2R8BA

The crystal structure of the protein atu2452 of unknown function from agrobacterium tumefaciens str. c58
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
b'PMTKDSYFHKSRAGVAGAPLFVLLHGTGGDENQFFDFGARLLPQATILSPVGDVSEHGAARFFRRTGEGVYDMVDLERATGKMADFIKANREHYQAGPVIGLGFSNGANILANVLIEQPELFDAAVLMHPLIPFEPKISPAKPTRRVLITAGERDPICPVQLTKALEESLKAQGGTVETVWHPGGHEIRSGEIDAVRGFLAAYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu2452
molecule tags Structural genomics, unknown function
source organism Agrobacterium tumefaciens str.
publication title The crystal structure of the protein Atu2452 of unknown function from Agrobacterium tumefaciens str. C58.
rcsb
total genus 60
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r8bA00
1PJAA 3FYTA 3E0XA 2ROQA 1P0QA 2PVSA 4KR0A 5DWDA 4ITVA 4PF1A 3G9ZA 4C88A 3QITA 1QO7A 4OUKX 3KOOA 2C0QA 1W4LA 1MT3A 3AIMA 3DL7A 2QJRA 4FLMA 2Y6VA 1B6GA 3ESBA 3VJMA 5AI9A 2C0PA 3AJAA 1TKRA 5AH0A 5E4YA 4AMYA 2JEYA 3TEJA 2QM0A 2IX9A 2UZ0A 3ANSA 3BXPA 2WLSA 3PI6A 4JEIA 1UWCA 1Q0RA 2VF2A 4GDMA 5FV4A 2HA0A 3ZI7A 2FUKA 4BBZA 3OPMA 3IA2A 2X5XA 1CV2A 2DCMA 1CUZA 3H2GA 1B41A 3SC2A 3F98A 1QOZA 4X00A 3DOHA 1DINA 4INZA 3Q8WA 1BEEA 1HLGA 3E3AA 4KE6A 2OGTA 1MTZA 3GZJA 1GZ7A 2YXPX 5KREA 4WFJA 4QDUA 4IH9A 3N0TA 1BCSA 3LP5A 4KACA 4YK7A 1ZI9A 2G5PA 4BAZA 5K5EA 1EINA 4I19A 5D3KA 3H2KA 4BCBA 4BTLA 4G1FA 1TRHA 4B83A 2CMFA 4ZWNA 1RWQA 4F5ZA 4J0JA 1N5RA 2WJ3A 2P8SA 1S8OA 2W22A 3PF8A 1OILA 4OU5A 1MX5A 4KEAA 4D9JA 1CUXA 1XLVA 4DGQA 4Y2QA 5ALMA 4I3FA 1KU6A 4JNCA 5ALFA 1QONA 1XZEA 4GW3A 3LCRA 4NS4A 5IVHA 3PUIA 4RE6A 4PV7A 2OAGA 2ONCA 5AK6A 1UK8A 2XUPA 2VTVA 2WIGA 4U2CA 3RLIA 1ZD3A 1T4MA 4UBJA 3NUZA 4QLAA 4ARBA 1NU6A 3OC0A 1BN7A 4C4XA 1CUYA 3HEAA 5JATA 4OYYA 2QT9A 3G0DA 4MYSA 1CUFA 5FP0A 1XZCA 4J3JA 3O4JA 1VLQA 3WKAA 2RGUA 2XUQA 2OQIA 3WIBA 5ALSA 5CXXA 2B61A 1UT6A 4AZ0A 3HACA 2QXTA 1XZHA 3FLBA 4B7ZA 5CXUA 3DOIA 4EY6A 5KWIA 2XQFA 3R41A 4LXHA 2XUOA 4KYVA 5DYWA 5EI5A 3W9BA 1DU4A 2QXUA 4FLFA 2HA6A 3C5VA 3BF7A 3KD2A 4HVTA 2ACKA 3HLKA 5DNVA 2XMSA 1CUCA 3MGAA 2H7XA 4UBNA 1JT2A 1BN6A 3ZLVA 3H18A 3IVMA 5JZBA 1O6GA 5ALNA 4J0CA 4BCCA 3VJLA 1HDEA 1XQXA 1ZJ4A 4NZZA 3H1BA 2DHEA 1VA5A 3UUEA 3ICVA 1R88A 1ODTC 5AKKA 4AO8A 2OCLA 3KWJA 5JAUA 2QKYA 4WJLA 2BFNA 2OCIA 5JYCA 4E15A 3FYUA 1XQYA 2WSLA 4BVLA 4KE9A 5HKBA 1LBSA 3BF8A 1G5FA 2QR5A 3O95A 4W1QA 4LYDA 3O9VA 5E4JA 1M33A 5DTIA 1R9MA 2CB9A 3AILA 1LBTA 2R8BA 4E11A 5SYMA 3BDIA 4EY5A 1LPNA 4OU4A 2D0DA 3ESDA 4J0IA 4X91A 3R3WA 3FSGD 5E2IA 2O2GA 5CT5A 2CEKA 2WIFA 4WY8A 1LPMA 1UKCA 3WYNA 4C89A 3FOBA 3C87A 1P0PA 2GBCA 2ZYHA 4KE7A 5CH8A 4B0PA 1CUDA 4YPVA 3QBJA 1YB7A 3DKRA 5AO9A 2O7RA 4X6XA 3VJKA 4OCZA 2XMCA 1RYYA 4A5SA 1ZD5A 2AJ8A 4MJ3A 1PFQA 1QGED 3WK6A 3SK0A 2B9VA 4J7AA 5A7FA 4AMZA 1G4HA 3WJ2A 4K6KA 1JMKC 3I28A 4EA6A 5DYTA 3FYUB 4P08A 1QFMA 5EHQA 1XRPA 5AIAA 7YASA 3PICA 2J4FA 5C81A 2VEOA 3FWHA 1EA5A 3ZLTA 4EY8A 5CMLA 1H2ZA 4M0MA 4G8BA 1QIHA 5AKIA 1F0PA 4Q34A 1XROA 2JEZA 3G8YA 3AZOA 4Y2XA 4K6HA 2HFKA 1E66A 3H19A 4QWWA 1SFRA 1HKHA 4DNFA 5D7BA 2GBIA 1DQZA 3D2BA 3GBSA 4OB8A 1JJFA 1C4XA 1DTEA 4K2AA 4Y2YA 5JAHA 2WFLA 3IULA 3D2AA 2HU8A 4X92A 4KAJA 4FFWA 2Z8ZA 4QZVA 4DSZA 5ALPA 3D59A 2ES4A 4X95A 4EZIA 3H2JA 3R3VA 2O7VA 5AOCA 3O4IA 1H2XA 3FBWA 2BAGA 5AKHA 3IUQA 2GBFA 4XJVA 5EIAA 2C4HA 3G9UA 1YASA 3TRDA 2ZVDA 3EBLA 3VVMA 3D7RA 1XLUA 3PDCA 4ZV7A 2EEPA 4PSUA 5AM1A 2OGSA 1LZLA 4B84A 1XFDA 1PV1A 3WIOA 5C8XA 4X6YA 4QDZA 1HL7A 4B9AA 3RARA 1ZD4A 5BWCA 1EVEA 4DTCA 3WA7A 2WQZA 1Q84A 4Y7DA 3STUA 3C43A 4OB6A 4B85A 3WZLA 5HK8A 1EH5A 1TK3A 3KDAA 1Z68A 3BE8A 4HTAA 5HFNA 1R9NA 1XKTA 3H04A 3I2KA 4P93A 3O4HA 4X94A 1DX6A 3M83A 1R1DA 1LNSA 2JGIA 1UK7A 2JGFA 1X2BA 3HJUA 5JD6A 4PQEA 4EUSA 4BCDA 5FXMA 4F0JA 1N1MA 1E5TA 4M0EA 1IMJA 4J0KA 1CQWA 1XZAA 2XMGA 2OGZA 4CG1A 5JASA 2BUCA 3VVLA 2GBGA 3W05A 2VJAA 4BP9A 1MNQA 4QLOA 1TCCA 2XUHA 4KE8A 1XZIA 4AO7A 3EF3A 1BEZA 3F97A 5AJHA 4EHBA 5IH7A 4FHZA 3QM1A 4H7KA 1YB6A 2JGKA 4QA9A 5HF9A 1F0NA 1SCIA 1YS1X 4LKOA 3R3UA 5CW2A 2WILA 3OTQA 1EDBA 5ALVA 3U0VA 5ALTA 2ORYA 5AICA 1QIIA 2R11A 5ALGA 3JW8A 3L1JA 5ALYA 1DT5A 2GZRA 2WIJA 1UOQA 4C87A 3G9XA 5AOAA 1UKBA 4AX4A 2XT0A 1LPPA 5D3ZA 2CZQA 1WHSA 2XUIA 1XZBA 2EDCA 2Y2UA 5ALRA 2XUDA 3PFCA 2WFMA 3A2NA 5EHXA 1LPSA 3EIOA 4QDTA 2O2HA 3EQ7A 3B12A 1WB5A 5LLSA 3B3QA 4BVKA 4OB7A 2LIPA 5LZ5A 1YS2X 5KBYA 4RPCA 5ALJA 3WMRA 1K5PA 3WKCA 4K6GA 4UPDA 1J07A 2VAXA 3H2IA 4N5HX 1GGVA 2B20A 2Y2VA 1E3QA 1EDDA 2PSHA 2AJLI 3V9AA 2WHQA 4BE9A 5JANA 4GHWA 1JJIA 2JGEA 3C5WP 2ZYRA 2ZJFA 4HXFB 3D3NA 2VT7A 1WPRA 1AC5A 4OSEA 5HF5A 2Z5GA 2HHAA 4QDOA 3BIWA 3BL8A 2AJCA 5JADA 4XVCA 4FBLA 3X3HA 5FKJA 2VA9A 2WUFA 3I6ZA 3A2MA 1IUNA 5AKYA 4XWGA 3I6YA 4ROTA 2WTNA 2DQZA 5DTJA 1VA4A 2OCKA 1EK2A 2XUJA 1BROA 1YR2A 4Q82A 4G4JA 5JALA 4OPMA 1MNAA 1WOMA 4FTWA 2PU5A 1DWPA 3CCBA 1WPXA 4L72A 4IQ4A 3TJMA 3IURA 2DHDA 1U4NA 1Y7IA 4F21A 3WL7A 3I1YA 3FLEA 4YASA 5J3JA 4N8SA 4Y2PA 2DQYA 1MAAA 1LZKA 3R40A 3C8DA 2DSNA 5JAOA 1XRMA 1IZ7A 1E8DA 5FPQA 3A70A 3G02A 4UHDA 2G4LA 1O6FA 1QO9A 5IVIA 2BGNA 1YAHA 1Y7HA 5FUMA 1MN6A 4UBLA 1R50A 3C70A 1SCQA 1GT6A 2V97A 4DMCA 1A88A 3SWWA 1QE3A 3VDXA 2Y6UA 4X85A 2FJ0A 4UHHA 2WM2A 2HDWA 4CIAA 4GECA 3GELA 5BV7A 3OURA 3OOSA 1GPKA 1NX9A 4U2DA 4C01A 5JD4A 4UBKA 3D5EA 3ESAA 5I9IA 4FNMA 2WKWA 2BJHA 4CI9A 5LIPA 3RKSA 1GKKA 1YA4A 1JJBA 1UK6A 1AUOA 2JF0A 2JGJA 5JD5A 4HXGA 1UKAA 3MUNA 1XRQA 4X7BA 4NMWA 1A7UA 1AGYA 3M82A 4B80A 1SC9A 2Z3WA 4HRXA 4TGLA 1MX9A 5FDFA 4UBOA 3HXKA 3CN7A 4IHAA 2GYUA 5ALOA 2CUTA 2WU4A 5ALHA 2ZJ6A 3ILSA 3K6KA 4B81A 1VZ3A 3STTA 4CG3A 5DYYA 2WHPA 4BRSA 3VISA 2JIDA 1QJ4A 2HU5A 4KRXA 1HPLA 5D6OA 1QTRA 1MAHA 2XUKA 4Y2VA 1AQLA 3JWEA 3G0GA 1GPNA 2VSQA 1QIEA 3VXKA 3STWA 1AURA 4K5QA 3HI4A 4H77A 2RHTA 1E8MA 3IUNA 2X76A 1OXMA 2PBLA 2H9YA 1QTIA 4FFVA 4PNZA 2QRUA 4UFPA 4KJXA 1K8QA 2I3DA 2XQIA 4J0GA 4U2EA 4DYHA 2B4KA 3WKBA 2JGLA 4G9GA 1C7IA 1T2NA 4Q3KA 4GLBA 2OCGA 1JU4A 1UZAA 5HFAA 4CCYB 1CEXA 3AIKA 6YASA 1YAJA 3CN9A 3S2ZA 1XQWA 4JUIA 4DLNA 2AJDA 3PF9A 3KXPA 1DWQA 2YH2A 5FRDA 1LPAB 1P0MA 1JI3A 5K3BA 1SOMA 4BAGA 1L7AA 4Y2UA 4G5XA 4L9AA 3UMJA 2BGRA 3HRHA 1XLWA 2IITA 3P2MA 3WL6A 4H0CA 3ZLUA 3DKKA 1KU0A 4M0FA 2JBWA 2HRRA 4RNCA 1AKNA 5AKLA 2RIPA 2FX5A 2VAVA 2RI6A 1W75A 1D07A 2RHWA 4GI1A 1TAHA 1FJ2A 1GQSA 5JARA 5DNUA 3STYA 3EQ8A 5EGNA 2WFZA 1XZKA 3OM8A 2WG0A 1GXSA 4ARAA 4S0XA 3NOXA 1R3DA 4H35A 2PKYX 3B5EA 3WYDA 3H17A 5H3HA 1ORVA 3ZV7A 1FFCA 4X71A 1DT3A 2I03A 5FPPA 2PSJA 4GWLA 2HM7A 1BCRA 4BTVA 5ALUA 3K9BA 1VXRA 2ZYSA 1R4ZA 5AHXA 3R3ZA 4KAFA 2CJPA 2Y1KA 4J0HA 4AN0A 5CT8A 5LZ8A 5ALEA 3GROA 1X2EA 2OQVA 1DQYA 5BOVA 5A6VA 3WWDA 1W1IA 2Z3ZA 3V1KA 1J2EA 3WWEA 1MO2A 2OG1A 5HZGA 1CR6A 1DX4A 3PE6A 1H22A 1VKHA 4I4CA 5IVKA 1J06A 3WA6A 3W2TA 1N5MA 3HABA 4UHEA 2XMQA 1ODCA 1K6EA 1CFJA 2I3ZA 3FAKA 4BATA 2J3DA 2H1IA 2BUBA 2PSDA 1QZ3A 1K4YA 3A2LA 4PSDA 1AX9A 1JU3A 3C6ZA 1ZI6A 1LPOA 2OLEA 2Z8XA 5AK3A 5T4FA 3L1IA 4BYMA 1CUSA 1TCAA 3V1NA 5HCUA 3A6ZA 4AN1A 4ZRDA 1EX9A 4UFOA 4B82A 3DS8A 1GQRA 4CCYA 3RK4A 1ORWA 1UOOA 2XMDA 3G7NA 2VQ6A 3O4GA 1P0IA 3LIIA 1EHYA 4O08A 3WK7A 1USWA 2AXEA 1HQDA 2WHRA 3AZPA 2PSEA 3FCXA 3ZWQA 3L1HA 1ODSA 2WUGA 5F4ZA 5HF6A 2HA4A 2XQKA 3AIOA 3DD5A 5AM5A 1WB4A 3LS2A 5CBKA 4OYLA 1XRLA 3C6BA 1THGA 4CFSA 1XZDA 3C8HA 1XRRA 1YCDA 4KRYA 2WIDA 4WDRA 4B9EA 2G63A 4Y2RA 1L7RA 4MYDA 5ALZA 5I7UA 2XMRA 1QIDA 2EDAA 3CCCA 4IO0A 5AK5A 4BB0A 3WZMA 3QPDA 4A23A 2VJCA 4H7IA 1EK1A 4EY7A 4J03A 1BS9A 4MEAA 2HA5A 2Q0XA 1VE6A 4JYMA 2ACEA 4G8CA 3BJRA 1Q83A 5A2GA 5LP1A 2CBGA 1Q0ZA 3BJMA 3N2ZB 2YYSA 1XRNA 5CURA 1L7QA 5IKXA 4Q3OA 4P92A 5EIHA 5FLKA 2FJPA 3AFIA 2PX6A 4PW0A 2BKLA 1CQZA 1H23A 5LKRA 3BIXA 2DR0A 3IUMA 1SCKA 3O0DA 5HQ3A 2ZSHA 4H7EA 4UHCA 4AXBA 3HSSA 5AM4A 3WQHA 3V48A 3WK9A 5K3FB 3V1MA 2HA2A 2DHCA 5ALIA 3FVRA 2O2IA 3KSRA 3DYVA 4HS9A 5ALWA 4Y2TA 3D0KA 1VZ2A 3QPCA 3G0CA 4BAUA 5AP9A 4RGYA 5T4BA 3WK4A 1LPBB 4QNNA 2XB6A 4AZ3A 4GBGA 4DMHA 3I6MA 5LYYA 1THTA 2WIKA 2XLBA 2K2QB 4H7JA 5AI6A 3G0BA 1W52X 1MJ5A 3MUOA 3BWXA 1EB8A 1QLWA 3WKEA 1CUHA 1QIFA 2V9ZA 2V98A 2IIVA 2WU3A 4AO6A 4HRYA 3G0IA 1ZGCA 4PSCA 5ISMA 4BZZA 5IVDA 3QYJA 4W1PA 5T4HA 3FLAA 5LZ9A 4Q3LA 4X3CA 4A16A 5LZ2A 2GZSA 1BE0A 4DMFA 4BZWA 1UOPA 4U2BA 5A7GA 3LLCA 1BRTA 1QIKA 5AI8A 4BC0A 3QMVA 3WK8A 4TPKA 3R3YA 1XZLA 2WUDA 1ZIXA 1UXOA 5SYNA 2VATA 1A8SA 2GYWA 3NWOA 4FOLA 3ZPXA 4UHFA 3R0VA 1IUPA 1JMYA 5AKXA 3LIPA 2XMBA 3CXUA 3F67A 4QWMA 3IDAA 3F96A 5HKAA 1VXOA 2HA3A 5LKAA 4N5IX 2QVBA 4Z49A 5HQ3B 2ZYIA 4QE3A 3HYSA 5K3EA 3U1TA 4IH1A 4MWTA 3T52A 1A8QA 1K63A 3C45A 3WK5A 3C6YA 5AI4A 2HL6A 2QS9A 4IH4A 3D4LA 1CUJA 5K3DA 3MVEA 4QDXA 4B6GA 1CUBA 1G42A 2OAEA 3Q0TA 1WB6A 5ESRA 3SX4A 4WFKA 3RM3A 3I2HA 4WCVA 4DMKA 2J3QA 3UUFA 4N8EA 5I8PA 4G8DA 1QFSA 3QH4A 1DWOA 2OXEA 4H7HA 5EIEA 5DNWA 4CG2A 1F6WA 1RP1A 4N8DA 3I1IA 2D5LA 1EXWA 4Y2SA 4H7DA 1CUAA 4CCWA 2XUFA 4U2GA 3WL5A 4EB0A 2HIHA 4BC1A 2VJDA 3D2CA 5DLPA 3PUHA 5JZ9A 3NGMA 4GEGA 4WY5A 1ISPA 5DJ5A 4FDMA 3IBTA 5A62A 1QIGA 5AM2A 3WJ1A 4H18A 1N8SA 4LXIA 1LLFA 3M81A 3QMWA 3FVTA 3I2IA 3K2IA 3WWPA 1KEZA 2PPLA 2PUHA 3FYUC 1CUUA 4WDQA 3W04A 5ALQA 5HK9A 4G4GA 4BVJA 3E1GA 2PUJA 3QMMA 1EDEA 5BWBA 3GA7A 5AI5A 3G9TA 4EY4A 2QTBA 3IUJA 4G9EA 5K3FA 5HF8A 5ALKA 4F60A 2QUBA 3O9MA 5CT9A 4ZXFA 3DYIA 1G66A 2NW6A 1BU8A 4ZGBA 2XUAA 1XZFA 3FCYA 2ZJ7A 2QZPA 1W6RA 3FNBA 5ALDA 5AM0A 4XIIA 3W06A 1CUVA 5C7YA 5CH3A 4ZV9A 1W76A 5JIBA 4PO3X 1E89A 1VE7A 1CUEA 5CT4A 4X90A 1TIBA 3WWOA 4LXGA 1CUIA 2QUAA 1J1IA 2WHPB 3ESCA 2XI4A 1JKMA 3I2FA 3C6XA 2XLCA 4HXEB 3V1LA 1CRLA 1OCEA 5AI0A 3BDVA 3GUUA 1ZI8A 4BDTA 5A71A 2HADA 5CT6A 4B0OA 3H2HA 1H2YA 4U2FA 3OG9A 5AKJA 3QVMA 1E8NA 1GKLA 4CIBA 1XZGA 2H7CA 1CUGA 4H7FA 5CTAA 1UFOA 3STVA 4DSAA 1C7JA 4AB1A 2RONA 4FNGA 5K3AA 4ZREA 1Y37A 5AKZA 3WL8A 3QZUA 4C4ZA 1MU0A 1HBJA 2X8BA 3GFFA 2H7YA 2WG1A 1YSCA 1VOTA 2HA7A 4X6UA 5A7HA 4DNPA 5AKGA 3ANTA 3I2JA 5ALXA 1LGYA 3DQZA 1FFEA 3WKDA 1CUWA 1MX1A 1FFDA 2XDWA 5EFZA 4W63A 3W9UA 1AMNA 2WG2A 3AUKA 1MPXA 2RAUA 2WJ4A 3F8SA 2GYVA 5EHNA 3I2GA 4P9NA 2YASA 1ZICA 2XUGA 1WHTA 4Y9SA 3KWFA 2C5GA 1H2WA 4FMPA 5C8ZA 1IUOA 2HU7A 2HRQA 3JYHA 5JAPA 4BP8A 1FSSA 3YASA 4W9RA 3T4UA 4UHBA 3R3XA 1X70A 2J4CA 4MQMA 4UBMA 4HAIA 2PSFA 1QIJA 4FKBA 1I6WA 1ZOIA 4LYEA 2C58A 3IB3A 3AINA 2PL5A 5AKEA 2WTMA 4V2IA 3DEAA 4QEKA 5AIBA 4DIUA 4MQLA 4ETWA 3IIIA 4X93A 4MEBA 1EB9A 1ZIYA 4OD0A 4BE4A 4FBMA 2WFLB 3AZQA 1ZJ5A 4LHEA 4BDSA 5CRIA 2AJBA 2E3JA 4C6HA 4WFIA 5FOQA 1FFAA 3WI7A 2W6CX 3HC7A 4GXNA 4FLEA 3H1AA 2CKMA 4DNQA 1NU8A 1CIJA 2ECFA 3DCNA 5LZ4A 2HFJA 4W1SA 2G5TA 4E46A 1IZ8A 2WJ6A 1XQVA 3ICWA 1UK9A 3E4DA 1ETHA 1XZMA 3F9CA 4HZGA 2QJWA 4L0CA 2I78A 4LIPD 1U2EA 2QOEA 2XMZA 4Y2JA 3DLTA 3DJYA 4X97A 4AQDA 1A8UA 3QPAA 4NVRA 4UUQA 4FWBA 1ACJA 3PFBA 1CPYA 5E4TA 5KWJA 3ED1A 5CH5A 1EI9A 1QIMA 1YA8A 1EVQA 4Q1VA 3FSGA 3EQ9A 2BUAA 2PM8A 5YASA 4JYPA 1GPLA 5LZ7A 1CVLA 2VT6A 4RE5A 4G4IA 1XKLA 5EHZA 2BCEA 4JH0A 3DL4A 2DFPA 4DM7A 1VJ5A 5AK4A 3M3DA 5K3CA 1WCYA 3DDUA 3HZOA 5ALLA 1IVYA 1U8EA 1XZJA 2JGMA 5AOBA 3TGLA 4EBBA 3H0CA 4DNOA 4XX1A 5C8VA 1FFBA 1U65A 3VKFA 4W1RA 1AZWA 4C4YA 4UFNA 3WLAA 1ACLA 2ZSIA 1ZGBA 2XQGA 1TQHA 2C7BA 2VJBA 2XQJA 2OPHA 4Q05A 5JZSA 1CLEA 4TVKA 2PU7A 1TCBA 4UBIA 4ZI5A 4L3WA 2XE4A 4J0DA 4KAAA 2C5FA 1ZD2P 2QMQA 2WUEA 2V96A 1F8UA 1WM1A 4MXDA 4BRZA 4YX9A 3DNMA 3STXA 4E14A 1JFRA 5AM3A 3WWCA 3S8YA 5T4EA 4MWSA
chains in the Genus database with same CATH superfamily
2VXYA 1CZNA 4H6VA 3LHSA 3T34A 3PGA1 3E0XA 5DW3A 3ZTTA 2C8LA 3EEIA 5C4MA 2VZLA 5E38A 2FAXA 4GKJB 2PH3A 3MB8A 4N0MA 4YMGA 1FL9A 2IGTA 2N46A 1PL8A 5F7ZA 2XBLA 4KGVA 5FJJA 2H48A 1M34E 5CLJA 1XGKA 1U81A 2NXEA 2QZSA 2WWFA 4B3XA 2YN0A 2QSYA 4XWKA 1Y8QA 2YWFA 4ASUA 2VCEA 4MRRA 2GCGA 3KL4A 4LE0A 4ARZB 4R1TA 4PYNA 1UPFA 1WX1A 3UMCA 3NOQA 4G0PA 3AFMA 3PWKA 1QGYA 1PL7A 3LD9A 4G09A 1YL7A 4FLMA 3EPRA 3FSEA 1B6GA 3ESBA 1T5OA 1BAPA 4JITA 2CXUA 3MS4A 5AI9A 3QE2A 4ZO7A 3IL2A 2QTRA 1TFRA 3IOYA 4PBRA 2FN7A 5EJGA 4C22A 2C1XA 2Q1WA 1IY2A 2NSDA 4ISCA 4X7PA 1PT7A 2F7SA 4Q21A 5EHIA 1KSGA 3SBOA 4R3WA 1QMGA 2AVDA 2QM0A 3VR5D 2ZR7A 1U9JA 5IK2A 4KPEC 3GRRA 5JI2E 4CF5A 3RYIA 2EGUA 4ZCMA 1X7YA 2GNOA 4MRMB 4ESOA 4YUZA 5BWNA 3HM9A 3PI6A 2VBIA 2AB0A 4JEIA 2PUAA 5GJCA 2EP7A 1O4VA 4S35A 1PFWA 3DGFC 3AY0A 2DFTA 5DX1A 2O8BA 2RBEA 3LFHA 1YKGA 4KDEA 1PJBA 4U8HA 1R66A 1Z6YA 4IXWA 3F5SA 4MVYA 3KXKA 4CUJA 5KYXB 3OX4A 4TMFA 5KTSA 3T4XA 1PFVA 3BK2A 3PQCA 3ZI7A 3ZU4A 3L7NA 4RTRA 1PKEA 1M54A 1PQYA 1T2VA 2CSXA 3P52A 1CV2A 3MTBA 3PCRB 3ZGZA 3D6AA 4U39A 5A3JA 5KSYA 1E2LA 1E1KA 1VCIA 1JB9A 1SY7A 1GQYA 1C3JA 3I45A 3BZWA 4ZVOA 4E2ZA 1OBHA 3UA4A 1PR5A 1GKUB 2PMWB 3DOFA 1UPUA 4X00A 4CM9D 1DINA 4DG9A 4EL5A 4ER7A 1L7XA 2HGZA 2EBFX 4EJFA 1XTSA 1PL6A 1U9ZA 3BHJA 3AF6A 2OGTA 5IABA 5ULLA 1Y8RB 5DI3A 2OC9A 1NTOA 3GIDA 2CLIB 4EHFA 1UH5A 2H59A 3GZJA 3DHWC 1GZ7A 1H66A 1XPUA 2W2NA 4GVLA 1U3FA 4ERXA 1I4TD 1MB2A 4LZOA 4XX0A 4LNAA 4HT3B 5KREA 1QVRA 4H4DA 4I4IA 3OKPA 2FW6A 3QX9A 2PIAA 2H63A 3JD4A 2FEKA 4D4GA 1F4LA 3LP5A 1SO8A 3HVJA 2ZTMA 4Q7QA 3JQCA 2FEAA 4JDPA 5EKUA 4WL0A 2G5PA 1M6VB 1GIAA 1GUYA 1UIMA 4HATA 4YMVA 5IHPA 5K5EA 1WXDA 2PS9A 4DILA 5D3KA 4DQLA 3CZCA 3L8FA 4CKYA 1RYBA 2CNNA 2VUSA 3ND8A 4BCBA 2XGSA 3A27A 1SKBA 3LK7A 3JPYA 2ZM5A 1XV5A 3C3BA 5CYFA 4DDWA 5U4XA 3Q3HA 4RU1A 4WHMA 2CMFA 4RK7A 4WT7A 4Z2AA 1X1RA 3OZSA 5CR9A 2EKDA 4MVJE 3SDZA 2QROA 4WVFA 2V3WA 4TS3A 4WA7A 4F5ZA 5IHXA 3ISTA 1D2CA 1OXKB 2P8SA 4QC2A 3UAOA 3SM9A 2Z2YA 4CM9A 1AO0A 3KQSA 1IAVA 2WF6A 2Y9MB 4G0QA 5BVGA 5KYGA 2NYRA 5JI3E 4MV0A 4OU5A 2DQSA 3H5VA 3FWKA 4KVAA 1RAIA 4K7JA 4DGQA 5F21A 4N48A 3QWBA 3P9ZA 3CH6A 3F6RA 4B6QA 3P2EA 3VR1A 2VAWA 5ALMA 4CGYA 1ZVMA 1JWLA 1KU6A 2KLBA 3NCHA 4M46A 1R4MA 5BR7A 3I52A 4KIFA 5CFMA 1XZEA 4OK6A 4UNSA 3THRA 4ER0A 4UM7A 4EW6A 4TWJA 4ZZ0A 1DBQA 3L43A 5KMGB 2QHXA 2IQ5A 2OAGA 5AK6A 1EHIA 1N57A 1ZISA 2Q2VA 4H4CA 4RZQA 2I1LA 5DNDA 4GOLD 3AYXB 1M8FA 1ZUNB 2ZYGA 1AN0A 3Q40A 4GX1A 4HGOA 4QLAA 1QG4A 4V03A 1NU6A 3VU1A 4ARBA 5BOSB 4DEXA 1F0KA 5AXAA 1OPXA 4J1TA 2ZM6B 1I94B 1TQ8A 4LDNA 3PRYA 3LX8A 4IXDA 3LT4A 1E2GA 4REMA 3ZWXA 4C4XA 1ZM7A 3BH6A 2J0QA 2Q5FA 3B8HA 3VVCA 3ZCTA 4CLXA 1G2PA 4P3KA 5BSRA 4KH0A 2V4MA 3CLTD 2GWRA 5FP0A 1XZCA 4NYIQ 3LCJA 1I5RA 2OL4A 1PJTA 2G9UA 3AEZA 3KLOA 3O4JA 5ARDA 1TYEB 1XCBA 3EULA 1CX9B 1PS8A 1GPAA 1VLQA 1VTKA 3A9CA 4YS6A 5JOQA 1QQBA 5FTNA 4OH7A 1LF5A 3OEYA 1PT9A 2XUQA 3WIBA 3AKZA 1RTKA 1BVYF 3VZCA 1KSFX 5C4GB 1DEAA 2GVDC 3GJ0A 1OF1A 3WHKA 5TF0A 2JVIA 5F9FA 3Q2IA 4FX2A 3TQHA 5CXXA 2B61A 1JE1A 4C3UA 4DIOA 2YWDA 2CJWB 1I3LA 2QA5A 2POQX 1I9GA 2F3RA 3T0FA 5DCLA 1TVEA 3LVFO 1LDBA 1JHYA 1D6NA 4AZWA 2AN4A 2VEDA 5CXUA 1W1UA 5B7GA 4GD3Q 1NF8A 3ROKA 1E5XA 5EPEA 4ALLA 1OAOA 4PXAA 2Q3BA 1I3OA 5SY6A 5C46F 3PQ7A 3ABIA 1KZHA 2HWWA 5AFSA 1Z9BA 2XUOA 5DYWA 4Z0NA 3DMGA 4IAOA 5D8DA 5EMMA 2M6KA 5DBOA 2MSEB 1LWOA 2BMFA 2D2VA 1DKRA 2ZB2A 5CVJA 3S5JA 3S2GA 1FP7A 5KCZA 2JKZA 3C5VA 4AYXA 3I5YA 3UT0A 2G67A 1IWOA 4XD2A 1YFZA 3Q11A 4B31A 1C3VA 1KRHA 1WUIS 4BVGA 4BWYA 1O54A 5DNVA 4B75A 5CGZA 4YRGA 4MKIA 3GLTA 1HO3A 4M7WA 4BN4A 4N7MA 1JT2A 2R7AA 3O03A 4FFLA 4MJ7A 4QGAA 2I7CA 3GJRA 3ET5A 4R68A 2P9CA 4HYEA 5EXEA 1V1JA 4IIBA 4LG1A 3COYA 2FZLA 3PZBA 2WNHA 2ZVJA 5HQTA 4TROA 5DSZA 3DV0B 3I73A 4LVNA 4QU5A 3WQQA 3ELYA 3H1GA 3OLWA 1RWOA 1INLA 3IAS1 5D85A 5H83A 1TMKA 1UP7A 4RK1A 3VJLA 1ZJ4A 4K40A 3H1BA 1U02A 3ONEA 4ECEA 4EENA 1GFWA 1U0JA 2ZU6A 2JLZA 1E6UA 4KZKA 1SRRA 5T8KA 3KX2A 2MYTA 2DJ5A 3ZXSA 3QU4A 3HM2A 5KWSA 1R88A 2NVOA 3DXFA 1Z22A 3L6BA 3LHIA 5THXA 2PKWA 4X8MA 4XASA 3ITDA 1XN4A 1VE5A 2OCLA 1U7PA 1JLSA 4KMRA 1A77A 3KE9A 1XC7A 1ULZA 3NKLA 3VOAA 3V8QA 4CM4B 2AXNA 3FYUA 3BXHA 4QVKA 4DA9A 3M1IA 2Q8NA 3BBPA 3OZWA 1NVAA 5FL7A 3NTXA 2FUCA 2ODAA 1E18A 2X9VA 3GDFA 4URZR 1B23P 3FCOA 2QDXA 1Z62A 3KYCB 2JLYA 3SU8A 4NEQA 2QL5A 4Z5XA 4C05A 1FFGA 2VN8A 1FYVA 2M1XA 5E4JA 5AVQA 2P9JA 4JL6A 3QUSA 4IKPA 4XEUA 4WOPA 4DV7B 1LBTA 1TUGA 2HK9A 3V9PA 4E11A 1O97C 5HVNA 3G2LA 2HF2A 3GT3A 3HN6A 2D2FA 2GF9A 5HIKA 4W5OA 4KKXB 4MIKA 1NBWB 1XEWX 3BDIA 3L01A 2XGOA 3NYWA 3P27A 1LPNA 1TIPA 3PWSA 4QULA 4V3CA 4EY5A 3RTBA 2D0DA 1U2ZA 2IXDA 4BJHB 1YGPA 3I0MA 4PZYA 4BQRA 3VNQA 4DQKA 1K1EA 5TMBA 4DIEA 1GL7A 4C0HA 5IFLA 4D4LA 4HQ6A 5IAKA 1U8YA 4PQYA 4EOGA 3PIRA 2JH9A 1FMCA 3EXFB 3OZTA 3GFTA 1P60A 3N3AC 4J7CA 5BY2A 1VYUA 3WBBA 5HM6A 3DBRA 4EJSC 2CL5A 4RY2A 4GPTA 3EVGA 6CHYA 3OKCA 3RUFA 1L8OA 2D5IA 1G5QA 4LJ4A 3KP1A 1P73A 3RHSA 1IJEA 1LPMA 3EGEA 6GPBA 1ORDA 2JASA 1BW9B 2P0AA 5CPBA 2HTFA 4L74A 3F7OA 2WKSA 4EYEA 1ZSYA 3C87A 4M8KA 4XI9A 3K0EA 2ZYHA 4BO3A 3JAWA 2C94A 2HRZA 1U28A 2P2YA 4PONA 3RCBA 4YPVA 3JAWB 5JFGA 4BIIA 4CTOA 1W25A 2IKSA 1Z2DA 2OCYC 4LZAA 1BW9A 3VJKA 3AOEA 4P35A 4OCZA 3PLRA 3ZWYA 4L9RA 1G5RA 4WZBA 1SCNE 4NJMB 1NV9A 1Q74A 1YULA 2C7VA 2NO9A 2PKQO 4D97A 1AKTA 2X2PA 3CXRA 2CXHA 3OLVA 1PJZA 3DQQA 3R7AA 4M9CA 3SK0A 4A5OA 3SQXA 4FEGA 1UP4A 4CLDA 5E2BA 2B9VA 4KWCA 4AIRA 4YUYA 2W6ZA 3RS8A 3WE7A 2YJ6A 3NBFA 5A7FA 4AMZA 8OHMA 2AZXA 3GJ3A 5AT1A 4MLDA 2BMWA 4IGAA 4OXIA 1SBQA 2P77A 1JMKC 3WGZA 1ZRSA 1Q0HA 5BV1A 4EA6A 2V6JA 5BN3A 1M5TA 1GITA 3TI7A 5DYTA 3THXB 2BTOA 3DTVB 1TEHA 4MV3A 4NICA 2CGEA 3GMIA 1QFMA 1OA1A 4Y0VA 1N6NA 1KI3A 4QYXA 3UT6A 3TNJA 2K4MA 2Q5OA 2WM3A 2MDTA 3IV9A 3MCVA 1M5UA 5B7QA 1XJ0A 3K8OE 1CNFA 5AIAA 3ZW9A 4MVJM 1SGWA 3PICA 1YCHA 2J4FA 2HWXA 2KWIA 2VEOA 1B8OA 3KHSA 2WYWA 2WABA 3FWHA 4IIUA 2YCLA 5EZ5A 4KLAA 1J24A 3I30X 1NNUA 1P0CA 2G1UA 3SQWA 1H2ZA 3OH8A 4M0MA 4DJDC 1OFGA 1BQ4A 3OCCA 2HHJA 4G8BA 4HNQA 3H8VA 3RVPA 5AVTA 1KKMA 2P1DA 1F48A 2IBTA 1DAGA 2HMAA 2P9HA 3FZYA 2AOUB 3I9MA 5GMOA 3NG1A 4KPFC 2UUAB 1XROA 5B1SA 4Z8YA 5EZYB 1SURA 1W5TA 4K6HA 2Z95A 1FTYA 2NUAB 5EZSA 1BS1A 3H19A 4XD7D 5LOVA 4FDLA 1SCAA 2IUUA 4DBVO 1V0JA 2ZJOA 3PT9A 4JLMA 4M0CA 2VZEA 3QLJA 5DV9A 4Q4HB 3RE1A 3TOZA 5I7FA 1KL7A 2G4CA 3D2LA 3PQ6A 4PYJA 2KBFA 3C24A 2B8WA 1YC5A 1QV7A 4YIHA 4QYSA 2PKQP 3DPSA 3PWTA 1EVLA 2C3PA 4OB8A 1JJFA 2F67A 2QG6A 4AJNA 4HRVA 5EIFA 1IK6A 3JQRA 2UVPB 2W00A 1MOZA 4K2AA 4Y2YA 3DV0A 4HLQB 1EJ6A 4MTLA 3B89A 4L6CA 4RC9A 1OYOA 2Z4TA 4TRNA 1V8OA 2AN1A 4LFBB 3D2AA 2HU8A 1C0IA 5FUBA 4KAJA 1SQGA 4M98A 3SMQA 5J4LA 5E6UA 1P2DA 3DBHB 1RRGA 3TQQA 2HLPA 2C7PA 4KNYA 2PTGA 2MINA 2WJJA 1ODKA 1VLZA 2X9QA 3D59A 4HPXB 1QRAA 3EX7C 4NECA 1PX2A 1UXGA 2B2XA 2NWQA 1WZEA 1G9TA 2GQ0A 2BGUA 3ESYA 3H2JA 5FADA 2O7VA 1W85B 1Z5UA 5AKHA 2BAGA 1RP7A 3IUQA 2XWSA 2O8FB 2JFVA 1FQOA 4AK9A 4B3DA 3LC0A 1DC3A 2V0NA 4B3JA 4EMBA 1TYCA 5FL3A 1PK9A 4XYLA 2PQ6A 3G9UA 1YASA 5IK2D 1VLMA 4FM9A 1NI5A 3LUPA 4U7GA 2ZVDA 2QRZA 1OZAA 1E4OA 1XLUA 2PJRA 3N74A 5LDGA 1PK8A 1JDZA 3QY0A 4ZV7A 1ZR2A 3I4CA 1W9MA 4PSUA 5KYYA 2OGSA 4RCYA 2FSPA 4QXRA 1WJGA 4E3WA 2XE8A 4FN5A 1P62B 2OYRA 3EGIA 3RAPR 1TM2A 1ZMXA 2Q2QA 3OD1A 4GOKA 4F2GA 3RADC 5AR1A 3VHXA 1WD7A 3P9IA 3H5RA 1OFIA 4QDZA 5BN3B 1KIMA 2H1OA 3L0BA 4CKEB 1GNSA 2RCYA 4FZJA 1JZQA 4MUAA 3RRXA 4EFMA 5I7EA 4LRXA 2E4VA 1D7OA 2RHBA 3ABZA 4JEUA 5AJVB 5CFNA 5GM2A 2BFWA 1A9YA 1H94A 5CDFA 4JP3A 3VSEA 2CNKA 2NTVA 2EJTA 3BFXA 3GFVA 4HH3C 3RJZA 4PC1A 4KXNA 1UXIA 5IAGA 3TO5A 3UK1A 3UA3A 4I6JA 4OI1A 1UMDB 3U3MA 4ZYUA 5FORA 4HPWA 5LMZA 1C29B 2J41A 3JWJA 4J1TC 2X86A 2FZGA 3CBQA 5LBIA 2IYPA 1HMYA 2ZB3A 2HI0A 2XVXA 1BKYA 4ZOAA 4YYEA 1HOTA 1SR8A 4WY2A 1TU0A 2VF7A 3BE8A 4FOTA 3JD3A 2Y1XA 1OBOA 3OBBA 4IJ5A 3EYWA 1JDTA 4OQDA 4P93A 5KYWB 1QAMA 1R0RE 4RGVA 5EWMA 3WMFA 1LNSA 3ZHUA 3I09A 2H16A 1KJJA 1R9JA 3KB6A 3SJUA 2PH5A 1XMIA 2ODWA 2QAJA 4OP3A 4Q7LA 3GBVA 3HA3A 1T1EA 3BRWD 3GF4A 2BLNA 2JGAA 2VP6A 4FFSA 3VO9A 3QWAA 4NBLA 4BCDA 4F0JA 5DGCA 2ODTX 4DLTA 5J2TB 2NP6A 1MEJA 4V24A 2YOHA 3FHLA 2FEPA 1YOBA 5HDQA 2AN9A 2RHMA 3ZV3A 5EJ7A 3A1NA 4K9NA 5C9ZA 1EZ1A 3DPUA 1Z15A 4CG1A 1I13A 2CZGA 2QB5A 4M87A 1U0TA 3GWGA 4NP6A 3OZVA 5KNDH 2PCLA 4XVUA 2FMFA 1BMQA 3W05A 1TUBA 1GSOA 2QYSA 3H9QA 1T0IA 1MNQA 4DMUB 3JD1A 1Y48E 2O05A 2PFGA 3WTCA 2Q5QA 4CV3A 2A1TR 2P9TA 2Y99A 3TRFA 2G5CA 2X7XA 4U3JA 1K08A 5TGZA 3C1AA 3L0PA 4X54A 5HIAA 2X8JB 5BQ5A 1AF4A 3LWNA 1VI2A 3U7IA 3MQ4A 1GNRA 1QE5A 1TKBA 2WZQA 4FHZA 3QM1A 4H7KA 3RSSA 5JJLA 3ETEA 3N87A 2YV3A 2AMJA 3QVXA 2CXPA 2JGKA 1CEEA 2HLDA 2VSOA 1DRUA 1UKEA 1UUFA 1EK6A 1PYDA 5CA0A 1ZNWA 1G2OA 2V5UA 3K16A 2ZJ3A 3K3PA 2G1PA 2O54A 3JQGB 2E1RA 2YQ4A 3NATA 4TTPA 1NRIA 3VI3B 2RHOA 1UMBA 3COVA 4U02A 1C8LA 3LJKA 3U0VA 5M04A 5ECGC 4R5HA 4BO8A 2ORYA 2PKCA 2V7GA 2R11A 3C3JA 5ABPA 3OPXA 5BN5B 4ZYVA 1GGKA 5DEIA 3JW8A 2ZRJA 4IF6A 3RUDA 3TZLA 1DT5A 2V45A 4O1IA 4NAUA 2Q6OA 4C87A 3DAOA 3PNMA 2LCQA 5B4TA 1LNZA 1UC5B 1TT5B 3BMOA 3MCUA 4H1TA 4CRWB 2XT0A 3BMNB 3LSTA 1LV7A 4B2LA 4WECA 3KOXA 1QH9A 5JVDF 3K70D 4REQB 2QTVB 1LPPA 4UAUA 1T9GR 4ACBA 1VYTA 3V8NA 3F78A 3DOUA 1IHXA 3PEEA 4F4FA 1PGPA 3NETA 5H8WA 2FHSA 5TQ0B 2NPFA 5KKCA 3EMDA 3CEPB 1IRXA 1Z5ZA 2XB9A 5LUBA 4UEQA 4RL6A 2JLUA 1YR6A 3OX2A 2AOXA 2E9SA 3NC1C 2HWKA 2Q3JA 2SICE 3D4NA 4V0ME 1KWKA 2F4VB 4MA5A 2IP1A 3MXTA 1YUNA 5JXHA 5ALRA 1ESCA 3KZNA 2XUDA 3B60A 3K8ZA 4DARA 3GAAA 5EP3A 4BQOA 4JXXA 1I14A 3GGPA 5EHXA 3OPNA 4JI7B 2PWAA 3CTPA 1TC2A 5DYGA 2WOJA 3NO4A 3PYLA 4EG4A 1E5QA 2AOTB 4O63O 3N2NA 2VRBA 1CDEA 1Y1SA 2WHXA 4OXKA 4BLPA 1R0SA 4MIYA 2JEOA 2LIPA 4HLCA 2SCUA 4UU1A 4Y2GA 5DHRA 3USCS 8ADHA 4Q01A 4PC2A 2WKQA 1IFXA 3ROMA 1NXQA 1FFWA 1HC7A 4P31A 1TZ2A 4NHEA 3GHHA 3UG7A 5CG2A 1K66A 2H57A 1E7RA 3TKLA 1K5PA 3VPDA 3K5HA 5DN6D 4LTNA 4K6GA 2E5LB 4I5FA 3D3KA 4FX5A 2I2WA 2OV2A 4DW8A 2WOOA 2VAXA 4ICIA 5INTA 3IELA 1COZA 4JLOA 4Q37A 2QVCA 4EO9A 4LVOA 3ZTWA 1GGVA 2B20A 3M5WA 1EXVA 2Y2VA 3F3KA 4JYAB 1E3QA 2PSHA 4QX6A 2AJLI 1SUCA 2BFAA 1RWPA 2WHQA 1GFSA 3RBAA 2FGJA 4CU5A 1FB5A 1VBFA 3K94A 5LWHA 4FINA 3L79A 3HCDA 2TRSB 2AOWA 5CLHA 3RO7A 4F3TA 1C9JA 3TUJC 1QZZA 3LOPA 4QDOA 3BIWA 2R4TA 1GDDA 3AY3A 2XECA 5KNBH 3BL8A 4JR1A 5KSWB 1VGQA 2YDYA 2GKGA 4FBLA 3X3HA 3E2MA 3I6ZA 4NE7A 3CG4A 3L41A 1HT3A 2A9PA 2QTLA 4ZT7A 3DLIA 3U4IA 2YVLA 1IUNA 3A2MA 4NCHA 1V7PC 3K9GA 2QJOA 4D3FA 5EIEA 1YHZA 3KM0A 1E3TA 3DP9A 2WT4A 1JZTA 2J08A 3SAJA 1C0KA 4AQYB 4Y0NA 1G8GA 3KOWA 1ZVVA 1PJ3A 2OV8A 2DAPA 2Q3DA 4J7UA 1KZ9A 4JT8A 4Y1EA 1I32A 1N7IA 4MW6A 4A03A 3H4TA 1DBVO 1TT7A 1X15A 3ND6A 3TFQA 3ZUPA 4CV1A 1JDBB 2O5EA 1VSQA 2ZDQA 4AY3A 1P77A 1T5BA 4MPTA 4AFNA 5A9SB 4XFDA 4MW5A 4YMWA 1K89A 5A9SA 4FBGA 1NMXA 4H2DA 1FDRA 3TSZA 4J0EA 4OPMA 2HQBA 5K0GA 2WT8A 2DQKA 1IQUA 4K46A 2HDOA 2YUIA 1L1FA 3V42A 5C51B 1QKJA 1V5GA 2RJNA 3PS9A 4K6OA 2R5FA 3ZUGA 1FXUA 2JI6A 4L72A 4IQ4A 1Q3KA 4D9IA 1E69A 3R1IA 5NULA 3ML1A 4R6XA 1JA0A 3CUUA 4ER5A 5IM4F 4PSKA 3VTFA 2RDMA 3DEJA 5LFAA 1RVV1 5ELXA 5A3RA 4B3SB 2B25A 2QR2A 4BQNA 3UUWA 4DABA 1UFRA 2BEVA 2WVAA 4F21A 3L6OO 4E2WA 3LCVB 3N0WA 1S7GA 3FYDA 3UJNA 1GSHA 2BFMA 3M49A 1V95A 4PWYA 6PFKA 5J3JA 3SKVA 4PS0A 1SM4A 4Y2PA 1VFNA 4YBRA 3K2BA 1FDTA 3HE3A 4AS2A 4DV2B 3Q88A 3RIYA 3T5GA 3ZIAA 3MHTA 1FEZA 2AQIA 2ATIA 1RRMA 3EXEA 4AXXA 4F11A 3KZXA 3ZJTA 2EGGA 2ZI6A 2ZJZA 5CIQA 1XRMA 3D1VA 4MW1A 2JVKA 3OM9A 1ZGAA 2CWDA 1NASA 2XVAA 3LX6A 1A8HA 4DCGA 4EEZA 1T4CB 1V4NA 4ID9A 1DELA 2I6FA 2Y3IA 5C37A 2IUTA 2DX7A 2PJUA 2GXUA 3A70A 4N0PA 1XJQA 2G4LA 4UHDA 1G5HA 5IZCA 1Z0KA 1KJ9A 2A3NA 5IVIA 1WO8A 1KSHA 2BVNA 4MK4A 5AVOA 2BGNA 3R5HA 4HNUA 3K6SB 1JPVA 1S0UA 1CE8B 2ODQA 4AI6A 3G7SA 1MN6A 4B76A 1ECFA 1JLRA 4UBLA 2G7ZA 1NR1A 3P0HA 1XTIA 3C6MA 1YQUA 1GT6A 4UDNA 3COJA 4AP5A 2PMBA 3NFYA 3BX1A 4GMDA 5K7SA 1GG8A 3L84A 1K0UA 3GGSA 1K4MA 1W5BA 2Z4RA 4M22A 1D0SA 4RPLA 3X1WA 1QE3A 5IKMA 3BD7A 1M83A 1CK4A 3A3NA 5EEHA 5JNSA 1MIOB 2ISQA 3IVCA 3TLCA 4CIAA 2AX3A 3TR6A 5KSZA 1LFAA 2XF2A 3HP4A 4R2HA 4YUXA 5FUQA 5JMWA 5BSFA 5EA2A 5LQUA 3IEVA 1Z4OA 5BV7A 3H7AA 3BCRA 5L3SA 4LKRA 5JH7B 2A9OA 1U3UA 2BFEB 3OOSA 5L7YA 1A8PA 1NX9A 4TKUA 1F7VA 3L8EA 1XBTA 4G1EB 3WBJA 5CA1A 2OHIA 1V3TA 1VBNA 1NJFA 3KYJB 1YBVA 4XDYA 1J7JA 1WU7A 3DDCA 3D5EA 1I4DD 1B7GO 3FMFA 5TQ2B 3S7TA 3ESAA 2OHGA 3FHOA 1H0HA 4JYZA 3KAPA 4IVPA 4J1QA 5LQRA 4IJMA 5EOVA 1AKQA 4XZ3A 2BJHA 2UKDA 4K6MA 4BVBA 1RYZA 4QFMA 1E64A 1GKKA 2VDKB 1Y1QA 1VCNA 2DG2A 3K35A 4BEJA 3LY5A 1DV1A 3AKYA 3CIFA 1UT8A 2GNPA 2I7VA 2QNBA 2X5JO 4MRMA 3T3NA 2HYDA 4JI0B 3G5AA 4CKWB 1YA4A 5IUJC 1PT6A 1YQWA 4BWFB 3CF4A 2GKOA 4B6SA 3RK0A 4YAWA 1KZ4A 2P68A 4AECA 1VQ1A 1BTOA 4FQ8A 4HXGA 3T35A 5JD5A 5EYPB 1FFXA 2IDKA 1H0RA 3UT5B 4KXLA 4DGSA 1U80A 3L5OA 4PG7A 5T41A 4X7BA 3EXEB 3AI3A 3U40A 3WJAA 3FUWA 4IM7A 4BO4A 5CIYA 4YAEA 4LOKA 2ZRAA 3TEFA 3KPJA 4TL8A 3VR6H 3HJTA 3W4JA 3NZEA 1DOZA 2Z3WA 3JQAB 4P3NA 3W5CA 1EUYA 4UBOA 4QBFA 4E1VA 2FF7A 2MSDB 2B1RA 2WZBA 3QVJA 2R48A 2FPPA 4R5MA 2VBFA 4GSLA 4W82A 5DX8A 2DXIA 3L02A 1HDCA 3ZE9A 1AK2A 3QEMB 1N6IA 1U2DA 5ALHA 1XDWA 2QE6A 3L0CA 1TMYA 3A3YA 4QBTA 1GRRA 3KQWA 1CRQA 2O1XA 1JSRA 3DL2A 3GAFA 2GEDA 3K6KA 3L5KA 4HAWA 4NK4A 3ZHQA 1FPQA 4B81A 3GJQA 1NUUA 3TNFA 3HFRA 4QATA 5AXCA 3LQQA 1L5HB 3TQRA 4Q7EA 5DYYA 1NVMB 3NBUA 3CCFA 5ES4B 2WHPA 1E3DA 1XG5A 3CE6A 2JAOA 3T3EA 4BRSA 4R31A 1TO6A 1KETA 1TEXA 3ZZNA 3RVSA 2NYVA 3R7DA 1DWUA 1KAGA 4O02B 4P4NA 1LEHA 1EXNA 4W8GA 1U8TA 5FPHA 3W8EA 3CRVA 3K73O 1ZGGA 3CM0A 2FKAA 1LTKA 1IJBA 1BHSA 1JP7A 2Q07A 2JIBA 1GZ6A 5D6OA 4ND2A 2PRZA 1V9SA 4JR2A 2HHHB 2JA2A 1BGWA 2OO5C 4Y2VA 1E7SA 1GKYA 1QIEA 4MVJA 3AOEC 3DEYX 3HDGA 3P9NA 4E6PA 3NCTA 4MQEB 3Q8XB 2OB1A 4L5YA 3ETNA 2XT9A 1YU9A 2IL1A 4H77A 2NVUB 3MWDA 3W2HA 2GASA 2QLMA 2XH8A 3QU9A 3NHBA 4LYHA 3PWZA 3RTAA 3ZOKA 4YJ2A 2H9YA 3F2IA 4LDRA 1T15A 5E7QA 4FFVA 5EQTA 1G8YA 4KO8A 2FE1A 1FVXA 2CJYA 3WXMA 4KPUA 3QSYA 3FTDA 3CRW1 3L0IB 3A10A 2A57A 1OWNA 3QTTA 4BNMA 3N8DA 8ABPA 3FOEC 4TLMB 1HXHA 1ZUHA 2IZOA 4RLQA 4Q9LA 2Q6LA 1HYGA 2R85A 4BV2A 4FIZA 2VS1A 3EG9A 4IIEA 4DOMA 2B1IA 2V7TA 4FYYA 2ZREA 4Y1RA 2FVYA 1DLIA 5DSTA 2FK8A 2PRYA 4Q3KA 3WX0A 3GN1A 4QQNA 2LXNA 4GLBA 1JU4A 1UZAA 2ZBDA 5HFAA 4CCYB 4EPWA 4D4IA 1BXGB 3SSMA 4N01A 1CEXA 4Q1EA 1YCGA 3HWRA 1DTWA 3EXG2 3D6FA 3PC8A 1LB1B 4BMSA 3A26A 1YAJA 2FEOA 3E35A 3MNFA 4IEFB 1T5LA 5JQGA 1H6AA 4RVSA 3I23A 4CMEA 1KS9A 2ZUVA 1LK0A 2AJDA 4TWRA 4C3ZA 4ZQBA 1VSUA 1NP6A 3ADKA 2VHQA 3G2KA 3DHYA 2VBGA 4B47A 1E2DA 2BCGY 3LYUA 4UOEA 3NAQA 4JJZA 2IWHA 4Q4JA 3TMAA 4CM8A 1MHTA 3LO8A 4H9GA 1BXRB 2Z9BA 4WGFA 2G9RA 1LPAB 4WLUA 5FRDA 4BP3A 1BH2A 4E5UA 4DR6B 1D8TA 1P0MA 3W2IA 4TYQA 3LT2A 4UU7A 4KQMA 4YDRA 3JTEA 3QKIA 1W4AA 4Y6QA 1FDWA 3UKDA 5L6MB 4E6EA 1T8TA 3Q6NA 5JAZA 4TWBA 4Y2UA 3B9PA 4TV8B 2DETA 5LYJF 1QG6A 3HV2A 3I83A 4XJXA 1Q1AA 1RHJA 4IXTA 9GPBA 3G2PA 3QUCA 2M2IA 1E5DA 5GONF 3MBIA 2HC9A 3JAKB 1H4TA 4RACA 3TPZA 2DHQA 5LNK1 5EKSA 3NRJA 3P2MA 1SBHA 1U11A 2JVJA 3IV7A 3ZLUA 2XBMA 1GPDG 1Q1ZA 3HJHA 4LJ5A 4C4PA 1BFUA 5B6PA 2QDKA 3NBZC 3RTCA 3S1AA 1BE8A 1TECE 4M1YA 4WMLA 4DF3A 4RTJA 2R2AA 1PFGA 2Y71A 3I2YX 3RUPA 4ZRNA 3WG9A 3ZE1B 3PR2B 4AJ4A 1UQTA 1W75A 221PA 3BSFA 2RHWA 4RUKA 5CK5A 5CPFA 3QF4A 4GI1A 4AJKA 3GOHA 4RXMA 1GM5A 3AI1A 3AK4A 4RTMA 3DOCA 5DNUA 5A9TA 1Z29A 3IO5A 1FP4B 4HO1X 4ND5A 3HGTA 1VGVA 2WUWE 4OUDA 5TS2A 3STYA 3KKKA 3NDPA 1FBTA 3SF8B 1KMIY 2WFZA 5IYZB 3UICA 1EXDA 1XZKA 2VZ8A 1UDAA 2Z9DA 1F8GA 4L76A 2AQKA 3OEHD 4YJGA 4IIJB 1YJAA 1REQB 4LMAA 4O4IB 3BD9A 4S0XA 3N6XA 5L3VA 2PKYX 3HRKA 2FMIA 3TD2A 2DBYA 4C29A 3B5EA 4JQYA 2ODNA 4D9FA 1OVMA 2HBZA 3ABSB 5EERA 2XNDD 1NFRA 3OFJA 2X9GA 5CA0B 1KEKA 4Q5IA 1GPJA 1E9VA 5H3HA 2V7XA 3RASA 1ZVKA 2ABWA 3ZV7A 4JBGA 2FFRA 3L92A 3WVNA 1HE8B 4MNTA 1U7TA 3L4JA 4QYMA 1XF1A 2PSJA 2VK8A 2QYTA 4G85A 2GHQA 2NN3C 3LECA 1C30B 1VLLA 1VRCA 2CFCA 3I8XA 2P9YA 5G53C 1G1MA 5CVVA 4I50A 3LBYA 3HFGA 3JY6A 1E1RA 1VHDA 4J43A 5C7OO 1U7HA 1ZMBA 2XX3A 3DZDA 3QEMA 4UDXX 5ALUA 4NCAA 4DCOA 5AHXA 3C98A 3RC8A 4Q19A 1VDZA 3OI7A 2PBFA 2CJPA 5IX8A 1IY1A 2XOKD 4L02A 1PSDA 3HCRA 1N2XA 2P9ZA 1MRSA 3LWZA 3G2MA 3P9XA 1JR3D 5FTLA 2FMXA 4B7CA 1N1DA 5BRAA 1V96A 1RABA 1W0CA 3IT2A 2YOFA 2GD0A 4PPNA 16PKA 5EKXA 5TT1A 2OCXA 3WAKA 2GD6A 2Y1GA 1VMDA 4CZ2A 2DPGA 3DE6X 3JVDA 1J2EA 3T3GA 3ZE2B 4Z51A 3MMPA 1ZIPA 3B82A 4XVQA 4M0DA 2KLHA 1HI9A 4JQOA 2J0EA 4WAUA 3G89A 1PSZA 1U6KA 4D6PA 2ZJ5A 3PE6A 1VKHA 2IP2A 3PHLA 2XXJA 1YR8A 3EXG1 1X77A 1J06A 1WMEA 1MR3F 3U4QB 4FFRA 3FWNA 3SHTA 4YCJA 2Z8YM 2FQXA 4EARA 3V2IA 3EPLA 4RWEA 1NONA 3IUBA 1DBPA 3K0CA 2XMQA 4Q9KA 4QQFA 4ZRMA 4ABYA 4W9NC 2JB9A 2CK3A 3DWIA 1IHDA 4YC7A 2EXXA 3K1YA 2GAFA 3ZIDA 2W70A 1JG1A 3DOJA 2I3ZA 1U0NA 1W46A 3FAKA 2G3YA 2J3DA 3I4LA 1J56A 3QWFA 5A9RA 2K7FA 5CFPA 2GX6A 1WXGA 4BKUA 1O95C 1J90A 2CY0A 1PJCA 2A1IA 2PSDA 1L5ZA 1PBNA 2QW0X 4RV4A 3NALA 4UQOA 2QT0A 4US1R 1KPHA 3DEKA 4OLHA 2VCHA 3ANYB 4FS3A 4UTNA 1WVIA 1UFVA 2WTUA 1LLDA 2CVFA 1WZIA 4KAXA 5KNCA 1BS2A 1ZI6A 3QE3A 4EB3A 1VL1A 4EYSA 1Q6YA 1EBUA 4CT0A 5IAOA 4B3TB 2RHHA 5AVRA 3KQHA 3FFAA 2OAP1 1JXAA 4H15A 3CVVA 5JNRA 2VUHB 4KW7A 1NDQA 4BYMA 1ECPA 4DA8A 5TEWA 4MPJA 1Q22A 2FDXA 1JIXA 1KI4A 2AV6A 2VDNB 3F74A 1FSGA 4ZRDA 1IVNA 3BILA 2HQ1A 2UZ1A 4UFOA 2Z30A 3D1LA 4AP9A 1TIKA 3LDHA 1YS4A 3O8NA 1GQRA 4B8YA 1GRNA 4CCYA 2JLCA 3FR8A 4LWZA 4EM6A 1SU6A 1K3UB 2DJIA 2I87A 2RK4A 3SVZA 1T6ZA 3T4PA 1Z5OA 1T4CA 3IBSA 3VTAA 3D6NB 1XMXA 3EMVA 3TG8A 2XMDA 2D3TA 4JLBA 3SC4A 3U60B 2Q62A 3G7NA 4DBLC 3U19A 2PZMA 3MTJA 1C9YA 3TBHA 4BN0A 1B8UA 3R09A 2XKJE 2WP8J 3WNCA 1DAIA 1L7NA 2HJ9A 1FX1A 2GN4A 1DJNA 2V7QA 4IV5A 1SIUA 3NMUF 2R9VA 5CK4A 2Q21A 1GFZA 2AFRA 4OGGA 4NBNA 4DXDA 5DM0A 5JSQA 1G7SA 1HQDA 4LNHA 1OFUX 2ID9A 1AY0A 2V55B 3T9AA 3NAMA 4CLEA 2HU2A 4S0ZA 4WADA 2ICAA 3FY4A 3T5DA 2HA4A 1JKFA 2FWJA 2MIIA 3ADOA 4I4TA 2XE7A 3TH5A 4OHYA 2R5WA 1T25A 2QRQA 3AIOA 3GT0A 3IA7A 3KT0A 4P4GA 4TT3A 5EWJB 5EUBA 2J5QA 1T26A 1VMKA 2EYQA 3PFIA 1U8CB 2X2OA 5D5QA 1OX4A 1WB4A 4P0TA 1NSFA 2IXBA 4E2YA 2CLOB 3ZNPA 2B5OA 4YFYA 1S3IA 1HE5A 3EWIA 4G97A 4HDKA 4RD4A 4LY6A 1R7RA 2A92A 2VI5A 4HMQA 4TLLB 4WBNF 5CYOA 4BJ1A 4YAJA 4CFSA 2PH1A 1E2FA 3UAGA 4GYKA 4WN9B 1KPIA 2UU9B 4AG5A 2PD3A 4IMJB 4QPPA 3LKBA 3BH7A 2WIDA 3LXRA 4WDRA 5HCNA 4CEJA 1BMFD 2CYBA 3B6IA 1SXJA 4IIDA 1O0BA 2G63A 3COSA 3W7VA 2UUOA 4HKTA 3HO8A 1A7JA 1XVTA 5ALZA 2F1OA 5FI5A 1ZYUA 5AK5A 2OENG 3CRZA 2IYWA 3I9LA 3LK6A 3NV9A 4LEIA 4BB0A 4IOLA 3ZI4A 3OY7A 1W73A 2Q5LA 2HK7A 3NIBA 4DRXB 4NESA 2GEVA 1I2BA 4H0NA 3HYTA 3OIUA 4PGFA 1SXJC 1BS9A 1DO0A 3QVUA 1V3VA 4PHTA 2G40A 3OKFA 4Z7NB 1D09A 3TDMA 4LJ9A 1VE6A 3KQOA 1RBZA 3IP5A 4G2NA 2QL6A 4BFYA 5JSKA 1L7OA 2WAXA 3VSBA 1HNNA 2COKA 5G0VA 1GA4A 1M2KA 5LDHA 3ENVA 1EFHA 3ZY6A 4PFSA 4YPOA 1YOVB 4R7GA 4ECAA 1M34A 2JFYA 4F9FA 3BICA 1CRWG 1T9KA 3BJMA 4L51A 3GPDG 1JHVA 1CY2A 1G3MA 3TL2A 1Z7GA 4ENQA 4D8YA 3FMVA 2AW5A 2FW8A 1V1RA 2PR2A 1CYDA 1DEKA 1SQ6A 3B13B 4NJEB 3B7GA 4TM8A 3ZYZA 3UMBA 4YMUA 5GIPE 3JARA 3O47A 3KJZA 5CLGA 4EQ6B 1CP2A 1WDKA 1USVA 3RTGA 1YR3A 2J5BA 1WUJS 4TL6A 5CX1A 3RYCB 4GUDA 4OHVA 4B09A 3K53A 3AFIA 3TPCA 4PZDA 2BKLA 3T9FA 4CQNA 2Y68A 1L5VA 3BIXA 4YMTA 2IELA 1GPYA 1SCKA 1KDPA 2V6BA 2Q6TA 1KZ1A 1AKWA 4H7EA 3SX2A 1DHTA 4JFRA 2PUGA 4DPKA 2ZRFA 2QP9X 5CUQA 1STOA 3HSSA 2AWOA 3FDIA 1HYQA 5AM4A 1IAQA 1K0FA 4NX2A 1M6EX 4AG3A 4BFSA 5K4GA 5CITA 2NU7B 4JT4A 5JAQA 3ANXA 1KHTA 5D86A 3NU1A 3GLFA 2HB6A 5ETJA 2PX4A 3QG5A 1UXJA 4HB2A 4I2VA 3ZU2A 4ZVSA 5I9BA 5CVTA 3K9QO 1KXJA 4Q4AA 2O2IA 5CA1F 4H60A 1FLAA 1IK4A 2QX8A 4C0JA 2J6IA 4E1AA 2JJQA 3GYBA 5CTJA 3KB1A 3W9SA 2QD4A 2YIVX 4HTFA 1TD9A 2VYVD 2WU8A 4MQ5A 4ZVKA 1KTIA 2C29D 2XT6A 2FOLA 2G1AA 3E22B 3TXYA 3D0KA 3WFZA 3LL7A 1P7WA 4D0GA 4PHHA 2C57A 3QPCA 1RXSA 4UCQA 4DVJA 4ZJUA 1LPBB 1NKSA 1ML4A 2X0RA 2XE6A 4QQRA 3M4NA 3LPDA 2IPNA 5BVGB 1B3RA 1TA4A 2WZDA 4QNNA 1MX3A 2XB6A 5JBIA 4E07A 3R7SA 1IDN1 4AZ3A 1RRPA 5B36A 1TYZA 2YQ5A 2W71A 5CEFA 2VK4A 3FGPA 4FUTA 3UMYA 3D8BA 3NI2A 3U49A 2E82A 2NO5A 4L95C 5DFAA 4HDCA 1LJ8A 2IUSA 3O3MB 1KJQA 4RKQA 4EFNA 4KXVA 4ZOCA 3ECSA 4C7KA 2H2WA 2WWTA 4LUCA 4BQEA 4QHYA 4JWTA 1Z63A 1RRFA 1IB0A 1W52X 4BO2A 4HLNA 3EPPA 4DCMA 2R84A 5C7LO 3NHKA 3F5FA 3TS1A 1QLWA 2PBZA 2V7EA 3I42A 1IXRC 4MB6A 3EEOA 1OOEA 1L7EA 2Z1DA 3AI2A 2QTWB 4NMLA 1RAFA 2HX1A 2Z43A 1H3EA 1PWXA 3SF8A 1M2VA 2XDQB 4R7TA 1OKKA 3K9HA 3G0IA 1ADJA 4A27A 1ZGCA 5L53A 3ZDAA 1APBA 4JBIA 1EG7A 3M6MD 3B7PA 1WV1A 3NRBA 5IVDA 3R75A 4N5NA 3UGJA 1NXPA 4G0YA 1C0LA 4W1PA 1X19A 3TOXA 1CEQA 4RHTA 2EW8A 3PQ4A 2XITA 4QPJC 2QUHA 4GBMA 4BUZA 1I7DA 3TMKA 1FVFA 3LP6A 4OHBA 3FDJA 4X3CA 3R8CA 4ZZ1A 4V1CB 3HDVA 5LZ2A 1JR4A 4MGKR 2EBUA 3HJBA 1NVTA 1P4GA 1T9ZA 2X13A 2IZ7A 3EFEA 2GZSA 3P4XA 3U4CA 3ZZUA 2I3GA 5AVXA 4BZWA 1QHHA 1VYHA 4I3GA 4ZA2A 2M32A 3EAFA 3L6RA 4X45A 5A7GA 5TB5A 5MFPA 1M6HA 4R0NA 5BT9A 2QLTA 3QMVA 4FR0A 3WK8A 5M5BA 3THOA 3TD9A 4WH0A 1NJ6A 3V3KA 3R3YA 2VVTA 1DB3A 2JS7A 2YNMC 3VR5A 2FXIA 3T0GA 1W47A 1B6TA 2BR5A 2B94A 3M6XA 5SYNA 5KTPA 5FL7D 3JQ8B 4ZC8A 1U0BB 2IH4A 4XOUA 3IUYA 3EWAA 2BYTA 1REQA 2BSQA 3ZPXA 3A6GA 4NYMR 2Q5EA 1P2FA 1Q6ZA 1M1ZA 2VSFA 1JMYA 3QFHA 3NHSA 2FFJA 3R9KA 4EG0A 4ALMA 3EARA 3GJSA 2WB4A 1AKMA 1XU9A 4KODA 4KWHA 3VBEA 4G1VA 3TVDA 1P2TA 2ZT6A 3UMVA 4DCSA 1C7RA 4QG3A 2JAWA 2PZAA 3VSDA 2P2DA 3S7ZA 1RRCA 4WASA 4X7RA 4F12A 4K1XA 3RYIB 4GXTA 2QV0A 4TM7A 2Q4OA 4N5IX 2QVBA 2RSLA 4ROSA 3OVMA 2FPIA 3EDQA 2Z09A 4ND1A 2VHCA 3S1AB 2PN1A 4RF2A 1KYYA 3DMYA 3T3IA 3KKQA 4O2BB 4L8GA 3BTVA 5CXSA 3AUSA 5E7IA 1TE2A 3C3EA 5CDYA 5LDDC 1HWYA 3SSNA 2QENA 3N2GB 3LPLA 4WOBA 3R9XB 2XDAA 2CWWA 1L8QA 3PHGA 2OHOA 5ICEA 2EKZA 4U0JA 3V8EA 3WK5A 5REQA 3GPIA 3OJWA 4YJ2B 5DCYA 1NVFA 5K2OA 4QM7A 1Z0SA 1CEYA 1GG9A 4ID3A 4JLKA 3I5MA 1TU4A 3H97A 2QUJA 4LDAA 4IH4A 3AF3A 4C0SA 3O91A 1KNXA 1PS9A 4O4LF 1R15A 3BWYA 4OAOA 1I6LA 1R37A 1NMEA 1Y80A 1ZOPA 2HF7A 1S3GA 1WSWA 2QRGA 3ABRB 3MVEA 4QDXA 1JG6A 4JZYA 5F5LA 3RRMA 1TJ5A 5L3QB 1CUBA 1G42A 1UC9A 5ESWA 1K75A 2XYVA 5EWLA 1G16A 4F1JA 2X8AA 5DLQC 3PGLA 3Q0TA 1XU4A 3A4VA 1B26A 4CVNA 3V4RA 3HNOA 3KBBA 4FYHA 1QGUB 1PLKA 3OLCX 3VFDA 3I2HA 4D1YA 2H0QA 2EC5A 3DMDA 3F46A 3B1XA 1AQ6A 1YVUA 4N8EA 1R6UA 5CB6A 4B44A 1MENA 2IODA 5CJPA 3NHZA 3FDZB 3T3OA 3E6AA 5C5CA 1DWOA 2X2EA 3PYXA 4OBWA 5BRJA 1G8JA 4Q1BA 1GUAA 1TO2E 1TZMA 3EW7A 4W8OA 1CVRA 4CMEC 1MRNA 3VX3A 1ZD8A 2CF6A 3NHRA 1Z2OX 1OYVA 1JL3A 3N7AA 3IAAA 3UGTA 4N8DA 4DSOA 2Q7XA 3IP6A 2P41A 1Z6ZA 1WZ2A 5ECYA 4F4JA 3TQFA 5BN5A 3TFOA 2H1HA 3UMFA 1NATA 4H7DA 4REOA 1NMQA 1YZFA 2ALJA 3EAQA 2JI8A 3MTGA 3MS7A 4KTVE 3T15A 2ESRA 4DIBA 2ECPA 3UGQA 3ETHA 4MV4A 1GHTA 3ZOZA 3UCXA 4YMSA 4BC1A 3WHPA 3IQWA 3ZJYA 2BR4A 2ST1A 1XYGA 3QE4A 4GUAA 1E3IA 3INYA 3WLLA 3OMWA 1PCXA 5AVWA 1GY8A 4IFIA 1RWWA 4QOGA 3V8MA 2AN3A 3AU8A 2VHVA 4Y1GA 2C4NA 3ELUA 4PO9A 4WY5A 3S55A 1Q21A 4PEVA 4E7OA 3Q7QA 1ISPA 1H1LA 1V7QA 1XDDA 4FDMA 4URUR 1QSGA 3FCAA 5A62A 5NLLA 2R62A 2HPHA 1XB2A 4QFCA 2I2XB 1WW8A 3AETB 3EZXA 1JB1A 1EVYA 4RYLA 3BC1A 4WNIA 5ICSA 1A2BA 2GCOB 2ZUUA 1FRNA 2R00C 2QLBA 4H18A 2A5LA 1NP7A 2O5RA 2QPOA 4NC9A 4A1OA 4G0UA 3I32A 4L0MA 2NX2A 1E2JA 1L4BA 3S2UA 4TTVA 1V71A 2C8VA 3NGXA 1Z2AA 4ARVA 2UZ4A 4YAOA 1E1NA 3AIIA 2BEWB 1CB0A 1K7YA 3C8ZA 4WPGA 3WWPA 4GR5A 1WHSB 1NLYA 2Y1EA 4QUIA 2PUHA 3FYUC 3L0ZA 2V58A 4JY7A 1Z12A 4XM1A 5BQXA 2CVPA 3KTAA 1U3CA 4EJ6A 1U94A 1JH8A 3GT4A 4JLNA 421PA 1GUFA 4RVUA 4GZLA 1IYZA 2PUJA 3JQ8A 3EPKA 2X9LA 2B92A 2EU8A 3DP7A 3GA7A 3U3OA 4URVR 5BWBA 4UMDA 3K2QA 1AK1A 2ZR8A 4R84A 5DHFA 3U39A 4FGSA 2C00A 2ZKIA 1U8AA 4O2BF 4OQQA 1KVTA 3IUJA 4KQ6A 2Q50A 5D1NA 5C5DA 2G0TA 5TQ0A 1ODLA 2Z0MA 1GILA 5DB4A 3FN4A 4F60A 2DLNA 4MGYR 4HQKA 2JGDB 4DG8A 2EERA 2H2DA 3FI9A 4M8SA 3T3PB 1G66A 1I6MA 2WF7A 1EFDN 3VTZA 4AIIA 4KREA 3SDBA 2V6GA 4ZGBA 2EOAA 3OECA 3PA6A 6YASA 2BZ1A 1XZFA 2LP4Y 1U4SA 2JFGA 4I1OA 4DYDA 3CUKA 4DUYB 1MMFB 3PA8A 2GZMA 2C96A 1QK3A 1K5GA 2CNBA 2WTEA 3A1VA 3FNBA 3TB4A 5AM0A 4B6FA 3HK2A 3EJ6A 4I5EA 5C7YA 2QLNA 4CIYA 5A0VA 2P2NA 4G86A 1VE9A 1U28C 3IR6A 5ENZA 3PHBE 3Q3EA 5DHUA 3EXFA 4PHCA 1E89A 4BFLA 1XCGB 4BNKA 1VE7A 2AI3A 1LI7A 3I9V1 1CUEA 2D4HA 1Q0PA 1QAOA 3A9WA 1XAGA 3CUEF 3P26A 3OKAA 5DBHX 1AE1A 3AMVA 4BVAA 3PPVA 1QH0A 3O2NA 4II7A 3HVUA 1TIBA 1E0DA 3ONDA 3WWOA 4TLAA 1IY9A 2AXQA 1T8UA 3PQ5A 4E5PA 1GGMA 1U0LA 2QUAA 5L3SB 1GAXA 5J5CA 2H1FA 1N7GA 3ESCA 2XAAA 3KUCA 3GP5A 5C3UA 1EFPB 2XI4A 4B79A 3VZDA 1GNLA 2XLCA 5FOVA 4HXEB 4UZFA 4TT3D 5HKLA 3U9TA 1NV8A 3CLRD 3CNBA 3SCZA 1ZU4A 2JLSA 1LVGA 5DTQA 3PKIA 3UPUA 5AI0A 1L6IA 2B4YA 4QAJA 5IAJA 3LVRE 2AG0A 1ZI8A 2OCDA 2QTCA 3CO0S 2GJAA 3FNHA 4UTXA 4QG7A 5C31A 4Q7JB 1H2YA 3RS5A 4V1CA 1D0VA 4LF4B 1G0NA 1JT9A 2VDQB 4KVZA 3VOBA 3TL3A 4JB8A 3JXEA 4RK5A 1P33A 2DLDA 2RD2A 4GPIB 4V0LA 3E18A 3WDSA 3OG9A 1NG9A 1GT91 1JTVA 5AKJA 1UZUA 1XXHA 2N47A 3O3OB 1V3QE 3RSFA 1TADA 4JKYA 1L5NA 3TZ6A 2OV4A 2W0MA 3B3FA 5K0LA 3AF0A 3VV2A 5ITZA 3RDPA 2EV9A 4HTFB 2F9LA 5CA0F 2H00A 4L4UA 1YNOA 5FBWB 3KPVA 3LH5A 1H4VB 1DRJA 3CLRC 3BOSA 4MCAA 1KERA 2YBEA 5IJ0A 1Y37A 4NDAA 3CR7A 3NWBA 3WL8A 1MLDA 4AU1A 4B84A 1N8TA 1NOKA 3OIWA 2RC5A 2C4WA 4RJTA 1J0CA 3BK7A 1I2ZA 1P45A 4NKRA 3T3DA 2GHTA 1XD9A 1ZCAA 3QBVA 4XLTA 2GJSA 2W42A 2WG1A 1U2GC 3RV3A 1VOTA 2HA7A 4F3RA 2RGRA 5LOVB 5E6SA 1X7DA 4Y6GB 4AKIA 3QVVA 5BSHA 2H51A 1J0XO 1E59A 1KBOA 1T3HA 4ABTA 3I2JA 2OMKA 2ODPA 1VG8A 5A6SB 3VGJA 2ZOSA 3DEHA 3E9RA 2RGBA 3ZLJA 2A1UB 4PX5A 4MRAA 3DHNA 3MUFA 5HTOA 2IEDA 3NWJA 4XB6B 1A5ZA 1UMDA 2CUZA 3DV2A 1P4AA 4KPYA 3H87A 1NLUA 2JK1A 1LGYA 3I72A 5GZ6A 1E63A 1FP2A 2AVNA 1DO8A 2NZ2A 1MC1A 2X1VA 3B6JA 1CY7A 3BFJA 4EHLA 1ZKDA 1K2VN 1PGOA 2VTEA 1A4IA 4PFQA 4G36A 3TOCA 3OU7A 2CHQA 1AMNA 2J85A 3AP1A 2W6MA 1Q7CA 4UUNA 4KHPB 2WPDD 2UXBB 5GTDA 3C1UA 5IAAA 1EM8A 1RWXA 1UR5A 1N9GB 2RAUA 1FDOA 2VHTA 4JS0A 4LOLA 3KYIB 4MVJH 3URMA 4L5AA 1BJRE 1UINA 2A0FA 2JDIA 3A04A 2GYVA 3F8SA 5CCEA 2EJCA 4BX3A 5B37A 4UOZA 5A06A 4RY0A 4OHZA 4HHEA 3BGSA 1G5PA 3DZFA 4LMRA 4Y9SA 1BXZA 4V0RA 2HWYA 3CEJA 1QPGA 4HAZA 1GCAA 4RY8A 3S29A 5KHOC 4ZCSA 4Y1RB 3SICE 1XQ1A 4Z9BA 3UQYS 1E4YA 4YRJA 2B1GA 1UAAA 2WP0A 4I4TF 5C8ZA 3OOJA 4HWTA 4WQMA 2JGNA 4ZT5A 2I4NA 2D1FA 3MT0A 5KTYA 1GNTA 3DT6A 4O4LB 2CMGA 3E2IA 1H69A 4PZ0A 3C4QA 1LDYA 2W6PA 2Q4BA 2RH9B 3WGOA 1P9WA 2ZJ8A 5A4JA 4RTSA 2CLKB 1O89A 3IAUA 3VZQA 1KDZA 2ZUWA 2I8CA 3X0DA 3QOXA 4DUGD 3GLGE 3PXEA 1QB7A 4HYQA 4UHBA 4UOQA 3NNSA 1FFHA 3R7WB 5J4HA 4RVFA 4MQMA 5BVHB 2AG1A 3EFHA 4MUFA 4HAIA 4XTCS 3WRVA 4FYVA 3F8WA 4Y2HA 3K0SA 4WKOA 2BHRA 3MMXA 1JYFA 4KDFA 3ZCUA 2JLRA 3IHWA 3PPXA 4MW9A 1WL8A 4FKBA 3REGA 1VB5A 2B98A 1E4VA 1U8FO 2O8NA 2WYVA 4LYEA 5J59A 3KSBC 2C58A 5SZHB 4DV5B 1OYYA 1Y5LA 3AINA 2AZDA 5I7SA 1X8LA 1SUSA 2O2ZA 1SWVA 3WGIA 2PXAA 4I46A 3UGKA 1GDTA 3OCJA 4RQBA 1JXQA 2E37A 4HGPA 4QEZA 3DEAA 3IEXA 4QEKA 1WKCA 4QVGA 1J9ZA 4DHWA 5DNYB 2HYIC 1F51E 5JY6A 3I37X 4UVDA 3R2JA 3IIIA 2CHFA 4X93A 1FA9A 4OD0A 4ITUA 1ZUIA 4FBMA 4Q9HA 3FMPB 3AZQA 3RPEA 4BMZA 5C8YA 1ZJ5A 3TBFA 1O8CA 1JSZA 1C5KA 5CRIA 5DM4A 3ZGLA 1U1IA 4BBAA 2AJBA 3VQTA 3ZC3A 2C61A 2PK3A 5CDGA 3RQSA 3DM9B 1P9NA 4ZEOA 2C9YA 4D25A 4WFIA 3WRXC 3CZ4A 4NZYA 2MTBA 1FFAA 4N82A 4YUVA 3WI7A 1YH3A 4EB8A 3FTPA 1EFPA 1WF3A 1XRSB 4L07A 2C3YA 3BT7A 2W2LA 2OSBA 3ZS9A 2DUWA 4ISBA 3GZNB 2QVLA 2CKMA 1G64A 1QR6A 1XCJA 3EC1A 2ZS9A 1PBTA 3PC4A 4GQBA 4KL8S 1NU8A 3TINA 3EK2A 1GL6A 1CIJA 1NUTA 3KR9A 1J5XA 1NNI1 1NR7A 2FFHA 2P6NA 4HDKB 4NBRA 1WXQA 3ZHRA 2XCSB 3IT3A 1FUUA 2BBTA 2ECFA 3DCNA 5D84A 1EU1A 2HFJA 5LZ4A 1ZBDA 2HF9A 4W1SA 3SFZA 1NVEA 1R5BA 1RAHA 2J6HA 3PC3A 4E1BA 4EITA 3NRCA 3IAEA 1NLMA 2DFDA 1II8A 3K4QA 4RENA 5F23A 1UK9A 4PAQA 4JJFA 3B1ZA 3DMRA 2FOIA 2PH7A 4RKEA 4UUPA 4V02A 3E4DA 1FS5A 2JLAA 4Y1FA 2VPWA 2ZTSA 1YTUA 3E7PA 4WWHA 3QOYA 3DBLB 4DDHA 3PP8A 4WBSA 4GM0A 3GZNA 2QJWA 4Q1FA 4Z9AA 1K06A 5A05A 1CC1S 1F1JA 3BB1A 3IRVA 5ITWA 1YBMA 3L1VA 2P3LA 4MEJA 3ZIAD 4BNZA 1RCTE 2QOEA 4V0MA 2XMZA 4LFAB 1XMOB 1D2GA 1NAHA 3B20A 3HSYA 4AVYA 4EVSA 1F8XA 2ATVA 2GJ4A 4U6QA 4AQDA 2BV3A 1NQUA 2W58A 4B3BA 3DWGA 4DLAA 5IPFA 5AUOB 1ULSA 1KFJB 1IEWA 2R00A 3CU5A 4RFLA 5F1YA 1L5MA 3BWBA 3V8VA 5LR6A 4UUQA 1EFVB 3ORRA 3ZKAA 1JF8A 3F71A 3ZWOA 5JVDA 2O6HA 3E1KA 1RD4A 3PFBA 4I9HA 4D6YA 3UJHA 1M2FA 3RYFB 4QUJA 2Q8PA 1CPYA 3AM4A 4MKHA 3ZXIA 2PHZA 4N5LA 5E4TA 5JRZA 4O8CA 5EMNA 3L9WA 3A6HA 5F52A 5KTOA 5CH5A 1NQ5A 5BP7A 4Q3AA 2F1JA 4OVKA 1HFEL 1JSXA 4FQ5A 4TVBA 3B9RA 2YYZA 4TLEA 4OMDA 3U7QA 3FB1A 4H1UA 3WGYA 1DPFA 3FSGA 3H4MA 1OQAA 3LUHA 3NYRA 5CDSA 2ZCJA 1M7HA 2VT6A 1C2YA 2YJ3A 1E58A 4RE5A 2ZDHA 3DAFA 3G85A 3N70A 1BXGA 1J2YA 4MV8A 3NDIA 1W9HA 2A5YB 3PL5A 4JH0A 4MGHA 4K3VA 5FOUA 3T7TA 3VNBA 5L4LA 3RSQA 1NJSA 4BWVA 2NSHA 2DFPA 2NMVA 1JILA 1L7MA 1HG0A 1XZQA 3TLAA 4QECA 1J2JA 1Z83A 3K9NA 4KMMA 1L7DA 2KE5A 4LC0A 4M60A 2CDNA 1XTUA 1SD1A 1KO1A 5KINB 3ETCA 5CVEA 1JQLB 3VH4A 3E5HA 2IS4A 3DWEX 4LRYA 5BMVA 5CM2Z 4TS4A 5JJBA 1H1TA 2O8FA 1I3KA 1PVDA 4YJ3F 1IZZA 2C5AA 4RSHA 3SYNA 4ENSA 1T9DA 3GLVA 4A8JC 5ADWA 1QWOA 4JAVC 4Z99A 1P61B 1VPEA 1I8TA 3TGLA 1AK9A 1JFVA 2J45A 4E2FA 4IDNA 3E7DA 5T7BA 3F7TA 3JZFA 4XX1A 2A86A 3ZV6A 1GPUA 1SKMA 1YDEA 2NVUA 1A4RA 1Z0UA 1U9CA 3A4LA 2HMVA 3I6IA 3L6UA 4NG5A 1FP4A 5HTKA 1Y1LA 5KI6A 3RKUA 1A5TA 4C4YA 1FRVA 1QMPA 1BD4A 4DLYA 3KE8A 3WLAA 3FGNA 3DONA 1J0EA 1LQUA 4TSKA 4KBYA 1YOVA 821PA 3OCZA 1L5RA 4YQFA 3N5KA 1SG6A 2GA8A 4EGCB 5IJWA 1TQHA 4RCVA 5EGSA 2VJBA 2HXSA 1TTQB 1U98A 4KLZA 3ZCQA 2DWQA 2SNIE 3LGXA 2AR9A 1KMNA 1N0VC 1PR3A 3QW2A 3V8PA 4BKPA 1CLEA 4N76A 5TF4A 1C7FA 4CKXA 2Y27A 5J1SB 1ZNXA 3B3GA 4M1WA 4TVKA 3MD0A 2QQEA 4D0LB 1DX9A 4FWIB 4MSUA 3RREA 4JZKA 5IUKC 5AW7A 3ZDRA 5BMVF 4PAOA 4CU2A 3SLKA 4FEYA 1HV8A 3O82A 1ZD2P 1Z73A 5C8YB 1RMTA 3QJ5A 4GNKA 1VIMA 1AD2A 2YVQA 4PG6A 4EA9A 3G6WA 3WHLA 5A6SA 5FAKA 4U6NA 1JIUA 2V96A 3PNPA 1Y1KE 3HB5X 3I5AA 1H2HA 4MXDA 3JX9A 1VCOA 5CNMA 3DNMA 2QLJA 3MG9A