8B 4E5MA 2ZVJA 1OFHA 4M76B 2X76A 3N2IA 2AI3A 2B9VA 1S2NA 2HF9A 2Q9BA 3KSRA 1C0LA 4O1MA 4J9OA 5CLQA 4NU0A 3DJFA 2FJZA 3AIOA 3GNSA 4RJLA 3P9RA 4FBTA 1W6RA 5IRCD 1R0XA 4MA5A 1BRTA 5E6SB 4B4DA 4BO9A 4RTSA 1NJ5A 4GLOA 1HEYA 1I1QB 2X1VA 1K68A 1FQKA 1NR7A 1SUEA 3CKMA 4S2EA 3V7WA 1YQGA 4DLYA 1JSXA 4ONEA 5L3ZA 2RGCA 1T3ZA 4GKJH 4PYMA 5DBGA 3DLCA 1V1RB 2O0KA 3DMRA 3H0EA 2BFCA 2RK3A 4R68A 3I58A 1Y7PA 1U0HC 4UU8A 3TE7A 3TSZA 2ZREA 3OIUA 3OHMA 3P96A 4IDPA 2VFAA 3RKUA 5EXTA 5FBHA 4P4UA 1U6JA 2AJBA 4IH1A 3DV2A 3FWPA 4JQZA 1Z4MA 4RKWA 2XMBA 1D07A 3E3LA 3N5KA 5J23A 3CUTA 4RORA 5JXIA 4I46A 5EQTA 4C2UA 4J94A 4MICA 3JYNA 4I9GA 2V9WA 1OR8A 5KFHA 1OV4A 4MKGA 3RRBA 2YRXA 5DGCA 4A8PA 3R5XA 1WSDA 5HFJA 5E25A 1CUDA 2HQBA 2OGZA 4GKAA 3MS4A 5TS3A 4CQMB 1O8BA 4EECA 5I8WA 2PYIA 1CR6A 5C4GB 1A8SA 5FOUA 5KC9A 1RT9A 5CYGA 1KDRA 2X40A 5BO5A 1TM3E 3JTEA 5K8TA 4U7FA 1Q2UA 1U3CA 2QXYA 1T3SA 3PQFA 3PXEA 5ERGB 2DERA 4LZLA 2HW8A 3DFIA 3RC8A 3GGCA 1MA3A 1DO2A 4RUKA 4CEHB 5KNBA 3DO5A 2QJRA 1WB5A 2X22A 2ZR9A 3E9EA 1V2GA 4UVHA 5DISC 2P3SA 3G2OA 1C50A 2CEKA 2IE8A 4LGVA 3RVPA 1UDCA 2EXXA 2TMGA 1DJPA 1SULA 2OGUA 3SCZA 3HCRA 2NUPA 3IQIX 1AKTA 4ZT5A 3V4FA 3A28A 3JWPA 2J6CA 3JU3A 4RHYA 4LDPA 2HA3A 1Z0UA 1SCIA 2IS4A 4JI8B 4PYOA 1X7DA 4WKOA 3MWMA 1U0GA 2WD7B 2ZYGA 3L7LA 1N5IA 5ICMA 2Q28A 3GO4A 1NMXA 3M3DA 1LWOA 2QVLA 1EBFA 4E03A 4MDYA 4AWAA 2V96A 5CVEA 4EFLA 1VMIA 4WBNB 1IDOA 1OBOA 4HQNA 5K3CA 1FVOA 3PEYA 4K40A 3NBMA 1ZL0A 1Z5VA 4JASB 2JFOA 1R6AA 2VUTA 4YREA 3NHKA 4QXPA 3A0RB 3V8EA 4DV5H 5K0GA 3U40A 4MEJA 2Y0BA 3O94A 3I4LA 3SBDA 2OA0A 5HJ7A 5CTAA 3UFBA 1NQXA 1X1TA 2WSIA 5TEVA 1M1NB 3U7FB 1PNRA 3WK6A 1VB5A 2WG2A 4PFQA 2OBFA 4WUTA 2CVZA 2H5IA 1MVOA 1E2NA 3EA0A 4RACA 4RH0A 1I50A 3T1HH 2IY9A 3AW9A 1D2CA 1Q0QA 3Q5GA 3W5JA