2R8BA

The crystal structure of the protein atu2452 of unknown function from agrobacterium tumefaciens str. c58
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
PMTKDSYFHKSRAGVAGAPLFVLLHGTGGDENQFFDFGARLLPQATILSPVGDVSEHGAARFFRRTGEGVYDMVDLERATGKMADFIKANREHYQAGPVIGLGFSNGANILANVLIEQPELFDAAVLMHPLIPFEPKISPAKPTRRVLITAGERDPICPVQLTKALEESLKAQGGTVETVWHPGGHEIRSGEIDAVRGFLAAYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu2452
publication title The crystal structure of the protein Atu2452 of unknown function from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 60
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r8bA00
4LYDA 1QJ4A 4BZWA 5CW2A 3RLIA 3V1LA 2V96A 3UMJA 3QVMA 5ALEA 4KE6A 2PBLA 3G02A 3I2KA 4KRXA 2HA7A 1YAJA 3R3VA 3CXUA 1ZI8A 2HRRA 5IVKA 4B0PA 3RKSA 3WKBA 4B80A 4UHEA 4UUQA 1K5PA 1LPPA 3OTQA 1A7UA 4I3FA 2HA6A 2AJ8A 1K63A 3BXPA 2QZPA 5ALQA 5AM4A 1WPXA 4X93A 1CUJA 5AI9A 2GYWA 2WHRA 2RAUA 4QA9A 3ILSA 4OB7A 5ALOA 5FKJA 3ZLVA 4Q1VA 4X95A 5K3AA 3NUZA 1LPNA 2J4CA 4L0CA 5AI8A 2Y2UA 1Q83A 4Y2SA 2OXEA 3QZUA 4L72A 5CT5A 5FUMA 2O2IA 4BRSA 1D07A 5AI6A 3D3NA 3DJYA 4DIUA 2PUHA 1QIFA 1R4ZA 5DTJA 2Y1KA 1AZWA 4I4CA 2H1IA 4UHBA 1X2EA 2HU8A 1CUDA 1ZGCA 3B12A 1CLEA 4X90A 1YCDA 3STUA 1UOQA 1EDEA 2R8BA 1W6RA 1QO7A 5KWIA 2VJAA 5ALKA 5D3KA 2WJ6A 4ZI5A 7YASA 1QIMA 3PUIA 4JUIA 1FFEA 3TRDA 1MX9A 4N8DA 2PX6A 1CUFA 2G4LA 1L7RA 1CFJA 4OD0A 4BAUA 5ALTA 4HVTA 1IZ7A 4AQDA 2G63A 2VAVA 4J7AA 3G8YA 2XMZA 1IUNA 3G9UA 2Y6VA 5AP9A 3I6YA 2DFPA 3ZV7A 4XJVA 3FBWA 1ZD2P 4DGQA 5EFZA 5CMLA 2X8BA 1XQVA 2HM7A 1AKNA 4UHHA 3DL4A 3GBSA 5FXMA 2JGFA 1JJFA 3WK9A 3W9BA 5E4JA 2VQ6A 2C5GA 2QVBA 1AGYA 2ZYHA 2XUIA 3FCYA 5AKGA 3WLAA 2Z5GA 1EDDA 5CH5A 3S2ZA 5JIBA 3I2IA 3YASA 4X94A 4WFIA 4JNCA 2HIHA 5FDFA 4P08A 5IKXA 2H9YA 4HXFB 3LCRA 1QIHA 1BROA 3STYA 1TCAA 5DYYA 3DOIA 1HPLA 3C6XA 4J0DA 1CUVA 5C8ZA 3F8SA 3O4GA 4BC0A 2PL5A 1L7QA 3ANTA 4PQEA 3AZOA 3WL5A 3GUUA 4UBOA 2XUAA 2UZ0A 1MU0A 2FUKA 1VJ5A 3QPDA 1XQYA 4EB0A 3LIPA 1UOPA 2WIFA 3H2IA 1XRNA 3IVMA 2VT7A 2PM8A 5ALMA 3ESAA 5HK9A 3VJLA 5JATA 5HZGA 2WUEA 4H77A 3GA7A 1K8QA 2EEPA 4FBLA 5FPPA 3WKCA 4KAFA 1XRLA 4AZ0A 5DJ5A 4H7EA 3QMMA 3SWWA 2WHPB 1W76A 1XZHA 1ZJ4A 5AH0A 1CQWA 4C87A 4G5XA 1TQHA 5AJHA 4MQMA 5CURA 2YASA 3OG9A 1LGYA 3IIIA 4B83A 1UK6A 3KOOA 2XUDA 5HF8A 3TEJA 3LIIA 5AKJA 4JEIA 4QE3A 4X3CA 3VVMA 4KRYA 1ACLA 3WQHA 1E89A 3BDIA 3OPMA 4EY8A 4WY5A 1B6GA 1TRHA 1E3QA 3AIOA 4H0CA 2HA0A 4BTVA 3HABA 4G1FA 3KSRA 1EINA 3TGLA 3VDXA 4M0EA 4AX4A 3SC2A 5K5EA 4FLEA 2Z8ZA 4CCWA 1QTRA 2WFLB 1XZDA 4QDUA 4J03A 1F0PA 4Z49A 1LPSA 1WB5A 3F9CA 2R11A 3WWCA 2BCEA 1PFQA 4F60A 1JMKC 1EVQA 5JZSA 1ACJA 2OG1A 4EY5A 4WFJA 1R1DA 1FSSA 5LZ5A 2HADA 3OM8A 3R3XA 1JKMA 4FOLA 3PE6A 4BC1A 3OC0A 2QRUA 2Z3WA 2XMRA 2XMBA 4DMKA 5YASA 1IZ8A 1WPRA 3G0IA 4Q3OA 3P2MA 3G0CA 2ORYA 1MT3A 3M81A 2WQZA 3LP5A 3V9AA 2BKLA 4FTWA 3QH4A 3CN7A 1XZEA 2DHCA 1E66A 5FRDA 2WLSA 2RGUA 5HFNA 4BB0A 3K2IA 1XZGA 3WWEA 2I78A 2WIGA 3I6ZA 1ZI9A 3SX4A 1VXOA 4CIAA 5ALUA 5JANA 3H18A 3PF8A 4H35A 4WDQA 4N8SA 4M0FA 2B20A 1QOZA 3ZPXA 5T4HA 3WJ2A 3F96A 4D9JA 1P0QA 3H0CA 3H2JA 3D2BA 1AQLA 4L9AA 1XKLA 4S0XA 1LPAB 1UK7A 3KXPA 4CG2A 1CUCA 4MXDA 1Y7HA 1OXMA 4DSAA 2WUFA 1CRLA 3NGMA 1SFRA 1W1IA 1GZ7A 1U8EA 3LS2A 5CH3A 4Y2PA 2RHTA 1R9MA 1ZJ5A 1J06A 5FOQA 4L3WA 5HKAA 4PV7A 4ZREA 1LLFA 4XVCA 1QFMA 1XZLA 4LHEA 2VJDA 2JEYA 3G9ZA 5H3HA 5K3DA 3F67A 1QONA 2VAXA 4AZ3A 5DYWA 5AK3A 5CBKA 1JU4A 4OB6A 2Q0XA 2JF0A 3QPAA 2I03A 1WHTA 1H2YA 4BE9A 1DWPA 2XQGA 4M0MA 4P9NA 2XUFA 5DWDA 1CUUA 3ESCA 3VISA 4INZA 3IUQA 1GQSA 4MWSA 2HHAA 5AM5A 5LYYA 1EXWA 3L1JA 1RYYA 2IITA 3IUNA 4B81A 5I9IA 2CJPA 2QR5A 5EHXA 5ESRA 5LIPA 1G4HA 3FLEA 1YAHA 2D5LA 1ZICA 1JJBA 4B7ZA 1DTEA 4HRYA 5IVIA 1LBSA 1USWA 4FBMA 4DMFA 4MWTA 1CQZA 1P0MA 4G4GA 2O2HA 2VF2A 3MVEA 4E46A 1R88A 1K4YA 3PICA 3BL8A 2XMQA 1H22A 3BE8A 5HFAA 3A2NA 3H19A 3OURA 5ALNA 1VLQA 3U1TA 2BGRA 4HRXA 3IUJA 3N2ZB 2QOEA 5CH8A 1RP1A 1GKLA 3VKFA 3KWFA 3HI4A 4FNMA 4OU4A 2JBWA 4UBIA 4ZWNA 3V1MA 2C5FA 4BP9A 4PF1A 2G5TA 1JMYA 1YSCA 2WHPA 3PI6A 5ALPA 4BVKA 2O7VA 3D2AA 4BCCA 1PV1A 3G0GA 1ORWA 3TJMA 2JEZA 1XZKA 4AXBA 3DYVA 4G4JA 4NMWA 4OCZA 2XQJA 3AZQA 5EIHA 4UPDA 4UHFA 2VJBA 2WIKA 5LZ9A 4Y2VA 5A2GA 5ALRA 3WYNA 1IVYA 1H2XA 2VATA 5AKIA 5E4TA 4FNGA 2JGEA 4MQLA 5K3FB 1ZOIA 5ALYA 1JI3A 4Y2RA 4E11A 1A88A 2CEKA 5AI0A 3O9MA 1R9NA 1XZMA 1QGED 2WTNA 3G0DA 4DYHA 2ES4A 1ZGBA 2JGMA 2I3DA 1G5FA 2GYVA 4G8CA 2DR0A 3DKKA 4OYLA 4EUSA 5C81A 3C6ZA 1W75A 4FDMA 4C01A 2DSNA 2C0QA 5BWBA 2WFLA 3K6KA 4EHBA 3WJ1A 1YS2X 5AM1A 1YB7A 4BATA 2JGKA 3E0XA 1HKHA 1QIEA 1E8DA 4UHCA 4C88A 5AICA 3H2KA 4XX1A 3WKEA 5LZ8A 5F4ZA 5DLPA 4AN0A 4F5ZA 3HACA 1UZAA 4QEKA 5EIEA 4OB8A 5JD4A 5LKAA 1G42A 5EI5A 3O95A 2H7CA 1GQRA 2XUQA 4C89A 5BWCA 3H1AA 3EIOA 2QS9A 2V97A 4MEAA 2PUJA 1Q0RA 2JGJA 4PSCA 2JIDA 1MNAA 4DM7A 1FFAA 3B3QA 5AKKA 1XRMA 3FVTA 2VT6A 3DQZA 5DTIA 3R3YA 4KE9A 1HQDA 4PO3X 3U0VA 5JAHA 4TGLA 3DYIA 2AXEA 1TCCA 2VA9A 1DU4A 4C4ZA 3ESBA 3ICVA 1CUWA 1XROA 4DNFA 5C8VA 1I6WA 3BF8A 2OCLA 3EQ7A 1HBJA 5ALJA 5FLKA 2XUPA 1ZI6A 3WK8A 1E8MA 1QTIA 5BOVA 5CRIA 5ALZA 1XZFA 3KWJA 5J3JA 4G8BA 1O6FA 4GXNA 5AM3A 4QLAA 5A7FA 5LP1A 1LNSA 1DWOA 2GYUA 5AKEA 4GBGA 3DDUA 4X92A 3BJRA 2CBGA 4G8DA 1YA4A 1QLWA 2EDAA 3I2GA 5AK4A 2HRQA 4XWGA 4ARAA 2CB9A 3C5VA 2XUOA 4U2BA 1XQWA 4H7DA 4H7IA 5SYMA 2HDWA 3IDAA 1ZIXA 2OAEA 2XB6A 4CCYB 4Y2XA 5CTAA 1OILA 2X5XA 4P92A 1ODSA 1N5MA 1ZD5A 4Y2UA 4QZVA 1KEZA 4LYEA 5FP0A 4B85A 1AX9A 3C8HA 4HS9A 3ZLUA 3FNBA 1WM1A 4N5IX 2XUGA 4P93A 2WILA 2O7RA 1BN6A 1MPXA 4E15A 4BDSA 4LIPD 1DINA 4W1QA 3DKRA 4KAAA 4YPVA 4PNZA 3STWA 5KWJA 1NX9A 2QUAA 1ISPA 1DQZA 3A2LA 1KU6A 4GDMA 1WB4A 3HYSA 2ZSHA 3FYTA 3WWDA 1J07A 2QJWA 1CUSA 5DNVA 2AJLI 4X71A 1MNQA 4HZGA 4V2IA 4Q05A 3R3UA 2WJ3A 2HA4A 3FWHA 5AKYA 2IX9A 1E8NA 4J3JA 1LPMA 1OCEA 4UBKA 5IVHA 4QNNA 1MO2A 2ZJ6A 2QTBA 4EZIA 3C45A 3GZJA 3JWEA 2ZVDA 2XMGA 2WUGA 4DNOA 3W04A 4A16A 4Y2YA 1UOOA 1H2ZA 2HA5A 3HRHA 1M33A 1A8UA 4GWLA 4IO0A 4DMCA 4YK7A 5HF9A 4BYMA 5AK6A 3I2FA 3R0VA 2GBFA 1DWQA 3E1GA 1UK9A 4QDZA 5AKLA 5ALXA 3I1YA 2VEOA 3B5EA 3WL6A 1Z68A 4Q82A 4OUKX 1CR6A 1MTZA 1C7JA 4BE4A 2I3ZA 4LKOA 4LXHA 5FV4A 4NZZA 3C70A 4AO6A 1TKRA 3AIKA 5K3FA 1XRQA 5HCUA 3MGAA 2XLBA 4KR0A 4KYVA 2PSJA 4NS4A 5A71A 3IBTA 2XE4A 2FX5A 3I28A 4FLMA 1CIJA 1XZAA 4BDTA 4J0HA 5T4FA 5AKXA 1FFDA 2PU5A 1XLUA 2B61A 2C58A 3JYHA 2XMCA 1UFOA 4EY4A 2WG2A 2OGZA 4WY8A 2WUDA 4MYSA 2H7XA 4H7KA 3ZWQA 5ALDA 1DX4A 3QM1A 2WSLA 1VOTA 5JAOA 3WK7A 6YASA 2X76A 4TVKA 2GBCA 2JGLA 5K3EA 4HTAA 5ALGA 3FYUB 3ZI7A 3WL7A 3O4IA 2OGTA 5AOCA 4OSEA 1QIDA 5HKBA 3G9TA 3H04A 1SC9A 3UUEA 1YS1X 4GHWA 5IH7A 1EDBA 4X85A 5ALIA 1VXRA 1QIJA 1CUAA 3AUKA 1EI9A 1HL7A 2WIDA 3D59A 3WA7A 2B4KA 2WG1A 2HA2A 2AJBA 4X6UA 4BCBA 1O6GA 1ZIYA 2E3JA 4RE6A 3C8DA 4EY6A 2DQYA 2OQIA 1DQYA 4ZXFA 3V1KA 2QUBA 2VSQA 4GECA 5E2IA 1L7AA 4U2CA 3H2HA 5ALVA 3WK5A 4U2GA 4C4XA 1IUOA 2OCGA 1EA5A 3VXKA 4GLBA 2J3QA 2K2QB 1YR2A 1F0NA 1LZLA 4EA6A 4F0JA 1XRRA 2JGIA 4KE7A 5JZ9A 2XI4A 4FHZA 3KDAA 2HFKA 3D2CA 3WI7A 2BUAA 4UBNA 4KJXA 4O08A 4A5SA 1F6WA 2PSHA 2HA3A 1FFBA 3ICWA 2XQFA 4N5HX 3IUMA 3WK6A 5K3CA 2XQKA 2ZYRA 3AFIA 5EGNA 4BVJA 3AJAA 2QXUA 4U2FA 1LZKA 4Y7DA 1HLGA 3QBJA 5AI4A 3KD2A 3D4LA 4BAZA 1P0PA 4H7FA 2WFMA 3L1IA 4CCYA 1UK8A 4DNQA 2YYSA 1QIGA 4EY7A 3FSGA 3RARA 4TPKA 5AKZA 2ACEA 2IIVA 2NW6A 1EVEA 2CZQA 1VZ3A 3QYJA 1XRPA 1EK1A 4KACA 3DL7A 1CV2A 2XUJA 2AJDA 1FFCA 4OYYA 3GROA 1QE3A 2FJPA 3FCXA 4B84A 4UBMA 1BEEA 2DHEA 5KBYA 1SCKA 4W63A 2VTVA 4DNPA 3T52A 3VVLA 1GPKA 4HXEB 2GZRA 5C7YA 3FOBA 3HJUA 4JYPA 5AOAA 2LIPA 5CT4A 5DYTA 3G9XA 1LBTA 3EQ8A 4A23A 3MUOA 1DT5A 4G9EA 4GI1A 4X6YA 3V48A 4Y9SA 4JYMA 5A62A 4E14A 2RONA 1GXSA 4JH0A 5JASA 1XKTA 2BGNA 3E4DA 1BU8A 5D7BA 3VJMA 3PDCA 5ALFA 4CI9A 4U2DA 2EDCA 2PKYX 5ALLA 5C8XA 3NOXA 1UKCA 5KREA 5BV7A 1AUOA 4QLOA 3DS8A 3DOHA 2FJ0A 5CT8A 1P0IA 1QIIA 2XMSA 3I2HA 3GELA 1ORVA 4AO8A 1W4LA 2PSFA 4J0GA 3W9UA 3WK4A 1ZD3A 5CXUA 3ED1A 3T4UA 4ARBA 3WKDA 3BIXA 4AN1A 1AURA 2HU7A 1TCBA 5ALHA 1H23A 2QMQA 4C6HA 1THTA 1WCYA 4Y2TA 3BF7A 1VZ2A 3M82A 4PSUA 1UT6A 1TAHA 4K6HA 1MX1A 4HAIA 2C4HA 5JYCA 4RPCA 4X91A 1BEZA 1BCRA 3G7NA 2PVSA 1Q0ZA 2GBIA 4B82A 3RK4A 1MAHA 2WFZA 3H17A 2WHQA 2OCIA 1GT6A 1EHYA 2GZSA 1XZJA 1IUPA 2G5PA 2ONCA 3O4JA 2WIJA 4DLNA 2ZJ7A 1THGA 5HQ3B 1LPOA 4DTCA 4BRZA 1C7IA 2OPHA 2YH2A 1QZ3A 3C87A 4OPMA 1XFDA 3WYDA 5CXXA 4HXGA 4QWMA 2DHDA 1VKHA 1ZD4A 2BUBA 4ROTA 2CKMA 4IH4A 4X6XA 3F97A 3FYUA 3R41A 5AHXA 5HF5A 3L1HA 1UKAA 4ZV9A 3M83A 1MN6A 1RWQA 3BJMA 1U4NA 3W06A 5ISMA 1VA4A 1NU6A 4WCVA 1A8SA 3FLAA 2WU4A 2WKWA 2Z8XA 3FSGD 4FWBA 1VE6A 4MEBA 4UFNA 2HU5A 4Q3LA 2OCKA 3STTA 4QDTA 4C4YA 1F8UA 3WA6A 2WG0A 4W1PA 1Q84A 3ESDA 3AZPA 1QO9A 2WM2A 2HFJA 1LPBB 4LXIA 4ETWA 3I1IA 1AMNA 1UKBA 5LZ2A 3ANSA 1G66A 3PFCA 5I7UA 4ZV7A 3MUNA 4UHDA 5EHZA 3PF9A 3C5WP 4BTLA 2XQIA 4FLFA 1J1IA 4CIBA 4H18A 3HLKA 4K5QA 1XQXA 2XUKA 2HL6A 4X00A 2BJHA 3Q8WA 1R50A 3WZLA 2QT9A 4PW0A 4QDOA 3RM3A 3IA2A 3HEAA 2WU3A 5FPQA 3DNMA 3CCBA 3AILA 1X70A 3N0TA 4PSDA 3C6YA 1H2WA 5AK5A 4FMPA 1K6EA 2XLCA 1C4XA 2RI6A 3STXA 4QDXA 3GFFA 3PUHA 1JT2A 1MAAA 4YASA 2RIPA 4J0CA 3HC7A 3R3ZA 5AO9A 1U2EA 4LXGA 5T4BA 1WHSA 1BS9A 4AO7A 5JD6A 2GBGA 4I19A 1R3DA 2ACKA 3NWOA 4B9EA 5AKHA 4BZZA 3WWOA 3D7RA 2OLEA 5LLSA 3CCCA 4IH1A 4B6GA 4CG1A 2ZJFA 2W22A 3QPCA 5HK8A 1N8SA 4Y2QA 3DCNA 3QMWA 3DLTA 4GW3A 3E3AA 1T4MA 3FYUC 1EK2A 5JZBA 1B41A 2J3DA 5HF6A 5A6VA 4BCDA 1MX5A 5JADA 2ZYIA 5E4YA 1GKKA 2XUHA 3FVRA 4KE8A 3O0DA 2CUTA 1QFSA 3WL8A 4YX9A 5JARA 5EHNA 4X97A 1HDEA 1EB8A 4UFPA 3WZMA 4MYDA 1VE7A 5ALSA 2QM0A 2O2GA 5LKRA 3C6BA 1QIKA 4J0IA 2XDWA 4OU5A 1FJ2A 3H2GA 3W2TA 3AIMA 4CG3A 1S8OA 1A8QA 3A2MA 4FKBA 1JFRA 1CUEA 2Z3ZA 4F21A 5AI5A 1CUYA 4ZGBA 5AOBA 4FFVA 1NU8A 2P8SA 1U65A 1XLVA 5EIAA 4Q34A 4FFWA 4W1SA 2CMFA 1X2BA 1WB6A 4W9RA 2OAGA 3OOSA 1CUIA 4J0KA 1UWCA 4DSZA 2J4FA 2RHWA 2YXPX 2XMDA 1EH5A 3M3DA 1BN7A 3HSSA 2W6CX 3HXKA 1XZCA 2DQZA 1CPYA 3V1NA 3R3WA 4K2AA 2C0PA 3EBLA 5SYNA 3CN9A 1GPLA 1SCIA 1BRTA 2D0DA 3WKAA 4K6GA 2PU7A 4B0OA 1XZBA 1CUXA 1JU3A 4U2EA 3FLBA 3LLCA 2QKYA 3SK0A 5EHQA 1EB9A 3UUFA 2PSEA 4UBLA 3K9BA 3Q0TA 5DNUA 5JAPA 3I2JA 5IVDA 5HQ3A 2Y6UA 1CVLA 1SCQA 3I6MA 4RGYA 1ODTC 2OQVA 1TK3A 4W1RA 4K6KA 4BBZA 1GGVA 3WIOA 1N5RA 2PSDA 2WJ4A 3D0KA 4X7BA 5DNWA 5AIAA 3F98A 3IULA 4AMZA 1CUGA 2ROQA 2Y2VA 2DCMA 3QMVA 3FAKA 3C43A 3D5EA 4XIIA 3QITA 2OGSA 4BVLA 3AINA 2QXTA 1ETHA 2AJCA 3EQ9A 1CUZA 5CT9A 1ODCA 4ZRDA 1Y7IA 3BDVA 5LZ7A 4BP8A 1CEXA 1SOMA 1AC5A 3WMRA 3STVA 1YA8A 4B9AA 4RE5A 3A70A 2V9ZA 3G0BA 1IMJA 4WFKA 2ZSIA 4UBJA 3W05A 5JAUA 3PFBA 5D6OA 4ITVA 1XLWA 5JALA 4G4IA 3DD5A 4Q3KA 5A7HA 4RNCA 2WTMA 3R40A 5LZ4A 5JD5A 4G9GA 4NVRA 3X3HA 3BWXA 4DMHA 3O9VA 1N1MA 2XT0A 4KAJA 2QJRA 2PPLA 1PJAA 2C7BA 2BFNA 4N8EA 4AMYA 1J2EA 1BE0A 1UXOA 1XZIA 5ALWA 4BAGA 1DT3A 5A7GA 3S8YA 1KU0A 3WWPA 5D3ZA 2BUCA 1MJ5A 1CUBA 3VJKA 4IH9A 2BAGA 1WOMA 1VA5A 4IHAA 1W52X 1YASA 4J0JA 5I8PA 5K3BA 2B9VA 3H1BA 4KEAA 3JW8A 5T4EA 4H7HA 1TIBA 4QWWA 1BCSA 4WDRA 1DX6A 5CT6A 3IURA 3ZLTA 1Y37A 1JJIA 1YB6A 4EBBA 1EX9A 2V98A 4AB1A 4WJLA 4MJ3A 5AM0A 2H7YA 3BIWA 4H7JA 4UFOA 5AIBA 2ZYSA 5AM2A 2ECFA 3A6ZA 2VJCA 3HZOA 4IQ4A 3DEAA 3O4HA 3EF3A 3IB3A 1GPNA 4CFSA 1CUHA 1E5TA 3WIBA 4GEGA 1T2NA 4Y2JA
chains in the Genus database with same CATH superfamily
2JZOA 2WF6A 3TNFA 4ARZA 4BZWA 5CXSA 5CW2A 3RLIA 1T5HX 3HNPA 3C1AA 1SG9A 2IOHA 3CKMA 1E4EA 3U7HB 3DOOA 1P1KA 3QVMA 4MQ6A 4XFKA 3MGGA 1MAUA 3CT6A 3N2IA 3SHQA 4KE6A 3WMEA 3RVPA 1PR6A 4RZUA 4NCAA 3OLCX 3DZIA 3K0HA 7GPBA 4RULA 3G02A 3I2KA 5AYVA 5L7WA 2X3UA 2C1EA 1JSLA 2WSSD 3CLHA 1NTOA 1YAJA 1QP0A 1IB6A 3TIVA 2ZUVA 3OD5A 4D4HA 2WPDA 3CXUA 3WLEA 2QYTA 2YZGA 2DFDA 2HF8A 2XNJA 1KMCA 5EKUA 1XTVA 1DV2A 1K0UA 5EQTA 5I4BA 1XV5A 2CN1A 1M6EX 2XODA 1SURA 3CHYA 3O8OA 3CURA 3OU7A 4B3DA 4JQOA 3SM9A 3ZGOA 1LPPA 3OTQA 1VKNA 1IUKA 3GRVA 1WX1A 4Y1RA 5AVYA 2HA6A 2HO5A 3KLOA 5ALQA 3L8MA 3OJLA 1QH1B 4MYCA 2RGAA 1N1EA 1CUJA 2HLDA 3BB4A 1USUA 2LW7A 4HD8A 4YMWA 4D4MA 3TLJA 1EUDB 4R71A 2BSXA 3HCEA 1E3WB 4GPBA 1DBIA 2WHRA 4MIKA 3ILSA 3ZCUA 4KLAA 5ALOA 3NIBA 1J7JA 3OBBA 4E7PA 3PRKE 3GH3A 7AT1A 1LPNA 2GR9A 4MCHA 3DUWA 1QYXA 2QZ4A 4MIOA 4DA7A 4IHJB 3L7IA 3QVXA 5K0TA 2EKLA 3LOUA 4L0CA 1G8SA 5CIYA 3L0BA 4Y2SA 1YVEI 2B35A 2OXEA 1Y4ZA 1JHAA 1ECCA 3JVIA 4J1TC 4BLTA 5FUMA 2MMGA 5TQ2B 2HOQA 4UE6A 4UM9B 1D07A 1G8FA 2MSLA 3AG5A 4KVZA 5LQAA 5CA1B 1MEJA 5EP3A 1SBTA 3ZWBA 1FE8A 4S05A 2JLBA 3H9UA 2CUKA 5KAMA 2RI1A 3R24A 4DIUA 2PUHA 3PTAA 3M4YA 2YZNA 3ENWA 1IZ0A 1T9GS 4NK4A 2PGNA 3WJAA 2JHAA 1F06A 4F45A 2BZGA 7REQA 3QY9A 2WJAA 3RVSA 1FMCA 1TCUA 1K8YB 3JQ9A 4K1LA 1TZMA 4GE0A 3U4AA 2YFKA 3A1EA 2ZYTX 3NC1C 2Z5VA 4CUZA 3TQCA 3U1BA 1PR2A 2HMUA 2WTXA 1H6DA 4I4CA 4IX9A 5KYYB 4MWEA 2TSYB 1O3YA 3CUSA 2A5DA 3GYBA 3KQTA 1YBVA 1VLMA 2HU8A 1F8FA 3X44A 5B3KA 3MHTA 3B12A 4X90A 3TLKA 3HK2A 1JUDA 1IZYA 3W34A 1UOQA 2MYTA 3D9QX 4GI7A 3ED5A 3KP1A 1QU3A 1OB5A 2R8BA 1HG1A 4IDBA 4L78A 1QFZA 4ZZ1A 5BNIA 4KGDA 5CFMA 2UUCB 2X0RA 2SKCA 4GSKA 1E7WA 5ALKA 1EX6A 2DWPA 3PZBA 1YDHA 3B3GA 5IJ0B 2NNLD 2IXFA 2K5UA 2BL4A 3MOSA 1LSJA 1FFEA 4JUIA 2YHBA 4XQ9A 1MX9A 5TT0A 3SBOA 1IBLB 4MS1B 1DCMA 4KQWA 3I04M 4RL4A 3VRHA 3ZJYA 4EI9A 4FYKA 1EFHA 2JASA 4PYRA 1RAIA 4G56A 4AJ4A 1TYBE 2IHUA 1DFGA 1H2FA 2IEYA 1MGOA 4BAUA 4LVOA 2EF0A 1C7ZA 5ALTA 3DVRX 1P9LA 4ZYYA 5B4TA 1GL3A 1M6HA 1FRZA 3OCYA 5K6RA 1QP8A 1VL5A 4YRQA 2WJZB 2BGWA 2XTMA 3ODGA 1O03A 4J7AA 3DM9B 3HVJA 1YQTA 2ESRA 3BJEA 4Q1BA 2CLHB 2WVGA 4J75A 4DZTA 2FOIA 2IEBA 2Y6VA 5TY0A 2V1XA 4BX2A 4L2IB 1X7ZA 3AUTA 3ZV7A 2PT7A 4XJVA 5JYBA 5JXGA 4BJ5A 1JAIA 1RYHA 4CLXA 1YZLA 3PS9A 2X8BA 1XQVA 1IE3A 2IVFA 4JJGA 1EX7A 2H5IA 3GT4A 3LGSA 3M6WA 3ONNA 4KW7A 1NVGA 3QKWA 4INAA 5FUWA 3DL4A 1ZN7A 1N2EA 3GBSA 3HKDB 4ZT6A 4CQLB 4Z4CA 3RFCA 4JI0B 2HJSA 1GAEO 1JJFA 3RBXA 2PA3A 5L45A 4BGDA 4E31A 3W9BA 1K2WA 3D6VA 1YDGA 2VQ6A 2C5GA 4RF4A 3RSCA 2E1RA 2QVBA 3SFVA 2BGUA 1PN3A 5L6LB 2FMTA 3KG2A 2WM3A 4FOTA 4LCEA 4O2BA 3JQAA 1UBRS 3LSTA 5LSAA 2ID7A 3KKZA 4ZVPA 4AXXA 3B2EA 5KTRA 2O2SA 3WLAA 1KI7A 3AESA 1PJZA 2FKNA 2WJGA 3B6IA 4AZ3B 4OQZA 3RADC 3ZE6A 2BYTA 2WTBA 2VDJA 3EN0A 4MB2A 1SU6A 4PZPA 3OE7A 4BFLA 5JIBA 2C7VA 3I2IA 3AI7A 4UXJA 1OX4B 4GYJA 5KC9A 4PWZA 3M1AA 1XCBA 4WFIA 2RCNA 1WHTB 3F0TA 2AOUB 4S2UA 3U9LA 2HIHA 1XJWA 2OHJA 1N34B 4P08A 3SIPA 1Z33A 2PXXA 1XMQB 2YN2A 1MB0A 3AY3A 4HXFB 2WWWA 3TNDA 4EFMA 3F78A 5F5NA 1H8EA 2ZR8A 4Z7OB 5JV5A 5GAJA 3SS8A 2QG6A 4W5RA 5GTDA 3N2LA 4QHYA 2BEUA 1MT0A 3HRKA 1TCAA 1VPDA 3IALA 2H4JA 4XLLA 5G1OA 3V4SA 4CXMA 2SICE 1V71A 3AL2A 3HBFA 4K26A 5IC6A 4LV6A 5JS1A 1Q74A 5FPSA 4PANA 3SD7A 5LXTB 3BVPA 1YACA 2NXNA 4Q3DA 2VJKA 5BQ3A 5IVPA 1UIRA 4CKCA 3FUXA 4WECA 2ASVA 2W2KA 3SJ7A 1ZINA 1CF9A 1UBOS 1SC3A 3IJ5A 4GNRA 1CUVA 3FX2A 3FSEA 3N76A 1QG0A 2YMQA 4BC0A 4YCLA 3GVCA 4JC0A 1QP4A 1TW2A 2I3GA 3IP8A 1K68A 2IYFA 2B6NA 4HAYA 4ND4A 4CT0A 4GYYA 1YU9A 4DBLE 1IK6A 4QULA 2W8BA 3WL4A 3GJRA 1D4AA 1SZDA 3WL5A 4HDSB 3NHPA 3V6MA 4UBOA 5LP6B 3RVRA 4QX6A 1VKZA 5EEGA 3VDQA 5BSWA 3U6BA 2DHRA 1JQAA 2D2EA 3E84A 3FJOA 4J2OA 1QH8B 3U17A 3VR1A 3BWEA 2Q27A 5K0SA 3G2LA 4DCSA 2VJQA 1MU0A 1KSJA 4B35A 4U0JA 1NXXA 3BXOA 1VJ5A 2A5YB 4UAGA 5LWQA 3BIFA 1R37A 4JCOA 1IN7A 3H9CA 4GL4A 1XRNA 1EP9A 2VT7A 1Q1ZA 2ANBA 2WPDD 5ALMA 4DFDA 1RKUA 1R66A 3ESAA 1BWSA 4L0DA 2BGJA 3T3IA 4PR3A 1FBTA 4NYMR 2C9DA 4D3ZA 4JYCA 1K5GA 1POXA 1RQRA 2ZEJA 3GA7A 2NZWA 4IX1A 1G7RA 1I9GA 2HI0A 1GU7A 1M6VA 2B92A 3M1IA 2EEPA 1U1FA 3PZRA 4OJNA 4QBIA 1FTSA 4JK3A 5FJIA 1T1GA 4FBLA 4A27A 3EGVA 4ACBA 2YWRA 2CB0A 1V11B 2HUPA 4BASA 5DJ5A 1B8VA 1IN5A 1V1MB 1Z22A 4M8IA 4S1NA 1ZMOA 2HLDD 4U9HS 3OE5A 1DO8A 2QMYA 3QMMA 4RJ2A 2WUVA 1VYUA 2FQXA 2FRVA 3C3YA 1SJ9A 2Q2NA 2WIBA 3ZZ0A 5KC8A 3PDWA 2O1WA 3Q7RA 1W76A 4RO0A 1N7JA 3OLZA 4H1HA 4LOKA 4AMUA 2ZI5A 2X1MA 3QLEA 4G5XA 5AJHA 2HBQA 2MIIA 5EP1A 2J0VA 4RJIA 5CURA 3NHLA 3T5GA 3ENNA 4EWLA 1SKYE 1ICEA 2VNSA 5DH9A 1DADA 4DJ5X 3HB5X 3S55A 4UCXA 3A4TA 4ZGGA 4D0NA 3T1HB 4XQ0A 2AJTA 4YAOA 3Q3CA 2ZSUA 4MJXA 1OXKB 1WWKA 2QSJA 4B83A 1YVPA 4X66B 2N46A 4G1BA 1V8DA 1Z34A 2ZJ4A 2HX1A 2FMKA 1W9MA 2EKPA 2I9PA 3PC4A 2DWQA 2EKZA 2H17A 1IHOA 4R2MA 5HF8A 3ZY2A 1GG2A 3BHJA 4FC6A 3V1TC 4A6DA 3C2QA 3NH6A 4XEHA 5IFLA 3U60B 4KRYA 4IHJF 4E13A 1ACLA 4MUIA 1LX6A 3BWBA 5BW4A 2QB5A 4F92B 4NHOA 4FP9A 4AJ2A 5JEDA 3WAJA 1ZXBA 1QS0A 2IIQA 2J31A 3IBCA 2YYYA 2C54A 5LN1A 4M7RA 4H0FA 2V7EA 4Z3OA 2HK8A 3OEHA 1FU4A 2CNLA 3AKDA 1MV8A 2AX4A 2Q3DA 3DAHA 2RK6A 4WY5A 5CA1F 3NP7A 3ZJUA 1SRRA 3B13B 4KLCA 5JNLA 4F97A 3DE4X 2JFPA 5CIWA 3CLRC 2VAMA 4BNMA 1IQRA 3SLKA 3LVQE 4FMBB 2DX7A 3FKSA 3W0LB 4OJMX 2ECOA 1WE2A 3HABA 2J3IA 1PGJA 4WLOA 1EINA 2CXRA 3H6GA 4ZIRB 3BILA 2A1IA 4R01A 3RV4A 3WHIA 3CLTD 2QVZX 4I46A 2B4YA 3VDXA 5BMVA 3UT6A 5FEUA 1R4NB 3NIWA 4TN1A 5K5EA 1Y1LA 2VPPA 4DB2A 1JDSA 3G8BA 3JQ8B 3VYTB 3SC6A 4HF7A 2XAAA 3VQTA 1JWBB 4H27A 4MV8A 5ERGB 3OPYA 4XJTA 3T7RA 3FHJA 3NAGA 1F0PA 3KOYA 4J03A 3AERA 3KIPA 4YS6A 1WB5A 4EYEA 5IDYA 2ILTA 5SZHB 1MJFA 2FZKA 4FPXA 1PW5A 2QV7A 4INOA 1R27A 3IP7A 2C95A 3WWCA 3VMMA 3A4VA 2NO9A 3EDMA 3EXIB 3UT5B 1QQBA 3HI6A 1MP0A 4N12A 1CS0B 4NJOA 1JMKC 4C06A 4PLZA 1WG8A 3F4BA 1YK0A 1EVQA 1JHMA 1OT5A 4JELA 1JAZA 2GERA 5KKCA 4BQFA 3I9KA 3WGJA 3QWIA 1QG4A 3DTVA 5LZ5A 2JA2A 5CNJA 3EVNA 3OM8A 1VLZA 4AS2A 2Z58A 2ZE5A 1WCV1 2VZ9A 3RIXA 1FQOA 4FOLA 1ZH2A 4BV2A 3PE6A 3A10A 4OP1A 3SVLA 2W2MA 3S2GA 3CRQA 1JYEA 2GPNA 4DQ0A 3LX5A 4RY9A 3ZGNA 2F3UA 2QRUA 3KQOA 3PYMA 2Z3WA 3KYBA 4ZZ2A 3HXQA 3F3KA 1RDFA 1XSEA 3W3ZB 1OPXA 2GN8A 4MULA 4QDJA 3V8BA 4P0PB 1Q7CA 3O2SB 1NF3A 3ESYA 1SKUA 3EVZA 4YHBA 1J8VA 3JQAD 3FYDA 2ORYA 5G4LA 5BR7A 4TWRA 3GZNB 3X1KA 4ZO6A 3R76A 1L9KA 1Q0UA 2F7SA 3LFHA 3UHPA 4OQDA 4DJEC 2FZLA 2WQZA 4ZMRA 5I4IA 2H1RA 4ZI7B 4FTWA 3KB2A 3GEEA 3KVVA 3OE7D 1XZEA 2DHCA 2C59A 3TUIC 3NKLA 1LQ2A 4OKIA 2VO1A 3K0FA 1E1NA 3OP1A 3Q3VA 4L95C 3P9RA 1ADGA 3TR6A 5B6PA 1N2XA 4DRXA 3GGCA 3PHHA 3PL5A 4U7HA 1QCYA 4BB0A 1XZGA 4LI0A 4RK5A 3FPEA 2NX2A 1Y98A 3O38A 4RKYA 4V0NA 3SZLA 5AW6A 1U8YA 3SEZA 3QLJA 4UAJA 2EF1A 1H8ED 1QWSA 4QGFA 4F8JA 2PZAA 2HK9A 4FYMA 4KQEA 4MV5A 1GTL1 1JA0A 1UJ2A 3A4LA 1RZ3A 5EUMA 2QIOA 1U02A 4RSMA 5FLEX 1HGXA 2JAHA 2O59A 3U9TA 4D79A 1SPBS 2VR1A 2WVAA 4BNDA 2R0QC 1E32A 4TYPA 4MUMA 4N8SA 1RAGA 2HMSA 4B2LA 4ENPA 1ESZA 1F9AA 4MKFA 1NM5C 2B20A 4OHVA 4ENUA 1QOZA 5T4HA 1NUPA 3H75A 3LL7A 4RIFA 1DC5A 4BWYA 1S4MA 4D6PA 2C07A 1UOEA 2HF9A 4BZPA 3NO4A 1F5NA 4YJFB 4H1WA 1P0QA 2QTNA 5C7IO 2FFJA 3L06A 4JQSA 4L9AA 4RF3A 5E8RA 3WTCA 1N6NA 3B3FA 1NLUA 3ANMA 4R9VA 1DOHA 1D0VA 4I36A 4LE2A 4LMBA 4RSGA 1NP3A 1UK7A 3GAZA 3N6VA 1OTHA 3QRWA 3GZ4A 1JQ5A 4UD2A 4ZV4A 3BK1A 2HR1A 2LCIA 3EZLA 3ROQA 1Q3TA 1AH2A 2YXLA 4NP6A 1EWYA 4TTVA 1MQSA 1SVOA 1EGMB 1C80A 2J3EA 1QRAA 3ZV6A 5KTTA 3QUCA 4UM5A 1IYZA 1L5FA 1F0YA 1IOLA 1V45E 1T1RA 3NGMA 5A6SB 5F52A 2Q3MA 2XZTA 8OHMA 1XA3A 2PVPA 3W5HA 3TL2A 5CH3A 1TO2E 3A1VA 2HQOA 5H5JA 2AG8A 3AG6A 4MO2A 5DHTA 1R9MA 1FX0A 4ETIA 2BH9A 3O1JC 4O2AB 1WO8A 1HEIA 3FZYA 5LP6F 2VG8A 5H80A 4BJ3A 1J06A 3H2BA 5FOQA 1JLRA 4NMLA 5FTMA 1EU1A 4OHXA 3ZI0A 4EKIA 421PA 3HDYA 1VGQA 3HDHA 1JH8A 3RHTA 2JJ2A 4C0WA 4K9QA 3UUWA 3I9NA 3BCHA 1TF2A 2BLNA 3EHDA 3FI0A 3KTFA 3RFFA 1XZLA 1RFLA 5JSHA 1HZJA 4P0QB 2I4TA 3R7SA 1YVDA 1OIXA 2COEA 2I6QA 1FJXA 3LVFO 1N33B 5CYGA 4LZLA 4U4AA 5A06A 3BICA 4S1TA 2Z98A 2VAXA 5BNZA 2H54A 4ILKA 1JS1X 2A14A 4Q9KA 4HRAA 4XGRA 2O2CA 3KEMA 2HJGA 4M8SA 1KNXA 4BWFB 5HWSA 4UEQA 5GOZA 2Q0XA 3E9EA 1UMDB 5LD2C 2I2XB 4RIGA 2PUDA 1AXGA 2FX2A 5DM60 1Z4NA 3OQ6A 4BIIA 3F6YA 2R7AA 3WSVA 3R7FA 3KHSA 1PR9A 1EEXB 1GTG1 3U40A 1J8FA 2VJMB 4DPMA 2XUFA 1NVTA 1OFUX 1KY5A 4IDAA 1NF9A 3A11A 2RHCA 4IGIA 2YFHA 2B1GA 3IP1A 1DC8A 3HVKA 4EHNA 3DFMA 2HHAA 4MWSA 3WX0A 1GNTA 1L8XA 2DECA 1EXWA 5CB8A 4K8OA 1R0YA 2VTBB 3W4KA 3NM6B 3WC4A 1BX3A 5JNTA 3G2MA 2W43A 3CO5A 4C6SA 3ELDA 3HU2A 4CM3A 2Q5JA 1ULZA 3QSGA 8GPBA 4LSMA 4GX1A 2CJPA 3QE9Y 3UFXB 4D9GA 4BZXA 2C7OA 1UPCA 4X61A 2IHNA 3TEFA 4XYEA 1ZVKA 3DR5A 3FBGA 1Z6GA 3WS7A 5BUCA 2D4AA 1OYOA 4JLNA 4WEQA 5DNDA 2Q6TA 3SEAA 4EHHA 4UNRA 3M3HA 2GN9A 4AP6A 1LEHA 4MDEA 4QXOA 3TBFA 3IGFA 4WNAA 4DLRA 5KU7A 4UW9A 5AW5A 5F21A 4NBWA 1I1OA 2OXFA 1FK8A 3C3AA 3O4VA 1AZSC 2P77A 3OEHD 4QNMA 1JJBA 4TQAA 3RS0A 4B7ZA 1VHLA 2J0SA 4E5NA 3I01A 4HRYA 4IKPA 2WSMA 1FVOA 2NVWA 1NF2A 1IM2A 3AW8A 2NVUB 4HQRA 3FKSD 1V6AA 4M1MA 3U7RA 2GX6A 1P0MA 1ID1A 4HPXB 4RHTA 1GPAA 2LCQA 3BH7A 1J99A 5JY6A 2VA8A 1DKNA 3U7QB 3WRYC 2JAOA 2QTHA 3ZVKA 2JLVA 1UC8A 2JW5A 3I45A 2YVQA 4BV9A 4NATA 1G8KA 2Q4EA 3NB0A 2DFTA 4ENQA 1Y9AA 1VLHA 3ZDCA 4GD3Q 1VFNA 2O8VA 4XQEA 3V1YA 1HE3A 2OT3B 3AFHA 1MG5A 3GJ3A 3A9RA 4RLSA 3TLCA 1OH5A 3PICA 1C30B 2OAP1 1K9SA 4MRNA 5KOJA 3WLOA 5J2TB 4M55A 4DL9A 2HTEA 3A2NA 3H19A 3OURA 1GFIA 1N6RA 1L6RA 3LFUA 4EATA 4DMUB 1U3GA 3N2ZB 2WWXA 3M6VA 3QUSA 3GLSA 4YNBA 2E0IA 1T3SA 3GWGA 2OMEA 3VKFA 4HDNB 1NW3A 4HK4A 4KIFA 3H84A 1JEQB 1EZ1A 3ZW9A 2YC4C 3MWYW 4E3WA 4OU4A 4UBIA 3JTMA 2ZS7A 3TTTA 2AC4A 2NYRA 3DSRA 5BMVF 4LF4B 1F2DA 3DTVD 2G5TA 2V8BA 3N59A 4NE9A 3L8ZA 3LBAA 1YSCA 1T34A 2MDTA 3O31A 3M4NA 1NQVA 2DWOA 4MJ7A 2P8JA 1NPDA 3EXG2 2ENUA 3FFXA 3OHMA 5ALPA 3OA2A 4BNVA 3TIIA 2YIJA 1ARZA 1PYOA 1QDUA 1X80A 4IXDA 5K4GA 2CJWB 1EJ0A 4BCCA 4BQNA 1FNNA 2OG2A 3A27A 5K8TA 1YI8A 4IIHA 1CEEA 5DEIA 1LLUA 3O8NA 4KXYA 4A8JB 4HDMA 4CMAA 1XZKA 1KDVA 1U0SY 4RPKA 1EGAA 4PO9A 5CYFA 3K09A 4EVIA 1AK2A 4P34A 3DYVA 1JDBC 2QHXA 1PK9A 3I04A 1DJNA 3GFTA 2Q9CA 2JFNA 5EIHA 4UPDA 4OSOA 5K03A 3R3HA 2W6PA 3PT5A 2VH1A 4ZQBA 1F2UA 1GNSA 3WYFA 1W34A 1YR1A 4Y2VA 2GCGA 4EA7A 1JFVA 2UU9B 2WTAA 4J6EA 1VYTA 3IDOA 4QGBA 1E2HA 2QMEA 1VJ0A 2DU8A 3WBKA 3GFSA 4ZALA 2YZ2A 1QMPA 3C3DA 4YHHB 2X6TA 3DDSA 3BZWA 2QRJA 3DD1A 3PXDA 2DTEA 3AF6A 4FNGA 3P9YA 5KOYA 1PJ3A 1H3FA 3K0CC 4MA4A 1JR3A 2JGEA 4NZYA 2G9QA 3TG8A 4IGKA 4RTQA 2CXXA 4JQYA 3BMQA 4MQLA 2XECA 4GMGA 1GAWA 1O9BA 2FDRA 2L42A 1FLDA 3G2HA 4U7GA 4Y2RA 4ZQHA 1A88A 3DCYA 3BE5A 3V8PA 1EVIA 1KP2A 3RYCA 4OHBA 1DKQA 1NVAA 6ADHA 1NVEA 2R48A 4BJHB 1E61A 1JLHA 3EG5A 2C8JA 2JGMA 3RVOA 3T0FA 3R6WA 2I3DA 2O19A 1G5FA 4JLBA 2GYVA 4XUCA 3FUCA 3G2IA 1TECE 5K3OA 4XI9A 2NT3A 2I1WA 4AZSA 2CHEA 3DKKA 2PNJA 2I6SA 1THZA 3MJTA 1C81A 4Z3DA 5HRAA 2XBUA 3HB7A 3C6ZA 3EASA 4F4IA 3MRVA 2DSNA 5DM70 4G5SA 4EF4A 3U31A 2WINI 2WFLA 3K30A 1JHVA 4I4TB 3VO8A 3RV3A 2AFIA 1D6JA 3K6KA 5E1DA 1EX1A 3I4FA 2RGEA 1ZIOA 2FG7C 5KDLA 2BKXA 3D54D 4BGUA 4BZQA 3ICPA 1VJRA 3KXKA 3KSAC 2FUEA 2A4KA 2YN4A 1NR5A 2ZS8A 1ZGJA 1I5EA 1U9JA 4NBSA 1O4WA 1K6XA 1XWWA 4WGFA 2P41A 1E8DA 1T3LA 3LXMA 3OEEA 1G6HA 1MUUA 4PPFA 4UHCA 5I9TA 4R8KA 2AC7A 5T67A 3UAXA 3UMBA 3GLFA 2IUEA 1CYEA 4ND3A 1H05A 2X1LA 1X74A 3WDSA 1UQRA 1UXIA 1ISSA 3F9RA 3FOAA 5CYPA 1OXTA 1CRWG 5CNMA 1PWZA 5DCUA 3R8FA 4K2HA 5EWMB 1SUSA 1DAOA 1OFVA 3QIAA 4AD8A 4F5ZA 4M60A 4RXTA 3UJ6A 1MBZA 2YQ5A 1NNLA 2JJ2D 2FFBA 5EIEA 2C3YA 1ZM9A 3ETJA 1N1GA 2B8TA 3BZBA 4ER6A 5EPUA 4KPUB 4Q1CA 2Q4DA 4M1WA 1SQFA 2X7JA 1T25A 2H7CA 4M49A 4PAWA 3SQNA 3TRHA 2XUQA 2ZAOA 2A1UB 3EGXB 3OF3A 4LQLA 1QAQA 2Q4RA 2W2QA 3MK31 2QS9A 3BC1A 3L6CA 3D8UA 3D0RA 5LBUA 4PNEA 4IW3B 4DEYA 5B3JA 4O2AF 2ZRIA 3E9YA 2M2IA 3U4HA 2LE0A 4DJTA 1O6BA 1W8DA 2WC1A 4UNIA 4NYIQ 1UH5A 2JIDA 4M1SA 1MNAA 5EERA 1ISIA 1X8JA 3OSZA 4IXTA 2JIRA 1APBA 4M0UA 1OI2A 3NBYC 1JIIA 4HGQA 5AKKA 3W2HA 1XRMA 2IDZA 3FVTA 2PJZA 1WUIS 4YQFA 1GCAA 3GCWA 1ZJZA 3K8OE 1HQDA 4KE9A 1RYFA 4PO3X 5LR6A 4LX8A 3A3KA 4MVXA 3G8AA 3DYIA 2B2XA 2ZJBA 1E77A 3FA2A 2DGDA 4G85A 2IIBA 1M1XB 1VM6A 2AD1A 2O0HA 3GDGA 4EFDA 4L4ZA 1EDOA 4DLBA 1XMVA 1M3SA 1Z3CA 3K0EA 4EHLA 1U2DA 1YUBA 1FJHA 1X7DA 2ADFA 3I83A 3VUEA 4C4ZA 4M1YA 3BFXA 5DIFA 1CUWA 3ITNA 3ZG6A 3U09A 2IBSA 3BTUA 2QJTA 2OYCA 5KKNB 2ZPTX 1PVOA 3VKHA 1QJCA 2DERA 3JQ6A 1IDN1 3CSSA 3ETGA 1T6XA 3BF8A 3FROA 4LE1A 4ZQGA 4NABA 1CJTC 1N3BA 2GEJA 2XUPA 2Q3FA 1GDHA 5A03A 1V8FA 1E8MA 4MV1A 1KYIA 3OJ0A 1G6Q1 3VR6D 3TFOA 3O90A 2HNAA 4YJDA 3BL6A 3QFSA 5BOVA 1H0RA 4B7CA 4EUNA 3CH4B 2DQKA 4OQLA 3TD6A 4RABA 3D8HA 4NCHA 2HMTA 4NRDA 1JNYA 4ARVA 4TTPA 2Z43A 3HXMA 2Q8NA 1OU0A 5ESWA 2O48X 2GAOA 2QLTA 5ED0A 3WGZA 1UMKA 4ASUA 3MZ0A 3FW1A 1YJXA 4HGPA 4L76A 5A7FA 4P4SA 1LK5A 3SF8B 2MSNA 3AVOA 1AG9A 1DWOA 1FDSA 5AKEA 1HM5A 5ILOA 1YL6A 5BQXA 4QU9A 1LSOA 2IX3A 2ZT6A 2ZBEA 1ABBA 4AW9A 2K6GA 5GMOA 4G8DA 3HP7A 3DEJA 2AQKA 2PFKA 1GOTA 1ECBA 1YA4A 5CLLA 2IUTA 2OGWA 3ETDA 3BXZA 1V47A 3RC8A 1I7QB 2FDCA 4ARAA 2CB9A 1F2TB 1OLUA 1Z6AA 1TKBA 3FKJA 1R8YA 5EIXA 3ZJ5A 1E9BA 4ND7A 1XGKA 3CW9A 2B37A 4PFKA 2UYYA 1QR2A 4REQA 2DWCA 1B26A 5E38A 4LHYA 5LYJA 1CRQA 3IDAA 3WLSA 1XPRA 3AHJA 3I39X 5K9ZA 4R2XA 2JAWA 2QQ5A 4XTCS 4Y2XA 1ORDA 4FFNA 1JFFA 5CLGA 3DFFA 5CTAA 1OILA 2X5XA 2X23A 3ODPA 3RBVA 2XR1A 2EX0A 1ZD5A 5DEOA 4B3IA 5C52B 3DLBA 3DO8A 2XB4A 5TVGA 1CY0A 1JALA 1PJ4A 2JAUA 3T99A 1BVHA 4AF8A 4YMHA 4NC9A 3AL3A 1UQTA 1RAEA 2B34A 1HORA 4N9WA 5DGIA 1M2EA 5JBIA 5L40A 1IBKB 3LUDA 1Q7EA 4P31A 1L7VC 3C8HA 4P4NA 3KXIA 4Q4AB 4ZC1A 3FNBA 5F1KA 1WM1A 3INRA 2GFQA 2PA0A 3LK6A 2LR0A 4RTOA 2CHFA 2XUGA 1O08A 1G64A 3QA3E 4R2JA 4U5QA 2O7RA 1D2AA 1BN6A 2JLQA 4MRMA 3KAKA 3BAFA 1M7GA 2FEMA 3D43A 4HVAA 3LOPA 3LUAA 3C0KA 4BDSA 1T5LA 4PFJA 3T3GA 2IYPA 3OD1A 4W1QA 2Q3LA 3FF1A 4FFRA 1HXHA 4REOA 1NLZA 1Z9BA 3FN4A 2HN9A 4B6RA 3THWB 3COSA 1FFWA 3H97A 2NACA 3Q8XB 3S2FA 3WY9A 1M2VB 3DBLB 4ISCA 1DL5A 4BO8A 4FFMA 2VDRB 2QUAA 1E7YA 4OK6A 3GPBA 4P80A 1TPZA 1KU6A 2X86A 3SIXA 1JR3D 1L5WA 3FWPA 4E5VA 3W1EA 4JGIA 4FYYA 3GRAA 1HT0A 3PGXA 1JPUA 1M9NA 2XXBA 2YOFA 2FEWB 1MF7A 3UC9A 1UM8A 3QFFA 4MQ5A 3MNFA 4Q7LA 2I9KA 2QW8A 1WDTA 2B82A 3K31A 2IH2A 1P3Y1 3AF1A 3MUEA 2FETA 3E82A 3R44A 1AZLA 1QNLA 4YBZA 3CLTC 4GWKA 1C9MA 3L92A 4N6NA 1LQTA 4LRWA 3GC6A 2GK7A 1RLJA 2CJYA 1NNEA 4RIEA 3G0HA 1FQWA 1VCOA 2O3TA 4LZOA 2HA4A 2CXQA 4F5DA 4MAAA 4P3YA 3SJAA 1KYYA 4ZVKA 1JDPA 4E4TA 1PZHA 5I6DA 4RIHA 3DV9A 1WCIA 4J3JA 1LPMA 5BT9A 1J22A 3K1AB 4TOIA 3P9CA 3I5UA 4WCFA 3PNQA 2REOA 4G3XA 3HJGA 3DTNA 2RK3A 1NQXA 4B31A 5HPYB 1VBNA 2FX3A 2QTBA 5IC4A 1U7WA 1PZGA 4ZEOA 2R1ZA 1E99A 3HU5A 1U8AA 1M34B 4LRYA 3SC4A 1DIGA 4J9UE 2YX1A 4Y1FA 4AG6A 1R8QA 1A2QA 4YV2A 1EWRA 4FHGA 1RLMA 4D96A 2P78A 2GCEA 3OEED 5D1NA 3VZRA 4P4TA 1OIWA 4NV0A 4HQ6A 3KQYA 3HRHA 1PDVA 1AXEA 2XKBA 3AOGA 4HNVA 5IM4F 3UG6A 4BMCA 4NENA 1A8PA 1HV8A 5FBHA 3SX0A 4G4SP 3LWNA 2BJVA 4I4TF 4DLLA 1XPOA 3QFRA 1TLTA 4YQZA 5HF9A 1HYQA 4YJGA 1AVTA 4DVJA 4NZOA 3NVAA 1Y1SA 1RKXA 5IC5A 2QY6A 3GLHB 1J8QA 5B1EA 1VB5A 2GBFA 4IP0A 1VPLA 1KC1A 3CZPA 1GQ2A 2FWMX 1EWKA 2AFRA 5E0OA 1N0HA 1VYVA 2IKSA 2KJQA 1WD5A 5BP7A 1UDBA 1VMAA 3GEGA 1YWGO 3BFVA 3U9SA 3DQQA 4WZBA 4I14A 1OWOA 2JCVA 4MJLA 2E5LB 2FU5C 3C1TA 2YKGA 2GM9A 5E3HA 2P3LA 3NGLA 2SKDA 1DKRA 3FYSA 3O83A 3S40A 1AV7A 3SHVA 2XDQA 3DE0X 4HAXA 4PHTA 3NIDB 2WJIA 4ECAA 5BW8A 2G5CA 2OE2A 2VWPA 1MTZA 3AEUA 3SBDA 4MWDA 1R0LA 1XU4A 3B52X 3FUUA 4CKBA 5FV4A 4ZCQA 1GSHA 1NN1A 2ATEA 3UWSA 4LBWA 1PK8A 4X1YB 1L7PA 1OA1A 2OVFA 4MGYR 2PKRA 1T8SA 2DXIA 4QC2A 1DZ3A 4DSTA 4WIAA 4B80A 3NDPA 2QRHA 1T6YA 1EM8A 2PSSA 1SBQA 5CB0A 3RRJA 3I30X 2O06A 2Q5HA 5HCUA 2NU7B 3QV1A 5EMMA 4BKMA 2XJ4A 4RTKA 4NEGA 4IZOA 4E6EA 3TUZC 4FSHA 1U2TA 4V1CA 2BKUA 4KQ2A 4FFDA 4ZCRA 2JIZA 5K0CA 3GQBA 1E3IA 1U2GA 3GXOA 3KFXA 2A0WA 4KIUA 2Q07A 1QVWA 2YW2A 4FLMA 1CIJA 4WA8A 2VI5A 3DP9A 4L02A 1MB3A 5CGQB 3VZDA 3FRIA 2NXCA 3VC1A 5ABPA 4LMAA 4BRUA 3TGPA 4KDRA 2J9RA 2PEYA 2YIVX 2GJKA 1Z6ZA 3QHAA 5FORA 4RJLA 4IIGA 2PU5A 4FGZA 4HJXA 4CL0A 2ID8A 4FWIB 3LY7A 4WTOA 4PX3A 5IW8A 4BXOB 5KYGA 2HXSA 4PRKA 1GR1A 1UFOA 1PCXA 1M10A 1CJUC 1U0FA 4KK4A 3I37X 4PICA 1GNVA 2EYUA 2D59A 1KMHA 2EC5A 1YULA 2NVBA 3KQQA 1CQJA 4NESA 3VO2A 1FNSA 2EFDB 4ASUD 5LQKA 4HEA6 4YDQA 5FOUA 4IWXA 4D02A 3CUKA 2E4ZA 1Y4DE 2FSFA 3AWIA 4D0LB 2I4IA 5DYIA 3TSYA 3VYRB 1QANA 3QU9A 3JQPA 1LX7A 3L8DA 5BYAA 1FNDA 2FEPA 2QAIA 1NAHA 3CLUC 2C2KA 4J91A 3VR5H 3MJDA 2FUG6 1RWPA 4DV6B 3C3PA 2JHFA 1E9EA 2ZIFA 1T2DA 2X76A 1XU9A 4TV8A 2B6HA 4N0EA 2QA5A 4C1BA 1L4YA 1RKVA 3TM4A 2GEVA 3WGVA 4DC9A 1L3BA 1QE5A 3KPVA 4UULA 4MPJA 2OTCA 1JZQA 2HSEA 1DQPA 2CVZA 5H3LA 4K3VA 3ZKAA 5CFLA 3BEDA 1JLLB 5LBIA 3GN1A 1J56A 2H4XA 1CY7A 5DOVA 1JI0A 3NJRA 4O4JF 3R6GA 2GM4A 1NPYA 3KV1A 1IXZA 1QIDA 2Q2QA 3ZZMA 1AK1A 1Z6PA 3E0QA 5CM9C 3KSMA 1JG6A 2QX8A 1HF3A 3SOZA 1A7KA 3LHSA 2NQ8A 1SC9A 3H04A 3PA6A 3B5IA 3UUEA 1GIAA 1KO4A 3U7GA 1X1DA 3IOEA 3TOXA 3IT1A 3PNPA 1PQUA 2CYAA 4ONEA 3RSSA 4AU1A 5B64A 5IH7A 1Y6QA 1HE4A 1TM4E 1USIA 3KJFA 4KWHA 4OXXA 4F4FA 1EDBA 1PEKE 2A88A 4WZAA 1DO0A 5AHKA 1QIJA 3EXHA 1CUAA 3V9PA 1E9RA 5BWOA 1RTTA 2A3RA 1WF6A 3RC1A 1NAIA 1NDQA 3WA7A 1J2TA 1RWXA 3L04A 2C83A 4JV5B 4RLFA 1Y3DE 4TLEA 2XWSA 1DG1G 3RRFA 4RLQA 4BCBA 4YMVA 1O6GA 2YWCA 4NSNA 1ZIYA 1OH8A 1KY4A 1GCGA 1U2ZA 4LSGA 4OFBA 3UGQA 2R3SA 3LLSA 4E4RA 4AQ7A 3KAQA 4X6LA 4E22A 2V7VA 4KPEC 1SXJB 2VSQA 3TXYA 4LQ4A 3S6JA 4K9KA 4DHWA 3R9XA 4WZAE 2Z1NA 1L7AA 5F3WB 3OT1A 1T5DX 2D7CA 3FMVA 3E1KA 1JXAA 3VGPA 1VPWA 3GR6A 4U2GA 3KNZA 4MHSA 4DR3B 3IOBA 5JNUA 2VTDA 2WP0A 1YIAA 3FFWA 2OCGA 3BMNB 3LUGA 3LT4A 3VXKA 4YXWA 2K2QB 2JLSA 4KUEA 1SUDA 4A0QA 2HF7A 3RYFA 2IP1A 4ALKA 1HNZB 1R0WA 1XNGA 1EG7A 2IOYA 3N8DA 2JGIA 3ANNA 3HQ4O 4Q9HA 4X3PA 2J3JA 4RQUA 4DIKA 4NKRA 5C7OO 4IOKA 4C4SA 3AR2A 3ZQ6A 4Z53A 3FIUA 3A32A 1XFAA 4KOAA 1KK1A 5DBEX 4LZWA 2TRSB 3CW8X 4GGPA 4M1TA 4B7XA 4UBNA 4OHUA 4KJXA 5A3JA 3BX1A 1WQ4A 4J1NA 4TLAA 4GS5A 4OGKA 1KFBB 4TQGA 5HHTA 5LQCA 2HA3A 1NONA 3HCAA 4FXOA 3R9KA 3K53A 2NSYA 3L7YA 5HKLA 3VSDA 3IUMA 1LRJA 2GN1A 5ELLA 3TTYA 3JALB 4J0QA 1EVYA 4MWCA 2QUKA 3ASVA 1FY2A 2X42A 1M8KA 2PLAA 1I4OA 2ZYRA 3JRWA 3C4JA 4MDYA 4NZ9A 5EGNA 5JO9A 3BE4A 3RG2A 2QXUA 5JFOA 4B71A 2HLNA 3QJGA 3CPEA 4BWVA 1ZH4A 4N6OA 4HEJA 5AI4A 1YZUA 2YRXA 3ITKA 3F46A 3JX9A 3CBQA 4N0PA 4H7FA 5CVVA 1VB3A 3L1IA 4DNQA 5KNDA 2DQ4A 3VUFA 1XN4A 1YB2A 1WHSB 4NOJA 5ES3A 2Z9CA 1JV2B 1R8SA 2YYSA 3NV7A 3OY7A 1QYWA 3NTUA 5COAA 5JJ5A 1PK7A 2A0XA 2ZJ0A 1EZZA 5TR9A 1CQIA 3MERA 1JG3A 3GAFA 4TPKA 2RBEA 1XALA 2FHPA 1A97A 5AKZA 4L0QA 3G2QA 4HN4B 3RO7A 3DFIA 3AV0B 5TPZD 4LZZA 3RF7A 1ZAYA 1NULA 3EGDB 2AE1A 3TTVA 3UICA 5M29A 2F3TA 5AW3A 3HEMA 2OAQ1 4CFYA 4R2IA 3T3EA 5H9WA 3E05A 2Q28A 3DR3A 4KACA 2XXAA 2AHOA 2QL5A 4COOA 4H6WA 4YYZA 1K7EB 2EKDA 1WMSA 4DNXA 5KIAA 4I7EA 5DPMA 4OYYA 4R68A 1P1HA 4FZ3A 1QE3A 3HBJA 4EUEA 4DY4A 4ZFNA 3QELA 1X9HA 1BEEA 2WICA 9LDBA 1HDOA 4DUYB 3I1JA 4JYZA 2P91A 3BMCB 3D8SA 2BEWA 3FSJX 4QQNA 4MR9B 2MCFA 4P3PA 1EUQA 4LF7B 1U0EA 5TEWA 2DEUA 1NUUA 1ODFA 1SCAA 1NI4B 4PC7A 4RA6B 2VYVA 4X20A 4DNPA 4PAQA 4QVIA 3QFCA 4OX9Y 4D9KA 4HRVA 4HVLA 2G83A 4HXEB 2YDXA 3L9XA 5U4QA 5EL0A 2QRZA 3CEJA 4FJ2A 3SYKA 3THXB 2J9ZB 3E53A 2OD2A 3FVQA 4I6EA 4MKZA 2BRUA 5AOAA 4DQKA 2LIPA 3D7SA 2I7VA 1Z37A 4ME6A 4M6WA 2O8FA 4XCQA 5EHIA 1LBTA 5DHQA 4UHJA 1GG9A 1U99A 1CZUA 4A23A 1D5WA 3OLWA 1BA2A 3PGA1 5EJ8A 1R7RA 1JG7A 2JIZD 4QAJA 4RD0A 4AMGA 1NYLA 1SEPA 5ITZA 4TYNA 3MUOA 3PDIA 1HYBA 4L51A 3BT7A 1SIBE 1G2OA 3NHUA 3EGIA 3NKFA 4G9EA 2V6BA 2B7BA 2YXBA 1KEEB 4E33A 2Y71A 2ZXEA 2C98A 3L6RA 3BORA 4BLUA 4FJ1A 3I5YA 3VPSA 2CDAA 3LE8A 3D6HA 1M1YB 4IJ5A 4R9SA 3T9CA 4AKSA 5A62A 2XNSA 5C8YB 1EP1B 2HHCA 2JLRA 1GXSA 5F12A 3O7MA 3ETLA 4WT7A 3AB3A 3Q3IA 3M6LA 3QLUC 3IH5A 4NF2A 1T43A 1INLA 5E9JA 1K0FA 3NYQA 4N7JA 3E4DA 1TM5E 2N0SA 4JI6B 5J5VA 2M6SA 4H59A 4R54A 1U0OC 2D5BA 3R7AA 4UQOA 2FSVA 2GNPA 2GRJA 2H65A 2JVIA 1H2BA 2YFQA 2QD5A 3FUTA 5BQOA 2V6JA 1N78A 3ID6C 4MUHA 3L84A 4TXHA 4AYTA 1WUTA 3JZFA 5KTSA 5LOVB 3DVSX 4LWQA 1SNYA 1DC3A 4UM8B 4N3NA 3UMGA 3QKSA 5KREA 5G0SA 1HDXA 3SSMA 1AUOA 3PWZA 1R9GA 4OUDB 1E6KA 1SBCA 4Q4HB 2J6IA 1DXHA 4G23A 3B1WA 4IQGA 2JEOA 3L6BA 3JATA 3JV7A 3R75A 3PQCA 1JEDA 1NKSA 3DA8A 2KQUA 4Y8VA 2FJ0A 1D2CA 1G9TA 3AJ8A 3O2NA 5E6RA 1P0IA 4HQFA 3B6EA 3KR1A 2PANA 4RPIA 5KINB 4I50B 3I2HA 4MRVA 4W7SA 2OXRA 2Q3CA 2H2WA 4KV9A 1BXKA 3OX4A 3TAXA 1YUMA 1JXOA 3AOEA 2A1TS 3WNZA 5F64A 1PL7A 4YCDA 3IX7A 3T9BA 2J0UB 1L5RA 1JE0A 3I9LA 4XLTA 3WKDA 1DC7A 3TOSA 4M7WA 2QPAA 1ZUNA 2XWQA 2D1SA 3GZTB 1AURA 3OICA 3ZYZA 5DOZA 4BVBA 5ALHA 4TZ0A 2FPKA 4JI5B 5E7IA 4FBGA 1GZ5A 1LNZA 4IGAA 2XGOA 4JHLA 1THTA 4DQUA 1GUYA 3BF7A 1AS0A 2QMHA 4IDDA 3KEGA 4X60A 5SV2A 5I9LA 3THSA 2GI4A 4IMIB 3S28A 2F1HA 4PSUA 4AJ9A 5BURA 3A31A 4DR7B 1Z08A 3I5XA 1W19A 2Z6QA 4MMXB 2EZ8A 4QOEA 3GBPA 4L75A 3TNLA 4KODA 1E1CB 1EWQA 4LTDA 1MX1A 3C4QA 3F5SA 1VPEA 3PQEA 4KLRA 1DAEA 2OO5A 3GJ8A 2YWEA 4TTIA 3LWDA 2FA9A 3DBRB 4RPCA 2QTFA 1AKVA 1ZYUA 3Q5DA 3DE6X 4XJXA 2IZ7A 4ER0A 5L3SA 2X0KA 3SFTA 2PVSA 4B82A 5E3JA 1QGUA 3M1LA 2P40A 4MAMA 3A4NA 3O74A 1Z12A 4TS1A 1E60A 1RHKA 3NM4A 1PW7A 3VNUA 3H17A 1QG2A 2QMZA 1MOQA 2NZYA 2IPNA 1RI3A 1WKBA 1FLNA 5EIFA 3OTWA 2OCIA 3E18A 1Z5PA 4EA8A 1EHYA 2EGGA 4FB5A 2P6OA 5BRNA 1YL5A 2V6GA 4MVCA 3UHOA 5EPEA 2AOTA 3COJA 1E6LA 2ONCA 4IJUA 4AY5A 3O4JA 3NJ4A 5JAQA 3D5TA 4QTXA 2D2FA 4BO9A 3VR4H 2HEIA 1GKIA 3LKZA 3VZCA 3JS5A 1PNQA 1OLXB 2JK0A 4KG7A 4ZEVA 4HC4A 4U7JA 3MF4A 4M0LA 4LZJA 3FOFC 1JIVA 1YI0A 2EJCA 2WD7B 1KMNA 4JJ8A 3OUTA 3INNA 2OBXA 2OFFA 4NAHA 2ZETA 4DPKA 4YACA 4M9CA 3SQXA 1ECJA 2YH2A 4KBGA 3QTLA 2PAFA 4HXGA 3VX4A 1TM2A 2DPLA 2BFBA 4FGKA 5AJZA 2IRWA 2ADMA 2CHQA 1QRTA 1B0ZA 4QODA 1CKEA 2ZB8A 3DULA 4BO7A 2C4MA 3KQVA 3F97A 5JDIC 3FYUA 3R41A 1URPA 3Q12A 3L1HA 1QKJA 4NCXA 3UJPA 4ZV9A 3WSWA 3IERA 2O52A 1QYIA 2OP0A 5DBHX 5ITSA 1F60A 3OMWA 5AJTA 1W4ZA 1H65A 2C31A 2FPPA 2Z6VA 1IC6A 3BJMA 2CDBA 3K8ZA 4UZFA 1R4AA 4HAWA 4YCMA 5ELXA 2GTIA 3ECCA 5KNDD 2YXNA 4E5YA 2CDCA 1WD7A 3BWVA 1CJKC 1KNQA 3HUUA 1AZTA 3U80A 1Z4PX 3E8MA 3CEAA 1XE3A 1OJ7A 1U6IA 1VE6A 3IA7A 3OOYA 4EFNA 2BI4A 3PHCA 2DR3A 4DLAA 1G8MA 2PQMA 5JNRA 3OCCA 4O4LA 2QTAA 4PLYA 2OCKA 1Y3BE 2VHXA 3K09C 2RGNC 1XD8A 3MA0A 3FCOA 3MRTA 2L0XA 4Q4JB 2QXYA 5EOVA 4RTSA 4I8DA 1L3IA 2VJPA 3IKTA 1XQ1A 4ZU6X 1H42A 1HE2A 3TQQA 4GMHA 3HN6A 3AZPA 3ZDBA 1BDJA 3H5IA 5HQTA 2ONJA 5BRJA 2WP8J 4MW0A 3ETEA 3P9NA 4ZHQA 2F1RA 3GARA 3A7EA 3IHTA 4LPKA 2I4NA 5GPBA 5FTLA 2AFHB 1U9IC 1W4AA 2GT1A 5AVQA 1U0NA 1TZJA 5LZ2A 3LHKA 4QO7A 4D8WA 3OP4A 1FMJA 2RJOA 3OZCA 3T7CA 5FAKA 4EQ6A 1G66A 2HWYA 1JXQA 3E48A 4YRCA 2QAGC 2VYVD 4KI7A 1LQUA 3KQSA 1EBBA 3MUNA 1KFKB 2OP1A 3OC6A 1PFKA 4OBWA 1V25A 3TQSA 1X38A 5JVDA 4QXMA 4HUTA 2JBAB 5GGYA 3K5PA 1WRBA 1SVUA 1J1IA 4ZDIA 4KKVA 3D0OA 3KZ1E 3GRZA 4I5EA 3N6RA 4BEJA 3IOCA 2D2VA 5FOWA 4QSHA 3DH0A 3A14A 4RTMA 4JJEA 3KHTA 3FETA 2EZ4A 3IEVA 4F3NA 4X00A 1T5BA 1DBPA 3A36A 4HWGA 1T1JA 4Q3BA 3URMA 1R50A 3B7PA 4E1BA 1MABB 1W2WB 3K5IA 4PZEA 2JFZA 4O1HA 2QT9A 4PY2A 3CFYA 2VPIA 4EGSA 4XB1A 2PZLA 1ZBDA 2OENG 1HYHA 1RIFA 2IQIA 3IA2A 4ZVNA 5I48A 2TYSB 1GVHA 3CCBA 3VH3A 1LU9A 2HRZA 1L7EA 3N0TA 3X1JA 3J80A 3TXXA 2JLXA 1G0NA 1H2WA 2VT2A 3R3SA 5E2AA 1A8IA 2RIRA 3AVTA 4GO1A 2IS2A 2VZLA 2HSWA 2WVHA 1WCXA 3PUHA 1MAAA 4YASA 5EXXA 2GN4A 4C7KA 3R3ZA 3A6HA 4LXGA 4XYLA 2OMKA 2EX1A 1C0EA 1N7HA 3OZVA 1E3TA 1X1RA 3QE3A 1BS9A 4P36A 3L1KA 5E6SA 5C8YF 4QM6A 2H31A 2DUMA 2WJVA 5JD6A 3NHAA 1O9GA 5L4SA 2BCGY 1IL0A 4ND8A 2H3HA 5DM2A 4KCGA 1NMSA 3CVXA 2Q2VA 3URKA 1RJFA 5HZHA 1R0KA 4FKZA 1WUYA 1R3DA 3NWOA 2AW3A 3T7EA 5B2EA 3ZOKA 4KWEA 3WWOA 2QR2A 1KBZA 1W47A 2OLEA 4AQYB 3C7KA 3NVMB 2O0JA 2C29D 3EZ9A 4NV1A 5FF9A 2O0LA 4EYOA 1KI9A 4Y9UA 3FZGA 4B6GA 2AKEA 4EZEA 1KY2A 4IIJA 4LHZA 2VXCA 1ADYA 5KNCH 1UDCA 3SS9X 2G0AA 3UHJA 1D1QA 1GQFA 2VDUE 1BCSB 1HT2E 1ZZGA 1LJ8A 1A77A 1TUGA 4TTRA 1FTWA 4GF5A 2R66A 4N41A 5DI3A 3SEQA 1B00A 5KYVA 4A2PA 4I1RA 4PNPA 1OFIA 2AS0A 3OCZA 1KZ4A 4DWWA 3DCNA 2IH4A 3QMWA 3SJUA 4GW3A 5EWJA 5DCWA 2NU9A 4LG1A 1FPQA 1TYAE 4FMCB 2CVPA 4RXUA 2EYQA 4RM2A 3RYIA 4I50F 3KQHA 1ZR2A 1FSPA 1Y1PA 2Z4TA 1YFKA 2P4HX 4IEEA 4JLSA 3TD9A 3BJZA 4YJ2A 3H3XA 4LNAA 1A7JA 4RA9B 2WHYA 3EWSA 1MX5A 4W8GA 5IRCD 2OCDA 2OCXA 1CZLA 1FZQA 1L8LA 2ZROA 2OK8A 4BUCA 4F93B 4KHPB 4E09A 4XVUA 1KXJA 2Z08A 1W5EA 2ZR0A 1H4SA 1QMGA 2R86A 3BXHA 3U3OA 4X8HA 3FVRA 1YJQA 4LKRA 1V16A 4WH0A 3EXEA 3NEJA 2DFNA 5D84A 1V2GA 1BKYA 1FXUA 2O05A 1CXZA 2WAYA 4N3AA 1I4LD 3VDMA 4G0QA 4BQIA 4F9FA 5C32A 1GLNA 2WT9A 4J0FA 4FCWA 2PZFA 3AK4A 1BD4A 3QPBA 4ZANA 3V8EA 2UZ1B 3O3NB 3WL8A 3REQB 5IJ9B 1XXHE 3FNFA 5EHNA 1MO5A 1XKXA 2KHZA 1HDEA 2G09A 3F5MA 2P6RA 1YONA 4WBNB 4C22A 2YVUA 3PVSA 3T5AA 3VMFA 2P2LA 3AI3A 4HWOA 1DJMA 1KI4A 5LQRA 4DJFC 4KPGA 4RPLA 5FWYB 4NI5A 2ZANA 4I1YA 2WKSA 2ZYUX 1QIKA 1R9JA 2EQ5A 1FUIA 4RVUA 2C3UA 5H83A 2EHDA 4DMLA 5LNK6 2X7XA 1WS6A 1P4HA 4GKJB 2PCLA 4NBNA 1MC1A 2X14A 2Q7XA 3EDRA 5JTUA 4QJ4A 1NRXA 4B6OA 1C1DB 4FKBA 2ENWA 3N58A 1UP7A 4X63A 1EFAA 1VJGA 4JC5A 3S1LA 1ZGAA 3AEQB 3T7SA 2PH1A 3TJRA 5AI5A 4F21A 1G2IA 3HM9A 4ZGBA 2C3PA 4FT4A 1BA3A 1IY9A 4JBIA 4JB0A 4NICA 2QRLA 2FWIA 3EA5A 1EWVA 3SC3A 2XRZA 3PUZA 3AEZA 4FR0A 3SQOA 3U7EB 2ZT7A 2KLHA 3D3EA 1NX6A 1RXEA 2G5GX 2P8SA 4WZZA 3CG0A 1UBMS 2YYZA 2W9XA 3GT7A 3QFTA 3VC7A 3R8CA 1FRFS 3T4PA 3I32A 4DZZA 1W6UA 3T1VA 1XF9A 2JGDB 1XAJA 4US0R 2ZVQX 1PFWA 3TW0A 4KUGA 5IAJA 3VR5A 4RCZA 3NNDA 1YR9A 1G3RA 3KD3A 3PA8A 1X2BA 3ZHYA 3GVIA 1YRBA 3M34A 3P45A 5T6MA 4DQXA 5JHHB 4TTQA 3PNOA 1CUIA 2PD3A 4JJ7A 3VTAA 4NU0A 1DOAA 4KN8A 5EEHA 2G6BA 4ILEA 2JZNA 2QNIA 2W2LA 1KIAA 3LCMA 3MB8A 4HTFA 2ACVA 3ANXA 4N82A 1BN7A 1SVNA 3AJRA 3SFZA 3MM4A 2BFCA 5HRCA 2XQVA 2OFOA 1OXBB 2FQWA 4H1TA 3SR4A 1VRCA 4O8ZA 5B58C 3R3WA 5DISB 1E3MA 5IULC 2B25A 1T9GR 5LCXA 3V1MA 3L4SO 1XLTC 3KYIB 4FGLA 2YZMA 2DUNA 3EBLA 3JR3A 4L6AA 2J9FB 3EY9A 4B2YA 4RESA 3TLXA 1U9ZA 1SCIA 2B4RO 1BRTA 3ABZA 4ZO8A 2IYEA 5A4AA 2HKIA 3PNMA 5BRAA 3PWSA 2FEXA 1EGQA 2IXTA 2Q1UA 1J2UA 1CCWA 3OCXA 2J7KA 2VJNA 4EKNB 5A4KA 2XCLA 2QWXA 1TT7A 2W6JA 4KIGA 3DEHA 4PLCA 4DKXA 4NV3A 4B0OA 3CH7A 4WZ6A 1GGJA 2WYVA 3SQMA 1O5OA 3MUFA 3IILA 3TLEA 1T2UA 1FYDA 1XZBA 3V8QA 4CI0B 3VZQA 1JU3A 4U2EA 3S2SA 3HP4A 4CM4A 4F2PA 2BZ0A 2JFVA 3VX3A 2I7XA 3TDNA 2QKYA 1IHUA 5BPHA 4P4GA 4TMKA 2OV2A 1XTZA 4J1QA 4XW2A 3NNSA 3PXGA 3S68A 2DPYA 4B3BA 4DEVA 3OI7A 4HEQA 3WQBA 1PV2A 1UBNA 4UBLA 5KU1A 1KZ6A 1YJ5A 3K9BA 3WLJA 4WOBA 4S1WA 2WK1A 3CWQA 4DYVA 3BA1A 3LKDA 1UEIA 2BD0A 2QW1A 1PBNA 1RYEA 3AB8A 2F6RA 4N0MA 2GEKA 4JASB 4OMUA 3TE7A 3V4FA 4RGYA 5REQB 1Z6YA 2WMYA 4HNTA 5JJKA 4NMXB 5JXIA 1KR5A 4TN5A 4AURA 3IPXA 1XAHA 5H02A 4ER3A 1GGVA 2XGGA 3MB5A 4M8NE 2R00A 1GRVA 4FE7A 3KKQA 3C6KA 1BXGB 4C0AC 2Q1WA 3ZD8A 3D0KA 1RADA 2YV2A 3HXLA 5EJ5A 4J7XA 4UCFA 5JAIA 1M6WA 3F98A 4XX0B 1ZFNA 1CUGA 1OFUA 1Z18A 1YRYE 2ROQA 3QVJA 4PIMA 1JYSA 3K1TA 3C14C 2Y2VA 1Q1GA 1FYVA 3FPKA 4P3KA 1RYNA 3OQ1A 4XUEA 5G2OA 3VAZA 4ZJZA 3QMVA 4IOJA 4RMIA 2K4MA 4YCSA 1G5RA 4DR5B 3C43A 3IUEA 4TSRA 1AU9A 4FYVA 2YY5A 1P2DA 2HREA 2DAPA 5K20A 1JEYB 3DZGA 4FFBB 3J81A 1GPBA 4XIIA 4E2XA 4ZDJA 2WV9A 2PQ2A 5MGBA 4EAAA 4DLPA 3ZKWB 2P1DA 3CUEF 5DCYA 2AJCA 5DN6D 1QRUA 3LXRA 3CLSD 4URXR 4ND6A 2EG9A 2P9GA 2JRLA 2XNDA 3N2GB 1OI4A 1EDZA 2BMJA 2GNOA 2Y0DA 1DPFA 1ODCA 2JH8A 1I36A 1M6NA 1N5LA 3FRHA 1Y5NA 3HR8A 3WYBA 4IIVA 5I7RA 2HZBA 3CM0A 3CF4A 3UUGA 3G3EA 4EG0A 3GDHA 4CNQA 1V4VA 4BLPA 5TRTA 3NUQA 3U44A 2VEDA 4YV1A 2W6OA 4P53A 2VDPB 3MCZA 5JYEA 3TZBA 1GZ3A 4X45A 4DCJA 5CHYA 3UVEA 1OKKA 2ZCUA 2M1XA 3HGTA 2QX9A 1CHNA 1P9NA 3VVBA 4C7XA 4YGYA 4E2WA 3U7FB 3RYHB 5BSHA 3IVAA 5JPDA 1RM0A 1J7KA 4LDPA 1WQ3A 1FUYB 3TZLA 3REGA 4UE2A 1ZK2A 1M5RA 4F4DA 2Z2JA 1G21E 1IMJA 3W6NA 2O2XA 4TT3A 4BY9E 2H2IA 2AD5A 1LI4A 4FN4A 2J7PA 4DCVA 1R6XA 2PVCA 2QUIA 4JODA 1PGPA 2WRZA 4UVHA 1IMOA 3PFBA 5D6OA 1KQNA 3FTFA 1PGOA 1MHTA 5JALA 1HDYA 3F3MA 4TXJA 1RPTA 1T0BA 4NYIR 4ZT4A 3V2HA 2OECA 4BMOB 4DW8A 4FMCF 4JB8A 1N8NA 3R40A 4QT0A 2LIVA 3UWOA 4G9GA 1DQNA 1EFPB 4C2TA 2SCUA 1R6TA 3I3SR 3ZY6A 1YS7A 3QHPA 3X3HA 4XWWA 3GLUA 3EYAA 4MVWA 4KAJA 4FINA 3EVFA 2QJRA 3RUHA 1GG5A 5E1BA 1AKTA 1E20A 1M83A 3H83A 3UMSA 1FSFA 2BTEA 4NCJA 4CEIA 2BFNA 3R8XA 1LC0A 1DPGA 2CYBA 4JJIA 1NR1A 1KAHA 1GYPA 1UJNA 1MC8A 5K3SA 2VN8A 1PQ4A 1AQIA 3OZAA 4QQKA 5IP5A 1XNRB 3DMTC 1H8HA 5TF4A 3FTEA 1GO2A 3WO1A 3LD9A 4XE5A 4D4GA 1AA6A 1QFJA 3UO8B 1KI6B 3EF0A 4FVTA 2W6MA 1TRKA 1DT3A 2C5SA 1AGPA 2DT5A 2HCRA 4BAGA 1FA9A 1G55A 4AJLA 3D6NB 3ZHZA 4BVEA 2BUCA 1UXJA 3QEKA 3OQIA 1I7NA 3TI9A 4PS0A 4LXQA 3VJKA 4XGKA 2Z6UA 1P7YA 3RHFA 4Y2GA 4DAEA 3EZXA 1M2JA 5LL6P 1YRLA 3OKAA 4I99A 5AVZA 2RJ3A 2H2DA 3GDFA 4L4RA 1WOMA 2IZ5A 3MQ4A 2WE8A 4ZOLB 3IR5A 1G98A 1NLYA 2F00A 5HS6A 5LJLA 2IYXA 5K0FA 1MZVA 1GT91 1QHHB 3VZPA 1F1JA 1XVIA 3T5TA 3UENA 1FTQA 1J4AA 1EMDA 1R18A 1WTAA 5T4EA 2Y9PB 4AP9A 2E85A 1RJGA 4MR7B 4H7HA 4GQAA 2ECPA 4QQRA 3VR5D 2FRXA 1N2CE 1XTTA 5JZOA 5LLDA 3TOZA 3KR9A 4LWZA 3E7DA 2VJOA 3SSAA 2O5CA 3CV3A 4RFSB 4RJJA 1L5QA 3AKEA 4DMRA 4DAOA 1DBRA 1MORA 1RPAA 3AHDA 4RK4A 1ZMRA 2GVNA 2V98A 2W2LD 2IU0A 3SLGA 5JMOA 4QPNA 1E7QA 1ZY2A 3LKBA 1YBAA 2WB2A 3FAZA 4IKOA 3KB8A 2QD4A 3QXGA 3U4QA 1YZNA 1E94E 3BOSA 3DKPA 3EVBA 3QLVC 3RABA 1AHHA 2QYOA 1N36B 2VJYA 2RGWA 2HMYB 4CMEC 4UFOA 4P2BA 1FDIA 2ZYSA 3VPHA 2GJ4A 1NW7A 4PQYA 2FCRA 1YDMA 2P7HA 3I8XA 4YBRA 4G5RA 4EJ2A 1KO1A 1C3LA 2IZ1A 3AUYA 4N76A 3MWDB 3PGJA 2Q99A 3FTQA 3HZOA 1E1MA 2BTOA 2PMBA 3GLGB 1KJYA 3IBYA 4GXTA 3M5PA 1N5IA 3PXEA 4TT8A 2ZJOA 4QBHA 5FPHA 1YZQA 2ZPUA 3T3DA 2UXDB 3EF3A 4MUBA 3RS5A 1ECFA 4M53A 4KWCA 4ODIA 1LRKA 1B1CA 2W6JD 4R0VA 5FYDA 3TNYA 2GHIA 3HKCA 4DRYA 3PEYA 1PX2A 3F71A 1I7LA 4LGMA 1IXYA 3CPHA 3UHAA 5KVAA 5IBPA 1UMCB 2GPWA 5FX2A 3TR5A 4I08A 4WX2B 5IKOA 3TVTA 4N6GA 4OL0A 1U5BA 4Y2JA 5DW0A 1VHDA