2R8BA

The crystal structure of the protein atu2452 of unknown function from agrobacterium tumefaciens str. c58
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
PMTKDSYFHKSRAGVAGAPLFVLLHGTGGDENQFFDFGARLLPQATILSPVGDVSEHGAARFFRRTGEGVYDMVDLERATGKMADFIKANREHYQAGPVIGLGFSNGANILANVLIEQPELFDAAVLMHPLIPFEPKISPAKPTRRVLITAGERDPICPVQLTKALEESLKAQGGTVETVWHPGGHEIRSGEIDAVRGFLAAYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the protein Atu2452 of unknown function from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Atu2452
total genus 60
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r8bA00
5K3DA 5AJHA 1YB7A 1ODSA 3HI4A 5AM0A 3ZLVA 4BC1A 4E11A 1YAHA 1E8DA 3T52A 4NVRA 1ODCA 3OPMA 4CIAA 3C45A 4X93A 4IH1A 1THTA 4BP8A 3C70A 5JZ9A 3WL8A 1XLVA 2QUBA 1XZAA 3WKAA 3M83A 1C4XA 1MN6A 4Q3KA 2XLCA 5FOQA 1N5RA 2HFJA 4A16A 1BN6A 3TRDA 3R40A 4UUQA 4PSUA 2ZJFA 4H7HA 1XLUA 3IUNA 1LLFA 4AMYA 3G0IA 1EH5A 2GYUA 5AM4A 2Z8XA 2HA2A 1Z68A 1QIDA 3FNBA 2O7RA 4X85A 5HKAA 2PSEA 1CQWA 1ZD2P 1UWCA 2OGSA 3D59A 3LIPA 1QIGA 5KWIA 4UBKA 1UK9A 2JGMA 3H19A 4MXDA 3DNMA 3HEAA 1ZJ4A 2AJLI 4BP9A 3RKSA 2HU8A 2WHRA 3H2GA 5FDFA 1NU8A 2XUDA 1USWA 1MNQA 1JJFA 1CUFA 2QTBA 3FYUC 1XRPA 5A7GA 4B9AA 5T4EA 4C01A 4BCDA 1HKHA 2X8BA 1T4MA 4F21A 1CIJA 4AB1A 4H7IA 2WQZA 2H7CA 1GQSA 2G63A 1CUZA 3TJMA 5IKXA 3FYUA 1LBSA 3NUZA 4W9RA 3WKDA 2PU7A 3ANTA 2RI6A 3WQHA 3I2IA 4MYSA 1EX9A 4LKOA 3WWCA 5BWCA 4NMWA 2XUAA 4OU4A 1UKBA 4WDQA 2DHCA 1BEZA 3IULA 4GHWA 3D5EA 1ACJA 3G9ZA 3QPAA 5A6VA 1IUPA 4FLEA 3FLBA 4IQ4A 5AP9A 3QMMA 5K3EA 1JFRA 4DGQA 2VA9A 3I2KA 1DWQA 1O6GA 3F67A 3HLKA 4MYDA 3CCBA 1DQZA 1CUBA 1TKRA 4OCZA 3B3QA 5FPPA 4EZIA 4FLFA 3ZLTA 1FSSA 3CN7A 2XLBA 2PSFA 2GBCA 1GKKA 2PUHA 1LPNA 1TRHA 3WA6A 4UHCA 2BGNA 1E89A 4B6GA 5DLPA 1XZBA 4IH9A 5E4TA 5ALWA 3H2KA 2JF0A 4C89A 2RONA 2WHPA 2C5FA 2DSNA 1MX1A 1AKNA 3C8HA 5AKHA 3ZPXA 3C87A 1IUNA 2WIFA 5T4FA 1T2NA 1A8UA 5IVIA 5JD5A 2PL5A 3K6KA 4U2GA 4J0CA 1QTRA 4I19A 4Y2TA 1QFMA 3I2FA 3IIIA 2ACEA 3VXKA 3WWEA 3WI7A 4X91A 4HTAA 3O9VA 2X76A 5ALNA 1WOMA 1CV2A 1IVYA 2I78A 1AQLA 1EA5A 4X90A 3W2TA 3ZV7A 2WFLA 3WL6A 2J4CA 1KU6A 1XLWA 4ZV7A 5JASA 3OOSA 2XUHA 1MU0A 1C7JA 1Y7IA 4QWMA 4PF1A 2H9YA 3W9UA 4AO8A 4PSCA 5JD4A 3SX4A 4K6HA 4G1FA 4KRYA 1WCYA 4B85A 4P92A 1AUOA 1BS9A 4JEIA 2XQJA 5SYNA 5LKRA 1UXOA 4GDMA 5CTAA 5FPQA 3VKFA 5JATA 1F0PA 2ZSIA 4UHHA 5KWJA 3O4JA 2HA5A 1K63A 2HRQA 3C43A 5IVHA 3WJ1A 1UKAA 5JAHA 1GPNA 1KEZA 5CBKA 2HADA 1XQWA 2WU4A 3WK9A 1JT2A 4HRYA 5A2GA 4AXBA 3N2ZB 3DL4A 3PDCA 3WWPA 3KOOA 4Y9SA 1Y7HA 5E2IA 1U4NA 4OD0A 2YH2A 2VAXA 3PE6A 4EUSA 2HA6A 5EIEA 2CUTA 4P08A 3LLCA 3QZUA 3KWJA 1QTIA 4XWGA 5D3KA 3BWXA 3DCNA 3OM8A 4N8EA 4RNCA 2ZYSA 1HLGA 1DQYA 5AKKA 2WJ3A 1C7IA 3LS2A 1THGA 4G4JA 5CW2A 4GXNA 3I2JA 1EVQA 5EHXA 1B41A 2IX9A 3FVTA 4KAFA 3WIOA 2AJCA 4W1PA 2PSJA 2V98A 3P2MA 4BATA 4MWTA 1P0PA 2OCIA 1XRQA 5AI9A 4G8CA 2Z3WA 3VJKA 2FJPA 3PF9A 2VATA 1YAJA 3WK8A 4KE6A 5HZGA 1YS2X 3WLAA 4WY5A 1SCQA 4JYMA 4BAUA 3O4GA 4EB0A 2EDAA 4WDRA 1EI9A 1XQVA 2XUPA 2OG1A 3FYUB 4BVJA 3AUKA 4JYPA 1CRLA 4J0KA 5ALOA 2XT0A 3H2HA 4DNQA 3TEJA 1UZAA 3C6ZA 4E15A 1P0MA 2HU5A 1X2EA 1CUUA 2AJ8A 5EIAA 4Y2XA 3WL5A 4Y7DA 5AOAA 3T4UA 4Q3LA 3B5EA 4UHBA 3IVMA 5KREA 1N8SA 2OCKA 4BTVA 5ALJA 4TGLA 1ZD3A 2O7VA 4Y2UA 1YS1X 4X71A 3OURA 3R3XA 3V1NA 5DNWA 5IVDA 1HQDA 2VJCA 3BL8A 1YB6A 2PUJA 3DJYA 4J0DA 4H7FA 3QMVA 2RAUA 1E3QA 3CXUA 2GZRA 5LZ7A 4DYHA 1VLQA 5HFAA 3A2NA 3ED1A 5AIBA 5I9IA 3I1IA 1QIJA 3UMJA 1J2EA 4O08A 3D3NA 2RIPA 3FYTA 4UBMA 3K2IA 4N5HX 3QPDA 4XX1A 1E66A 4GEGA 2Y1KA 1BRTA 2WUFA 3WKEA 1DT3A 5AICA 2ZJ6A 1AGYA 3QBJA 3BIXA 4FNMA 2XMDA 2WSLA 1GPKA 3BJRA 2J3QA 4PW0A 2XQFA 2ES4A 5T4HA 4Q05A 4HVTA 4AZ0A 4ZRDA 4QDZA 4LXIA 1KU0A 4GBGA 4LYDA 4BTLA 1QOZA 3PF8A 1JU4A 1HBJA 2VT6A 4XJVA 3S8YA 2BJHA 4ARBA 5CXXA 1EDDA 4QZVA 3IURA 4BVLA 2OCGA 4QLOA 2HFKA 2QVBA 2VJDA 1ISPA 4FBLA 4HXFB 3F8SA 2JBWA 1AURA 2X5XA 3I6YA 1VE6A 3R3ZA 4DTCA 2ONCA 1ZGBA 4OYYA 4EY8A 5ALLA 4QLAA 4OUKX 5CT6A 2OCLA 1LZLA 2JGIA 5AM2A 5CT5A 4BZZA 3KDAA 5AI8A 2XUIA 1DWPA 4YPVA 5HQ3A 1K4YA 1XRLA 5ESRA 4K6GA 5C7YA 2QXUA 4J03A 2I03A 5K3BA 3FCXA 4KE7A 4ZXFA 5EI5A 2DHDA 3LCRA 5DYWA 4H0CA 4AMZA 3WYDA 5DNUA 3STXA 4Y2SA 1XZFA 1E5TA 5AK4A 3QITA 1H23A 4FMPA 4A5SA 2D5LA 1H2XA 4J0IA 4WJLA 2CMFA 5ALIA 4QE3A 5JADA 4FFWA 2GBIA 4UFOA 1CUEA 3HSSA 1I6WA 3WKCA 4EY6A 5C8XA 3W04A 1Q84A 5EHQA 1JMKC 3F9CA 2VF2A 1GXSA 1CUSA 3EQ7A 4BZWA 4DNPA 1A8QA 4YASA 2HRRA 2XI4A 5JAPA 2LIPA 1H2WA 2PPLA 5AKJA 1XZHA 4H7EA 1ORVA 1LPBB 5AI5A 2QMQA 5BWBA 3EBLA 3V1LA 3EF3A 4AN1A 3EQ9A 4BVKA 3W05A 5K3FA 1W6RA 5EFZA 3EIOA 5ISMA 2CKMA 1N1MA 4W1QA 1E8MA 5AO9A 4G9GA 2Y2VA 3GELA 2IITA 2ORYA 4B0OA 3CN9A 4GECA 2QJWA 3PFCA 3E1GA 1XRNA 2GYWA 3IBTA 2HHAA 1MJ5A 4E46A 2WUEA 2HU7A 1GGVA 3F98A 1EDEA 5AH0A 2XQKA 3BDVA 3WK5A 1X70A 2WKWA 4N5IX 1QLWA 4W1RA 1R4ZA 4B84A 1ZIXA 1DINA 1CUCA 1DU4A 2WTNA 1WB4A 3STYA 4BDTA 3DS8A 3TGLA 1GQRA 2B20A 2WLSA 4IO0A 3AZOA 3YASA 3AFIA 3VJLA 1FFDA 2DR0A 2HL6A 1CUGA 2HA0A 1QONA 3H2IA 4H77A 1XFDA 5YASA 3IA2A 2Y6UA 3HZOA 3HACA 2PSDA 2DQZA 3L1HA 5HF8A 4NS4A 3DOHA 5LZ4A 4AZ3A 4EY7A 2ROQA 4FHZA 4WY8A 4Y2QA 3AJAA 1AX9A 3RK4A 2OPHA 2XMGA 1PJAA 3I28A 1LPAB 2OLEA 2RHWA 4TVKA 5CH8A 1DX4A 2QJRA 2VJAA 1ODTC 1XRMA 5LYYA 4PO3X 1QJ4A 1BROA 4LXHA 4I4CA 2QUAA 2GBFA 3D4LA 4L3WA 4B81A 1UOOA 1VXOA 2ZYIA 1VZ3A 2XUGA 2WIGA 2VEOA 4RE6A 3IB3A 2HA7A 1LPSA 1AMNA 5JANA 4JH0A 3O4IA 1YCDA 5AKYA 5ALMA 3JYHA 2K2QB 4X00A 1A7UA 4J0HA 1CUIA 5BV7A 5AK6A 3G0GA 1CQZA 1IZ7A 3C5WP 2CZQA 3PICA 5ALRA 3X3HA 4E14A 3ICWA 4DNFA 1XZGA 4NZZA 2QR5A 4MJ3A 2PBLA 5EHZA 4Y2RA 5K3CA 3DLTA 4CCWA 1W4LA 3A6ZA 3BXPA 3B12A 4V2IA 3STVA 4ZREA 5JARA 3ZWQA 4OB7A 4UHDA 5AI6A 2R11A 2G4LA 5AKXA 2RGUA 3HRHA 3H2JA 4TPKA 5FKJA 1QZ3A 5AI4A 1YA4A 2XMRA 4BB0A 4KEAA 2XUKA 1CUAA 4QWWA 1XZMA 3RLIA 5ALYA 1XKTA 4FNGA 4MEAA 2C7BA 4QDXA 3QM1A 4X7BA 2PM8A 2DQYA 5JD6A 5DNVA 1LGYA 2BFNA 1K5PA 1WHTA 4XIIA 1SOMA 4I3FA 4CG3A 3UUFA 3C6XA 2CB9A 3S2ZA 3U1TA 4DMKA 5FLKA 4GW3A 4UHFA 2YASA 3DEAA 3M82A 1TCBA 4Y2VA 2AJBA 1XZIA 3QVMA 4G9EA 1VA4A 5A71A 1H2YA 2VAVA 3HJUA 5AKZA 3OG9A 2NW6A 5HF6A 2WHPB 2WIKA 4KAJA 2P8SA 5CH5A 2JGEA 4DLNA 4BRZA 3ESAA 1BCSA 4U2FA 2I3DA 2W6CX 2WG2A 3H04A 2WFMA 1XZLA 3G9UA 4ROTA 4EHBA 3K9BA 3FAKA 4IH4A 4F5ZA 1SCIA 3M3DA 4KACA 4UBOA 3ESCA 1B6GA 3RARA 3DOIA 4K6KA 2WFLB 4H7DA 4ETWA 5FXMA 4Q34A 4KAAA 1F0NA 2QKYA 4AO7A 1FFAA 2XQGA 3FSGD 1UOPA 2C4HA 3E0XA 1UKCA 1OXMA 3G8YA 4G4IA 2IIVA 1Q0RA 2XMBA 1MO2A 2C0QA 3VISA 4CG2A 4UBLA 4KE9A 4QDOA 1BCRA 2Q0XA 5DTIA 4BBZA 3FBWA 1VXRA 1W76A 2OGTA 2VTVA 4AN0A 4Q1VA 1ZI6A 1VZ2A 4H35A 3LIIA 1AZWA 2JIDA 4P93A 4J7AA 1YR2A 2ACKA 5AKIA 1IUOA 1FFBA 3FSGA 4DM7A 1MX9A 4GWLA 2WJ6A 4C87A 4G5XA 5ALHA 4OSEA 1EXWA 2QOEA 1JMYA 3ESBA 3QPCA 3WYNA 5AI0A 4B80A 1LPOA 1CUVA 3PI6A 5AIAA 1QE3A 3O9MA 1EK2A 1CVLA 3WZLA 4FKBA 5JAUA 3G02A 3UUEA 3WMRA 2BKLA 4AQDA 2YYSA 1TIBA 5K3FB 5LIPA 3DYIA 2JGJA 1LZKA 2H7YA 4J3JA 1ZOIA 3W06A 4FBMA 2UZ0A 5JALA 1QIEA 1L7AA 3FLEA 3ZLUA 1P0IA 4K5QA 2HA4A 2XMZA 3AIOA 1A8SA 3VVMA 4BC0A 1CEXA 2XQIA 4GLBA 1NU6A 4LYEA 4WFIA 2O2GA 2JEYA 3GUUA 1CPYA 4WCVA 4QNNA 4B82A 3WWDA 4UBIA 1ORWA 3A2LA 4U2EA 1JKMA 2W22A 1TK3A 1AC5A 5EIHA 3R0VA 2XDWA 5E4JA 4C88A 5LKAA 5ALPA 2WIJA 4J0JA 1R3DA 5C8ZA 4C4XA 1HL7A 3C6BA 4PQEA 3STWA 5CURA 4U2BA 3BDIA 1EB9A 2HA3A 5LZ8A 1WPXA 1MAAA 4B7ZA 2XUQA 4D9JA 3HABA 5LP1A 1EINA 4MWSA 1BU8A 4WFKA 7YASA 4X92A 1CUJA 4IHAA 3CCCA 1G5FA 5DYYA 2PVSA 4QEKA 1TQHA 4CIBA 3R3VA 4KYVA 4EA6A 3U0VA 4M0FA 3DKKA 5LZ9A 4C6HA 5ALQA 4DSZA 2ZYHA 3RM3A 4X97A 2XUFA 2OAEA 5HK8A 2OGZA 3VJMA 2BUCA 2CEKA 5LZ5A 4OU5A 5DWDA 1VA5A 1K6EA 2ECFA 4RE5A 2HDWA 4Y2JA 2E3JA 3WK7A 1MTZA 1GPLA 1W52X 5JZBA 5ALUA 5FP0A 3NOXA 4GI1A 5JAOA 3QYJA 4Q82A 3HXKA 1O6FA 5AKEA 1OCEA 5I7UA 3AILA 5D7BA 5DTJA 1QIHA 4X6UA 5JZSA 4QDUA 4Q3OA 1YASA 1DTEA 1CUDA 1L7RA 4F60A 4LIPD 3H18A 2FJ0A 1G4HA 2B9VA 2VT7A 2XB6A 5ALZA 3A70A 4HXEB 3AIKA 2VQ6A 2JGKA 3ILSA 2RHTA 2WM2A 2JGLA 2WIDA 1ZGCA 4FLMA 2OQVA 3N0TA 2GYVA 4HAIA 2I3ZA 2WJ4A 1FJ2A 4RPCA 3DYVA 3VVLA 1G42A 1JU3A 5IVKA 1GKLA 5A7HA 1E8NA 4EY4A 3V1KA 3JWEA 5BOVA 1X2BA 3SC2A 4BCBA 4ZV9A 3GROA 3WA7A 1H22A 3SK0A 2O2HA 1EVEA 5D6OA 3H1AA 3O4HA 4FOLA 3FCYA 4AO6A 1LPMA 5ALXA 5CH3A 2JEZA 3WK6A 4RGYA 3V9AA 1WHSA 3F97A 4K2AA 2DCMA 4CG1A 3KSRA 3PFBA 1MNAA 5HQ3B 3FLAA 4UPDA 4ITVA 5ALKA 5AHXA 3PUHA 1WB6A 2H1IA 4YX9A 1XROA 2XE4A 1H2ZA 3GA7A 3L1IA 3FOBA 3KXPA 1R9MA 2WUDA 3EQ8A 5CT4A 5AM5A 4UFNA 2PSHA 3HYSA 4U2CA 3QMWA 1XZEA 5ALGA 3O95A 3WK4A 5FV4A 1XQYA 1MT3A 3I1YA 4BRSA 5A62A 3V1MA 3JW8A 1OILA 1XZDA 2Z5GA 1N5MA 2QXTA 3F96A 3KWFA 3ANSA 1UK8A 1IMJA 4FFVA 3D2CA 3A2MA 1LNSA 2ZYRA 2WFZA 6YASA 5HFNA 2BUBA 2WG1A 2AJDA 4PV7A 5CT9A 4L0CA 1U8EA 3QH4A 1QGED 1Q83A 3G9TA 3BE8A 4MQLA 4W63A 2WTMA 3I6ZA 1HDEA 2C58A 3D7RA 3I6MA 4DSAA 3GZJA 2B4KA 5AK3A 4FWBA 4F0JA 1VJ5A 5AOCA 5ALVA 4B0PA 4Y2YA 4W1SA 3D2AA 1WM1A 3DKRA 5K3AA 2WUGA 1UOQA 2OQIA 5AKGA 4BAZA 2GBGA 1TAHA 1GT6A 5JYCA 5CXUA 3AZQA 4C4YA 2XUJA 3VDXA 1ZIYA 3OC0A 1VOTA 1R88A 4M0EA 2EDCA 2V9ZA 2BAGA 2VSQA 5DJ5A 3Q8WA 1UK6A 1FFCA 1ZJ5A 4JUIA 4BAGA 5ALEA 1M33A 4Y2PA 3NGMA 3MUOA 2GZSA 2ZSHA 3IUQA 1XKLA 3H17A 3DDUA 1D07A 1PFQA 2O2IA 3BJMA 5C8VA 1R1DA 5T4BA 2XUOA 1EB8A 2QS9A 1F6WA 3WJ2A 1JI3A 4INZA 4DNOA 2C0PA 1U65A 5F4ZA 1QIKA 2BUAA 1XZKA 4LXGA 1RP1A 2Y2UA 4S0XA 1UK7A 5ALDA 1R50A 1CLEA 3GBSA 3FVRA 4HZGA 5HF9A 4DIUA 1GZ7A 4X6XA 5H3HA 2Z3ZA 5FRDA 3C5VA 3AINA 3Q0TA 4CI9A 1QO7A 2WILA 5AK5A 2JGFA 3BIWA 4PSDA 4FDMA 3NWOA 3WIBA 3IUJA 2QM0A 3MUNA 4DMFA 4ARAA 5E4YA 5DYTA 2OXEA 4FTWA 2FUKA 5IH7A 4QDTA 4ZGBA 2PX6A 1NX9A 2D0DA 3R3YA 2B61A 3DQZA 2DFPA 1WPRA 3ESDA 4BE9A 1W75A 3H0CA 1ETHA 2QZPA 5C81A 4Z49A 1JJBA 1W1IA 1CUHA 1Y37A 1UFOA 1QIMA 5AM1A 2G5TA 4KE8A 3BF7A 1Q0ZA 4BYMA 3G9XA 1ZD4A 3MGAA 5LLSA 1ZI9A 5AKLA 4C4ZA 5CT8A 1EDBA 1ZD5A 4HXGA 1RYYA 1ZI8A 3H1BA 2C5GA 4ZWNA 4X95A 3IUMA 3G0BA 5EGNA 4BE4A 5ALTA 3WZMA 2HM7A 3STTA 1CUYA 1S8OA 2AXEA 2VJBA 3SWWA 4EY5A 3L1JA 1LPPA 4N8DA 5FUMA 3WKBA 1QIFA 2EEPA 1R9NA 1SCKA 1CUXA 2BGRA 3W9BA 1J07A 3AZPA 3C6YA 4LHEA 3BF8A 4UHEA 5AM3A 2ZJ7A 5EHNA 4UFPA 1DWOA 3G0CA 5JIBA 5ALFA 3O0DA 4JNCA 1XRRA 4G4GA 2XMCA 2J3DA 2QRUA 4L9AA 4DMCA 3V48A 3D0KA 4B9EA 3G7NA 1QIIA 4J0GA 1K8QA 2XMQA 4DMHA 4KRXA 2PU5A 3ICVA 4OB8A 1TCCA 4G8DA 3R3UA 3I2GA 4UBNA 2WG0A 5KBYA 3IDAA 5A7FA 3E4DA 4OB6A 4H18A 1UT6A 4ZI5A 2BCEA 2DHEA 5CMLA 1XZJA 3DL7A 4WFJA 1MPXA 2Z8ZA 1U2EA 1XQXA 5HKBA 4KR0A 4XVCA 4MEBA 2G5PA 5HCUA 1EK1A 5SYMA 1DT5A 3OTQA 1P0QA 4X3CA 3AIMA 3D2BA 1ZICA 1LBTA 4AX4A 3G0DA 4L72A 2FX5A 2OAGA 4UBJA 4CFSA 4H7KA 4KJXA 3WWOA 4HS9A 2ZVDA 3HC7A 2V97A 1FFEA 3M81A 4H7JA 5J3JA 4M0MA 4N8SA 2Y6VA 1MX5A 2CJPA 1YA8A 1F8UA 1YSCA 1DX6A 3C8DA 3I2HA 4BCCA 1BE0A 4EBBA 4PNZA 4P9NA 1J06A 2J4FA 3WL7A 4QA9A 3STUA 3PUIA 5D3ZA 1L7QA 5CRIA 2V96A 5K5EA 1WB5A 3DD5A 1SC9A 3FWHA 4OYLA 4B83A 2QT9A 4G8BA 4X6YA 3E3AA 1J1IA 1QFSA 4HRXA 4CCYA 1A88A 1XZCA 1QO9A 1RWQA 4A23A 1CFJA 1VKHA 3LP5A 2YXPX 3R3WA 5ALSA 1VE7A 1MAHA 1SFRA 3R41A 1BEEA 1PV1A 4MQMA 2PKYX 1EHYA 1HPLA 4CCYB 5AOBA 2CBGA 1IZ8A 5I8PA 4OPMA 4U2DA 4YK7A 2WHQA 3MVEA 2H7XA 1JJIA 3GFFA 2R8BA 1CUWA 4X94A 4BDSA 3KD2A 5HK9A 1ACLA 1G66A 5HF5A 5LZ2A 1CR6A 2XMSA 1TCAA 2HIHA 2WU3A 3ZI7A 1BN7A
chains in the Genus database with same CATH superfamily
2OHFA 1YB7A 5FFMA 4U9UA 1ODSA 4KPEC 4PG7A 4V1CA 421PA 1L1FA 3FFWA 4KQKA 3DLAA 4AS1A 4IX9A 4J76A 2ZIFA 3HU1A 4NYMQ 3QI7A 4WZ6A 1ISFA 3DF7A 2V55B 4RIGA 5DYNA 1PEKE 2GK6A 1NVVQ 4C9BA 3EXFA 1WO8A 2VF8A 3H8JA 4AIIA 2CYBA 1L5YA 1ODCA 5REQB 1ZL2A 2VNAA 3N7AA 1FB5A 4IJVA 1T24A 4J4BA 2O2EA 3TLXA 5IAAA 4L08A 5IF3A 2HX1A 3U31A 1DAOA 4XRGA 3K3PA 3TSAA 4CIAA 2GCOA 3HR7A 2XRFA 4EQ6A 3Q2KA 1XLVA 1EZZA 1Z7YA 3KETA 3KFVA 4DPLA 5A1TA 1DBVO 4C5CA 1LRKA 1SOAA 1UPTA 2YFKA 4UVDA 3CF4G 2D5AA 2WKSA 3HJAA 2FX3A 3L6RA 4GI5A 1XAGA 4G5GA 2P6PA 3OLZA 4G56A 1ZPDA 1U7XA 2B8EA 2BW0A 4UDOA 3FIUA 3LCMA 2XLCA 4GBMA 4Q3KA 3RYTC 2WV7A 4LDNA 3KZ1E 3N6VA 4N3CA 3RIEA 2FPGA 2BKXA 1DLIA 1N5RA 3KLNA 3RS3A 3KB1A 5LMCA 4NYIQ 3G9QA 2GZDA 3PNSA 3DULA 4IYJA 4MV0A 4TYWA 4G5OA 3E84A 2C4NA 4R7ZA 1EK0A 4D9BA 3ND5A 4E3WA 2XCOA 3DHYA 1TF5A 3FTDA 2V8OA 4JUAA 5DCYA 2AG0A 4L9RA 4L5BA 2Q5IA 2HO4A 2V54A 2EYUA 2ZJFA 4H7HA 4HATA 5T41A 4YYEA 5B55A 2OZKA 4AROA 1KP3A 5FR1A 2F3RA 4YCAA 3F6PA 5ESXA 3ENZA 2IP2A 4CF7A 1Q1GA 5AHKA 3G0IA 2PJUA 3HCWA 3HWRA 1HYQA 3DZFA 3G2KA 3S8EA 1YKGA 2BFDA 1S7CA 2VUHB 4R8KA 1BH6A 3E3OA 4EJ0A 1DKUA 1NF2A 2B5VA 3RWMB 5BOSB 1L1EA 4MW7A 4AJKA 2IV3A 4HDOB 3WWYA 5HKAA 2L69A 4XVQA 4E5SA 5T57A 3ETJA 2JS7A 3E1SA 4IXWA 5FA5A 1IXZA 1QCZA 4F6RA 1UAYA 5IAOA 4P86A 3RR2A 2DT8A 3GZNA 3EIWA 5COBA 1H2FA 2ZZMA 1M0WA 3ZWWA 4RD6A 4FYMA 1HE8B 3K9HA 4RKFA 2B78A 4AWXA 1T1EA 5KWIA 1NVBA 1UK9A 4MWGA 5DT9A 3LAWA 2H65A 1JS1X 1V6AA 1ZK3A 2UAGA 3TBFA 1QF9A 2JHGA 1E60A 1JIUA 4OQNA 3HEAA 3UWDA 4RV9A 5JSFA 3K8OE 1GZHB 1QVZA 2QTVB 3PX3A 3NTVA 1RXUA 5CM2Z 5FTWA 1GTMA 3RKSA 2IYXA 4PVDA 1Y8QB 3Q3JB 1NU8A 2XUDA 3IKMB 4PHCA 3H16A 5CYPA 1EZ1A 4M22A 3WRWA 5CM9C 3ZDRA 1JJFA 1CUFA 1K3FA 3EFEA 2DYKA 5F78A 4R0MA 3QY9A 1XRJA 3GWGA 3PQ2A 3WKEA 2PUVA 1V5FA 3C8ZA 3UA4A 4RCZA 3VGPA 4YAIA 2W2VA 4A36A 4B9AA 3IQXA 3CMMA 1DOZA 1HKHA 2I2CA 3QF4A 4Q93A 4DNXA 4ZDKA 1JLLA 3DKPA 1T4MA 3DDZX 1M1YE 5GGYA 5SY6A 1PTKA 1O5TA 1UBJS 5DCWA 4AB1A 4KMMA 2XHEA 2NUPB 3VKVA 4E4YA 1G8GA 3DDOA 4JQOA 4RNDB 5CVDA 1HTTA 1CUZA 1YQQA 2G63A 2IZ5A 1TJPB 4MVYA 5G4KB 4UAGA 3K1YA 4P1ZA 3FMPB 3M5WA 1Y33E 3B6MA 3BCHA 1L5WA 4HTFA 5KC8A 3B1JA 4YAGA 1OB2A 3L5OA 3FYUA 2VQFB 4IICA 3WB2A 2AKEA 1OHHD 1C0IA 2AR0A 2PFGA 3JVIA 2DLDA 4TKMA 4W9RA 4POAA 4G1BA 4GXTA 3G2NA 3ORRA 5KSYA 4PCVA 3DVRX 2YJGA 3ANTA 1IHOA 2JI6A 1CSEE 1QG4A 3EFOA 1UXHA 2MCFA 3EGDA 3WQHA 3RUFA 4Z0PA 1FFYA 2QZZA 1CZNA 2KWIA 4MYSA 3MGKA 5EAIA 4LKOA 3IOBA 1CK4A 2PGXA 1XCPA 3RF6A 4OLAA 1WXIA 2DWCA 4A6EA 4G1CA 2XUAA 3B82A 4R2LA 4OU4A 4BX9A 1UKBA 2R00A 4N01A 4D97A 6Q21A 3DZ8A 3KLMX 4ENPA 3W79A 2DHCA 2RJOA 3E58A 3DEHA 5PNTA 1NN3A 1F7VA 4RQBA 1Q2XA 4GOND 4YROA 3AVWA 1ACJA 2POQX 2I80A 4MCHA 3ZXYA 5C34B 1NOIA 3KU4A 4J9VA 5SY9A 1D9XA 5T64A 1KIAA 1H8ED 2MWMA 4KFUA 3SBOA 4CL2A 3GT0A 3LPDA 4IQ4A 4A2WA 2C5LA 1E2PA 3TWOA 3D3QA 1NVTA 4RK1A 4EW3A 4WT7A 1I4EB 4AQYB 2F3UA 2H1HA 4U9HS 3EWSA 1MA3A 4ASUD 1YBHA 1JFRA 1UJ4A 3HH8A 1KDTA 4IIDA 2VA9A 5A4DA 3ZQKA 3QG1A 5KHLB 4KUHA 4JP2A 3TKAA 3J80A 4XYBA 3ESYA 1O6GA 2ZAMA 3DXYA 4RQUA 4MYDA 4KLAA 5F7OA 4WADA 2OESA 3ZGXA 2GN0A 4EGCB 1CUBA 5HIIA 1TKRA 3P2JA 4PGAA 3ROFA 1K8RA 3OCVA 3UJ8A 1GAWA 3B3QA 4J6FA 5B58T 2P1DA 3QOXA 5FPPA 2P2DA 2QMZA 3VYWA 2MOKA 1TVKB 4AJ1A 4EZIA 3IT0A 2IPAB 2W43A 2W6IA 4NV1A 3G79A 3Q6MA 1U3DA 4IFTA 5CIQA 2C1ZA 3KP1A 3CN7A 3HVJA 4QG3A 2PSFA 3A7DA 1L9XA 4N3NA 3V4VB 3CKMA 1YFZA 2GBCA 3WLRA 4MCAA 3BQ9A 1TW2A 2R6GA 1GWNA 3LUAA 3PC8A 3E7FA 1WP4A 2PGNA 3P9YA 1YQXA 3OESA 3U5TA 5F7XA 4Y1GA 5GMOA 2WD7A 1SEPA 3QVLA 2IUUA 3VPHA 3F6RA 4IF6A 4RQTA 5HRAA 5TMDA 3BTSA 1JEJA 1Q7BA 3KT3A 4OKSA 1AKNA 1JQAA 4CMEC 2Q6VA 3ZCXA 2A9JA 3I3SR 1W0JA 2GPTA 1EWQA 2JLVA 3C87A 4OMDA 3DE1X 3GH1A 1UDRA 5FOXA 3GC6A 4WCDA 3UK1A 4TQUS 4IOMA 3AR6A 4O1MA 4TV8A 3NEPX 4L5YA 3HFRA 3QUBA 4IIJF 4UTNA 1A8UA 1F8FA 2PLNA 3LECA 2VXCA 4KO8A 1JECA 2DECA 3RU2A 5JD5A 4AY2A 1VMAA 3NTUA 3E81A 3OKFA 3KR2A 2OILA 1VPLA 4QDKA 5DNEA 4D5GA 4XR4A 1S8FA 4HMOA 2ZDQA 3FOZA 4O5AA 4GBJA 1N2BA 1E3IA 1OR8A 2AEJA 3E9YA 4OY3A 2QPLA 2HT6A 2VDLB 5IAJA 2WA1A 4EHJA 3L4SO 3W8NA 2CXXA 4LSGA 5AJUA 5C7LO 3GJ6A 1ZXLA 5DYIA 4HTAA 3VC3A 3X1ZA 2I3GA 5K3OA 1CEQA 2GK3A 3O9VA 1QH9A 3PGXA 3P9PA 3ZHTA 4YRNA 4AKEA 1MRZA 3QWIA 2OB1A 1WOMA 4RZIA 1Y7LA 4Z4EA 2YL2A 2GNAA 4D4MA 4L6IA 2I78A 3ZWPA 3SC6A 2FSFA 3W2TA 2VDRB 5HUJA 3QYPA 4A91A 2QRVB 3A2KA 4AKIA 4ISBA 2A1UA 3BTOA 2QTTA 1U7PA 2PWBA 5AHWA 2EZUA 2C1XA 2XF2A 1CYDA 2XTNA 3ASZA 1XLWA 4I9UA 4ZV7A 2NU6A 1ZOOA 3OLWA 5EP1A 1I4TD 3O5AA 3GFTA 4OEHA 1VJRA 4C30A 2C4UA 2NQ2C 4BX2A 4YREA 1ULUA 1Y7IA 3MPOA 3PNYA 5DLEA 4QWMA 4GAEA 4XLZA 1KKLA 3KZMA 4WE3A 4FJ1A 4LDZA 3HCEA 1J5XA 2DE0X 4XD7D 4F2HA 2BFPA 1PSDA 4B46A 1E4VA 3QU4A 2G4CA 5A05A 3SLGA 2EX4A 3INTA 5JD4A 1L8LA 2CXHA 1ZGGA 1MRSA 3OY7A 1VJ0A 3WGJA 4EL0A 1ZISA 4RCYA 4MJLA 3ZEIA 4G1FA 1G60A 3DW1X 3HKBB 3ZGOA 4CDGA 3WAKA 2P4QA 1T8SA 1RWMA 3I9V1 4CHTA 5C46F 4YUWA 4KGXA 4M8SA 1UT5A 5FB3A 2HSZA 1EU1A 3MWEA 4EO9A 3JQAB 2NUTB 4FQ7A 4AQ7A 1XFAA 1SQSA 1E2QA 1GU0A 2VTEA 2Q7DA 4P92A 1VLLA 3EZFA 5KNCH 2JHFA 2WPNA 4BP3A 2YX1A 4BU1A 1QTQA 5H7XA 3MMPA 1I5EA 1CLUA 1UXOA 2FFBA 3AOEA 3K7EA 4U3JB 1PJQA 4Y0NA 5A3VA 2NUAA 5IUJC 3AVOA 4YRLA 3ZE7A 5DMHA 3EIQA 3ZTTA 3A27A 3WX0A 1C1YA 3RS2A 3KKPA 3O82A 2HA5A 2FZ4A 1H4SA 1K63A 4MITA 4DV3B 3IGFA 5D8DA 3ZE0B 2Q9UA 2VA8A 3LVQE 5KYXA 2PZKA 1IY8A 4O4LA 5DASA 5BRJA 3TVTA 3DVAB 1U3TA 3HFJA 2WA2A 4AF6A 3WJ1A 4LI3X 5LD2C 5IVHA 1UKAA 1JWAB 4RSGA 4NZNA 1GPNA 4B35A 4CTNA 1UQUA 2QGZA 2WDZA 2GPAA 3DZKA 3FMGA 4J07A 2G1PA 1XQWA 1IOVA 1U8XX 2WNHA 4LV5B 2AR7A 2VYCA 3MNFA 3VNBA 1M2KA 3SAJA 4X8OA 5ETJA 5EZYB 3WFZA 3P2KA 4OQFA 5FOWA 5K0GA 5A2GA 2J0QA 1VKOA 4NF2A 3DL4A 1I4LD 3WNCA 2J6CA 1XK6A 3SQOA 3X1KA 2Y4NA 5MGBA 5EJEA 4RTNA 1Z35A 4LHZA 2NVOA 3GY0A 4PZUA 5BXQC 1F3OA 3WWPA 2G77B 2VTBB 4XCVA 4Y9SA 3BH7A 5EYPB 5IJ9A 1U4NA 3RRMA 3MTIA 1UJBA 1G4UR 4GU5A 3ZKAA 3RVLA 1QDEA 2VAXA 5FTLA 2D5CA 1QNFA 3O93A 3RU7A 2CLCX 3M0EA 2RGNA 4NCHA 1FXWF 4EUSA 1SKYE 1CRQA 1W5FA 2PCJA 1N4DA 1P9RA 3DQPA 1GITA 1M6VB 1QV6A 2J3MA 4FYVA 4NYJR 3U7QA 1HM5A 4DA0A 2ODWA 1OTXA 4C7BA 3RTAA 1V2HE 3GLQA 4ZEVA 2O5VA 4Q9AA 1VLMA 1Y6GA 1EX1A 4PR0A 1TB4A 4WZAE 3KWJA 4B7CA 5JNLA 1QTIA 3T4EA 1QBGA 2FSHA 2W93A 2C2KA 3A6PC 2G3YA 5K09A 5ERYA 4C2UA 1X7WA 2HF8A 3DCNA 3OM8A 4WNYA 1DO2A 1GLVA 3H97A 3LOPA 4MO2A 3P4XA 4YC7A 1N1DA 3CJQA 2L42A 3OIWA 3NBYC 2FRXA 1Y6QA 4Q9DA 4BN0A 3PDIB 4H1WA 2ZVPX 5KYUB 3DOCA 1LTHR 3PQ7A 1XDDA 3MYYA 3HQ4O 2R4QA 1UZMA 4G07A 3RGWS 4C04A 4MW2A 1L5ZA 3MINB 4KXFB 3TR0A 1SWWA 4G4JA 3DCYA 3IJPA 4JR0A 2ST1A 3AERB 4FSHA 5CW2A 5TEVA 1T3ZA 1XD8A 5EHXA 2AFIB 3AG6A 3EDOA 3PJDA 4M9RA 4Q4HB 3ROXA 5B6JA 3M7IA 2B4QA 2KJQA 3MCAA 3GAFA 4NBLA 4WASA 4KAFA 5E8JA 1P6QA 5TPZD 4Q3NA 121PA 3UK2A 5TR9A 3ZGLA 4QAJA 2AJCA 2JIZA 4OFZA 3ZS8A 4YR9A 2VH2A 2WU0A 3NYQA 2I54A 2IC5A 3TNDA 2PSJA 1B3RA 4ZI7A 5IJ0A 1M74A 3FG9A 4DLPA 1LLCA 3BZBA 3GFRA 3ECSA 4R98A 2PRJA 4F9GA 2ORVA 5AI9A 4ZQGA 4Z2YA 4TWZA 2QQ5A 1P2SA 2B2NA 2NO6A 2NG1A 2GAAA 2O8NA 2D1SA 1NTOA 3AR8A 3DOUA 3DZCA 3OAAA 2WV9A 2Y76A 4X7MA 2RBKA 4DCCA 2B1GA 4MWOA 3PF9A 4I8DA 4GSKA 2Q9CA 4QGHA 3LDUA 4WZAB 1MO5A 2PX0A 5JHHB 2YVAA 3JPWA 4CUKA 1Z2EA 4OBEA 5F23A 1OBCA 1A9XA 2VJMA 1WU7A 4EMBA 3WLAA 3TR5A 3KE9A 4GX0A 4MB6A 1SCQA 3A58B 3AIIA 4WY5A 3M3HA 5BN3A 1U9ZA 3AI7A 2O4UX 1KO5A 2P65A 3IAFA 4DDMA 3O4GA 1CJMA 4EB0A 1TJNA 1HRKA 3FHCB 3QF4B 4AKGA 4PBRA 2P11A 2MR6A 2FEPA 4URFA 3OOWA 5E38A 1XTBA 2BEVB 4JV5B 3UH0A 2CUNA 1H1DA 4PAWA 3TFQA 3X1MA 5AUOB 2AL7A 1DIBA 4WBNA 3BD7A 5DFAA 4OHCA 2BFFB 3FYUB 2P4UA 3T54A 1NSYA 3AUKA 4YIHA 4KQWA 4A8HA 2IDJA 3LWNA 4TXJA 4KHPB 3GXBA 3GR6A 1XD9A 4JYPA 3HU5A 1VSQA 4NAUA 4LGMA 3RRZA 2Z6QA 2Q2OA 1Z4KA 3TRIA 1VBKA 3RQSA 2X40A 3WMXA 1E7YA 5JPIA 1VHDA 3KNZA 3H2HA 4FW9A 1T9CA 5G1NA 5P8WA 1KYQA 3QG5A 4LZNA 1R64A 1QHYA 5I01A 1RAAA 1U3VA 1QQTA 1WW2A 2AOTB 1CR0A 5JVDF 2ZWIA 2M1ZA 3ENWA 3OAAD 4O2AB 1CUUA 1FTWA 3P0EA 1K6XA 1HH4A 1ZNWA 3EODA 4Y2XA 5ITVA 5AOAA 4Q3LA 5DTEA 1PNRA 3B5EA 2H63A 3S99A 1O57A 3IVMA 3K15A 4P98A 1YTUA 4PINA 3WRVA 4C2TA 3A4IA 3DPUA 4RTSA 1V7PC 4D3XA 4F7DA 4DJDC 1ZR4A 3R09A 1OBVA 1ZSYA 1TT7A 1VI5A 3L7BA 3KKLA 3ITNA 4PLPA 4Q4LA 4TGLA 3VYSB 4I4TA 3FR7A 1X8JA 1STOA 1HFWA 3NBUA 3VR2A 1HTBA 5AW4A 4O4JA 1IH8A 1O95C 1E2HA 1LWOA 4Z1OA 1WX1A 3T9FA 4ZPJA 1YS1X 4B7XA 3UW1A 4E3ZA 4ZEOA 2REXB 2G9QA 5CB6A 4W5TA 2A5FA 1U0BB 2YXDA 1A72A 5LC1A 3OURA 5KYWA 2R2AA 1TE2A 4N03A 5IABA 2P3OA 4Q12A 2PZGA 4JOBA 3QXCA 3NIBA 5AW2A 3S81A 2Y71A 3UXMA 2QP4A 3SY8A 2GETA 4RZHA 5HQJA 4UXJA 3BFPA 4WXYB 1CRZA 1X1TA 2C5SA 4YHBA 3UANA 4FPXA 4FMCB 4JXJA 1WOYA 5I4BA 1X74A 2GZRA 2I0FA 2YN4A 4HAOA 5LZ7A 2HZBA 1O5IA 4DV6B 1VLQA 2XCQA 1E79D 2AV6A 3G5LA 5I9IA 1XAJA 3F6EX 3AKZA 1VI2A 5LOVB 5JUWA 2QLFA 3M9WA 3BXXA 3PWKA 2YZNA 3OE1A 3TNFA 3IVRA 2BFCB 3EOZA 3ESRA 4A7PA 1AV6A 3CQ9A 3PD7A 4QPJC 1QC5B 3WL3A 4UBMA 4ZCLA 3VSDA 4WLOA 4N7RA 1N5IA 1Y4AE 2BHLA 3KQTA 3M4XA 3R6DA 4MVJH 3WB9A 3ZCVA 5B5SA 5HVNA 2ZJ2A 1EIWA 2JFBA 3R7AA 1CJCA 2AWNA 2FN7A 4DMGA 1DUSA 3QVOA 2Y1KA 1TC2A 3MOGA 1BRTA 3MS7A 5I7RA 2LCFA 4MRMB 4OA5A 2ZJ6A 3EG9A 3IV6A 1H1LB 3GJ5A 2CFCA 4K0RA 3BIXA 5SV2A 3D6HA 5CIWA 4B79A 1L0BA 2WSLA 2C9CA 3CU5A 4U1RA 2PVPA 3KZVA 3OE7D 5FOTA 1AMUA 5EMLA 3KPWA 2XQFA 3ETGA 3WGQA 5T4HA 1XTSA 1E2DA 2OO5C 2VHUA 1E2GA 2CLMB 4HUQB 2WWYA 1EM8B 4AZ0A 4ZRDA 3SG0A 1FSZA 1LK5A 1I33A 1Q74A 3GNSA 3TOXA 3LUGA 2IZZA 3ZH9B 2O9JA 1KU0A 1ZINA 2P1ZA 1SHTX 1VYVA 4E5UA 1KRWA 3C3MA 3ICPA 3AY6A 2YWJA 1VLJA 2J0UA 2O7NA 3TBHA 4EF4A 3ZI0A 4CEIB 3KPJA 1JU4A 1MEOA 1FIUA 3VSCA 3QOFA 3IA7A 3OX1A 4TQAA 4Y18A 3UENA 1IPFA 2Q2NA 2P41A 1JQBA 3IURA 4JLMA 4MROA 3WMEA 2OCGA 2HFKA 2ODAA 5LQCA 1URPA 4HDCA 1IOZA 3KJZA 3UMVA 2VJDA 1P1IA 4L6AA 3IIMA 3T1HB 1XF9A 4FBLA 2H1RA 2QLJA 3VTAA 1UINA 3F8SA 3I0NA 4I50B 2V7WA 3R4VA 5JQWA 4IG9A 1FNMA 2H5JA 1F6DA 4DTCA 4PLTA 3Q6NA 1N5JA 3PDHA 4RAQA 3A28A 3TAHA 5I7AA 3EMKA 1BVHA 1ZGBA 4QLAA 3IBCA 4E5MA 3GRRA 4BX3A 5TSDA 2JGIA 4DCMA 1EVJA 3OLQA 4DSTA 1HXHA 2E85A 3WO0A 1Z8DA 5A4KA 4L9WA 1R5OA 2J7PD 3OZBA 1QFZA 1JDPA 3UCEA 3Q7SA 5HSGA 5FNVF 1TM4E 2B8TA 3I8XA 2DU8A 3IHKA 2IOFK 5CM8B 1DWPA 2BR3A 5F2KA 3PIIA 4KX5A 3G6KA 3BFJA 1UBCA 1P1HA 4MWCA 1DAGA 4TSKA 5AJYA 3ZD8A 1JBQA 2PT5A 5KVSA 2MSCB 1DI0A 2ODTX 4HH4A 2V0GA 3AU8A 2P91A 2X0IA 1V8ZA 1NBMA 1WXHA 3IEPA 1G18A 3HZZA 1V7QA 1KI2A 2I2AA 5ESRA 1QVWA 2JEOA 1I32A 3JQFC 1PK7A 4K6GA 4WEQA 5LJIA 2CJXA 1PS8A 3KQSA 2QRNA 3KJEA 3LBNA 3UB3A 4G85A 3N0XA 3Q5EA 3FCXA 4KE7A 3TTXA 3CMCO 3NGXA 4HF7A 5HM6A 3OEHD 3EVZA 3LCRA 4RGBA 2IIBA 1EK5A 1JFFA 2YBEA 4JI3B 2VWHA 5FADA 3TW8B 3UTDA 1KWKA 1L5SA 5DYWA 4C4PA 1NNEA 1J9EA 4AMZA 3EPHA 4DQVA 2YHIA 4JMLA 2A0UA 1JEAA 3WYDA 3ZJYA 2J0EA 2IV2X 1DAIA 1F38A 2WJHA 4TT3D 4YAKA 1YD7A 4JBYA 3UT5B 3STXA 4C1BA 1NVGA 1OX4A 4ZT6A 2BM0A 4EG7A 1XZFA 2VP6A 4E0BA 4PGFA 1EFTA 3E82A 5C4MA 4ZC8A 1SQGA 4R1OA 4PTYA 1VJTA 2KE5A 2D5LA 2JJ1D 3LY7A 3FJOA 1EEXB 2R1TA 4J0IA 3S40A 2YXBA 3IAUA 3G82C 3KJHA 2QAGB 2ZBGA 4NU5A 3TG8A 4BFYA 2QNBA 3SVTA 4D99A 4NMHA 3G5TA 4XJTA 3P20A 1HOXA 1C7FA 1JTFA 4CM9D 2GTHA 4A6DA 1PHPA 3E2PA 3ILXA 3ZC3A 4ZZ0A 2AI2A 4PYNA 1JMVA 5L3RA 1U9IC 4WGFA 4RMJA 1W73A 1EG2A 1DSSG 1ZCJA 3RANA 2G6BA 4M9SA 4FFWA 1G5RA 1TO6A 1I6LA 1TMOA 4DHEA 4XWKA 1KY2A 3QVGB 1TD9A 1SN7A 3HSSA 3O73A 3TAXA 1VGRA 2CV2A 2BZGA 1M8KA 5I9TA 5C8XA 2PMCA 3QFHA 4ZKEA 4AZVA 4HR7A 3AESA 4QXAA 3DBHB 3FBGA 7REQA 4D4LA 3W04A 3Q9SA 4IXTA 4QYTA 3DO6A 4ZA2A 2GB4A 1PD1A 1G6HA 5EWMB 4HT3B 1HT3A 3D7SA 4FKMA 1JMKC 3GZTB 2JIQA 1ZLYA 2HCFA 1UBOS 4B2YA 2VF2A 5FI3A 1GXSA 4AJHA 1CUSA 3ANXA 2HUNA 1CF9A 2O14A 4BZWA 1Q1AA 2I7XA 1DDOA 5BQ5A 1V6CA 2P1RA 2V7EA 3LUDA 1UC5B 4MQUA 5EIWA 3C7AA 1A1VA 1H2WA 4H27A 5JZVA 2YIVX 4LYGA 2RC5A 1EBBA 2QL9A 1SVKA 5AKJA 3W8FA 4H7EA 3MJRA 2FQYA 1LS1A 3T7TA 1GRRA 3RTBA 4ALLA 4XAQA 4BQEA 4FYHA 4MSUA 4F38A 2P9BA 3RIYA 5BWBA 3ZY6A 3EBLA 1ZH0A 4ARUA 4D56A 2VPQA 3VR2D 3DZDA 4V03A 3EF3A 4Z7QB 4J7XA 1RLUA 3EQ9A 4HLUA 4LTNA 4MUAA 3LY9A 4TRJA 3VNQA 3ZHVA 4K9KA 3VZPA 5CCEA 4BVKA 1GFIA 2EW2A 1OW3B 5B4TA 5GAJA 4MVJA 1RLIA 3TIVA 1WQ1R 4BQNA 1WB9A 3HMKA 4XOUA 2C94A 1X8LA 1C0EA 3L8GA 2CWWA 2JD0A 1PWZA 1E69A 4KHZA 4NG4A 3OZCA 1MKYA 1I2MA 4W1QA 1EFPB 3R9XA 3SJBA 4FB4A 2Y2VA 5ED0A 1UZNA 3PA8A 3WQRA 2R8RA 3C3XA 3FJ1A 1KEVA 3QLJA 4QU8A 5E1OA 5LA6B 4EA7A 3WLMA 3CN9A 4GECA 1UEIA 3BYZA 4OYLA 3DJFA 3PFCA 1XRNA 5EUBA 5FUYA 1EE1A 3HKEB 3LUFA 5JDCA 4Y6LA 3FM9A 4O33A 5E1BA 2WHEA 3IXLA 2B4AA 1GGVA 1Z0AA 2HU7A 2AVNA 4L4RA 1JAXA 1WY7A 2OZPA 1W49A 5LB2A 2O8CB 4CI9A 3CE9A 3KOMA 1SHKA 1ZEMA 4BN4A 3HJFA 2QTRA 5K6AA 4AK9A 3HADA 5AH0A 1PJLA 1I9CA 1NLUA 3E3LA 1VHJA 1QWOA 3AO0B 5U4XA 4KZKA 3THYB 5DV9A 5AW5A 3J81A 4ZAVA 1CHDA 3ZDYB 1V11A 5ITWA 1GSIA 2YIDA 3T99A 1QLWA 2AC2A 3HS3A 1S7GA 4FFBA 3HCBA 4IG4A 1NJSA 3QMPA 2J3JA 3C39A 3U9SA 5I47A 2XRZA 1R4ZA 2PZ8A 5B2EA 1Y9EA 1WXDA 1DEXA 1SK8A 2ZR0A 1ZIXA 4YO8A 2G28A 1XL1A 3CR3C 1CUCA 2NXEA 1AUPA 3O92A 2EF0A 3C15C 3HCOA 2WTNA 3MJEA 3O26A 2AGVA 2GLXA 2C3YA 2QRHA 2QN2A 2B9EA 4KDCA 4S0ZA 4TQ9A 4ZRNA 4N76A 2GJ4A 3FZQA 1T3HA 2WJJA 3TD9A 1R6TA 4LRSB 1U8FO 3DS8A 5K6TA 2WLSA 2ZRLA 4DUGD 3NP9A 5C8YB 4AX8A 1WUYA 1Y1SA 3VJLA 1FLVA 3GYGA 1ZGAA 3CNLA 4YBRA 1XTTA 4ID3A 2H2IA 3HP4A 4J4HA 2NUBA 1YDWA 2DR0A 4K2HA 3TSWA 4BGIA 1CYEA 3LPCA 4BQRA 1RIFA 1QONA 4BZQA 4JVOA 2YHSA 5F3RA 1KZ1A 1VHWA 2Z09A 2I5PO 1P45A 3IVAA 1H0HA 2Y6UA 2HMAA 3HZOA 1J33A 1SIWA 3IAEA 2PSDA 3L1HA 2QY9A 2FOXA 3JQFA 1S0UA 1Z4NA 4GR4A 4AS3A 4NS4A 3O3MB 3I04A 4CLRA 4TTRA 4AZ3A 3LC1O 4NYJQ 1DEOA 1UIMA 3QUSA 3SZGA 3TXAA 4DCTA 5KTKA 2WKQA 4TSRA 4LE1A 4UNRA 1XAIA 2XZLA 3A3NA 3TDMA 4E2WA 1JZQA 1YZQA 2DFLA 1RQGA 1MV5A 1LF5A 1VRCA 2P9CA 4QX6A 4QPZA 4YLYA 1JKJB 3CNBA 1H2RS 2ZJBA 1AF4A 1D0IA 1FTYA 2JGDB 2OD7A 4V0OA 2WVJA 4CKZA 1Z37A 4C0KA 1UL1X 1IAVA 4G6ZA 5CH8A 2EWMA 4FMDB 2BR5A 3TLAA 1APBA 3FPAA 1XO1A 3DE5X 4HNSA 1ESDA 4EX7A 2J6IA 1WBDA 1N57A 4C0XA 4XWAA 4RHFA 4JITA 5EIFA 5L6LB 2X7XA 2F3PA 1E92A 3ORSA 5BYBA 3W9SA 5B64A 1AQNA 2IHNA 3PIDA 1RQPA 2ZRPA 2E89A 5C53B 1O77A 1BMQA 1UWKA 2FFQA 3KHTA 1E7SA 1CY4A 2Q07A 4HAYA 4KRGA 1NBIA 3DWIA 3F8WA 4GEKA 1JE1A 1XLTC 1MW9X 2ZG6A 4HN2A 4B4UA 4A15A 4HS4A 3F7OA 4GFDA 3RC9A 4ZEWA 1JFSA 5H16A 5SZIA 1ZOPA 3RAJA 1J56A 1UMBB 2BEJA 1QVAA 2HA7A 2YWEA 1XQ6A 2GZMA 1NZFA 3D8RA 4ZAWA 2VZEA 3ZU6A 3UPTA 1RRKA 2YXLA 1NA5A 4HQOA 4XKJA 1U4OA 4TMTA 1SBTA 3O4IA 4OL9A 4C4RA 4E30A 2WVHA 5AKYA 1TA9A 1ZNXA 3QENA 3VH1A 2XD9A 3JYHA 3K5HA 5KMGB 1WRBA 2YJ3A 3CRQA 2DUUA 2FSIA 2AMFA 3PFWO 4YNBA 3U62A 4EF5A 1IB0A 1AV7A 3BFKA 3DTVB 1PJRA 3U17A 4BKQA 2A92A 3HCDA 5BPHA 5JMOA 5AK6A 2FRVA 4D80A 4ZI2A 4CF4A 5D2CA 3EMVA 3OTWA 5K20A 1VJ1A 3BWCA 5IAGA 1J24A 2C7QA 1HX7A 1JGTA 1RAGA 1Q22A 3KHKA 2AD1A 5B4UA 3EUAA 4RHXA 3GBPA 4U2KA 3C5WP 2GM3A 2HJSA 2OBNA 4C2BA 1P1RA 2B8NA 4P2BA 4JJZA 4US0R 2PLWA 1U8TA 3OT1A 4WNCA 3PICA 2UUBB 5CFQA 3I61A 4HUQA 5C32A 1EJ2A 4V38A 4NZZA 5HUHA 4DIKA 3BWVA 2QR5A 4MJ3A 1R6BX 4KL8S 4DC0A 1MABB 1JQDA 4RD1A 4WUVA 5B1DA 4EHAA 1QBKC 1W4LA 1W93A 4INPA 3A6ZA 3B9QA 1HK7A 5ED4A 3B12A 2PAFA 2V6IA 4MO9A 1J5PA 1AGXA 4LTMA 1QYXA 4WNIA 4UMDA 1R66A 4BO8A 1NJ2A 3ZWQA 1SC6A 1F7UA 4UU1A 2IU3A 2BDTA 4RVFA 2BJVA 2G4LA 1SD5A 2UYQA 4WCFB 1SCUB 3IPLA 3LXUX 1PT9A 1P74A 4NXMB 3UYKA 1Y8AA 1FRFS 3I3OA 3VOTA 3ECAA 3ER8A 2CXOA 4J43A 3EE6A 3PA6A 1U0LA 5FKJA 3R5HA 5FFFA 3WGNA 4U7DA 1RJEA 3BE4A 2Q1WA 4FHDA 1OFUX 2PMWB 3QU5A 2HJHA 4UXIA 1YJCA 4ARZB 1K98A 1GPDG 2C7BA 3GDGA 3NDPA 5J4LA 1KOGA 4DR6B 1GCUA 4QDXA 1S3FA 5J1TB 1JWBB 1P39A 5CVUA 3ST7A 4TUYA 2BFWA 3W5BA 3EEIA 1J0XO 1WULS 1NMXA 2RAVA 3N0WA 4C22A 1A9RA 4I3FA 1I4WA 5I7WA 5DEOA 4CG3A 2D0PB 3T9AA 3GPCA 5LQUA 2WWIA 4XX0A 3S2ZA 1HOTA 1KJ9A 1U2RA 3IIKA 3U1TA 2OWEA 4BB5A 4LGYA 4EEXA 1ZP6A 3J81k 4KQIA 3TE7A 4QTYA 5FLKA 3CZAA 2TRSB 3GVPA 4Y1RA 1ZDMA 5J2UB 2YASA 4LBWA 3FI9A 1O94D 1J25A 1BHO1 1JJVA 1DJQA 2JAOA 3DEAA 4PWZA 5JYDA 2Z08A 1TZ2A 2K4MA 2R65A 1C81A 1R3UA 4FDUA 4I2NA 2PNJA 5E6SA 5ERXA 3HDVA 3JVVA 4K87A 4EI8A 1VA4A 2VWQA 1RYEA 3O8NA 1FVXA 4OBBA 1RWOA 1B76A 1FUYB 1UAGA 3QKSA 4QYMA 1DQRA 3OG9A 1KJIA 2XBUA 4NNOA 1NULA 1KR5A 2WHPB 5DCUA 1P1JA 3JQEA 3TPFA 3TUZC 5IARA 5AXBA 1Z5PA 3NJRA 4URUR 4RTPA 1OQAA 2DEUA 4GPIB 1FDTA 1X7XB 2X2FA 2J5QA 3DAOA 4HEA1 3NETA 4GX5A 3WLQA 1SVWA 4KAJA 3E48A 2WMYA 4PYOA 1JA0A 4XQ0A 2QD4A 5EKUA 4ZCTA 3FUTA 3IDZA 2ZETA 5KOHA 1AXEA 2JLXA 5JDIA 3DEIA 1RMYA 4MPJA 4HFRA 3JQ7B 2SKDA 3SHVA 3QX9A 3L93A 4F06A 4XB6B 4DV5B 3I53A 4QUEA 4L1KA 2HK7A 2NXCA 2GAIA 2I3DA 3A37A 3PX2A 1DQNA 5A02A 5K1ZA 3D43A 3H04A 3QW4B 1O58A 5CDHA 3I76A 2ODEA 2XNDD 3W1WA 1JV2B 2QD2A 3LVRE 3PGVA 4ROTA 4L27A 4EHBA 5K8CA 3GJZA 1G98A 3K9BA 5SZHB 1QANA 1GL3A 4YMLA 1IEXA 1PJCA 3QLEA 2C7VA 5JAIA 4F5ZA 2HEGA 1SCIA 2F8LA 4UBOA 4K03A 3O2QB 4GOXA 1IAQA 5I4IA 1VHTA 1EUCA 2ZEJA 3RARA 1U3CA 3W4IA 5CITA 5KOYA 1C30A 1T9GR 4NL4H 2OK8A 2GO1A 1UEXC 3FD8A 4K6KA 2WFLB 4DCGA 1SK9A 4I1VA 3RD5A 1EIZA 2OHOA 3MLAA 4KNVA 1H85A 4QATA 1W5TA 1PV2A 1O1YA 2VS1A 4KLZA 4WKGA 5BSFA 2ZRIA 4M2LA 3C1TA 3MMZA 4MWEA 5FXMA 4A0SA 4EHHA 2HW8A 2JFQA 4DWJA 4M1QA 1L3BA 4D3YA 2FK7A 1P6XA 1ZOSA 3I62A 2WNSA 3CLSD 3AY0A 1GGEA 2WRZA 5IM5A 3RKRA 4CU5A 2UYHA 2C4HA 4P32A 1AHNA 1I0ZA 2HR1A 5CW1A 5KWVA 5D84A 5HP4A 3TL6A 2ZIAA 5DNCA 5CNIA 4AY3A 2ZRGA 2JLYA 5EPEA 4G4IA 4L50A 4G0MA 3NHSA 4W7IA 5JSUA 5C1BA 1ZSVA 1CE8A 4JZKA 5TY0A 1KQFA 3OZ7A 2C0QA 1D2HA 1T2DA 2VEDA 4XI9A 5JWRA 5D85A 3CG4A 3GF4A 1KO4A 4Y6RA 3WS7A 3QBEA 4CG2A 1QKKA 4KE9A 4C3VA 1DAMA 4II3A 4MP6A 4DILA 2UXCB 2Q0XA 2VHWA 2BR4A 2W4MA 2ODNA 2JJ2A 2R97A 4PIPA 2CHVA 5DGDA 5DO9A 1PZNA 1Y89A 4ABYA 1VXRA 4GH5A 5CX1A 3ROQA 2XYVA 1Y8CA 3CH7A 1J1ZA 1G21E 2GO7A 3I58A 4JX8A 4OKNA 3G17A 3NHPA 4DZZA 4HFMA 3H5RA 1YC2A 4Q1VA 4KI7A 3T0FA 2BL4A 2JLWA 4RVCA 3QPUA 1V5WA 3PPXA 4E32A 5DK6A 2YICA 2CCGA 2B2XA 3BHMA 4X62B 4JBIA 1E61A 2NGRA 5G02A 5ADVA 1TYDE 2QLMA 5KZMB 1IZYA 1JW9B 3FXAA 3HKDA 2GPWA 3DMHA 4S1TA 1DFGA 2WE7A 3VNVA 3JZIA 2Q4EA 1GZ6A 1AVTA 1BXGA 4OAOA 1E1CA 2WF6A 5AKIA 5EZQA 1IUOA 2ECOA 1EJ0A 2VSXA 3IQWA 3MWDA 2R7MA 3NAGA 4EUKA 4C87A 2FVXA 3LUPA 2UZ3A 3OUZA 3KQLA 4NENA 4D25A 4EJSA 3FOFC 2FDXA 1OWNA 3NNSA 1E3WA 1E2UA 2QOEA 2HF9A 2P9JA 3AXSA 1I3NA 4JBXA 2HWYA 5A9SA 2C2MA 1F2DA 3FWZA 3LUBA 5IFKA 4JKOA 3D7LA 3HUTA 2A94A 3HY6A 3QEKA 1DJPA 1ESMA 2E49A 1JBEA 2IHBA 3S7TA 5JLJA 1OIVA 2ZW9A 1VPTA 1Z39A 1PL6A 2QUIA 3ICOA 4LE0A 4Q7MB 1EK2A 4FFPA 1NWCA 5AVOA 1CVLA 1TIKA 1GZ5A 3SDZA 3QIAA 8LDHA 5EOVA 4QGAA 4CQNA 1G291 1RWWA 1EDZA 1KOLA 8GPBA 2VK4A 2O23A 1PSZA 1RHMA 3A1DA 4W9MC 2P0EA 4LOAA 1E5QA 2CZGA 2FEOA 2ZSAA 3WMRA 2BKLA 5FD8A 5L7WA 1TPYA 1TYZA 2HB6A 2YYSA 3WB0A 4A8JA 3R3JA 5JCOC 1W36D 2PVCA 4J2HA 2I29A 4BLTA 1RWXA 1Q7TA 1WD7A 3AOEC 1R6UA 3OLVA 4AP5A 4ZOAA 5CAEB 4OYRA 2NU8B 3B2QA 3V8VA 1YDEA 4C78A 3KOXA 1AHIA 1KC1A 2VJLA 1S01A 3L8EA 3NHMA 2BMEA 3GA5A 2A5GA 3P9XA 3QVVA 4BXOB 1ZJZA 4JYBA 3AKYA 5JBNA 4EB6A 2ZXFA 3BMQA 1JLLB 1AZSC 2XKAA 3A0UA 3MLEA 4N3BA 3I01M 4MUMA 4FBMA 4N0EA 1L7AA 5MF6A 4R84A 5EKTA 4TXMA 3UK6A 1EWKA 2JASA 3QLVC 3B6IA 3ZLUA 1DZIA 4FHGA 1ZKDA 1I8TA 4OHBA 1ZM3A 5JI2E 1RCTE 1V3QE 3NWJA 1L4NA 1Q0SA 2JHAA 2WPDA 3BJEA 1ZL0A 4QBGB 4XDZA 3W2IA 3SSNA 5L8VA 1WNFA 5JISA 5ARDA 2M1XA 1N92A 2ACVA 1J2UA 3O7WA 1R9GA 3EJWA 2XVAA 4FK8A 5CCXA 2G1JA 4LYEA 5FNVB 1V4VA 3GLIB 2O2GA 3IMKA 2JEYA 3S70A 1NJ6A 1OTHA 1H2HA 1LKZA 3IAS1 3TLJA 4HVCA 4EMUA 1RQ2A 1F9EA 4M1KA 1YJAA 4B82A 2AFRA 1NUSA 1SWVA 3E9EA 4NESA 1ORWA 3A2LA 1JKMA 1OF1A 3DVQX 2W22A 5SICE 1NXSA 2QT0A 3IR6A 4Q9HA 4YJHA 5EIHA 2XDWA 4C88A 5CB4B 4QGFA 4MDYA 4MR7B 2NZUG 2WIJA 3WLOA 1NXOA 5BQFA 2KSQA 2FPIA 3ML1A 2C61A 4I6JA 4IIFA 2I33A 3HFSA 3KSMA 3HYNA 2BC9A 1GUAA 1LB1B 2JLBA 3RODA 4L9SA 1DOAA 1Z5NA 2A35A 2NSJA 1PZGA 2VDVE 4MI6A 4ZQHA 2JHPA 3DVAA 4KYTA 4BZPA 4U2BA 3PT9A 2PEZA 4WOBA 3TLCA 4BMNA 4ZV4A 5HGJA 1EB9A 4GMGA 3FZYA 2R00C 3L8YA 4IIYA 4LVNA 5B3JA 3FRIA 5EP2A 4MVWA 2EWWA 2FW1A 4K6MA 3Q1LA 2XUQA 2XZOA 2P0YA 3S2EA 3ZG6A 5EZYA 4Q4JA 3ZWOA 3KHUA 1GADO 1NFFA 1VPDA 4MWSA 2LRHA 5LDDC 2ZB4A 2V4UA 4BNZA 1GYPA 3LCVB 4RW0A 5BMVB 7YASA 5ECGC 2ZBEA 2BZSA 1PT8A 1H4TA 1UP7A 5IWAB 3LT2A 2HSJA 4NBSA 2EARA 1Q92A 2FU5C 4O1IA 1T6NA 4Z4CA 1A50B 3LPLA 2B6HA 1MABA 2GVNA 3CZMA 5TJHA 1XKQA 3OZWA 4WLEA 2XB4A 3AKEA 1SKAA 2R6DA 4MI3A 2QU7A 2B7CA 4IOLA 4QEKA 1UPUA 2Q50A 3MT8A 2B69A 1F6BA 2CVPA 3HE3A 4IDPA 4G9BA 4JOQA 4IQGA 5DI9A 1DFHA 2Z2KA 3R3VA 5IG2A 2J5BA 3IQZA 1CP3A 1GUDA 4KGDA 4ZVOA 1OHHA 1DJLA 3ZDBA 2IS4A 1PT7A 3IAM6 1JYEA 3HUEA 2ECQA 3V8NA 3NHLA 4QSHA 2GHTA 3AHDA 3RM3A 4L5IA 3H2SA 4CT0A 4X97A 5T3YA 1X7ZA 3AP2A 3O4VA 3EMBA 2CEKA 3ZLJA 2R86A 3MUEA 3T5DA 1J7JA 1CS0B 4OU5A 3FPEA 3IBFA 3K2BA 1DKQA 1VSBA 2J9FA 4OHYA 1DGQA 1VGQA 1Y4UA 1C5KA 4WNAB 3PXBA 2C96A 4JT2A 1RWVA 2Q99A 4ZU6X 2QVLA 1FP6A 3FPHA 3G13A 2ECFA 2AYYA 3PHBE 2W6NA 3VR3D 3KBOA 5THQA 4EG5A 1PIWA 2IYWA 3CH4B 2BT4A 3H8SA 4Q00A 4V39A 3VPFA 5J4YA 5J4HA 2VYFA 1SA0B 3EZGA 1G8FA 4F2PA 1DG9A 3MD9A 4JODA 2UVPB 1QXSA 4MR8B 1NG9A 1CZUA 1XXHE 3PQ8A 2D1FA 2ZROA 1LS6A 1T4CA 4FGWA 3U80A 3H7AA 4LW8A 4YALA 3T7KA 4EMTA 4OMFG 1G0OA 2IYEA 2NU7A 2R8ZA 2OB2A 2PL1A 4HWTA 2PUBA 1B0AA 1F4LA 4N5LA 3QBTA 4ENQA 4C3ZA 4CKWB 5I7VA 4D8VA 3ORHA 5J2UA 1KMQA 5JEEA 1C3JA 3Q87B 3ITDA 3W8DA 5AW1A 4QODA 2IYQA 3UF0A 4X8MA 2Q45A 4FFNA 1IVSA 4KTVE 3LPAA 5JNUA 1KZ9A 4V0KA 3CEAA 2B35A 2Q6LA 1TTTA 1FSFA 4TS1A 3SR4A 1ARZA 4KKXB 5D7BA 5DTJA 1VP9A 3ASYA 2X2PA 4IKEA 521PA 3NANA 4F85A 4X6UA 1PNTA 1U1DA 2YR0A 4MV4A 5JZSA 4G67A 2DMRA 4JENA 1U0HC 2HNKA 1GUZA 1YASA 1TUGA 4KQJA 4Q3OA 5KTMA 2NTVA 2BF7A 2BF4A 3ONFA 5GP1A 2PGLA 5E0OA 4EVIA 4IIVA 5HKOA 1L7RA 4KXVA 2O8FA 3MPUA 4LIPD 1Q7RA 5F7JA 4ZIRA 5HS4A 1H69A 1LI4A 3HV2A 4PY2A 1HI9A 5CJPA 4QUDA 1Y8ZA 1K68A 1G4HA 2B4RO 3PP8A 3LRXA 3MJTA 3L8FA 4RTQA 1LV8A 3KEMA 5ALZA 1QYWA 1WUTA 3I32A 2HMSA 1OT3A 3K0AB 5T6MA 1GTRA 4MKFA 4MZXA 1AGPA 4DBLE 1OBHA 3ECCA 2JFNA 1ZVMA 1H3FA 1US8B 2JGKA 1YI0A 3W6UA 1L8XA 3R24A 4V0MA 2RHTA 4NZ9A 1JEOA 1WUKS 1Z4JA 2VCHA 2JGLA 2WM2A 3FPFA 3DW3X 2OAP1 1FX1A 2WIDA 3NHBA 4OATA 4TS9A 4HEJA 4BKPA 2YOFA 3UAWA 2GYVA 2NSDA 4HAIA 4YRSA 3G6WA 2BKUA 4GP6A 3TOZA 2ILVA 1KRHA 1IXKA 4EW6A 4YMGA 4ZT4A 1JR3A 1ZX1A 1DUIA 2QK4A 3MWGA 1ISHA 3R7LA 3R9XB 3QUAA 4P4SB 2X7HA 1N6PA 3LOQA 3NRJA 4OJKA 3ZW7A 3S7ZA 1YGYA 1XNHA 3K0BA 1EWVA 2QSZA 5GADl 1IRIA 5DHRA 3LX6A 4J94A 1T3TA 4F1JA 3ROTA 2BM8A 5M2QA 1E8NA 1Q7GA 1Z6GA 2PX5A 3L0DA 3CUYA 1RI4A 1RHUA 2PZEA 3OT5A 1CG6A 1TD1A 4GP7A 1CS4C 1EJ6A 4NJEA 5FL3A 3V8RA 4BUJA 4PGGA 5T8KC 2A7QA 3SC2A 2FJUA 5J5VA 3NDRA 2FHPA 1KL7A 1IHXA 1E2LA 4TM8A 1XU4A 2YZ7A 1ZSNA 3ONDA 1MVLA 4W82A 1Y4DE 1E64A 5KUTA 3KYDA 2CVQA 4Q66C 4TX1A 4Y6OA 4LKRA 1QLJA 3UFXB 3FCYA 4AO6A 5ALXA 4E5VA 1Z4MA 4CM8A 1CVRA 3TVDA 4YV2A 2Q62A 1PGPA 4H6VA 3WK6A 3V9AA 3G23A 2IEAA 2XCLA 3MMNA 2OCYC 4KZPA 3GK3A 3F97A 3KV3O 4RM3A 4G0VA 5LYJB 3CUVA 4K2AA 5L3QA 3I05A 4BKMA 4EJSC 2DCMA 1GUBA 3EEQA 2H6EA 5K2MA 1EFCA 3K9NA 1CDZA 1MNAA 3DO5A 1RVDA 3PD0A 4OAPA 3ZS9A 5A9RA 5KTTA 3HO1A 3ZGZA 4A5OA 1ZJ6A 3QXJA 4UPDA 1C41A 2GARA 4RMHA 1AQ6A 3T7SA 3THSA 1E6UA 1QR6A 2NO7A 4S04A 2FQQA 1Q1EA 4KH0A 5AHXA 3TLYA 1KZYC 1ESCA 4YX9A 2JK0A 5HKKD 1H2ZA 4P3YA 4KO2S 5DHFA 1Y9DA 4F46A 3L1IA 1YVRA 1JT9A 1GY8A 4FP9A 1EVIA 1Y3FE 3LJKA 4GG1A 1C3OA 3T3DA 1D4ZA 2AC4A 1G3MA 3R8FA 1D03A 2FZCA 2JC3A 4L6CA 5EJ5A 1KFJB 2PJZA 4KWHA 1ZNQO 4HH3C 5K0EA 3QJYA 3RASA 3C1AA 4PLVA 3DHWC 5HRUA 4QFDA 3O8RA 4O4HB 5JNWA 2CFRA 4X1YA 3VU3A 1L4GA 3HRIA 1MT3A 2QN7A 5FEUA 3B6JA 4BRSA 3ND6A 5E3HA 2BCJQ 3H5WA 4I0WB 1W5BA 1E9VA 3GJ3A 3NI2A 4PZEA 3FAZA 3CSUA 4Q1DA 5G2OA 1XZDA 4KC0A 3RTCA 2X8AA 4FHFA 3PUZA 3GFPA 2I2FA 2JGNA 2QXTA 4ZTZB 3F96A 2DT5A 2HOQA 2V7TA 4RJ2A 4XIGS 1RZRA 2BDUA 4QBHA 5LDGA 1P18A 2RHJA 2XJ9A 1IMJA 5LB4A 4YPOA 5B37A 1JN0A 5AW0A 3ZBPA 2EKDA 3A2MA 2QVGA 2ZTMA 2JAUA 1QRTA 3FCCA 3GUVA 4FVTA 1N8TA 2WFZA 3UATA 4IDCA 1EP3B 2NQTA 2QJFA 2XDQB 4P7FA 3QSYA 4QJBA 5HFNA 1PVVA 2QG9A 4GRAA 5CYFA 4HJRA 3MF4A 1J6UA 3A6EA 1J22A 2C4TA 2IUEA 4LWOA 1P6UA 4KQ2A 2C84A 4PV7A 3WFIA 3AUFA 5EXSA 1U8EA 2I55A 3IVXA 3QH4A 3OO0A 3DZHA 3PGKA 1NJFA 1QGED 3CY6A 4JQCA 4L0DA 3THWB 2J3KA 3EAGA 3OP1A 4I1RA 4LRTB 3KX2A 2L82A 4OHOA 4RXUA 5K51A 3TTWA 2X5NA 3AEZA 2ID9A 4L8GA 3EVBA 4S2UA 2XWSA 2H92A 2WTMA 1Z29A 2Z9BA 3EXEA 3IQGX 1Y0BA 2ZRBA 1KAQA 4CKBA 3UWKA 4G5HA 5KYTA 2C8LA 1EQAA 3NAZA 1LQUA 4DSAA 3GZJA 2ZR8A 3BXFA 2C03A 3F0TA 1XHEA 4GZLA 3E5MA 2WWTA 3KZKA 1JZTA 3GFVA 2O5RA 3OKCA 1C50A 1P31A 4IJUA 4OQZA 5CJ2A 4LYHA 3UJ3X 3JSXA 1CQXA 4IDDA 3RIMA 1IOWA 1Q0QA 2WVGA 3FHOA 4KXLA 3M2PA 2WJGA 3T6KA 3V34A 5CA0A 3V32A 2I4NA 1RM3A 1VFNA 1FDUA 2ODQA 4OHKA 1YUBA 1U8ZA 2AI1A 3GGJA 4EJ2A 3AW8A 3CNHA 3OPYB 3D2AA 1SD1A 4EARA 4XIFA 2Z8YM 1FFXA 5A5DA 1B6RA 1OWLA 2WBLC 5B58C 2XCSB 2YNMD 1W5EA 1FBNA 2C3PA 2PXCA 3DKRA 1DLJA 1SCNE 5JSZB 5EQDA 2XCIA 2MJLA 1UOQA 5AKGA 4BNJA 3GLIA 3BRQA 4PONA 1S3GA 3HSKA 5JNSA 5LPNA 1IK4A 3R7BA 1E2JA 3ISJA 4AMUA 1LTKA 5JBQA 3RRJA 2BHSA 4ER3A 4C4TA 4YT4A 3OLCX 5BNIA 4C4YA 3OEYA 2FW9A 1U0TA 1ZIYA 2WMOB 4MVJE 1R88A 4U7PB 2LGJA 1NXPA 3PB3A 4U0KA 4NPHA 2B4TO 2OPBA 3GUHA 1IYZA 2V9ZA 4P81A 4DCVA 3SSOA 4FR0A 1RADA 1CB7A 4AZSA 5KYYA 3Q8WA 4N41A 1FFCA 3GLKA 3NJ4A 1JAYA 1U3UA 1RE0A 2OEPA 1RBYA 2FG5A 2QYHA 5IFLA 2X15A 1E6MA 1X9GA 2FPGB 2AMLA 3GDHA 1M0TA 5F64A 2CE2X 1OAKA 3ADOA 1GRCA 3B5JA 1MORA 3HR4A 4KWIA 4MWDA 3UJAA 4JUIA 3UK0A 1ZJYA 2R96A 3I9FA 4BAGA 1SUAA 2VPTA 2HD4A 2RAFA 3RRYA 1T6YA 1M33A 4XARA 3BEOA 1QU3A 1S2OA 1Z4OA 4G09A 4L57A 3JARB 3MUOA 4OJTA 2RG1A 1C1HA 2I6XA 2XMPA 3F3KA 4KAXA 2G1AA 2IYAA 5C4IA 5JNRA 3I9LA 4DMRA 1MX3A 1D07A 3RFXA 4ZCIA 5J2UF 4M7OA 2O2IA 3PUWA 1KA9H 4KVFA 5DCLA 3TIXB 4S3MA 4ZHQA 4OJYA 1NI4A 4R1MA 3QEAZ 2Q41A 2WU1A 4PAQA 3WP0A 1E5DA 2J8ZA 3C3AA 2PGDA 3ZHSA 3AESB 1EB8A 2F7SA 4P7KA 5DM0A 4TS4A 4MDEA 4LWZA 1IG3A 4XQGA 3HB4X 4INZA 5E8RA 1ZK2A 1DC4A 1IZ0A 2C0PA 3IELA 3M33A 2IXFA 3BQMB 1N6IA 1ZCZA 2IUSA 2MSEB 4QT0A 5IDYA 1QIKA 4ZCMA 2EP7A 4OGFA 4R40A 4LXGA 5U1PA 3LUJA 2D62A 2DTXA 3MTGA 3QV2A 1YU9A 3RFCA 1BHSA 2PR7A 2VSNA 1UK7A 4UQLA 4CTJA 4ZT2A 1YRWA 1EYZA 1PT6A 1R50A 4G4SP 1CLEA 1ZVJA 1SQ5A 3FVRA 3A14A 3QVXA 1CIPA 4HZGA 3U26A 2Q4RA 2UVDA 1J0EA 2V3WA 3B8HA 3P5BA 3CZ9A 1ECGA 1QJCA 4LA4A 2GCGA 3BPSA 3E7WA 4DIUA 1GZ7A 1H1LA 2XGMA 3IE1A 2FKAA 3UOGA 2YHBA 2Z3ZA 1RI1A 4JNKA 2RH9B 4FR2A 4MQFA 4U02A 2FSVA 1B74A 1IU9A 1CR2A 3LGAA 4N7MA 1BYUA 1G19A 3T9CA 2LUOA 4CBVA 2RSLA 4E5DA 4EABA 5CFNA 4QOSA 4ISCA 1GG2A 5AK5A 3VTFA 3NBKA 1UJCA 3CINA 2J59A 3KXIA 1XEAA 3LT1A 3MT7A 4FDMA 4Y0VA 3TLGB 2H4XA 3L4BA 3WIBA 4RVHA 3IUJA 2QM0A 2Z2XA 3HJRA 3MUNA 2XVMA 4DMFA 4F3TA 5E4YA 3TGPA 3NB0A 1RD4A 3QXHA 4ZPXA 4EG6A 2YWXA 1W0JD 2ZSEA 3DMYA 3LQFA 2NTYC 4OM7A 5FTMA 1AO3A 5K4AA 4DDTA 2BMVA 1VL2A 5DT2A 3RHSA 1JQJC 3ZHUA 1QHNA 4PIVA 3ET4A 3UHJA 1D4FA 5AR1A 4V0NA 1GA4A 1I2AA 1FFSA 4KO1S 4LZPA 4R8MA 4EK9A 3SEAA 4B33A 1NX9A 1KE1A 3NH9A 1W9MA 3C4QA 4QJ5A 1J0CA 3HHPA 2OM2A 1WW3A 1AK9A 3BHIA 1XP8A 4H1HA 2HWUA 3R3YA 4KWCA 1QAMA 4CCAA 1OA1A 2QX4A 4D8TA 1WUIS 2I6TA 3FKQA 4YQFA 1YZKA 4Z3OA 5CVVA 3EZLA 3H0CA 4KXMA 2AG8A 3OQNA 1E9FA 1KO1A 1MIOB 1N8NA 2FSVC 2VRCD 2ZB3A 3FCEA 4FGLA 3W6ZA 3GLSA 3TLZA 3ZOKA 3QUTA 4Z49A 3JYOA 1CUHA 3E70C 4ZKDA 1IN4A 2O2YA 2BCGY 2NYUA 3OD5A 3K94A 3NWPA 4UM7A 1Y1TA 1JF8A 4LMBA 3RJ9A 2RH8A 4DDUA 1QIMA 2VIIA 3KD3A 4MIEA 5AM1A 5KTPA 1RR6A 1W2HA 3OJEA 2WWVD 7ABPA 4C6SA 3NP7A 3DTYA 1KJNA 3GD5A 3PHLA 4G0PA 3T4PA 3FDIA 1ZYUA 3MB8A 3G9XA 3HHEA 2OA0A 1CJTC 1G20A 4DMMA 4YRBA 4DG8A 1QG2A 3P94A 3WWZA 4ZYLA 1EDBA 1L5QA 2DFVA 3Q2OA 1ZD5A 3KU1A 4DR5B 1W0CA 4HXGA 3L7NA 1EX6A 2RGBA 4G26A 2PBFA 3KYJB 1IN6A 4NCXA 1KK3A 2VRNA 3SD7A 3WXBA 1AMOA 1FW6A 2NZYA 2C5GA 5EESA 3R7SA 3TRHA 3GL9A 3ZUPA 3WGOA 3CXRA 2P9ZA 3HA7A 3OJLA 4LJ6A 5ALTA 4YCMA 1P4HA 2JIOA 1HE4A 5CEFA 1AKQA 1OGIA 3IJ5A 2AXEA 2VJBA 2QVZX 1MF7A 4LFAB 3RVQA 3LTEA 2MU1A 2ZI5A 3GEHA 4IJKA 3SC4A 4N8DA 3GJ0A 3L6OO 4FC6A 4JBHA 1RBMA 1HE2A 3B9BA 1E5VA 5FUMA 1V35A 1OKKD 3LQ4A 4UAUA 1XL0A 3FGNA 3WHLA 4EKGA 3F6BX 2H59A 5AUQA 1MC5A 3S0JA 4COOA 3U7HB 3WKBA 4PNPA 5TF0A 4P35A 4YACA 4AF8A 3IPCA 5LVAA 1UFVA 2HPZA 2O59A 1O5OA 2P4HX 3GN1A 1L2TA 2PL9A 4LZZA 1ADCA 1P3DA 4O5OA 2EBHX 3BK7A 1B3BA 1EEHA 1R00A 2MSDB 2KPOA 1X1CA 3HDHA 4J1SA 2EL7A 3TI7A 4NNJA 3W9BA 1VCNA 4EUFA 1WDKA 3AZPA 2IS1A 1HL3A 4DABA 1C9MA 1TQ4A 3KALA 5C18A 3BH6A 3A9RA 2E4AA 4UHEA 2J07A 1YZGA 2OHIA 5EHNA 1S9HA 2G72A 1X7YA 2CLIB 1YK0A 3GYBA 4JUFA 3I5XA 1IM5A 4LCJA 5AW9A 2ANBA 4HMPA 3ZGYA 3G0CA 2OCXA 5CDTA 3GDFA 4H6XA 5TF4A 1ND6A 5AVRA 1BTOA 5HIAA 3MWJA 4L16A 1IULA 1I3LA 2ZSFA 2ILTA 1U9IA 3QVJA 1XRRA 2XF8A 3PE4A 2AXPA 1CZLA 4M1YA 3RVNA 4FC7A 4IL5A 4PC2A 1PR1A 1BS1A 2H17A 3EGIA 4P6VF 5CJJA 1C3OB 3P2IA 5TVKA 2AHOA 1W36C 1N2JA 2R5WA 3Q9LA 2XYPA 4MP8A 4BGEA 4PGHA 2MIIA 3BCRA 4DMCA 1HDXA 1O08A 2Z95A 3FF4A 4DQKA 2OR3A 4KYUA 3EXIA 2I67A 4YIKA 2GGSA 4NRDA 4YLGA 4BQQA 5DXJA 1N2GA 3F5FA 2D0IA 2ETVA 4PYJA 3CVUA 2RE8A 3RVKA 5SZKB 3T5BA 1G2PA 4NZOA 4IHQA 5L3VA 1QRRA 2PU5A 4YAFA 3UHOA 1B7GO 2ZI7A 4GQIA 1TCCA 1U1IA 3LQ2A 1T91A 2VPPA 1BXRB 3I2GA 2ZQ5A 3NUQA 3R3UA 4M8IA 4RLHA 2EFYA 4GI7A 3UJDA 1EBUA 1W88B 1VM6A 2V5VA 3OEHA 4EDHA 5K9ZA 1VPEA 4W5HA 3IDAA 2JJMA 4XH9B 2I9KA 1PZXA 2DBVO 3C85A 1N5KA 2QRVA 4MVJI 1TEVA 2OQRA 5IDVA 5IJAA 2ID4A 3ROEA 3H4VA 1IWBB 4HYQA 1S2IA 1E7WA 1P2GA 1T10A 3HUUA 1PNOA 1PYDA 4WFJA 3AETB 3UZUA 4ZAFA 3WNDA 2CW5A 2CFSA 3H2ZA 1UM9B 1G7RA 2Z8ZA 3NPAA 3TB4A 4ESOA 5BWNA 2JJ1A 1REQA 4R1UA 1MZVA 3H0KA 1I94B 4OOEA 3AT1A 5DSXA 3H6GA 4XVCA 1T5HX 2IIPA 1Z6AA 3Q12A 4NBWA 4I50F 4BLSA 1E20A 2VPWA 1QKJA 4PCUA 1Y8RA 5LQNA 3RK1A 2GKGA 1DT5A 2OVBA 2C7RA 3DWEX 4CQMB 3HKEA 1ZCAA 1Q6YA 3O1JC 5H9VA 3MJSA 4UKDA 2IW3A 1RC0A 3RVDA 5TMPA 3FNIA 4OSOA 1SVSA 5JD3A 1ZU5A 2OAGA 5EMJA 5CVTA 4PPFA 4FOOA 2O3SA 3TF5A 4HS9A 4BNFA 5JDIC 1DCFA 5INTA 3VX3A 2ZVDA 3BCUA 4G8JA 1ZG3A 4R1QA 4YHHB 1FFEA 5HA5A 1DIRA 3D5QA 5AHRA 1SG9A 1A9PA 1BCRB 2Y6VA 1MX5A 3H6KA 2ZWPA 3DDWA 3U4IA 4OGKA