2R87A

Crystal structure of purp from pyrococcus furiosus complexed with adp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
334
structure length
334
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGAKGGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PurP protein PF1517
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 100
structure length 334
sequence length 334
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r87A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r87A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r87A01
3ETHA 4HQ6A 2X0SA 5C1OA 3ORQA 1W93A 2DIKA 3TW6A 4E4TA 4WD3A 2VR1A 5H80A 3ETJA 1UC9A 3AW8A 5K2MA 2R7MA 4FFMA 1KJ8A 3N6RA 1B6RA 2YL2A 4FFPA 4XZ3B 4HNVA 4IWXA 4I50F 3K3PA 5LOVF 3OUZA 1DV1A 3R5FA 4MV4A 2VPQA 1UC8A 1M0TA 2P0AA 4O7WA 2OLSA 1EUCB 3E5NA 2FPGB 4WBNF 1KJQA 2VQDA 2R87A 4O81A 5HV6A 2CQYA 1B6SA 4I55F 2V59A 2C00A 2FP4B 4TV8F 2QK4A 2CNUA 1GGOA 4O7RA 5BMVF 5EZYF 2NPOA 1DV2A 1GSAA 1AUVA 1GLVA 3BSWA 3G8DA 2YS7A 5JVLA 5LA6F 3TINA 4FE2A 3BG5A 5CAEB 2FB9A 4O7VA 4MV6A 5KX5F 4FFLA 4C5AA 3UFXB 2GQRA 3RUPA 4MV8A 2YRWA 2IP4A 2NU7B 4O7NA 4O82A 3KAJA 3R5HA 4EAAA 4FFNA 3QFFA 2YW2A 4IZOA 4M98A 2I87A 3AX6A 2W6QA 4YAKB 1PX2A 5GONF 4EG0A 2YRXA 3VA7A 3TIIA 1A48A 4MV9A 2GPWA 1EYZA 3GLKA 5I47A 5BPFA 3VMMA 3LP8A 3KREA 1GSHA 1CE8A 4O7TA 4O4JF 2SCUB 5DMXA 1CS0A 4NYEA 1C30A 3RV4A 4FGRA 3ORRA 5D8DA 2HGSA 4ZOLF 2DZDA 4MA5A 4GGMX 3U55A 5LP6F 2W6NA 5J2TF 2XCLA 3TIGA 4EA9A 3K5HA 1A9XA 1OBDA 5CB4F 2VHEA 3RFCA 2YZLA 4ZQIA 2ZDHA 4IWYA 1Z2OX 2DWCA 4RZQA 5KKNB 2YZMA 5HBRB 2GQSA 5J2UF 3VOTA 3WO0A 4O7LA 2NU9B 3I12A 2YS6A 3KAKA 4O83A 1JDBB 2YZGA 1W96A 4DLKA 2YYAA 3HO8A 3SE7A 1M6VA 1CQIB 4MA0A 2QF7A 3V4SA 3VPBA 2NUAB 1IOWA 2W70A 1Z2PX 2ZDGA 5JQGF 5LYJF 2R6FA 3WNZA 1T36A 1KJJA 3MWDA 2GPSA 1C3OA 1E4EA 4C5BA 4O2BF 4MV1A 3VPCA 4O84A 3BSYA 4O2AF 2J9GA 3K5IA 5IYZF 4FFOA 3VPDA 2Z02A 1KJIA 1EUDB 3R5XA 2FPPB 2W71A 2R82A 5CA1F 4EABA 5CA0F 3NUAA 4ZHQF 4O86A 2YWVA 4O7YA 3N8DA 4FU0A 4HNUA 5C1PA 4YAJB 4M9UA 4EGQA 1EZ1A 4O4LF 4O4HF 3R9RA 1CQJB 3TQTA 1KEEA 1KUTA 3OUUA 3MJFA 4L1KA 3R23A 4TV9F 1OBGA 4QSHA 3Q2OA 1KC7A 4XYMB 3U9SA 3LWBA 4I4TF 3RV3A 3JZIA 1EHIA 3V4ZA 2V58A 4MV7A 3KALA 2W6OA 2YZNA 2CNQA 4XYLB 2PN1A 1DIKA 3DF7A 1KJ9A 4ME6A 1GSOA 2DLNA 1I7NA 1ULZA 2W6ZA 1E4EB 2I80A 2W6PA 4TUYF 3MWEA 4YJ3F 1JLLB 1M0WA 2XD4A 1SCUB 3JZFA 2ZDQA 4DIMA 2R85A 2I8CA 2CZGA 3BSSA 1BNCA 3U9TA 1VKZA 2R84A 1VBGA 1I7LA 5FNVF 3G8CA 4MV3A 1Z2NX 2R86A 3HBLA 3HB9A 2PVPA 5LXTF 4EA8A 2HJWA 4XX0B 2R7KA 2GLTA 4YBZB 4EGJA 1JKJB 1IOVA 2FPIB 4FFRA 4YJ2F 4M99A 1AUXA 2WYOA 1WR2A 4O7ZA 3GIDA 4C5CA 4J6EA 2R7LA 2NU6B 5JH7F 3Q1KA 2V5AA 4O7SA 5JVDF 2PBZA 4Y8VB 4IHJF 4HNTA 3U54A 5C8YF 2W6MA 4ZI7F 2CNVA 3JRXA 1BXRA 3WO1A 4IIJF 4M9CA 3JRWA 1VBHA 2Z04A 4HR7A 5JQWA 3BFPA 4MAMA 4O4IF 4YB8B 1PK8A 1JDEA 4EA7A 2R7NA 5BPHA 1KBLA 2NU8B
chains in the Genus database with same CATH superfamily
4ZYTA 3HRIA 1MJ5A 1S4MA 2NN3C 2ECOA 4OSEA 2NSHA 4X91A 1XDZA 1AKEA 3HGTA 4KO3S 2YL2A 4EPXA 2ZRCA 3BMQA 3I9KA 2D3WA 2RDMA 1DOAA 1KMMA 3V7FA 3NR2A 3OTWA 3TQQA 3WGLA 4CQMA 1KEZA 1KHHA 2FTKE 1DL5A 1YZLA 2FPGB 4C4SA 5IT0A 4ZK2A 4ZDJA 1ZI9A 3EXG1 2B1GA 1DC5A 3QFTA 1QYCA 3OPVA 1C9JA 4PHCA 4AJ1A 1TM1E 4U7FA 2VBCA 2AMJA 2ONZA 4MS4A 4MVJI 3F1LA 4HCJA 3S68A 4D02A 4D0RA 2AZTA 3LCMA 1R3UA 3A0UA 4YUYA 3MQ4A 2YC2C 3KB6A 4E09A 1L4EA 3HU2A 2F43A 3GMDA 4HX5A 2OP0A 4FCTA 4AL4A 5B3KA 1J2UA 4A82A 5D1OB 4Z99A 4AMGA 1BXKA 1D8AA 3AKYA 5KT4A 4P3OA 2W2LD 1AIPA 3U6KA 3O8DA 4JLNA 5JMOA 4WHXA 3G7UA 4EUNA 1RYBA 2ZIFA 3NEAA 3AFHA 2XCUA 2BGNA 5SZJA 4H6WA 2ZPAA 1IBLH 1FU4A 3A4IA 2I2BA 1DKLA 2H18A 5H59A 4AJNA 3Q5DA 2PGOA 3LQYA 1BHO1 2PVCA 4EUFA 3T6KA 3M4YA 1MF7A 3PCRB 3VHXA 4DZRA 3WG9A 2R8OA 1QC5A 2DBVO 2HYIC 3VVMA 3W9BA 2FKNA 5ESRA 5CM9C 1SUDA 1QFZA 3T7AA 4HBGA 2PBRA 2GT1A 5ARCA 4GGOA 4HDRB 1G3IA 4QGFA 4OGFA 1RAIA 2IOQA 5IN5A 4FE4A 4DSTA 4ZVRA 4LH7A 3HUEA 2GAFA 4ARIA 3GBPA 3EC1A 1GV0A 1H9BA 1NVFA 3MYYA 1XI2A 4Y2SA 4JEIA 1XMQB 4JFRA 4D9EA 1YWGO 3C24A 3CEBA 5CP8A 2JGLA 3R75A 4ZCMA 3EVNA 3N6VA 4BGIA 3L02A 3QQMA 5KI6A 4J2HA 4KNWA 4XOUA 4E03A 1KJWA 1C50A 1A9QA 1T36A 2BQ3A 4OHFA 4CEHA 4RKEA 2ZAYA 5CDTA 3KK0A 3DLPX 3X1MA 3UGTA 2PUEA 2WUDA 2AJCA 3A2MA 4ZT7A 1HEUA 3BJZA 3E3LA 1CS4C 4FBUA 3D4BA 4BKOA 3A9UA 5FP0A 4DM3A 5G2OA 5A3SA 4B80A 4OBWA 2ONJA 2JBAA 2FZ4A 3WC4A 5KWVA 4NCIA 1VGRA 1CRWG 4BECA 1QORA 4MX8A 4JN6B 4HXFB 2VJDA 3RGWS 3PSHA 5FBKA 5BP7A 1E58A 4A0HA 1FDOA 5KQSA 4EZIA 4GBED 2JCVA 1YZUA 2W6ZA 2ZYUX 4QAQA 2G67A 2ACKA 2W93A 3LYLA 1U8YA 4C89A 5C8ZA 3GMIA 4PO9A 1POXA 2BKLA 2GDZA 3FMGA 3EISA 1G2QA 3A3YA 5CGQB 3NC0C 3CTPA 4RTJA 3C4QA 2D1TA 4A15A 3JXEA 5G3ZA 1RU3A 3R9XA 4ISBA 1VSVA 4JC5A 3R44A 4U2DA 5IJXA 4MV3A 1T4CA 4ZZ0A 3TS1A 2NV2B 4UNPA 5IDWA 4X64B 1L5OA 2B1JA 1EUCA 4ZYYA 3EFOA 5IU6A 4B85A 4R83A 3W5SA 3AEUA 4YXWA 2UZ4A 4MWGA 3HH8A 4LGYA 5KC9A 5J59A 2R8BA 3RSHA 3FYUA 4BFXA 1RYMA 5IG2A 3FOCA 3OKCA 1OZHA 4KUEA 5HEKA 1XCBA 1I50A 1AQJA 4TMWA 1P1HA 2YR0A 1L7QA 3PRJA 4YJ3A 2QYHA 4J0GA 1U0HC 1Q91A 3VKFA 2J6BA 1PSWA 5I5EA 4BE4A 2I4TA 4C1NA 9GPBA 2B83A 4L6AA 2QQ5A 4MVYA 4BVLA 1NVDA 3ZPXA 4CKBA 4RVSA 5H4GA 5LD2B 4JP8A 1UM8A 2NACA 5HIIA 1K6JA 1B41A 4OIFA 1AH2A 3A9TA 4PNEA 4FYKA 3WGOA 1XZLA 3FBTA 4GYWA 1FS6A 2PGIA 1KERA 2R2AA 2AIRA 2ZBFA 3I39X 3UUWA 5KTRA 4TV8F 2Y4OA 3NVKI 2QMZA 4XR4A 1YZ3A 2NVUA 2HSJA 1L5QA 3B9PA 2UAGA 5EVJA 1KA9H 5M7EA 4EHBA 1ELOA 4QBTA 4DLBA 2AE1A 1JKXA 1YT5A 4RZUA 3NHZA 2CV1A 2HSGA 4ER7A 3V1LA 1I80A 1A27A 2HREA 2WT9A 4RF3A 2JFVA 1P7WA 4X95A 3HCFA 1L7RA 2RCYA 5AVXA 5HKKA 4ZMRA 1NW4A 2ZWVA 2Q5FA 4DGQA 2DXIA 4BGEA 3OZ7A 3WYBA 4Y6OA 2RAUA 7ADHA 3DV9A 4RTQA 5IZ4A 3A9WA 5ALFA 5TGZA 4PQFA 2P3QA 1XTBA 4ZXFA 4IBOA 3ONNA 4MDFA 4R2XA 4FZ5A 2E48A 5AVYA 2QZJA 1WX1A 3OCYA 3UWDA 1GR0A 4LYEA 4QA9A 4AKSA 4I9FA 3QF4B 4BMNA 2WFZA 3M4XA 2AR7A 2I65A 3H5RA 2C5GA 4EPWA 5IUJC 5TMEA 4C22A 1CJUC 4POOA 3OBBA 1ZIOA 3RC1A 3H18A 5IRCD 1CNMA 3N5KA 2IUSA 3FWNA 2HB6A 3LP6A 3VBEA 5KG3A 2EP8A 2F3PA 4WCVA 4GWLA 3ZHZA 3JX9A 5HYVA 3ZQJA 1L5VA 1VGQA 1AMOA 1SVSA 3GPIA 5IVPA 4MIEA 4Z1OA 1EVYA 1DWOA 5CYOA 1W36D 3ACCA 2AWNA 2Z5GA 2O07A 4CE6A 2AOTA 1R5BA 5CFRA 4QWWA 4FN5A 3GJ7A 1X7XA 4ZOQI 3TIXB 2OQRA 4L2IB 2PHZA 4Q16A 1P4SA 4A6PA 1N6NA 4ZVVA 3HN6A 1EB9A 4O2BF 3DFMA 1QYXA 1CDEA 1ZCFA 2XGMA 2P11A 1HTTA 1XX6A 1U2RA 3CNLA 4Y2XA 5AKYA 3UF0A 1TM7E 1X70A 4FC7A 5JROA 1YOVB 4N76A 3QUTA 4YGXB 4MRMA 3DT8A 5C35A 3IERA 4Z9FA 3V8NA 4XX0A 5JS7A 2Y0EA 1E69A 3LWBA 2HVSA 4QYXA 3H0EA 3EOZA 1C1XB 4J4HA 4M0FA 1NL3A 1G2PA 3AR9A 4IICA 4URYR 5K8IA 2OZKA 3DCJA 3F6SA 4EKGA 2YZNA 4JIMA 4X20B 3KFLA 1AS0A 2VCEA 1DPFA 3HDGA 4UCUA 3BDAA 3TNYA 5A9SA 4Z86A 3C3WA 3SEAA 1I3NA 1JEJA 4H16A 3U4CA 1M8PA 3RYFB 3TMYA 3FD8A 5ITVA 4MUAA 1IN1A 4IDOA 5HCNA 2P9JA 4IIHA 3VGJA 5C3EG 4G36A 2D5IA 1T9DA 3GAFA 4RTOA 1EFDN 5IT4A 1P19A 1TT7A 4NABA 3M4ZA 4KR0A 3WL4A 4Q15A 3IFSA 1MH1A 1Q17A 4QC2A 1SURA 2CFIA 3E2PA 4OHCA 1XRLA 5K3OA 2NVXA 2HIAA 3C8MA 4BV2A 1K7EB 4AN1A 1PG5A 1JHYA 1UANA 3MS4A 1M73E 1M2NA 4LXXA 2WJYA 4OQ4A 2QRHA 1RLJA 2GEJA 3E3AA 3QFRA 5F2EA 4E5DA 3C3AA 1PLLA 3U0VA 4C3OB 4WXYB 1I1QB 1EZZA 3QVMA 5IT9W 1VIAA 2NU8B 4G8CA 1AQLA 4F3RA 4NXMH 2QYOA 1JAYA 1TQ8A 2ZUBA 1YF3A 4BNGA 1E3DA 4OKSA 2NUPB 3G5LA 2YW9A 3NOOA 4NECA 4NBNA 4D4IA 3RTXA 4P84A 4WX2B 3T7IA 4WUVA 2FSPA 2ZP1A 3WYDA 3IAS6 1J8MF 1VSQA 3CQ9A 1NULA 4X8MA 4DMGA 1G21E 1LVHA 1LBSA 1NM5A 1USVA 2BGWA 1KQ3A 3R0XA 2QM0A 2E7ZA 2V4ZA 4LXTA 1ZESA 1KFCB 2RG1A 5JALA 4ZI7A 4O7VA 3KOXA 4WXPA 4AS3A 2HG8A 2VF5X 3AB8A 3SHVA 4B2IA 3UXMA 4GKJH 2BGRA 1IBMB 5CBPB 1XPUA 2Q4TA 4Y0AA 5F23A 3C6YA 1N2CE 1DI0A 1O6CA 3FUTA 2BI4A 5A3RA 1T8WA 4AJEA 3ZDDA 4G5RA 1KNQA 4F7WA 2BM8A 1QFJA 1SUAA 3V8RA 4B83A 3VV2A 1L4UA 5I5YA 1UT5A 1ZVKA 5IX8A 1PJ4A 4OJTA 3DLIA 5DM70 1GTJ1 3AERB 4DUYB 2BL4A 2ZSHA 5J4LA 3WLRA 3NHFA 3IMCA 4Z9AA 4PPYA 3I04A 4ND3A 1XNJA 1Z8NA 4IVQA 2IU6A 4KAFA 1UAYA 1XDUA 1EK6A 4BNZA 2AFHE 1J6UA 3PDWA 4DSOA 1NJ6A 4QGSA 4EARA 2WJIA 3PX3A 2WKPA 3SIPA 5DP2A 1QVVA 1VBFA 5CEJA 2WJJA 1C3LA 4AY5A 3MTJA 2XVMA 3JRNA 2LBPA 1KI6A 3NV7A 1K1EA 1A2QA 4OAPA 1GCUA 2WWFA 4GX2A 2BEUB 1Z56C 2IYFA 4O63O 2IBMA 1G2WA 2AVNA 4M1ZA 1R9MA 4DC1A 1F8FA 2QTFA 4NENA 4QQ8A 4DIOA 3JQ8A 2VKQA 4QAJA 3VVLA 1X8KA 5MN6A 5I9NA 4C0JA 3LA8A 3BJIC 4RAYA 3FZEA 1EXVA 1D4ZA 1H4TA 3EXIA 2G4LA 4G9BA 2G70A 3LQ4A 4I19A 3LWDA 1MBZA 4QPCA 1J2TA 3K8YA 1T25A 5DX1A 3FRIA 2VBIA 4B09A 4NFHA 4TKVA 1EUDB 2PLAA 3CRVA 2MIIA 3DMGA 3HB4X 4P4LA 4ZHQF 3IRVA 3GTPA 3DBIA 5BNFA 1FL9A 2PUAA 2FK3A 1KYXA 3HXOA 4DIKA 1ICEA 1Y9JA 1Y4SA 3TLAA 5JHGB 1Y3DE 4ED1A 1TUBB 3HNRA 2CXRA 2Q2WA 5GONB 3G9QA 5TS3A 4K28A 4PVCA 1C41A 1RRMA 1DCMA 3E2IA 5EUBA 2A9QA 4GBMA 3AEQB 1M8GA 4MDHA 3U5ZB 4DLXA 3B2NA 1XD2A 4A3SA 2MHCA 3FF4A 5ENVA 4WCFC 2Z8YA 2BFOA 3H4VA 5FPTA 5KAPA 4PICA 2PRSA 3DL4A 1BNCA 5C7IO 2HPHA 3ANTA 2AJBA 1OV4A 1LSJA 3WB9A 2F3SA 2CL6X 1VBGA 2RIPA 5DTQA 1Z8DA 4UE2A 2OWDA 4D4JA 4NEGA 2OCIA 3D6HA 3ICPA 3N2LA 4BBPA 3R9IA 4KUGA 3VNNA 1FFCA 2EZ4A 3T5GA 4F1WA 3NDJA 1Q21A 4MVJD 2EDCA 5LZ9A 3ORYA 1QTIA 1BMFD 5B7NA 3NIFB 2ZOSA 4YT5A 2PSHA 1NBHA 5F3DA 1W88B 1FDSA 4O3RA 3JRXA 4AZ3B 2O0JA 2CJPA 4M0EA 4B3TB 3M6WA 2A9OA 2VSOA 3EVAA 3ZD8A 4HB3A 2YVLA 5CFQA 4J9PA 3IAEA 4QSMA 2NG1A 2BBWA 2LNDA 4CMBA 3EEFA 4EK9A 4NR0A 2ZSUA 1GZVA 3IL2A 4WNAB 1B76A 3G49A 1IY0A 1NJ8A 2ZETA 3FHTA 3AP1A 1K6MA 2AEMA 4HKTA 2C0PA 5IBCA 2WF7A 4FMCB 3WX0A 3JQBA 4RQBA 1Y5RA 3TE6A 4BJ3A 3Q5GA 2P65A 3C8ZA 1TK2A 3SDSA 1KJQA 2SICE 3IALA 3LWZA 1XE3A 1JFFB 1YJ8A 3EBPA 4QWDA 2J32A 5EZSA 3JVEA 1KVSA 4X97A 4A3FG 3FNFA 3TOCA 3NC0B 4CFZA 4RIHA 1Q7EA 4GGPA 1T2UA 2KWIA 3TMKA 1LEHA 5A6VA 2VNHA 5TY0A 5JY1A 1SMKA 3KG2A 2K2QB 1CJTC 5DNEA 3OZXA 4S24A 1HT0A 5F78A 4RCZA 2IOHA 3JAWB 3FWPA 2L82A 5F5LA 1G98A 1Z33A 2ZSAA 2PA0A 2ZYHA 4NJEA 2BTQB 2O6LA 3TM4A 4EBEA 1AGNA 3F9IA 3TSWA 1EA5A 3L6RA 2R44A 4ZQGA 1JTEA 4ENPA 5JFGA 1ATZA 1XKTA 1FX0B 2HGSA 3D8SA 1XHFA 3ZWMA 3KJEA 5EZYA 3BD6A 3BICA 1PJRA 4LZZA 3VNUA 1HH4A 1UNNC 4WSOA 3IP7A 1QANA 1YVRA 5KWEA 1GT91 1AS3A 3SC2A 3EOAI 1P0QA 5KG0A 4XD2A 1KKMA 3PW0A 2NZWA 2V54A 2C2YA 3EVFA 4GXTA 2W00A 2ZR7A 4G8DA 4P86A 3VSEA 3WLSA 1VHWA 3EK2A 3W1WA 3KTFA 1XPOA 3PUZA 5CVJA 1E7SA 4ND7A 1HV8A 3BAZA 3QLJA 2XMSA 3UK6A 4BO2A 4Q48A 4NLLA 1D4OA 1E79D 4QDKA 2HZ7A 5C32A 1FXUA 3BSYA 2A1TR 1KDPA 4IM7A 1ZW1A 2ORIA 3BX1A 3HCCA 4BS9A 3UHJA 4YP1A 5MFZA 2RHWA 4FU0A 2HKIA 16PKA 2VWHA 1FJHA 2OKCA 2XQKA 2G28A 4YHHH 1OROA 4LYDA 4CU2A 2GB4A 3CUWA 3RT9A 5KKAA 4PCAA 1MHPA 4KO8A 1Z4QA 2N9UA 3RV3A 3DL0A 1B42A 3B38A 3V48A 3GV7B 2N3ZA 4CL0A 1M1NA 4TTAA 3I64A 2Y3IA 5EWMB 3OX1A 4DQVA 2Z8XA 1IOLA 4JIGA 1PJ3A 3SYTA 5KS2A 5TDHA 1MABB 4DAAA 3VOAA 3IOCA 2YYYA 2ZRMA 2QTHA 3CRQA 3Q3EA 1JHRA 1QAOA 3EQ9A 1FFDA 3S28A 2E4AA 4LCBA 4P4NA 2RH4A 3VBCA 4YQYA 4AMUA 3WWJA 1UBGA 3B13B 2R84A 1SC9A 2FMKA 3UBTA 3SF8A 4W6QA 5BWNA 2O2ZA 1ODJA 3ADBA 2F9LA 3TO5A 1IIBA 4G25A 1VHJA 3AW9A 2BC9A 1JJAA 4BO3A 1ZUNA 1TQDA 4MW4A 5DE3A 1Z17A 2JIRA 3TE7A 3ITNA 3HNPA 4IX1A 4I6EA 4PAOA 4YLEA 3K0BA 5JJCA 1DINA 1V8ZA 1TA0A 1CW2B 1OH5A 1SIOA 5C31A 3CVUA 1RAHA 3KFVA 2IZ5A 3DT6A 5A3JA 4GW3A 2B63A 5C46F 3AHFA 2WMOB 1Z88A 2MMGA 4OV6B 3W8RA 3ESRA 5IKOA 2QL7A 1ISPA 2PKRA 3REFA 1KP9A 4IZ6A 1ZMRA 2HBYA 2P3SA 3A4NA 1R4NB 1GPMA 4BFCA 2GAOA 1UPBA 3W4JA 1PJ2A 2ACEA 4QUJA 1XNQB 3GD7A 2ZJ3A 3P27A 5DNDA 3PCXA 1FZTA 3LY7A 1DXYA 3U44A 1Y1PA 4OXKA 3ZQKA 3TSZA 1HX7A 3R5SA 4RACA 5EWJB 3VR6H 4K9RA 1KSGA 3K9WA 2GZ1A 4XGRA 3AVOA 4EQ6B 2IUFA 2GPTA 5KEIA 4U7GA 4V0NA 2C7RA 3ZIAD 5AXAA 1VB5A 2R8JA 3BXOA 2QAGA 3UJPA 3CZ5A 4TYPA 1YK0A 4MQFB 2Q46A 2VRBA 4RNDB 3JSXA 1QV7A 2FZEA 2P7IA 2WLSA 2IHZA 4BNMA 1OR8A 1SEIA 5JAPA 1NVMB 5EC8A 1NNLA 2REOA 2GCIA 1QIIA 1YJCA 4G8BA 3FAKA 4MQUA 3ABQB 3W5AA 3P0EA 5K4GA 2HGWA 1W8DA 4I7EA 3TBFA 3EQ7A 1DVRA 1V16B 1WD5A 2Z9CA 2F1JA 4H7KA 5EWLA 3ZCTA 4KXWA 2QP3A 3MGCA 3URKA 2H31A 2G9QA 4I55A 3GYGA 3N2ZB 4U6QA 4MINA 3U55A 4ZT3A 1QE5A 1TYEB 4B3RB 4MWSA 4KSBA 5AVJA 4UVEA 3LUJA 1EWKA 4D96A 5C3UA 4KBGA 1IN8A 4ECUA 5CDYA 1YFJA 4Q4JA 2ADOA 4J9UE 1CHDA 4R8UB 2GQSA 4D43A 5E9QA 3PHIA 4RFSB 1DQNA 3MLBA 3QTTA 4JBGA 3PB3A 5CE8A 5DQGA 4WKBA 2EQ5A 3O6VA 4KJZA 4HF7A 2YYAA 4UZEA 4E3WA 3LVFO 5ENZA 3UNXA 5H83A 4BX3A 4PX5A 2ATEA 1K1SA 3KJHA 2QE7D 2CMDA 5KJFA 1ZINA 1MPTA 1WHTB 1T5LA 4OK3A 3OQIA 3ANSA 1MH9A 4CC5A 4LJKA 3BDIA 5H5JA 3CXRA 3AFMA 3RSLA 2OGSA 1DBWA 4DE5A 1D2EA 1Y1QA 4K6KA 5DNUA 2E4WA 3E81A 4C4TA 3IDQA 3A9SA 2IYSA 4R1TA 4C7BA 1WMEA 3ZE7A 4NCNA 4PSKA 2QTWB 3KJGA 1C3EA 3I0NA 4RK7A 5B3AA 1ISGA 3OE7D 5ADWA 3LDUA 3D5EA 2XODA 4ZEMA 3A3NA 5DYWA 3Q7QA 4AB1A 5LLSA 5B1DA 2DYKA 4CL3A 5FOXA 4B3MH 3S5JA 1WETA 2JFWA 1E7RA 1N7GA 2QLMA 2ZTLA 2QZSA 1FSZA 1AA6A 1W30A 1FBTA 4W8HA 1W6UA 1J8YF 3O9VA 2H07A 1NQXA 1NUSA 2BFWA 4HXGA 1UM9A 2VZ9A 4RUCA 3HWRA 1WB9A 3KB8A 3KUKA 4OQMA 2IW3A 4WK4B 3ZDZB 3NI2A 4RY8A 5L3ZA 1QB7A 2QZ4A 1OFHA 2CW8A 5CVTA 4X62H 5CT8A 3ILXA 3A1NA 3QM1A 2D1QA 4EMBA 4NV3A 2XGGA 4KFCA 2A1UB 3DTVB 3STYA 3GLUA 1N9ZA 1DO8A 5TPWA 1XFDA 3ZJTA 1V4NA 4C30A 2X8JB 1NI4A 1V48A 1J07A 2H4WA 4M99A 5GOTA 5DG9A 4RZRA 1GUFA 3ECAA 4ZYWA 1TCAA 3BFVA 2VPTA 2BFFB 4L8LA 5GV8A 2OV3A 2ODTX 3E05A 1PGNA 1FA9A 3ES9A 3WIEA 4HB2A 4QQKA 2C9MA 5AVZA 4FFBB 3HP4A 4GC9A 1RPNA 1XVLA 1QK5A 3EEBA 2IXFA 1O0CA 4S1WA 5EIOA 3M6VA 5BXQC 5C0OE 3IAM6 4EO4A 4JLDA 4DYVA 4EKDA 3ID6C 3GEPA 1TC2A 4I8IA 2D8MA 1DMRA 4XZ3B 3EIOA 1EFPA 3AONB 3ERCA 4PAMA 1A8QA 3N0RA 2A5GA 4R9UC 3HA5A 2B20A 1OFGA 3LQQA 4OQQA 3OPNA 3A27A 4B6PA 1OMOA 3WK6A 3WJAA 1A4IA 4DRFA 3CO0S 1PJZA 4GMXA 1OASA 4YRAA 4L6IA 2MJLA 1W0KA 1YQEA 4WCFB 3OIWA 2I71A 3OF2A 4RVUA 1NURA 4BLTA 2CHUA 3DXFA 5CFOA 3RH0A 2Q1WA 4AZVA 1AKNA 4FFLA 4IIJA 4C4RA 4BY1G 3OZTA 1M2HA 3NHJA 3NKFA 3IJEB 4LJSA 4RESA 5AM1A 1FPMA 4J3NA 2FV8A 4MO9A 3PGJA 1F1BA 4F4ZA 4RBNA 1SYXB 3HY3A 1AZWA 1WMFA 3OZWA 5BT8A 1MQAA 1ADCA 4J2OA 2OAP1 4JOCA 4GKVA 4CHTA 2C94A 1XK6A 3QPCA 1HBJA 3PIIA 4RSRA 3GJRA 1NQ5A 1ES9A 2HDNB 3KREA 3PFBA 1OI3A 2GCGA 1CS0A 4M9SA 1YDWA 3SBOA 4NS4A 3EVZA 2EWVA 5ALMA 3R5KA 5G1NA 4DRXB 1E2DA 3KEFA 4Q66C 1PWEA 1R0LA 5F5NA 5IXJA 2D2VA 4GVLA 3QNWA 3VYTB 3UQZA 5HBRB 1ESZA 3JWGA 4AN4A 3ELUA 5ESXA 2Z2XA 5TQ2B 1PZHA 3PGLA 2P0EA 1KTAA 2B63G 4C7MA 1L6IA 5AKHA 4CIYA 1QSGA 1VL0A 1WLYA 3OZSA 3KOYA 3DCYA 1SCJA 1YL7A 5EKUA 4JP3A 1UJCA 4M6WB 2FLPA 2VTBA 4REQA 5CFLA 3GW8A 1GKKA 2PJZA 1MW9X 5BWLA 1KDZA 1LDGA 4Q1EA 3CLHA 4F0JA 2PFSA 2FW6A 1WOYA 5FFNA 5AP9A 2ZGIA 2W71A 4KQWA 4OFWA 1U9IC 2X6QA 4KR3A 4BLRA 4ERNA 3UT6A 1VDZA 4V1CA 3UK0A 4YV1A 3R9RA 4ARCA 4M0LA 5DBFA 3L4SO 1YUMA 5HE8A 3GARA 5EJ9A 4P8RA 1GD1O 2K7FA 4QHTA 4BN5A 5IABA 1LTHR 1U0SY 3CEPB 3WE7A 1UBTS 4N40A 5BSRA 1RM4A 1B7GO 2FPIA 3HTXA 3GFTA 3TXAA 3P9CA 3QY0A 2G6BA 3PHJA 2UXCH 3HU3A 1E4EB 5ES4B 2XNDA 2G1UA 5HTKA 4CMEA 4DDTA 4PXAA 2JKZA 2FN3A 4GOJA 3K8QA 1Y34E 1VYHA 4GI5A 3PVZA 1XSEA 3QHQA 4RSHA 4DBLE 1YR9A 3D59A 1DAHA 4JP1A 3T5JA 1N9KA 2VPSA 5FJ8G 1X13A 1EA7A 4CM3A 3KBOA 2JFUA 3CV3A 3LP5A 2HK7A 4G0MA 1CUSA 3LUGA 2VA2A 4F60A 1P1CA 1D2MA 2J3QA 4IDFA 3A7DA 4MWDA 2JANA 4FINA 1K4KA 3COSA 4ZC1A 4E22A 2RJ3A 2QSJA 2JARA 1MX5A 5BOSB 3P2OA 2QQ0A 3G2NA 2QN3A 3OM9A 3KXIA 5HK8A 3HI4A 2CNVA 2GDJA 4N3GA 3ZOKA 5LB4A 1QH8A 5K0BA 3K35A 4AU1A 5EQDA 1XXLA 1L5YA 2IS6A 3K72B 2CNDA 1O97D 1G8AA 1N0UA 4PQEA 1LX6A 5A5EA 4DLNA 4F71A 2YJ5A 3AESA 2IYUA 2W7OA 5J58A 5FXMA 4I4NA 5AM2A 2CV0A 3AHDA 2BGGA 4OHUA 3JD2A 5L7TA 3ZDBA 1AVTA 4JROA 1N5DA 3IILA 2GN1A 5KG6A 2XUQA 3UENA 3KSBC 1FFGA 1O1YA 2Q9BA 1WZUA 4EW1A 1D1SA 1ZD3A 1RTKA 3MIZA 1PUXA 4C07A 4ECVA 2PK3A 2HF7A 4B84A 4R5HA 3GRRA 2F59A 1J1ZA 4BYMA 2B1RA 3HOYG 2BCJQ 1G21A 4JI3B 3ZV3A 3FROA 4KMMA 5LOVA 2G8LA 2WI8A 2Q41A 4P4SA 1Y3HA 4N47A 4P81A 5LXTB 2PZEA 1LLUA 2Z3ZA 4CM8B 5I5UA 1XRPA 4TKMA 4IJQA 3IV6A 5NULA 2C31A 1GIAA 2APJA 2R1ZA 2O8FA 4L50A 1N2CA 2C3YA 1XQ1A 1CVRA 3IVXA 3CTMA 4PZUA 3EXEB 2Y1XA 1JU4A 5AW5A 5K0CA 4DQXA 2WNHA 3EYWA 2DFVA 4Q7MB 5T4BA 4D4HA 3L1JA 3IODA 3WNVA 5JJBA 1KYQA 2K4MA 3S6JA 1K5DA 4CNQA 2DPXA 3T5DA 4QRHA 2YZMA 1C7JA 1HNWB 4FS1A 3K32A 2C1EA 1PYGA 4O33A 2X0JA 5J47A 2DBZA 5C44G 3D7NA 2PGNA 2HA7A 2AFHA 3OZIA 2NO1A 3WWEA 1OXTA 1PJQA 3PD7A 3K0KA 1KI7A 1VSTA 1K0FA 3KDSE 3RIEA 4TMFA 5I8ZA 2RHOA 3FAZA 3DBOB 1KRWA 4BCDA 2VAPA 4IH9A 2CDRA 4O84A 1OC2A 4NKRA 1JZTA 1RRGA 3RB8A 5LA6B 2X5OA 4S2UA 5DKFA 1KH3A 4J16C 2PKQO 3GIQA 4MDYA 1V1RA 2GILA 3TQTA 2R6AA 3SY8A 1ZNQO 1V7CA 1H3EA 1N8NA 2QJTA 4OCZA 2N1MA 4WKGA 3Q9SA 4BB6A 1C8KA 4FOPA 1OU4A 2J0UA 3DHVA 3DZJA 2GEBA 4D6XA 4HMPA 4KGVA 1ESNA 2PS9A 4NG5A 2J6HA 4BATA 1VHLA 2DFTA 1UQUA 1VYTA 4EH1A 2EBHX 4I1UA 2IQIA 4KPGA 4UVGA 3UHPA 4JBXA 2Z6AA 2F90A 3TM5A 4F12A 1FUKA 4KIUA 3PRKE 5CEEA 4LV6A 4DV5H 4XDHA 4FKMA 1G64A 2AW5A 2GNOA 5JG7A 2QXYA 4FYIA 1XEAA 2ZJ2A 4RD6A 3BK7A 4YCDA 4G5OA 4QPNA 4RD1A 4OJKA 3FY4A 4MR9A 2WWIA 4FEEA 1YS7A 5FF9A 1I0ZA 5DHRA 3B6JA 1BFDA 1EK2A 4OATA 2EV9A 3W1VA 3DBLB 3H2GA 3UMSA 3PVCA 2Z9DA 4RZ2A 1IOVA 3NWJA 2EP5A 3K1TA 4KTVE 1IY1A 5I5GA 1ZAKA 3K0HA 4WK6A 5EQJB 3U13A 2IXTA 1IZ9A 5D5PA 3CO5A 1IYDA 1E9EA 1OWPA 1EDOA 1W59A 4J0HA 3KTAA 4WQMA 1WCYA 3Q6MA 1N34B 2DH6A 2ALJA 3D2CA 1CY8A 1DBIA 3KVOA 3ZWPA 5K0GA 4OOEA 4E15A 4R6XA 4E4TA 1FVXA 2H1SA 3ASZA 1EXDA 4IJWA 3KYCA 1H9AA 4O4HB 1UJ4A 3U7RA 4JASB 1E7YA 1PEKE 5K0EA 1D9XA 5C34B 4CM9D 3K0AA 2Y1GA 4URHA 1KY3A 3NHRA 5BW5A 2HMTA 5LLTA 1I2DA 4DCJA 1J42A 4DSZA 3IA7A 2CNUA 2OENG 3VNAA 3BBLA 2B61A 3V32A 1QIKA 1GRVA 2O52A 4FFSA 1QGZA 5FL7A 2Q50A 3L04A 1BN6A 2YHAA 2P2SA 3A32A 1SOVA 2HU8A 4PSUA 4HUJA 5EWJA 1VIYA 2G0AA 3ZHTA 2OZLB 1FJGB 2C4HA 2AF4C 4DR7H 2Y9MB 3ORSA 1ZJ4A 5LZ5A 5BUZA 2B0JA 3PJFA 1ZGZA 4B3IA 5AIAA 3QE0A 5KOJB 2GZDA 3V6LA 2PGAA 2YWBA 1N6PA 1SUBA 2WM9B 1P9LA 2PJRA 4N8SA 4C6TA 3DDCA 5A4MS 4I4IA 1G42A 4U7JA 3QGMA 3FMVA 3TCXB 3RV4A 2VAXA 1R0SA 2ZG6A 1GUAA 1H2YA 4MA5A 1LS6A 5TPZA 1WMDA 4EG6A 3AL0C 3C3XA 1TA4A 4YRMA 2JLZA 3OFJA 1OBDA 5TC4A 3H40A 1W19A 2LGJA 4QJ5A 3AHCA 2YZLA 2IQ5A 5E7IA 2ZVPX 4R3WA 3PP8A 1TAGA 4GPIB 4ABYA 4NK5A 1M2VA 4BNXA 3OHMA 2F67A 4RVFA 2BEJA 5FBZA 2J6SA 4YPFA 5B57C 3WYGA 1CUEA 4RKWA 3SEFA 4JNCA 2P35A 3K2BA 3R3HA 3TXXA 4HHEA 3FPFA 3QWUA 1C0PA 3T94A 4LNUB 1SVIA 4UAJA 4BBAA 5CG1A 2RH9B 3I01A 3WNZA 1QXSA 5BWOA 1TVMA 4WK2B 2P8SA 3FPSA 3FJ1A 4N8EA 2A5FA 5CBKA 3ZWNA 2RI1A 3AQIA 3S0JA 4J9LA 5EXXA 1XRSB 1T3TA 3DTNA 3TUIC 5KFBA 2XSZD 1Q0HA 3NUAA 3RS3A 2C03A 3HKZE 2EX4A 2FKAA 4JXJA 4U0JA 5IPFA 4IV0A 4A3IG 1KY5A 2FW1A 5C9ZA 3BMOA 4UE3S 2FETA 2QSUA 3DDWA 2XXJA 4DV7H 2H1IA 2FG5A 4JHLA 2W2KB 1SCIA 4PGMA 5KYVA 3GCWA 2Z5LA 3O8NA 4CKCA 3KALA 2J3KA 1AHNA 1KDOA 1K2WA 4DA8A 2DABA 3GBSA 1SQGA 1R6AA 3TXYA 4XWTA 4AF6A 5M29A 4V1CI 2AI2A 4TM8A 2EW1A 2XXBA 3AY3A 1N6IA 3CB2A 2AFRA 3SICE 3QPBA 1YQQA 5AW6A 4JVSB 4LYHA 4I5DA 1GNLA 2HEIA 3AF3A 1NJ1A 3VU9B 2JBWA 5IAKA 2XUDA 5B5SA 2REXB 4AF7A 5ADHA 1MQ9A 3COJA 4B6JA 1KO1A 1X7ZA 1GPDG 2G1KA 4ZI2A 4UDXX 2JVIA 1G6HA 2ZB8A 4X8OA 3IOYA 1VCOA 5ESDA 4EY6A 3WLFA 3Q0EA 3S40A 1IBLB 3J80A 4LWQA 3FWHA 4FKZA 3BHMA 4HWTA 1H66A 2CLSA 1D2CA 3N7TA 2GCOB 3TJRA 2FPWA 4ZV9A 4PR0A 1D2GA 5KT7A 2QYTA 3SXUB 2BR3A 4HZUB 4O7SA 5LMNH 1OLXB 5JT1A 1IBKH 1XMVA 3L5KA 3L8DA 1UMDA 1A96A 4ALLA 1ZRSA 4XLTA 4AQ7A 3PJEA 4ECXA 1C1DA 5JQWA 4QYIB 2GRUA 3ZWXA 1K98A 5CB8A 4E46A 1EVZA 1PDVA 2ASEA 5KC8A 1WO8A 2NO4A 4RY9A 4Q6WA 1QHHA 4L5JA 2DIKA 3OHSX 3A6LA 3D9QX 3PQDA 2JLWA 4TYYA 4JWKA 1VHQA 4ARAA 3JVDA 1Z0KA 1BEEA 2F3UA 4RV9A 4XDYA 1M0TA 4Q4AB 2E6KA 1Z0UA 3DFZA 4JB3A 1V9LA 2EWWA 1BGWA 2GD2A 1RQGA 2WWGA 1GZ6A 3H3FA 1G5IA 5CDFE 1UADA 3E1GA 3OUTA 3DKVA 3VYSB 4TQUS 2G6TA 3DKPA 3IB6A 4DCGA 3LULA 3RRXA 4FI3F 4X00A 4EY4A 4K6MA 5I8PA 5F2KA 2OXEA 3QLTA 2QRKA 4FZJA 4O59O 3FMFA 3QF7A 3FH0A 1U2DA 1GCIA 2IDZA 4AECA 1HLFA 4AI6A 2FRDC 4U00A 3PWKA 3QVSA 2A5JA 1O77A 2XADA 1Y1LA 2CD7A 4QBIA 3T3NA 4RPHA 4WNIA 1IM2A 3QU9A 5LKAA 3SZOA 2QTVA 4MQ4A 2XIGA 3V2HA 1Z35A 1JR3E 1RSZA 1RCTE 2BAGA 2XCSB 2CVFA 2FW7A 2XVZA 4OHPA 1GG5A 2X2FA 1L1QA 3NP7A 1ZOLA 3LNTA 2JF0A 5HGJA 3LVRE 2WHPA 4DJDC 3VKGA 1I6KA 2YWCA 3ZEIA 1H0KA 3K30A 1TQ4A 2J30A 4DA0A 3G8YA 1IXRC 4ODIA 2PH1A 2VP0A 4G2TA 2OO3A 2AOVA 3PWZA 4ZQIA 1SXQA 1DJLA 1TT5A 2PD4A 2DWOA 1AK9A 2J9XB 4J75A 1C9KA 3G5TA 1XZBA 4IS3A 2O7VA 4TL8A 3VHLB 4JI4H 3JQ7A 4I50B 3RJZA 1Y5MA 1FP1D 1TIPA 1D1TA 3FR7A 3T1TA 1XF1A 3CX7A 4CTMA 2O19A 1C7IA 1O8CA 3VR4A 5F3RA 1U6KA 2E2IA 3DNFA 2X23A 1JVNA 3K6RA 4XYLA 1FP7A 1CRQA 5I7AA 2GPSA 4O4JA 3OX4A 1E6KA 3PI6A 2O3QA 3IDFA 5HBRA 4ZOLA 4E11A 2UUPA 4DCCA 5DG8A 1YOBA 4CMHA 3GTJA 4O86A 4JB0A 1YHNA 5ELXA 3TVYA 1R9GA 3DEAA 4BTEA 4CMAA 1Q0ZA 1L8XA 5BQ5A 2GUGA 4M6WA 4TV9F 1X7DA 2CL7X 1A4XA 4R69A 1PHPA 3UKJA 5JAHA 1OH8A 3GILA 1HPLA 4UUGA 3D6UA 1T0HB 1E6MA 4GZ3A 3EVBA 4D3SA 2I6SA 4PLWA 1T8SA 1SHUX 2Y77A 3L8FA 2GR9A 3TKAA 3LDAA 1EHYA 4RMHA 1YTUA 4JD5A 3AJEA 2ZI7A 3HNOA 2JLAA 3KAPA 3ZI7A 3OQBA 3DWFA 5BW4A 3KQVA 4R2JA 3KWLA 1TAUA 3IVGA 2IHNA 3EQ6A 2ZR9A 4IQ4A 4U5QA 1L4KA 5C53B 4IMPA 4UOEA 4ETWA 5IYZA 2ZDQA 1ZAUA 3VJRA 1SKUA 1O94C 4OHWA 2IHKA 5CB4B 3TX6A 3WWHA 4GP7A 3UW3A 3K6JA 2WWYA 5EIXA 3OZFA 3NP9A 1PL8A 3W3AA 1FTGA 2YY5A 5KFGA 4WLFA 4DJ5X 5EXEA 1E3JA 3DGFC 4PZPA 2ZXUA 2ZAIA 1W29A 1VRWA 1Z62A 2R6GA 2EJ3A 4US2R 4GH5A 3HHPA 4L95C 2A5DA 4FT4A 1E59A 4I4TA 1E2QA 1TWFA 5JNTA 1T2VA 1TJ4A 4F06A 2LTAA 4EX7A 3AVXA 3ZXYA 3HMQA 1ZVQA 4P3XA 3PQCA 3GJYA 2G4CA 4BP9A 1H94A 5CT9A 3SPXA 3B1ZA 5LMUH 2GK7A 3MUEA 1F8XA 3MG9A 4X54A 2BVNA 2YCHA 4EB8A 2YMMA 2CCJA 1LRLA 3ICWA 4N54A 4KZPA 4YDSA 2R7MA 3FKIG 4D5GA 1XAGA 2BJWA 2R47A 4EGFA 5B4UA 2HO4A 2P9TA 4YAKA 4D26A 2B94A 2FCAA 2AMFA 1WNFA 1YL6A 4ND6A 1PWYE 3E2MA 4ZGBA 4OHOA 2BMVA 4WBNF 2WIBA 2VQDA 3JQRA 1AHIA 2PUJA 2RGRA 4UUBA 3L0OA 1KKUA 3PUVA 2YOGA 4DQKA 3IP8A 2XTJA 3FOZA 4E5MA 1DV2A 4IV8A 3VH3A 1NVGA 3G8DA 3LCJA 4ZOBA 5FA6A 1JUDA 2CFTA 3PEFA 4DR5H 1E1QA 3W8NA 2R1TA 1PEAA 5JYEA 2A14A 1J7JA 3QNMA 4FPXA 1U0NA 3OSPA 2JEJA 3AF5A 4XA8A 3FRHA 1RWPA 2VDWA 3VH2A 1W75A 5DGAA 3G9XA 1DHRA 3KETA 2MINB 1JA0A 1S9DA 5HF5A 4D46A 1V5WA 2RH5A 3MR2A 4AKGA 4J3FA 2OHHA 2QT1A 4D41A 3BILA 1TKCA 1UK8A 4EB3A 3RIMA 1Y8RB 5JY6A 2JHAA 3IDSA 5I5VA 3LO8A 5BW8A 5BRAA 4XQCA 1BU5A 5EXTA 1JMYA 1ZCBA 3UUEA 1O4VA 3IBCA 3ZK9A 3ZQ4A 3HDTA 3THWA 4OMDA 2WKQA 5TS2A 3GRFA 3QMWA 4AO6A 1SJ9A 5KINB 1S3FA 2O0HA 4BZXA 1HFJA 3JVVA 3A10A 5E2AA 3OFNA 3B8HA 5KMGA 2WTMA 2O8CA 4ZVSA 5P8WA 3INGA 4HADA 3CBGA 4A2BA 2A2ZA 4UU8A 2R8XA 2Z2JA 1OWNA 3CGWA 3EBLA 2J41A 1CP3A 3JASA 1JA9A 4RA6A 1M1XB 3DZGA 4X3PA 5EVCA 3MOGA 3GVIA 5COQA 5I9IA 2ZS7A 5BYKA 4HAWA 4M8LA 5EE9A 2O8BB 2JGAA 4CJXA 5DN6A 4BUCA 3V9PA 2AK3A 4JJGA 1N2XA 5U4XA 1W87A 2UXDH 3M6AA 1ONSA 3M6UA 4NXMB 1KO5A 2CNLA 5KG2A 5HA5A 1FUUA 3L3BA 4O7YA 1FQWA 1XCPA 1IUNA 3WWDA 5FWYA 2HV9A 3SBDA 1Y9EA 1XA0A 2F1HA 2ISSD 2OH2A 1VSUA 4ESHA 5AK4A 3U3DA 1E2UA 1UAAA 3GV8B 2RHGB 1U7TA 1M2GA 4FM9A 3E8MA 1J33A 3NDBB 3EF3A 2WPDA 3KZOA 3NJ4A 5BYBA 5CCEA 1KMIY 2ACVA 3MTEA 3EWIA 4FJ0A 4ZOCA 3K1AA 2FZCA 3VNRA 1GSOA 3KOMA 5KFOA 3M6IA 3GLVA 2FEOA 3GUHA 1NBEA 1F0NA 2PD6A 1HT3A 5CFPA 2ZYGA 4G4SO 5IVDA 4ND1A 5CNMA 4WESA 1RS0A 4J7XA 4A1FA 1HRKA 4EKNB 4K3VA 4CMIB 3RTBA 2PRZA 3C5VA 3FI9A 3ICOA 3B9RA 1TEXA 1V1MB 3QI7A 2AXPA 2I03A 4FP9A 5JXWA 4JR1A 5K3FB 1T6ZA 3FOWA 2DSTA 2ZRLA 2FPGA 4KL8S 2Q1SA 2FVXA 1M2FA 3HJRA 4DUZH 2I1LA 4C5CA 4PLZA 3H8JA 5JSHA 3TNFA 3QVGB 1NR7A 3MQ2A 3OWXA 3CRW1 4LJ8A 2JRCA 3MWMA 3ILVA 2GFIA 1KQFA 1C8VB 1SHJA 5A5DA 1SBHA 1XVAA 1QH9A 4QFDA 4X94A 2CHFA 4E5PA 2PRJA 3VDRA 2WZQA 1HSOA 5D1OA 3TTVA 3FUUA 3RVBA 2Y93A 4D6PA 2PIAA 1AE1A 4HEA1 2WSIA 4KXNA 3IBTA 4HPXB 2HO5A 1VJ5A 1G3QA 5AXDA 3UT0A 3E7DA 4FYPA 5BQPA 1IJBA 1T2AA 1VMDA 3D6AA 4PZZA 4HDQB 2HLHA 4RGVA 1RLTA 1Z5UA 4ER6A 1XL0A 3ZN2A 1V5GA 1YZFA 1H6BA 2PJUA 1Z7GA 1OWTA 3I6MA 1HFWA 1ZEMA 3OQPA 3LF1A 4JVMA 4V0ME 1VCNA 4IFBA 4QOFA 4HDRA 2O57A 3HYRA 3WS7A 1WKVA 1B0UA 3E3MA 5IP5A 3TMAA 3KPYA 1G5HA 3R7FA 1JLRA 5AK0A 1H4QA 4D97A 2ZROA 4QEKA 2FH5B 1VHDA 4IMRA 2R7AA 4MV9A 3BTVA 2C7BA 2BLNA 3GJ6A 4NDAA 3G59A 2P6OA 1EZ4A 3L07A 3VMMA 3NHYA 4K46A 2J4DA 4IV5A 2BFPA 3N7AA 5K8TA 4HOYA 2JFZA 1JSRA 4IEEA 3ROXA 5GGYA 3GVHA 2KLBA 4AW9A 1PX0A 1HORA 3OA0A 4R2MA 1R37A 1XEFA 2M6KA 3SLGA 2PLNA 4BP3A 4UUNA 5HFNA 2VCYA 3ONWA 2RKOA 5FDFA 4JENA 1FFBA 5EMMA 1W9MA 5AOCA 4GSYA 4J76A 2V3VA 3SVLA 1BGVA 3FUVA 3KSMA 2AN9A 2QW0X 1SQSA 4DW8A 4XJXA 3MJ4A 1VP3A 3NTOA 2BISA 3O73A 5TF4A 3RSSA 3D0RA 4Z4QA 2A35A 1N57A 3L8GA 4UFNA 5J43A 1MVNA 1TMGE 1VPTA 4QTUB 4WZAB 3C48A 2F00A 4FC6A 2PWAA 1AN0A 1V8BA 3QMVA 5D7NA 2GKGA 2NUBA 2GLXA 3OJXA 3BE5A 1SOWA 1DBPA 3LPDA 2ZJ8A 2OVFA 3RO7A 4BO6A 4XJSA 4RXMA 5KFEA 4ZT4A 2VEOA 5DNAA 4LRQA 2Y1KA 2I3GA 2D4AA 2RK6A 3OZUA 4JZYA 3S7ZA 1EBUA 5BR1A 1GDHA 2Y76A 2OHFA 3VVBA 5GZ6A 2GJ9A 2J8ZA 1NYLA 3VTKA 1R6DA 4N0QA 1CIJA 1NPDA 4IKPA 3NNNA 3Q85A 1ZN9A 4ZCTA 1E4OA 1E7WA 4GLLA 4MV7A 4OP2A 2OORC 2GYWA 5KFAA 1N2OA 1DJPA 3LHKA 3ELWA 1XROA 3DE6X 4ZCSA 1MAAA 1X39A 2YIDA 5BMOA 3QFCA 2IE8A 3S44A 1D04A 2GUWA 5M34A 4ILEA 3RS8A 3E3OA 1ILWA 3TW0A 3AIIA 1Q14A 3T1HH 2RBEA 5DXFA 1L4LA 4C2AA 3FTQA 3OC6A 3VZDA 1L8LA 1N5RA 4QNRA 4F96A 2AT1A 1D2AA 2FFQA 2GJSA 4KG7A 2RB4A 2E89A 4TMVA 2ZJTA 3A6KA 3AF1A 3KVVA 3ZDRA 4M86A 1JQ5A 3KZKA 1FDIA 3O5AA 3WMWA 2FR8A 3PTLA 4ZEOA 2X5KO 3GEBA 2C5AA 1R0YA 4OUDB 1CY1A 2X7JA 4MWTA 1K2VN 2XLCA 3OIVA 3HP1A 2FPRA 1I51A 2H4JA 1T0BA 1ORTA 2WVHA 4ZO7A 4PHGA 1YIAA 1TDJA 2AB0A 1ZS9A 5AK3A 4DCSA 1I7DA 2C8VA 2FSSA 2PUBA 2PMBA 4EB0A 1QQAA 1KC1A 5JFOA 2G36A 4OQYA 2R8GA 2GBCA 1NZJA 2WMDA 3WGQA 2XUIA 5JE8A 3DO6A 4ZKEA 3UUGA 2DQSA 5F64A 1R6TA 1N6RA 4NEQA 4RORA 4LDAA 3HPRA 2HNBA 3RRBA 4ZD6A 2PUFA 2UKDA 1IG3A 3VZCA 2VJAA 2VNJA 1R7RA 3QF4A 3KQOA 2DHEA 1WPGA 1LLFA 3J7AK 3F6RA 2G5TA 4LBVA 3UK1A 1MXHA 2DOKA 5IC4A 1FQJA 1G8SA 2AJTA 4YHHB 2JZNA 2UXBH 3ND8A 2BBSA 2PT6A 5CGZA 4KN6A 3NTXA 5ECYA 2G82A 1Y7LA 2EC5A 4QDXA 3H0GG 3I3SR 2D0IA 3QPWA 1Z37A 1ZETA 1K7XB 2ZT7A 5K05A 3G1WA 2J5QA 3Q41A 5D01A 3MCUA 3BN3A 4G0UA 1KYIA 2W0SA 2IYWA 3N75A 4L2IA 3AKDA 5ES3A 4YO8A 3UWMA 2VN8A 3TBKA 4CMKA 5COBA 1S2OA 5I5WA 1U7DA 5DSXA 1ZVMA 1YMVA 3FLAA 3CLTC 3BORA 1JA1A 4Y6QA 2Q28A 1QIDA 1JPUA 5I7VA 5A03A 1KAQA 1LJUA 1VJCA 5LQUA 1PD1A 3EZ2A 2HF8A 1E60A 4HWPA 1EWQA 2PLWA 3DE5X 1DIHA 1P4GA 3BE4A 1F2TB 2I9KA 4BKQA 1YOVA 3E7PA 1C0KA 4ZZ3A 4NH4A 2W2QA 2Q6OA 1S3SA 2BFAA 2V55B 7MHTA 5SV2A 5LLDA 1UKCA 5AUOB 5GVSA 5JD3A 2DTXA 4TTRA 1R4MB 1N6OA 1C1XA 2ZB2A 2FHSA 5KNCH 2QOEA 3QNUA 1YRYE 2XWPA 2J9FB 4MR8B 4X20A 3S2FA 4P0TA 4E2FA 1QNFA 1K6EA 4O2AF 3D8HA 1KI2A 1NJSA 2DE0X 3FTCA 1KJIA 2FPPB 2F8SA 2VDJA 4AS2A 3RYFA 1CQZA 3LFTA 2ECFA 2ID4A 3OSNA 4IOLA 3GH1A 4BJ5A 3KU1A 4RZ3A 5DVZA 3MR6A 5LJLA 4QM7A 6NULA 2H51A 3B89A 2GVNA 2Q2UA 4BNDB 2ECKA 2QTZA 2XYGA 4TL6A 3KQQA 4L8VA 2A84A 1IMOA 4CQMD 3F4KA 1JG3A 5CD9A 3MT0A 3L7YA 3AB3A 3ENKA 4YPVA 4A8HA 1RC0A 3C2QA 4A92A 2X1MA 3TUZC 4Y2HA 1JX6A 3HWWA 3I8SA 1PUIA 3HKZA 3DF7A 3ZW8A 5FOSA 3D0KA 4MGIR 3PDHA 4XUCA 4DNFA 3T61A 5BWVA 3TLEA 1POWA 2I6GA 2QMYA 3U4GA 2JIPA 4HQKA 5KFWA 1CR4A 4NFSA 3OT4A 2GAAA 1QV9A 5ITZB 3RFTA 2QTTA 5FA8A 2NU8A 1Z2AA 2AQIA 2E2HA 2BLLA 1AOXA 2DPLA 5DWDA 4M87A 3CH7A 2NUPA 4I6JA 3PS9A 4PBSA 4N5HX 3TOZA 4MIOA 4BN4A 2AZDA 5DO9A 3F5DA 3D7MA 4RVOA 1H1LB 4M8SA 2UVWA 1I1OA 4E6PA 2C5HA 5TT1A 4B81A 1CY2A 4M22A 1THTA 2EYQA 2DLDA 3L6OO 2H17A 2QGZA 5LB2A 4LV5B 3ZHSA 3WFIA 4YONB 3AHHA 1PNOA 3T3OA 2FRVA 4Z54A 3GFOA 3VU3A 5AHKA 1TU3A 3RBXA 2YUTA 3PFHA 3SS7X 3I32A 2JI6A 3GGCA 3CJTA 3LBIA 2WJVA 1KEWA 5CBPA 4MCJA 2V6IA 4HQ6A 2OXRA 3ORQA 4FLMA 1B6TA 1OX5A 2BF7A 5L3SB 1KK3A 2ZTHA 4TYWA 4NC9A 1TWGA 3HXLA 1WU8A 2FW9A 1URPA 5FL7D 5KPDA 4CCWA 4A6XA 3A11A 4Y98A 4LF4H 3AERA 4I1PA 2GCEA 5JRDS 4KQ9A 1GNQA 4OQZA 2VZ8A 4I2NA 3I34X 2C5LA 3SHTA 1VKNA 2R11A 1WXGA 3A28A 4YR7A 2PNJA 3O1IC 5AWFC 5FWDA 4Z8XA 3F49S 5EUCA 2J0EA 4Q1FA 2P77A 2GCNA 1GGMA 5CDFA 2BEUA 2BTOA 3M0EA 4PC3A 1TO6A 4ZAXA 1PAUA 5ETJA 4C4AA 1YHZA 3BWMA 4B3MB 5JUWA 1WUIS 5TPZD 3TQSA 1QO0A 2GCPA 3B70A 1RBYA 3Q72A 3EPLA 2JD1A 3U3JA 4RD2A 3E7FA 2WYIA 3TTXA 4UBMA 3G6YA 2AFIB 2RONA 3HZHA 1Q0QA 2Y1FA 4AROA 1I3CA 1QS0B 3ROPA 1RYDA 3SX4A 4LIPD 4B32A 4D0NA 2R6HA 3RWBA 1EUDA 4DWJA 5BWXA 1LQUA 2G9ZA 3OLZA 4HNRA 1E0SA 1JR3A 2VUGA 4XGNA 4WKNA 2ZRPA 3AUKA 2OILA 1Y3BE 3VOTA 3N43B 2NUTB 2DUUA 1T5OA 5DYTA 1XTKA 1OH6A 2YNMC 1VL5A 1TUBA 2ZBUA 1ZONA 1YQWA 4MV5A 5GONA 3HZOA 2Z9BA 1OJ7A 2V1XA 4Q39A 4YXWD 4QL3A 1E1RA 1RWVA 2VTEA 4U3JB 4KGZA 4JKOA 4E12A 2VF7A 3P9KA 1WDKA 1QUFA 4Q19A 3ZZ0A 1GO2A 3ZW9A 4NCJA 4COOA 3UMCA 4RD0A 4ESEA 2ZSKA 3AEQA 3OG9A 4M54A 3QU4A 1PO7A 2Q3JA 3FMPB 4CI9A 2F9MA 1T8YA 5FH9A 3AKEA 3GZ4A 1K3FA 4HPWA 1OX4B 4RXUA 4YN3A 2BGMA 1GG9A 4TS1A 4LXQA 5EP2A 4JJZA 2CKZB 3H17A 3HN7A 5H16A 1VKOA 1U6IA 1CZOA 1AUOA 1II0A 1GL3A 1CG6A 1T5HX 4OQDA 3PWSA 4P1ZA 1X0XA 1Y3IA 3HT5A 4OEHA 4U7PB 2Z4SA 3I8OA 1CEEA 5EJFA 2A5YB 1KQPA 2R7ZG 2PKQP 4X3CA 2JVKA 4GPZA 2UUBH 3RSFA 3WAJA 3ROGA 3KR9A 1YR8A 5F9HA 3NWPA 1I1MA 2B2XA 1T1GA 2CHVA 3K9CA 3ZDYB 4UDOA 3NALA 3AB7A 2GM9A 1TJPB 1JAZA 1W88A 3RKRA 2VSFA 5T57A 4AZ3A 1I10A 3Q5EA 4A03A 2MSCB 3ASUA 2R3SA 3KQKA 2HIHA 2HW8A 3L1VA 4UJ3A 3BA1A 2JBHA 1D8TA 2ZFUA 4RA9B 2GD6A 1ZJJA 5HKKD 4NU0A 4X61A 1ST2A 3FWYA 4OKIA 2HWYA 4KR2A 521PA 1IUPA 4BVJA 4WNAA 1W25A 4Y6GB 2VHJA 3F6YA 1FXSA 2FE4A 1NA5A 2FFAA 4EDHA 3OX2A 4D2IA 1JFFA 1BGXT 1KBOA 3FPJA 5JH7F 1G5TA 4FSDA 2EBUA 3VJMA 1RYHA 1Q44A 3CLSC 3DHWC 5TGTA 3ZI4A 1OVMA 4BX8A 1R0ZA 3TSOA 1MEEA 1CUZA 2A88A 2W4MA 1P45A 4N6OA 5FJIA 1LGYA 3T0IA 4IGEA 5J9FA 2C92A 2X0RA 2BUBA 1NY5A 4MEJA 3ANMA 4AYBE 3ZVKA 4ZU6X 2ON6A 3DMRA 3JAWA 3MD9A 4YQWA 4GKKH 2IY7A 2BFNA 1F12A 5EXDA 2CJFA 1VOTA 2BTQA 2Z5VA 4B34A 4BO7A 5HWSA 1MRNA 3L1KA 4YDHB 1PZNA 3STXA 1FX0A 1NFQA 5KUTA 1JDJA 1CRPA 3MNFA 4MW7A 2IEDA 3GLIB 2TMDA 1BX1A 1HRDA 3A04A 3BHIA 3EAGA 3FDJA 2IP4A 3EYAA 5ECDA 3NM4A 2HJ9A 4QREA 1C4WA 3KOUA 2R8RA 3SNKA 3BDVA 2XKAA 1IEQA 3AYXB 4LN1A 3C5CA 2YRXA 2HXYA 1A9XB 3B51X 5I5TA 2EJTA 5KFUA 1CUXA 3WMFA 4J0QA 4TGLA 4C0WA 1Z73A 3PGVA 3HQ4O 3Q98A 3OWHA 4COKA 2UXCB 4FGJA 1MJHA 2AHRA 2VJNA 2QQGA 2VH5R 2F6RA 4BVEA 3DEKA 1UKVY 1ZM2A 4B47A 1EDBA 3Q7RA 2QX6A 2P27A 3I9V6 5IHPA 3KTDA 3OU7A 4TT3A 3PRHA 1EUQA 3WL5A 3M2PA 2IP1A 1GQQA 4PCUA 4YY3B 4H6XA 3F96A 3FBWA 1NUTA 5A6SB 5JO9A 3GIJA 1DRVA 5HMLA 1KR5A 4P80A 3D3JA 4HN4B 3MILA 4EGCB 4Y2UA 2FMUA 3HO6A 3L4EA 1O57A 1Y82A 3PGMA 5BR8H 3HVKA 4QPPA 1V43A 1EBFA 4MUHA 3VDNB 1GILA 4XPZA 4IXTA 3OZBA 3H13A 5EWMA 4C2BA 3KC2A 1V45E 1M7BA 1H0SA 3HEAA 2AMYA 1MABA 1JG1A 1CT9A 1NKVA 3SJCA 3PG5A 1E9VA 1PR6A 1NG1A 1R3DA 4YQEA 1YMQA 1TTHA 1G5PA 3DVSX 4PS1A 4PZ0A 3GJ5A 5KU1A 1YRAA 4Y2RA 2YXLA 4JT9A 3RDPA 3G2QA 4ED0A 1P81A 4CV1A 1CY6A 1DRWA 3A2LA 5AFSA 4O3MA 1S01A 3ND5A 3FOEC 3BAFA 2CNWA 3H2KA 3HVIA 1P1RA 5JOQA 5CH5A 5DCUA 1YS4A 4UAUA 3LK7A 2HU5A 2QN6A 1NVBA 4R2KA 1CZRA 5EDWA 3NNSA 1RYZA 2SHKA 2KBEA 5H82A 2X8AA 1ODFA 3R7AA 4D57A 2FE3A 3QE4A 2OO5C 4NMHA 3SQLA 1P0CA 2D0DA 4B4WA 4EBDA 1A7JA 5CTJA 2J45A 3JQ6A 4BV3A 4LRXA 1R4NA 1IXZA 1AMUA 2PWYA 3H8WA 4TTQA 2VYNA 1QZZA 1Z2NX 5KTTA 3PDCA 1MG0A 2JGNA 5HNEA 2PVPA 1TZ2A 1E1YA 1DOHA 3F47A 2EVWX 2JDIA 3HXTA 5ICCA 4B3XA 4BJHB 4OI0A 2OCXA 4IY1A 2D6FA 1NLFA 4EQ6A 1KZ7B 3LYUA 1TYAE 3TWOA 3GFFA 1HYQA 4KAAA 2QI9C 1ZGGA 1Y6GA 4MQFA 1T10A 2FN8A 2CCKA 1SIUA 4DDMA 5E95A 1UBEA 3IMKA 2C2MA 3VR5H 1KRHA 1PVVA 2L17A 4YP3A 4KTTE 2ZULA 1H93A 5I48A 1XN4A 3Q2KA 5CW2A 3DEIA 5B7PA 2XZPA 3W4IA 1T0IA 3CW2A 1K8XB 1MNAA 3ESDA 1V16A 2B4YA 1CR6A 1LBTA 1NMXA 1E1QD 5FLMG 1QDEA 3O4IA 3WGIA 3F8TA 1HYEA 3COYA 1DC6A 3EUAA 3BWDD 4YT4A 3QX8A 3AC0A 1RXUA 3NONA 4ITUA 5TR9A 4BMPB 1IE3A 3MUNA 3T7CA 4YMSA 4XSHA 5JS2A 1PR3A 5IDVA 4PZ9A 5CIYA 3WLTA 2TMKA 3R7LA 1WTAA 3FKIA 5B4VA 3IMEA 1N9GB 4R8UA 4JLPA 5T4EA 3W5IA 3GRYA 4RFSA 1PX2A 1MA0A 2NX2A 1VE6A 1X1SA 4M88A 1B2LA 1CYDA 1XJQA 2DPIA 2OQVA 5KTPA 4V0MA 1WHTA 1EJBA 4JV5H 4XJVA 3WHKA 3V6HA 1GQRA 1I3MA 1ZL2A 4BJ1A 2VPXA 4AUNA 2BMEA 2GEKA 3ONVA 1HQDA 3T41A 4Z9XA 4MVJM 2A1HA 4CLEA 1ANKA 1AA9A 4MK4A 1EJ6A 5IJ9B 3HYSA 1S0MA 3Q9NA 4B76A 3WGJA 2ZIGA 1P39A 1XZFA 4QBKA 5H4HA 1M2OB 4HDCA 3W6NA 4OLFA 1PQWA 3G8BA 2F55A 5DN6D 3RC7A 4NPHA 1TIBA 4WMLA 1LB1B 1U3GA 5K3BA 2H16A 4OU5A 3CM0A 2HV8A 3N2EA 1E92A 3EN0A 4XWAA 3TEJA 1FRFS 4YX9A 5FRDA 4OBEA 1YE3A 2RC5A 3C3JA 3PXXA 4TVSA 1G63A 1RXVA 3M49A 9MHTA 5GGXA 1A8HA 4F84A 2ZJFA 5BN5B 4IHKA 5KT5A 3FA2A 1U7HA 3R0IA 3QJYA 1OZFA 5C1PA 1ORHA 1U11A 1RHUA 4KRGA 4EJ6A 4JYPA 3VYUB 4F4WA 2CL0X 2KS6A 5B55A 1H6AA 4B3FX 2VK1A 1GLGA 3V7UA 1OC4A 3LLVA 5FEMA 2A1UA 3DTVA 3R0VA 1B8OA 3O2SB 4GE3A 1NVTA 1R8JA 4DB2A 4D3DA 2X8JA 3E8XA 3S8MA 3UUFA 3ZWKA 2Q2VA 1EXNA 3FHOA 5AKKA 5CA0B 3C7KA 4LS3A 3J80W 3I6IA 1D6JA 2EERA 2BFFA 1I33A 1B8NA 1L7PA 2HA5A 3UT5B 3T9EA 4FFBA 5DIFA 2RGCA 3EB9A 1PT9A 5LP6B 3ZXSA 1U2EA 4X90A 5MDHA 2XGSA 3V42A 4Z7QB 3WKCA 4DR7B 2QJFA 4AP6A 5F2NA 4MICA 3TRJA 2CMKA 2CY0A 3F7TA 1XD8A 4QFCA 4XZ3A 4HZGA 2FA9A 5AO9A 3WYAA 5LFAA 5ICMA 4HTFB 5E3JA 1ACMA 1G8YA 4RZXA 3SBEA 4IRXA 3HR4A 1FZQA 1Q77A 1XUOA 2X22A 3V33A 3ILSA 1TIKA 2BFCB 2JFXA 3M6FA 2QAIA 4J6EA 4NCKA 2WM3A 3HKBB 1MO6A 4WCFA 3WIUA 5JQGB 1L8QA 3FUXA 1E7MA 1KH2A 2H3HA 2VXCA 5AKEA 4OXNA 3GUUA 2D5AA 2EFGA 1KVQA 4S1TA 4CM1A 4XFJA 3IP6A 2TS1A 1PE0A 3LXMA 5ALOA 2HADA 5KFPA 5L1JA 1UFKA 3AVQA 2NSJA 3V8VA 4CIXA 3A8TA 5A04A 1UXJA 5DNWA 2AGOA 2VF4X 1C4XA 2HCFA 1DFGA 3UOGA 4UARA 1NE7A 1UH5A 1P80A 3DCIA 4B3BA 3AGQA 2C5FA 3TW8B 4A3JG 2C2DA 5FQNA 2QL9A 4KQJA 3NB0A 4B5KA 4I36A 3PEYA 2CMFA 1E96A 2OR3A 2ZTVA 2XNJA 1YMUA 1EE1A 3P4YA 1C14A 1M2JA 2CHEA 2FB9A 3C70A 3M6XA 3UFXB 2H11A 4DRXA 5K3EA 3EA5A 5T5QA 2HCRA 4L9WA 5B1YA 3CGGA 1JKFA 3W04A 2N75A 1ZK1A 3ZW7A 5C37A 6REQB 3IUPA 4CODB 3WXMA 4R71A 4JOQA 4YP6A 2P3OA 4G0VA 1ND5A 1XZDA 5TQ2A 1KJNA 2XTMA 4UQOA 3J7AC 1TAQA 2VDPB 1PR4A 1ENZA 1QQTA 3AUYA 3LP8A 1SHZA 5KNDA 4UASA 4XE5A 1T1SA 4UU0A 1RRFA 4PQYA 5DMXA 4W7SA 2ENUA 2YOHA 2XMDA 2C7VA 1SOAA 3O1HB 1ACJA 3ISJA 1AM4D 3BXHA 2HHAA 4IDEA 5KYWB 1RM5A 2HPZA 2RBGA 2IYLD 1QO7A 4GMKA 3F6CA 1UEJA 1NF9A 5LU9A 3G5UA 3M34A 5G53C 1BVYF 4OHRA 2ZE5A 1II9A 1DFHA 2CT8A 4JBIA 3BGIA 2JHFA 3D8NA 4JBHA 3SHOA 1BEZA 2DUMA 4IDGA 3B7PA 2QV7A 2JIDA 5JLJA 4CF4A 4V0QA 2RH8A 3K1YA 1GZ7A 2PEYA 3HZRA 5LMNB 3IV9A 4GC5A 5BVGB 5E8RA 1IBKB 3QHPA 3AIKA 3LPNA 2GF0A 1WSWA 2DTEA 3A4TA 2PQ0A 4G89A 4AKEA 4WKPA 4KYTA 5TE9A 1E4EA 4FJ1A 4PRZA 5BV2P 3EAFA 3TLKA 2Q5IA 1VHTA 3R5XA 5KDOA 1SVNA 2ZS9A 2G77B 1VS0A 1CJMA 1RXWA 4JJIA 3BXZA 2QN8A 5K8CA 3JCZA 3WJ7A 3MJFA 1FLVA 3KZNA 1FDVA 3Q2OA 1OI7A 2CYCA 1J0XO 5G4LA 1NC1A 2IPXA 1M6VB 3A9CA 2GFQA 4N8DA 1YR2A 1I7SB 1A95A 2X14A 3PX7A 2IGBA 5BOSA 5BSKA 5AQ1A 5C5DA 3KZMA 3NDIA 3O3NB 3PXBA 4Q9HA 2WOOA 3NTUA 2RHTA 3ENZA 3BH0A 4D4GA 1V35A 1G9SA 3L7OA 3BTSA 3IG0A 1GP2A 2WMNB 3K0CC 5AXBA 4J9OA 2GBFA 4WVLA 2WQ7A 2C9ZA 2VUIB 1F17A 3HJCA 3U81A 2CZGA 2PY6A 1DKNA 1SOUA 1ZJWA 4ESVA 4RLFA 3W6PA 1WQ1R 3LPLA 1RZRA 2FOLA 2PS3A 4G4SP 4JUZA 1J0AA 4UULA 1XK7A 3T5LA 4ED7A 3PC6A 3E5RA 4OLAA 1GT6A 3T0GA 4HH0A 1RXSA 2J3IA 3Q1KA 4L4YA 4D7AA 4WN3A 1AB6A 4TLCA 5AXCA 2EF0A 3PTAA 1QWSA 2ERCA 3CG0A 2Z04A 2F4VH 1UUFA 4R7ZA 2DQKA 2VQ3A 3H84A 1F7UA 1EDDA 3CISA 3TRFA 4QUIA 4BWVA 2G80A 2OFXA 1SB8A 2V4QA 1FNDA 5EJIA 4KB5A 2CJYA 4JI4B 2EWMA 3A1SA 4O4LB 1J00A 1I6MA 5AI5A 1HF3A 2NZJA 2J6IA 4R0VA 1B6GA 3TLCA 1ENPA 3ZNQA 3E5NA 5LXTA 4CM8A 3OLWA 2FF7A 3HEBA 4Q9IA 4ER0A 4YRZA 4MCHA 3SFZA 4BVBA 2J46A 5I5XA 3EXEA 4FB5A 1UOOA 1I6WA 4E2ZA 4C3ZA 3I6QA 3AIMA 1ZMOA 1VJDA 4R41A 4G5HA 1CP2A 4WZAE 2R1UA 2X0NA 3PLAE 5JO0A 3M9XA 3LUHA 5CG2A 2HIXA 3S70A 1GYPA 1QTNA 4DR6H 2PYZA 2M6LA 3O3MB 3CF0A 2JGMA 3HC7A 1P4AA 4C76A 4CV2A 3AFNA 1CIPA 1I1KA 3V1UA 1LK5A 1YRWA 1Y1WA 3AOEC 1XO1A 4AWBA 1WDTA 3I5UA 1I6UA 4TMTA 1P5FA 4K0RA 3NTQA 5JJLA 3DKRA 2TSYB 2C4WA 1TW2A 2CLIB 1CB7A 2E0IA 1P62B 3EQ8A 2Y1CA 4JSRA 1JDUA 3GROA 4CN9A 1KE1A 2HRQA 3HJAA 5LA6A 1A9XA 2FCRA 2P2NA 2GTHA 3OC0A 1KARA 2PKEA 1PJBA 1GZ5A 3H0GA 3EJ6A 3NANA 1EVLA 3AVYA 1S2LA 1DAEA 4M1TA 4GKJB 3IPLA 1T9BA 3AV0B 1J56A 4O7LA 1P16A 4XUGB 2BGUA 4W5WA 3H19A 4LZOA 2CJWB 221PA 5HF9A 3Q7TA 3U40A 4BCCA 4ZJUA 3HCRA 4RKYA 2DJ5A 1DNPA 3GJSA 4PYMA 2J0VA 4OYLA 2NNWB 4Q7EA 2Y9PB 3H9EO 5LMUB 2OG2A 1KMQA 4L7QA 1MFZA 4BO4A 3EDQA 3GVCA 3ZTYA 2EJCA 5D7BA 1Y80A 4E5YA 1Z82A 3G68A 3WGUA 1XV5A 2PMDA 2FX2A 1DP4A 2KSQA 4KK4A 3S2EA 4H6PA 1R5JA 1Z5GA 3JQAB 1J5PA 4KXFB 3K9BA 3ZOZA 1GQFA 4CC6A 3ENWA 3DBLA 3EEQA 1PTJC 5KHAA 4YVFA 3KD2A 5CJ2A 4LXYA 5CCXA 2GN2A 5KFSA 1E6UA 3WWPA 2FPSA 1W0KD 1Q0SA 4D9GA 4ETMA 2OMEA 2FPLA 1Q84A 1XQXA 3H75A 2DM6A 1VMIA 5AJHA 1QJCA 3PNLA 1PV1A 5E7JA 3KPUA 5ELMA 4NHEA 4DR5B 1BTOA 4US1R 1UBHS 2BELA 3DA8A 1QKJA 3KTMA 5K1ZA 4KI0A 1QHEA 4QG7A 3V80A 2AXEA 4R40A 2Q5HA 5JMPA 2J5KA 3DZDA 1NVKA 1OXKB 3KQPA 4ZOEA 3VTAA 1ECGA 2XTAA 1MB4A 5K7SA 4M1MA 1KOGA 3T5AA 5FNVF 4MJXA 4X71A 4O4HA 1TJ5A 1K66A 5FOWA 1CQPA 4LECA 1U2ZA 4EW6A 1CR2A 3AJAA 2OQIA 3D3QA 3H5TA 4RTMA 1GTRA 3OM1A 3WB1A 3OH8A 4ZRDA 4QLBA 3HVRA 4YHBA 2OAEA 3LX4A 1JH8A 3RF6A 4CM5A 3O84A 4LKRA 4Q34A 4PSCA 1YB6A 4AMVA 4C14A 1GRNA 4M7OA 4ETIA 2I7VA 3BXFA 3MERA 4F5ZA 5CIWA 1P6QA 1KSHA 2XLBA 1OAAA 3C16C 1K75A 2VZEA 2Q07A 4GECA 4EJMA 2ZRFA 1P60A 1XL1A 4HG2A 3I5XA 4H7FA 1KI9A 1YBAA 3UC5A 1OA0A 1E5QA 2BP7B 2GJ8A 1U8UA 2C2RA 2OZLA 2WVAA 2Z3WA 3KV1A 1S6YA 1P0MA 1Z38A 2C58A 4LG1A 2ID8A 4CN8A 1RJQA 4F4CA 1TTTA 1BS2A 3U3ZA 4BQEA 1E63A 3B1VA 4DA9A 5KOJA 4AJOA 1N2IA 4MGEA 1JDNA 1RI1A 4NPAA 5H0IA 2AOUB 2QRVB 2Q4DA 3H2BA 1RHJA 3DEHA 4AYBA 4P93A 1DKUA 3RVNA 3WK8A 1JU9A 4XLZA 3SI8A 1P0PA 1VIVA 2DKOA 1A71A 1YASA 4X65H 5AVQA 1I3OA 4C5AA 3NU1A 4UCTA 2YZ2A 2EIXA 3DFIA 1S2NA 2IGTA 1X7YB 4GI3A 4RVDA 2OD2A 1AX9A 4CLRB 1Y9ZA 2OESA 4ZQCB 4LVUA 2YFYA 1C4OA 1PZMA 3AHGA 3A37A 3LY5A 1RXIA 4EEXA 3DMDA 4A3EG 1W4RA 4DLRA 3DE2X 4HYEA 2WJPA 2WHXA 1XTJA 5UKDA 2O2CA 3KXDA 1KGDA 4LNUA 2AUMA 4ZWNA 1LLQA 3CNEA 5A7GA 2YV5A 5EMKA 3TTTA 2XNDD 3PD0A 5IYDG 4JI1H 2ZYIA 3LSTA 5EHNA 4ZT2A 4NH0A 1XU9A 1GZ4A 3F5QA 5HFJA 4R5MA 2PXAA 2HNAA 4B9EA 2HK8A 3T9AA 3R3XA 1ET0A 1N0VC 1D1QA 1YJ5A 1R0BA 2PBLA 1NOJA 4J9KA 1BFUA 3GV5B 3CA8A 4X7BA 2OSBA 3ICEA 5T7BA 1RKQA 4DUZB 2W2MA 1W96A 2NO5A 1N8TA 1IEXA 2Y1WA 3T4UA 1KAMA 2W2KA 5I9SA 4INOA 3MXOA 4I1RA 1IULA 2D06A 3UXHA 4HQFA 3OQMA 4DB4A 1I9CA 2Q3DA 1GPWB 1VLHA 4HDKB 5FAXA 4QO8A 3TL3A 2A78A 3EZ9A 2XT9A 5CB0A 4G4IA 5BV8A 4GR4A 3SJ7A 4FFOA 3RAQA 3S2SA 3W77A 3KRTA 1YCDA 4FFWA 4KFUA 2I5PO 3MFHA 3VU9A 1SRRA 1IONA 4WK0B 3CXUA 1GA1A 5CR5A 4WCDA 4J8PA 5KVAA 3H1BA 1TVKB 1LA2A 4HRXA 3UQ8A 3MR5A 3UJDA 4OMFG 4ZEVA 1EVKA 3OE5A 2DFLA 3HDQA 4CMCA 4JVOA 3BBPA 1WW2A 3H5OA 2R00C 2YJNA 4L4ZA 1RJWA 4I9NA 3OWOA 2GCOA 1U3WA 4U8GA 1ODTC 2V97A 3NQ41 2W6OA 3S55A 4OL0A 3SXUA 1ZLXA 4WFJA 4HZUA 1OLXA 1U9IA 1LUAA 3CIFA 2W6PA 5THXA 5EGNA 5MGNA 3CLRC 2Z1DA 3F2IA 2OPBA 3EHEA 2Z08A 4GMFA 3MWKA 2JK0A 4R31A 4QYIA 1WWKA 2XUZA 5KCMA 1TZKA 1ZD1A 1Y1WG 1TTQB 5HQTA 2AKAB 4MH0R 3DR3A 4IEIA 2BUAA 1CLUA 5CA0A 2ZRGA 2PANA 4MKIA 3LUDA 3EWAA 1CB0A 3JW8A 1YZYA 4W99A 2R7ZA 1H1DA 4BLPA 1BA3A 4Q4AA 4M4SA 5AVVA 4OI4A 5BUSA 2WAYA 3UKOA 5DNVA 3GA7A 2GN9A 5KVSA 5ERXA 4C6RA 3F67A 1Q7CA 1XHLA 4G0YA 3W5JA 4M0UA 1G6KA 4G4JA 4KO2S 4TYNA 3I9MA 3IQFA 3VRHA 4HNTA 5BQXA 4W8GA 3C87A 3I76A 3BKWA 4KE7A 4MUEA 2GHIA 1NUHA 3NLLA 1EVEA 2PO5A 3GDGA 4ZCPA 3REQB 1A2OA 4KLZA 2M6RA 4FHFA 2AFIE 3WQBA 3ST7A 3T99A 2CUZA 1JHAA 3M1IA 4MGKR 3GAAA 3WWCA 1C3JA 1ECPA 1NG9A 2ZSJA 5LQDA 4RL4A 1ZOPA 4BY9E 2QG4A 4K9DA 1CR1A 2FQXA 3B6KA 1EPUA 1Y1TA 1FF9A 5C4IA 3S2UA 5TJHA 3KP1A 4OXXA 1UPFA 3NCHA 1EFKA 4L8WB 2I34A 1NT2A 1WBBA 3PE6A 2Q7DA 4DABA 2A5LA 3EGIA 4Q1CA 1W5SA 2Y71A 3QEKA 2FRXA 2O5VA 4PO1A 1JLSA 4HK4A 3PNKA 2WSSA 3TEFA 4IZHA 3ZBQA 2JA5G 1Y98A 3DZCA 3W5DA 4QWEA 3IO5A 5FADA 3MRTA 2Q5JA 3PXUA 2NP7A 4EITA 5F52A 1XWWA 5T64A 3A58B 4YR0A 1HTBA 1GQ2A 3M5CA 4UD6A 5F33A 2WIKA 3V8QA 2YQ5A 4I50A 2V6MA 4WNYA 4CKEB 9LDTA 2RB5A 3BQ9A 3NPAA 2HBZA 4YQFA 4ZT6A 4DQDA 3UWOA 4ZREA 4DEYA 1YZTA 2BYTA 5BWUA 1TAEA 2XCRB 3BIJA 3ZVLA 4TTIA 4CCAA 3RD5A 1VI2A 3IEIA 5HS6A 3ZXIA 2JCGA 3RC9A 2GH1A 2RGEA 3T1HB 2YMLA 1F6DA 5J2TF 5DW3A 5B2FA 3DB2A 3GG2A 1PFQA 2PQMA 4I46A 1F3OA 2Q1YA 4BNIA 1ZDMA 4AF8A 2PNFA 2JI4A 4KLCA 4FHEA 1U9YA 4FHGA 5C1DA 3PRYA 2IC5A 4JLMA 3WWOA 3Q8KA 4DNOA 2JATA 4DIUA 1RACA 4BO5A 2COIA 2C95A 4OXIA 3PGKA 1FNNA 5FOUA 2EOAA 4LZWA 2O2JA 4PSAA 3ZZMA 3QLEA 1FY2A 5CNKA 2JFHA 4PYQA 1GITA 3LQKA 2WU3A 4TVOA 1SCDA 1USWA 3FDSA 3VDQA 3WLEA 4R2WA 4NFYA 3CZRA 3WI7A 3O83A 5EHXA 5CHYA 2HR1A 1IN4A 3F2VA 2ATXA 4Q6BA 3Q8RB 1LPAB 2ZYWX 3KJZA 4GQBA 1NWHA 5CA1F 4HAXA 3NDRA 2J9ZB 1HR0H 1BIFA 1RHKA 1PZXA 2GRAA 5CB4A 2X9QA 2CF6A 1YVPA 2Q7OE 1Q57A 1TJ3A 4W5RA 3ZLVA 1LNSA 3WYFA 1RYYA 5ADUS 4PRLA 3MT9A 3FB4A 4YCNA 3KHGA 5A4FS 5FKJA 3MZ0A 4EHIA 2EBWA 2QIOA 3P0JA 2P9CA 5F4ZA 3NH9A 4UHFA 1KEPA 4GLJA 4C43A 5FD6A 1B0PA 3C3YA 1BQ3A 1DGQA 4BV9A 1H8HA 2CMHA 2FSGA 2HVRA 2H0QA 1DG9A 1MXFA 2BD0A 4BRWA 3IXMA 2JLUA 4J16A 3BQ2A 2C59A 3SMVA 4QYMA 5B64A 1JLLB 2UXBB 5D5QA 2VQEH 1T9GS 3H87A 3EPJA 4LA4A 5DYNA 4RVHA 1V71A 1XDSA 4Q01A 1H2AS 1ZM9A 2EZ9A 1M7HA 4JKIA 3RM3A 1KMHB 1RM0A 3NT5A 4DYHA 1X7WB 3GLIE 4TPKA 2QRJA 2EKZA 4FE7A 5IKPA 4L9AA 4NPCA 2FMXA 2HDKA 2QTRA 4K8OA 5A7HA 1XMOH 3INTA 3EIHA 2Y0DA 5JIBA 2JGFA 3T1YH 3U17A 3R40A 3IVC