2R8BA

The crystal structure of the protein atu2452 of unknown function from agrobacterium tumefaciens str. c58
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
PMTKDSYFHKSRAGVAGAPLFVLLHGTGGDENQFFDFGARLLPQATILSPVGDVSEHGAARFFRRTGEGVYDMVDLERATGKMADFIKANREHYQAGPVIGLGFSNGANILANVLIEQPELFDAAVLMHPLIPFEPKISPAKPTRRVLITAGERDPICPVQLTKALEESLKAQGGTVETVWHPGGHEIRSGEIDAVRGFLAAYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the protein Atu2452 of unknown function from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Atu2452
total genus 60
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r8bA00
4AX4A 1QIDA 2WLSA 2BKLA 4N8EA 3Q0TA 1E66A 1CFJA 4DYHA 2QR5A 2WHRA 2VJCA 4Y2YA 1EVEA 3I6MA 1FFCA 1JJIA 3HZOA 2HADA 3NOXA 5T4EA 4K2AA 4UPDA 4KYVA 3WMRA 3X3HA 2QXTA 4UHHA 2WFMA 4KAJA 5SYMA 3WWEA 2ZJ7A 4X97A 4DMFA 5T4HA 4B82A 5E4YA 4FHZA 2PVSA 2JGKA 3FCYA 3OPMA 2HDWA 5DJ5A 4ZI5A 5ALZA 2JGJA 4G8BA 5ALLA 4HRXA 1W6RA 4ZREA 2H9YA 3DKRA 3H17A 5LYYA 3VKFA 1DU4A 4F5ZA 3C8HA 3M81A 3IUMA 3OC0A 1R3DA 3WA7A 3ZLTA 5HFAA 2OGSA 2NW6A 1O6GA 1CQWA 2WUDA 4H7JA 5DWDA 4HTAA 3IUQA 2DCMA 3DJYA 1WB5A 1XLWA 1E8NA 1THGA 5ESRA 2YASA 1J07A 2OAEA 1CPYA 1QJ4A 1H2YA 3WQHA 4J03A 2VJDA 3WK6A 3V9AA 4MEBA 3ANTA 5FOQA 4GLBA 1P0IA 4CIBA 4X90A 3HEAA 3QPAA 4U2FA 2B9VA 2PM8A 1DWOA 1R88A 3PICA 1BU8A 1EK2A 3WWPA 3BL8A 3A70A 2DFPA 4PSUA 4N8DA 5LKAA 2JGEA 1DWQA 3VXKA 3M82A 3AZOA 2XQJA 3R3WA 2W6CX 4QA9A 2I03A 4ZV7A 4LHEA 1AKNA 1U2EA 4NVRA 5BWBA 4BTLA 1JKMA 5AI6A 1XRMA 4AQDA 1ZI6A 2PSFA 5IVHA 1Y37A 4HXGA 2Q0XA 5ALIA 3C8DA 3GA7A 3STYA 2JGLA 2XUFA 5KREA 1TK3A 3PDCA 1C4XA 2J3QA 5DYTA 3I2KA 4ARBA 4B83A 3WI7A 2WFLB 5DYYA 4B81A 1ZGBA 2PL5A 2WJ4A 3WZLA 3IUJA 1YASA 4FMPA 1K5PA 4IO0A 2VTVA 1UT6A 1Q0ZA 3GBSA 3ESBA 2XUDA 5AKHA 2CBGA 4U2CA 1FFBA 5I7UA 2VJAA 4PSDA 1W1IA 4OPMA 4H7KA 3JWEA 4RGYA 3STTA 3A2MA 4WFJA 4KEAA 5DTIA 1QFMA 5CT4A 5AK3A 4KE8A 1RYYA 1MAAA 1CUYA 4KJXA 4OB6A 4QLOA 4DGQA 4G5XA 4UHFA 3LP5A 2R11A 5ALJA 1CUHA 2VT6A 1XRLA 1XKTA 1LLFA 4GBGA 4RPCA 1TIBA 2JGMA 1YAHA 3M3DA 2WJ3A 3BJRA 4W1RA 3QMVA 2QXUA 2QZPA 5AJHA 4BZWA 2ZYIA 4LKOA 5ALOA 3NGMA 3PE6A 5D3ZA 3WL8A 3PFCA 3UMJA 3ZI7A 4AZ0A 4JYPA 4P93A 1VXOA 3R3YA 1ISPA 2XLBA 1ORWA 2BCEA 3TJMA 2B61A 3R3VA 1SCKA 3B5EA 4A16A 4QDTA 3C70A 4BB0A 4N8SA 1GXSA 5A7FA 1AGYA 3I2FA 1MX5A 5C7YA 4N5HX 5EHNA 3AIMA 1AQLA 1X2EA 4AO7A 4G4JA 1ZOIA 3G9TA 5JD6A 1CUFA 1GPNA 2QUBA 2XUAA 3W9UA 4Q05A 4PV7A 4W1PA 3HYSA 4WCVA 2V98A 1R9MA 1DX6A 3WKBA 4KR0A 4W63A 2WILA 4X00A 4Y2JA 2O7RA 2I3ZA 3FSGA 1MAHA 1LPMA 2OAGA 4O08A 4HAIA 4WFKA 3B12A 2FX5A 4EY5A 5FLKA 4Y2UA 3QZUA 4K6HA 4Q1VA 5LZ4A 4WY8A 4Q3LA 4Y2XA 1SOMA 4XWGA 1HDEA 4TPKA 3WA6A 4P9NA 2YYSA 3HC7A 5AM0A 5JADA 3FVTA 1ZD5A 1P0PA 1EINA 5ALYA 7YASA 1DX4A 4AB1A 3ZPXA 1VZ3A 1U8EA 3IURA 3HSSA 2ACKA 4C4ZA 3SK0A 3WLAA 2WTNA 5C8VA 1A8QA 5AK5A 1HKHA 2X76A 4AMYA 4HS9A 4FNMA 1D07A 1N1MA 2HU5A 4U2EA 3BWXA 1K8QA 1LPNA 3G0DA 1EH5A 1GGVA 1ZI8A 3PF9A 5HFNA 2CUTA 5A6VA 5HKBA 4HRYA 1C7JA 1WB6A 3CXUA 5AICA 3STXA 1CUEA 4I3FA 1GT6A 3WL5A 5FDFA 2XMCA 5FP0A 1ZD2P 4C4YA 4E11A 4GEGA 2JGFA 2AJLI 5HF5A 1Q83A 2J4CA 2HFKA 4MXDA 3AIKA 5LZ8A 4BRSA 4BVLA 2AJ8A 3A6ZA 1C7IA 1JMKC 5AIAA 5K3CA 1LNSA 1B6GA 1TKRA 2DHDA 2GZSA 3WJ1A 4L9AA 4GDMA 2RONA 3RKSA 2Z3WA 3WKEA 1NX9A 5ALMA 3AILA 2GYVA 3O4JA 3WWCA 3RARA 5JATA 2WIJA 3G02A 3GUUA 2XB6A 4NZZA 4PSCA 5DLPA 4OU5A 5K5EA 4MYSA 3BIWA 1DQZA 2WIDA 4FLFA 2Z5GA 1MX1A 3BDVA 5LLSA 3JW8A 5CXUA 1UKBA 4G1FA 4E15A 1XRNA 4X6YA 4H35A 1BN6A 2VT7A 2XQFA 2AJBA 5HF9A 4X94A 2DSNA 3HRHA 2R8BA 3WWDA 4K5QA 3AFIA 2ECFA 1QE3A 1JU3A 2OCKA 2PUHA 3JYHA 3BF8A 5JANA 3IBTA 4BDSA 2PSJA 1AX9A 1BEEA 2WIKA 1YSCA 4X95A 3M83A 3ILSA 5D6OA 3C6XA 4BE9A 5AM1A 3HACA 3G0GA 2BAGA 2XMDA 3G9UA 2XUGA 2GBFA 1CR6A 1E5TA 5AH0A 2OPHA 3O0DA 3DYVA 3H2GA 1ODCA 4J0JA 2VJBA 3WIOA 3H1AA 3ZV7A 2RI6A 2C5GA 1XQYA 3K9BA 4GWLA 1CUCA 3QPDA 5AKIA 1CUAA 4UFNA 5BV7A 1VXRA 1VKHA 2WSLA 2WHPB 3F97A 4UFOA 2XUQA 2WU4A 2OCIA 3ESCA 4P92A 5CH8A 3WWOA 1GZ7A 1F8UA 3KXPA 4C01A 4XIIA 2QUAA 4RNCA 4B6GA 2Y1KA 4XX1A 5JZSA 4QLAA 1QO9A 5AKZA 5AIBA 4H7IA 3H19A 5AI4A 1AZWA 1T4MA 4BVKA 1IVYA 2G5PA 1AUOA 3D3NA 4JEIA 5IVKA 2DQYA 1QIMA 2XMSA 2JGIA 1MTZA 3I2HA 3Q8WA 3F96A 5JZ9A 3TGLA 3V1KA 3WKCA 4DIUA 1QTIA 2C5FA 1IUPA 1LPAB 3A2LA 3EQ7A 4HXFB 4DSZA 1MU0A 5AI8A 4UUQA 1UK7A 1ZICA 1EK1A 1XRRA 3EQ8A 1YS2X 3VJMA 3C87A 5JAUA 4KRYA 1R50A 2I78A 4LYDA 4E14A 3NWOA 3VJLA 1N5RA 4OUKX 1ZJ5A 2P8SA 1YCDA 5AO9A 1XQXA 1YB6A 4KRXA 5A71A 2QT9A 3W05A 1T2NA 2YXPX 3DEAA 1XZAA 3IIIA 4W1QA 3D2AA 3R40A 3AUKA 4ARAA 5HK8A 3QVMA 4BDTA 1AC5A 1N5MA 4TVKA 4H7HA 4FTWA 5EHXA 3KOOA 5AM5A 4DNPA 3FLBA 3FLAA 5AKEA 4M0MA 3D4LA 4UBLA 2AJCA 4PW0A 3C6ZA 2HHAA 1X70A 3WIBA 5FV4A 4J0HA 2QJRA 4Z49A 2CEKA 3R3ZA 4PF1A 4UHDA 3N2ZB 1QO7A 4MJ3A 2AJDA 4U2DA 5E2IA 4JH0A 5JAHA 1XQWA 2WJ6A 3AZPA 3DNMA 4BC1A 3VDXA 2XUJA 1CUBA 4Y2SA 5ALXA 3T4UA 1A88A 4CG1A 1OILA 2G5TA 5I8PA 2IITA 3E0XA 5ALWA 1I6WA 4IQ4A 3PF8A 1XZIA 5JAOA 4Y9SA 4EUSA 4C87A 2J4FA 2XUOA 1GQRA 3G0BA 4OSEA 2H1IA 1UOOA 4XJVA 5JALA 1XZKA 4H7DA 4CG3A 4ETWA 4YPVA 3L1JA 5ALNA 4EB0A 2XUIA 2C4HA 2CZQA 2WM2A 2XMZA 4G9GA 4JUIA 2G4LA 5ALQA 4DM7A 4YX9A 1IZ8A 5ALDA 1TAHA 1YA8A 4QZVA 3W2TA 4J0GA 3WK7A 4KE9A 1USWA 1KU6A 4J0CA 2VATA 5AKJA 1VA4A 1MJ5A 2GYUA 1XZDA 4EZIA 4FBLA 2ZYSA 3G9ZA 4HVTA 3O9VA 4QDOA 4NS4A 3RK4A 3DL7A 4FLMA 4S0XA 4KAFA 3DLTA 3D0KA 5EFZA 4H77A 3H04A 1RP1A 4IH9A 1QOZA 1XKLA 4CG2A 1K63A 1NU8A 2VF2A 2WUEA 3TRDA 2HL6A 2EDCA 3W04A 2K2QB 4BE4A 1QIIA 4B84A 5T4FA 3O9MA 5DYWA 5YASA 5JYCA 3QMWA 1Q0RA 4LXIA 3TEJA 3FYUA 1WOMA 3IB3A 1ODTC 4GW3A 1CLEA 4DMCA 4OCZA 3HABA 4ZGBA 1F6WA 4ZWNA 3ICWA 1AMNA 4EY6A 2XQGA 2HA0A 2E3JA 1U4NA 1XFDA 3L1HA 1FFDA 4OYYA 3BF7A 5ALTA 2C7BA 2WG2A 2HA6A 2WG1A 3STUA 3IDAA 4C6HA 4LIPD 1PFQA 5CMLA 3V1LA 3FVRA 1YB7A 4WDRA 4PQEA 5BOVA 4UBKA 2Y6VA 5JAPA 4F0JA 2DHEA 4B0PA 3ZWQA 4AO8A 1QLWA 3I28A 1BCRA 1XZEA 3FWHA 5IVDA 5AI9A 2XI4A 1CUDA 2XMRA 3C5VA 1F0NA 1JI3A 2ZSIA 3F9CA 4BC0A 1UWCA 4DNOA 3BIXA 4F21A 2XMBA 4QE3A 3RM3A 5JZBA 1CUXA 4EA6A 4KE6A 1G66A 5IH7A 1LZLA 5HQ3A 4Y7DA 2HA3A 4LYEA 2GBIA 5SYNA 3I2GA 3LLCA 1MN6A 2QS9A 4TGLA 5CBKA 5ALUA 3H18A 2YH2A 4BAGA 2B4KA 1DWPA 3C43A 3FOBA 4G8DA 5ALGA 4D9JA 3IVMA 5LZ5A 2GZRA 5IKXA 4QWMA 1XZMA 3D5EA 4DTCA 4RE5A 1HLGA 1LZKA 4Y2TA 5K3BA 4MQLA 1LBSA 1M33A 3GFFA 5CH3A 4M0FA 4OYLA 3I1YA 4BATA 1W76A 5CT6A 3CN7A 2QTBA 2FJ0A 2HU7A 2PU5A 5D3KA 2HA7A 2IX9A 3DD5A 4QDXA 2JF0A 3I6YA 3MUNA 2EDAA 4DSAA 4X3CA 1UK6A 5FXMA 5AK4A 3S8YA 4ZXFA 2PSHA 2VAVA 2HA2A 5JIBA 2PKYX 1J06A 1VLQA 5EHZA 4BCCA 5DNWA 1XQVA 4UBOA 4CIAA 2DR0A 5CT5A 3UUEA 2VAXA 2Z8XA 1U65A 4B9EA 1GKLA 1BRTA 3R41A 4Q3KA 1EX9A 2WQZA 4MEAA 1LBTA 3WK9A 4XVCA 4FLEA 1THTA 5AHXA 2CJPA 3U0VA 3VVLA 2OXEA 1CUSA 3C6BA 3G7NA 2WHPA 1EVQA 4QWWA 1WM1A 4QEKA 1MPXA 4B80A 3PUHA 5ALPA 4EY8A 1Z68A 3E3AA 1BROA 4J7AA 4DLNA 4V2IA 1UXOA 2OQIA 1B41A 5LKRA 2O2IA 2Z8ZA 1EDDA 4IH4A 1BS9A 3CCBA 1EDEA 3F8SA 1WCYA 3WL7A 3C45A 3KWJA 3QM1A 4FOLA 3QMMA 1UFOA 3C6YA 4U2BA 4W1SA 1UK9A 1A7UA 2ZSHA 2UZ0A 1E8DA 5CRIA 1FFAA 2BGRA 1ACJA 1IUNA 5EGNA 1WB4A 1R1DA 5EIAA 3AINA 2JIDA 4UBMA 4B7ZA 1QIKA 1CEXA 3FYUC 1CUIA 1HPLA 3IUNA 4BCDA 1OCEA 3P2MA 1YR2A 3H2HA 2XDWA 3BXPA 2QVBA 1XZCA 1H2XA 4INZA 2VA9A 3V1MA 4WJLA 1QIJA 5C81A 3HLKA 2WIGA 2WTMA 4BAZA 2BJHA 2RHTA 4X92A 5EI5A 1LPOA 2V97A 2O7VA 3UUFA 1XRQA 2XQKA 1JFRA 4MWSA 5KBYA 3DCNA 5FUMA 2D5LA 5KWIA 1RWQA 3QITA 5ALFA 2AXEA 2ZVDA 1ZJ4A 3STWA 5C8ZA 2XUKA 4UHBA 1HL7A 2OGTA 5ALEA 3R3UA 1IZ7A 1X2BA 4I4CA 4WFIA 4Y2RA 4OD0A 1DT3A 5ALVA 2XT0A 4K6KA 5DNUA 3QBJA 1CRLA 1IMJA 2WUFA 1KU0A 4UHCA 4Y2VA 1L7RA 4CI9A 1DINA 1ZIYA 1TCBA 4ZRDA 5E4TA 4J0KA 3I2IA 3DKKA 2PBLA 5K3EA 4A23A 2DHCA 3C5WP 5JD5A 3SC2A 4GHWA 2ZJFA 4GXNA 1JU4A 3EQ9A 2DQZA 1QGED 3G0CA 1QFSA 3WYNA 2QJWA 5ALKA 5JASA 5EHQA 2ONCA 4YK7A 4BP8A 4GECA 4BTVA 1AURA 2ROQA 5AOBA 5K3FA 3DYIA 3WZMA 2OCLA 4U2GA 1BEZA 2WHQA 4JNCA 1HQDA 3IULA 1BN7A 2V9ZA 2WU3A 2XUHA 5HKAA 1O6FA 1JJBA 3BJMA 3WK8A 3U1TA 3CCCA 4G8CA 3ZLUA 4Q82A 3AIOA 3F98A 1FFEA 3D2BA 4PO3X 2ZJ6A 3CN9A 5AKGA 1FJ2A 2GYWA 1S8OA 1K6EA 5DNVA 5CURA 3G0IA 1UKAA 4BZZA 4C4XA 1SC9A 1ACLA 1W52X 2WIFA 1SFRA 2Z3ZA 3QPCA 3SX4A 2XUPA 4H18A 3I6ZA 5EIEA 1KEZA 5HQ3B 3OG9A 3B3QA 5CT9A 3G8YA 3O95A 1CUGA 1QIHA 4GI1A 4A5SA 2QRUA 3QH4A 1CIJA 3ZLVA 1XZFA 3T52A 5A62A 3D7RA 4UBNA 4G4IA 5ALHA 4BAUA 4QNNA 2W22A 3FSGD 1XZHA 1ZI9A 4KE7A 3H0CA 2QM0A 2BFNA 5AI0A 3SWWA 2O2GA 1TRHA 4UFPA 2ORYA 1YS1X 1TCAA 3PI6A 6YASA 1P0QA 3N0TA 1CUWA 4UBIA 4NMWA 4J0IA 1YAJA 3HXKA 2CKMA 3MGAA 5CT8A 1DT5A 2XE4A 1CUUA 3HJUA 1UZAA 1K4YA 1EXWA 4CCYA 2XMGA 4X6XA 5CTAA 4ITVA 2RAUA 5CW2A 2JBWA 2HFJA 2QOEA 3KSRA 1E3QA 5A2GA 1XZJA 5JD4A 3EF3A 1R9NA 4BRZA 3KD2A 2HRQA 3V1NA 4DNFA 4CFSA 4X91A 1DTEA 3FYUB 4UHEA 4BYMA 5AKYA 3EBLA 3LCRA 3VJKA 1XROA 4LXGA 2WG0A 5HF8A 2FUKA 1OXMA 3HI4A 3WKDA 3H2JA 2ACEA 1ZD4A 2C0PA 4H7FA 5K3FB 4EBBA 5HF6A 4L3WA 4B9AA 2Y2VA 2OGZA 4DMHA 1JJFA 4JYMA 4FKBA 1QIEA 5F4ZA 1H23A 2GBGA 2WUGA 3FAKA 4W9RA 2PU7A 5K3AA 3R3XA 1CQZA 3BDIA 5AOAA 3OURA 3KDAA 4EY4A 3DOHA 2X5XA 2PPLA 1J1IA 3R0VA 5AP9A 3H1BA 3STVA 5ALSA 1E89A 4EHBA 5D7BA 2BGNA 4DMKA 5AM4A 2OLEA 4OB8A 4LXHA 4QDUA 1QTRA 3WK5A 1UK8A 1VJ5A 4L0CA 4X93A 5J3JA 1ZIXA 5C8XA 2HU8A 4RE6A 2PSDA 1BCSA 4H0CA 4ZV9A 1P0MA 1LPSA 1QONA 5KWJA 2PUJA 4BP9A 3RLIA 2C58A 5JARA 4KACA 4H7EA 5LP1A 2O2HA 3VISA 3E4DA 1MO2A 5K3DA 1XLUA 3V48A 1ODSA 2EEPA 5AKXA 4EY7A 2GBCA 2BUAA 5AM2A 1ZD3A 2OG1A 3K6KA 1CV2A 4F60A 4DNQA 1JT2A 2CB9A 2B20A 4FNGA 4G4GA 1EA5A 4BCBA 2ZYRA 4WY5A 5AKKA 4E46A 4AXBA 2PX6A 1WPRA 4N5IX 1UOQA 2HM7A 3L1IA 4L72A 1QIGA 1A8SA 3D59A 1XRPA 4BBZA 5LIPA 4Y2PA 5HK9A 2LIPA 2WFLA 4QDZA 2V96A 2QMQA 5AI5A 4FFVA 4Y2QA 1MX9A 4MWTA 2J3DA 4WDQA 4KAAA 5FKJA 4PNZA 3WYDA 1YA4A 5AKLA 5LZ7A 3DQZA 3I1IA 3GZJA 5A7HA 3VVMA 4MQMA 2X8BA 2WKWA 5I9IA 1FSSA 3D2CA 1GPLA 3O4GA 1VE7A 3WK4A 5AM3A 2VQ6A 3MUOA 1WHTA 1NU6A 4I19A 2VEOA 4ROTA 3GELA 3EIOA 4G9EA 4AMZA 2HRRA 5FRDA 4Q34A 3DDUA 3LIPA 3ESAA 2RIPA 5EIHA 3OTQA 1J2EA 1SCIA 4OB7A 1L7AA 3PFBA 4J0DA 4OU4A 1MNQA 3OM8A 4AZ3A 1GKKA 1TQHA 4IH1A 3W9BA 2XQIA 3MVEA 4M0EA 2BUCA 4X85A 1HBJA 5LZ2A 1XLVA 4HXEB 4UBJA 1XZGA 2I3DA 1VOTA 3DS8A 1Y7IA 5BWCA 1EI9A 5IVIA 2RGUA 4CCYB 1CUVA 4HZGA 3G9XA 4MYDA 5LZ9A 2OQVA 3OOSA 3S2ZA 1QIFA 1JMYA 4FBMA 3DOIA 3WL6A 1H22A 3YASA 1SCQA 4C88A 1LGYA 4YASA 1EB8A 2PSEA 2IIVA 4B0OA 1WHSA 2HA5A 1ZGCA 5A7GA 3FBWA 3BE8A 2H7YA 3DL4A 2WFZA 1CVLA 2G63A 3QYJA 2C0QA 1WPXA 1QZ3A 1XZLA 1CUJA 4Q3OA 3WKAA 3O4IA 1EDBA 2Y2UA 3H2IA 4FDMA 4J3JA 5E4JA 4FWBA 4K6GA 3H2KA 3PUIA 2H7XA 4C89A 3IA2A 1N8SA 2VSQA 5HCUA 3LIIA 3K2IA 5AK6A 1VA5A 1R4ZA 1G5FA 1BE0A 2HA4A 3O4HA 2CMFA 5ISMA 2JEYA 2HIHA 3FNBA 4BVJA 3AJAA 2ES4A 2OCGA 1L7QA 1LPBB 1VE6A 5H3HA 1F0PA 5AOCA 1VZ2A 1UOPA 4CCWA 1IUOA 3NUZA 2XLCA 4AN1A 2H7CA 2XMQA 4FFWA 3GROA 1GPKA 1MT3A 5CXXA 1ETHA 5T4BA 3ICVA 5FPPA 1EHYA 1H2WA 1EB9A 1G42A 1TCCA 4AO6A 3ED1A 1XZBA 1CUZA 5DTJA 1GQSA 2D0DA 2JEZA 1A8UA 5FPQA 5CH5A 1Y7HA 1E8MA 1UKCA 3WJ2A 3F67A 3AZQA 3ESDA 3KWFA 1DQYA 1PJAA 2Y6UA 3FCXA 2QKYA 3A2NA 1G4HA 4X71A 4IHAA 3LS2A 4X7BA 5HZGA 3ANSA 1Q84A 3I2JA 1ORVA 4X6UA 3W06A 1W75A 4P08A 3E1GA 2RHWA 1W4LA 5ALRA 2BUBA 2FJPA 2ZYHA 1MNAA 1PV1A 3FYTA 4AN0A 1LPPA 3FLEA 1H2ZA 4B85A
chains in the Genus database with same CATH superfamily
4M0KA 4NCIA 4XFKA 3MMNA 1YZUA 2EWVA 1G1AA 3E82A 5HJ2A 5I7HA 5FV7A 4HMQA 5LVAA 3I9JA 3GHHA 2GD0A 1FVXA 1HDCA 4WA8A 1ESNA 1GV1A 1E7YA 2NZYA 2UZAA 3MWFA 1CFJA 2GS9A 4OAOA 3VKHA 1E1CA 3CE9A 3KNZA 2F64A 3PRYA 5FAXA 4BQRA 1KFKB 1WW8A 1W85A 2VJOA 2OFXA 2ZR8A 4RUKA 1V7PC 1QRDA 3LQRA 3I6MA 5IFKA 1SUCA 4O1MA 5ALPA 2IUSA 1N6NA 3HZOA 4NQZA 4BVAA 1GTVA 4XB1A 3P2IA 4OA5A 1KMMA 5K51A 1JQAA 1SGWA 4KQJA 4KYVA 4FEYA 5DE3A 3WMRA 4J3NA 5HM8A 2HWKA 4IGKA 3U81A 1C0EA 1ZIOA 3OICA 3IMCA 3BE5A 2AQIA 4E31A 5IYZA 3WBFA 4TLDA 3X3HA 4A0FA 3IQZA 2VR1A 2F48A 4E09A 4WMLA 3ESRA 2QXTA 4G1MB 2HMWA 4KAJA 3REFA 2G04A 4CQMD 4ENUA 5SYMA 3MMZA 1MO4A 4I4TB 4DUYB 1ADJA 3LYUA 4X97A 4GI2A 4HDKB 3DEKA 1LDYA 3BQMB 1FQJA 3K94A 3OJFA 3PGJA 5T4HA 4BNDB 4UPEA 1B93A 3CX8A 3GQBA 5K3SA 3FCYA 2G9NA 2BL4A 3VOBA 3W1WA 4ZHQA 2O59A 4IX1A 4RX1A 5ALZA 4J43A 4K3VA 5ALLA 4KXLA 4KRGA 5L7TA 1OBCA 4HRXA 1DLJA 1P2VA 1A4RA 5IEBA 3KU1A 5GGYA 1QOQB 1FMTA 1VL1A 4YJ3B 1ZL2A 2JI6A 1R8YA 2H9YA 1I80A 2J45A 2JFHA 3GD5A 1LNQA 1UPCA 4FQ8A 4ZREA 5DZSA 2DBQA 4Y7CA 5AW4A 5HJ5A 1J8MF 1Y3FE 3GLGA 1M1YE 2Z3VA 4C3OB 1BHJA 4UMVA 2IH5A 3WICA 3LPMA 3WXMA 3X1WA 1P5ZB 1CDZA 5A9SA 1QP8A 4CLXA 4DJDC 3FPJA 4GD3Q 4UTOA 3VFDA 3Q5GA 4BNYA 3R7DA 4LDJA 1O6GA 1CQWA 3AEKA 4BP3A 4CMGA 3PLRA 6ADHA 1OHHD 5DWDA 4EW2A 5KJEA 2DCMA 3PQ4A 1M1YB 3HP7A 2ONZA 2WTEA 3CIFA 3IS3A 3QVSA 3ROEA 1E8NA 4UTRA 3CURA 3BKWA 3PHIA 1THGA 2O7SA 1QZZA 2YASA 3PC6A 2WT9A 4NBRA 4EKNB 1BVHA 1P7PA 3JQQA 2AXNA 4LI0A 2YHBA 3R6WA 3TLGA 4BLOA 1YUBA 5KYGA 3K7EA 1SXIA 4QO7A 3SDSA 4YTEA 3IIJA 4Z7NB 3L2OB 3V7YA 1VSBA 1AXRA 3GNSA 3MUEA 1QM5A 5LBIA 3LDGA 1JR3A 1PBNA 3U48A 3WQHA 4DLBA 2V74B 1NW6A 3HBFA 3VZSA 2PRYA 4BKMA 4I2NA 5CW1A 1ULSA 1HLDA 3ANTA 2EWMA 2GBLA 3UA4A 1Q92A 2CZCA 4GLBA 3FA2A 4AQ7A 3OWXA 1SUWA 3F9IA 3UWDA 1CJCA 1OWMA 1KS2A 1QFXA 1ID1A 2OZVA 3PPYA 3LLSA 2FEOA 3NB0A 5L4NA 2B9VA 3DHVA 4G8JA 4DUZB 2OC9A 5CB4A 1NJ2A 1G8HA 3ELYA 4HDAA 4J4BA 2QMYA 3P4UA 2PGNA 3AUUA 2OHIA 3CRW1 3QNWA 1KI7A 3CVJA 3MTQA 2R4UA 1WX1A 1SD1A 3ME5A 1EQ2A 2QGNA 3NETA 4F9TA 4HDMA 4BNZA 5JS7A 2YRXA 5BOSA 5L9AA 4YMHA 4N8DA 2JGEA 1A50B 3VXKA 2BTQA 3NFRA 3F4BA 3M82A 2ZCUA 3O8QB 2XQJA 3B5IA 4RVFA 3ST7A 1KOJA 5DM60 4PVCA 3GVHA 2Q99A 3P0EA 3RAPR 2ZRIA 1VKZA 1WOYA 3CXRA 3IODA 1SMKA 2W7TA 3WDLA 1U7HA 4ZV7A 2P8JA 3NATA 4R41A 3MJEA 2Q1XA 2C42A 2XHZA 3DAYA 4NVRA 3H86A 1UPFA 3U2QA 3UCXA 4BTLA 3BGOS 1P1FA 3H0KA 3CNEA 3B60A 3MWKA 4L78A 4AQDA 4LUCA 1WSAA 5HZKA 3BAFA 2R62A 2QJFA 2VLBA 3VZCA 4ZVSA 3IGFA 3Q3JB 5CD9A 3ADBA 4INOA 4F84A 4TKUB 3PLNA 2VPYA 3SNKA 4PIPA 2V03A 1E79A 3HJGA 4O4IA 5IVHA 1HV8A 2W2QA 4JR0A 2JLVA 3ISTA 2NZXA 1Z13A 4ZVTA 1F0KA 4HXGA 2Q0XA 4RPGA 1EFVA 4RSHA 5C31A 1R0YA 3QE9Y 2CLMB 3IVXA 3MGBA 3MJHA 2O8BA 1LWOA 4J16A 3L41A 4RLFA 1PJ2A 4CF4A 3SVTA 4N48A 2ZTUA 4KUGA 1QS0B 1DJNA 4YQEA 1HYBA 1PR2A 3H9JA 4N03A 2XUFA 1W5EA 1GILA 1TK3A 2C2BA 3GJ4A 1GEGA 5DYTA 3T5GA 3AMVA 5DWQA 3I2KA 4Q3NA 1KYVA 3IDOA 1P4JA 2RH9B 2IK8A 3LE8A 4B83A 5GINE 1HFKA 4D9CA 2E4AA 2WFLB 2X40A 4UDYX 4Z86A 2O14A 2ZUCA 5DYYA 3WQRA 3WZLA 1DTWB 3N8DA 4JBIA 1M1UA 1XTSA 2FXVA 4ZARA 4QOJA 1OFUX 1FMJA 1IWBB 1K5PA 4QKQA 5JZOA 1LU9A 1UT6A 1Q0ZA 1XTKA 3GBSA 2W6IA 3GWGA 3F3SA 3PR1A 3ESBA 5KYVA 4IIXA 3SZRA 3PDUA 2AKAB 1FFBA 3N2KB 2JJ1A 3G2HA 1NBHA 2YINC 2OK7A 3OE4A 2PX3A 2VJAA 4F4HA 2YDXA 5TC4A 4FZRA 3P9CA 2LDXA 1DQNA 2Z95A 4W8HA 2V7VA 4UMEA 2AE2A 1IOVA 4KEAA 2QGZA 5IXJA 1XNHA 1PJZA 1EX6A 1QPGA 2G9VA 4TUYB 3PUYA 1RYYA 3O8LA 2Q5OA 2G70A 3VHRA 3IQDB 4LOKA 1I24A 3K1AA 1CUYA 1LTHR 2AKYA 3RSZA 2GR9A 5BNIA 1ST3A 4A2WA 4D99A 1QKJA 1JV2B 1W19A 1QE0A 3H4MA 2Y1WA 2JPDA 1BDBA 4OQXA 4IEIA 1EFPA 4PG7A 4IQFA 5B6IA 4G5XA 5LU9A 1REQB 3PC8A 5FJIA 2XA1A 3VVCA 1L4EA 3BMNB 4I5DA 2BEWA 1J0DA 3VR3D 3HXOA 2IC5A 2EZUA 2PBRA 2R11A 4UUPA 4H1TA 1L5GB 4U9IS 2HO5A 2J7PD 3LF2A 4WY2A 3WLIA 4AS2A 1TYDE 2IYFA 3LY7A 4DUGD 3AESB 3FMOB 4JR2A 4MGZR 5FWAA 2VPZA 2G9ZA 4GBGA 4C0KA 2QF7A 4BVGA 6PFKA 9LDTA 1NP6A 5EE0A 1NQXA 3SSNA 5JDCA 3IDFA 4RWEA 4MWBA 4JGIA 3ZJTA 3FZGA 5CVVA 4IAOA 5FH9A 2GOYA 1P3Y1 5HIJA 2G1AA 3ESZA 4AG5A 3OTHA 1O3YA 4Q9IA 3QMVA 3UWMA 4E12A 5AJHA 1DDGA 1G19A 4F9EA 3FFTA 4COKA 4BZWA 4ND1A 1ZKDA 3NGMA 3PE6A 3H9UA 4LQLA 1O97D 4ETNA 3K8YA 1TO2E 3B2EA 3DV2A 3NBXX 1CQXA 3BM5A 1TGVA 4IDNA 3NAGA 2OZKA 3H5TA 1F6BA 1M1NB 1Z6XA 3I0NA 4MHOA 4MA5A 2O8EA 2VQDA 1GQFA 2A5DA 1PQ4A 3R3YA 1ISPA 3NAQA 1MF7A 4Q1BA 4FPXA 4AJOA 2F3UA 4NOKA 3ECAA 3DEHA 2FPSA 1XL0A 2OFPA 1CF2O 1JMVA 1H6CA 2NZWA 3MWYW 2C4VA 2HDOA 3B5EA 3UF0A 3V1UA 4HDKA 1FDVA 1WXWA 3VGJA 3L04A 2X9VA 3VHLB 2KWIA 3I3SR 4P53A 5JQWA 2YICA 5DNDA 5TEVA 1Q1AA 4BB0A 1GXSA 1CZUA 4U7PB 4RZXA 2WA1A 2AFHE 3C3YA 1OT5A 1V5FA 2R6R1 3MIZA 4MH0R 3UMBA 5C7YA 3C3JA 4DHWA 1U5BA 5EC8A 1I7DA 3IEKA 1AQLA 1HQCA 1NN0A 1QRRA 1ZJWA 2C7OA 3O9ZA 3HA2A 4N82A 3OEHD 2B6HA 5HGXA 1WXFA 1ZOIA 5IJ0B 2C3OA 1LI4A 3G9TA 1T0IA 1FDRA 1M0WA 3B38A 4BP1A 3TBHA 3EGOA 4P34A 1DUSA 2XUAA 4O5AA 1UZLA 2J33A 2VF5X 1HM5A 1K97A 1TEHA 2JFWA 4I50B 4OQFA 4QAQA 4PV7A 3BWMA 4WVLA 4ZZ0A 1QG0A 2A35A 3PWSA 4CMHA 3Q0EA 4XJXA 3RBVA 1JF8A 5K01A 2DBZA 3SFZA 1B23P 2ZQ5A 2H48A 3TRHA 4A9AA 5MGBA 2WILA 3F5QA 1DKPA 5B37A 3QF7A 1U9IA 3SOPA 2I3ZA 5HJ7A 5IAGA 2IVZA 1GRQA 1UXGA 1QAQA 4H6XA 2YXDA 3D4NA 5EN4A 1YBAA 2JKVA 2OYSA 3ZS8A 1WBDA 3QQ5A 1RSZA 4RA6A 3A1CA 2VBFA 5EJAA 1X8XA 3VOTA 2FX5A 4C7OB 1DNPA 5HBGA 2X42A 3CTMA 3M1LA 1YO6A 2Z04A 2ZAIA 4OMUA 1TT5B 4FYHA 4Y2UA 4PPFA 5LZ4A 4Q1VA 2W5UA 5AQEA 4CKCB 1Y1RA 3D8RA 2FH5B 3PGXA 3FJ1A 3IMGA 3IBGA 3MPOA 4Q3LA 1R64A 3KV3O 3CPJB 3F8TA 4KXYA 4RCVA 4Y2XA 4EI7A 4ZTBA 5CFMA 1M1XB 4FD3A 2H1VA 3E7DA 4PS0A 4QUEA 3GDOA 1JHYA 1H1DA 5B1HA 2YYSA 3DDNA 5F76A 3TOSA 2FRDC 3VSAA 2IHUA 4O4JB 4UULA 1PQPA 2I9KA 1M83A 4RHYA 2F9MA 2AWOA 3FYDA 1ML3A 3G2LA 5BURA 2C0CA 1DEAA 1I32A 2CFTA 2GF9A 4I8IA 4YCJA 5F33A 5MN6A 2L19A 3PD7A 3DTVD 2IS1A 2BF4A 1P0PA 1EINA 2BBWA 2ZWPA 4GYJA 5FYQA 3KAPA 3LC7O 4UQOA 4OP1A 4DCSA 1E2PA 2FKNA 1JU9A 2CXTA 2X4LA 4GLFA 4OMDA 3CUKA 4OHUA 2DECA 2OGWA 2QJOA 3F6YA 3RSLA 2FWAA 4UTZA 1R0BA 1WTCA 3QK7A 4LF5B 2ZDHA 3A6LA 4RDCA 1JR2A 4U7HA 3T4EA 1PL0A 4ZVPA 4L7QA 1YZYA 4EI9A 4EO9A 3DMTC 4DWVA 2YVQA 3EGDB 4FFSA 1E32A 2X76A 1XYGA 2JCXA 2WJJA 4G0WA 1I7LA 4WV3A 3FF1A 4HS9A 4FNMA 3DWEX 1GAWA 4TVBA 1USVA 2I6GA 3LUGA 4D9IA 2PUWA 3T1QA 4NZ9A 4WBXC 1C7ZA 3BWXA 2V0CA 3EMBA 5AVOA 1U28C 1GGVA 3PF9A 2I6UA 1SUFA 1KQOA 4DQVA 1Z3CA 1KXJA 3P45A 4MWEA 4V0NA 3WIVA 4C6TB 4M0PA 5A6VA 2CV1A 2X13A 4GGOA 1WB6A 1K6IA 1UBEA 4GX2A 1CUEA 1GT6A 3PQ8A 3QW4B 5FP0A 4CL2A 1ZD2P 1P62B 2G28A 3VOSA 1JECA 3ZK7A 1I2DA 4C4YA 4YRBA 2KMLA 8ATCA 1EGQA 2APJA 5ILOA 2AJLI 4JSYA 5HF5A 1Q83A 2G88A 3RKRA 3DEJA 5HUHA 2GXSA 4ZO8A 2CDRA 1I7QB 1NVXQ 1M3SA 2P9TA 2PZGA 4ID9A 5LB4A 1DJQA 1QVZA 1KPHA 1NI4A 4H6WA 2AJ8A 4WNAA 4OY3A 4OI1A 4OHKA 1NE7A 3RQIA 2WWXA 3VSBA 2I6SA 1KDZA 2D59A 2ZQZA 4ZVMA 1B8NA 1UPXA 2QX4A 1NVKA 5TE9A 5LDGA 1LNSA 1YBVA 5F5LA 3RTEA 4PX2A 3EIXA 5F2KA 4ZOLF 1MAWA 1M2VA 4G0NA 4Q19A 3ZH9B 2PYZA 2FGJA 3U4IA 4QQRA 2RONA 4EITA 1WEKA 5L40A 1NI4B 1NX9A 5ALMA 4EUHA 1XVAA 3FHOA 5TGTA 2VSOA 4FN5A 1IQRA 4OV6B 4PINA 5H81A 2OESA 2IRWA 1QKIA 4Q03A 1Q1ZA 2NQTA 4PIVA 4KSCA 4S1NA 3RARA 3RUIA 2ECQA 3INRA 3MOIA 1IVNA 5CB4F 2PTGA 2H08A 4MR8A 3H1GA 4MUIA 3DCIA 3GUUA 2B69A 1N78A 4CF7A 3K15A 4HFMA 1R0KA 2QM8A 4Z53A 1XI2A 2YRWA 1DXYA 4QBGB 4RWZA 4R8RA 4H31A 5KSOA 1DFHA 4W5WA 4X66B 5KOHA 3E6AA 4OU5A 4R0MA 2O1XA 1U2TA 1GNPA 3G6KA 1DQZA 1DAEA 1II8A 3ODGA 4AJJA 4FLFA 1K2WA 2CXPA 3A9VA 3SHFA 2W11A 2IDMA 5DU2A 3NKFA 1NBAA 3BZWA 2P1DA 3IXQA 4NPHA 3BDVA 1A9RA 1JDTA 3W5JA 1FTGA 5LLSA 3K8ZA 4A7PA 1WF3A 2O23A 1V6SA 2HPAA 3DKPA 3KJHA 1QB7A 3LY9A 1JQEA 4IJ6A 5CXUA 5B1YA 4RNDB 2BCGY 2ECPA 2OE2A 2VSXA 3OZEA 1KY2A 4G1FA 4E15A 1H2HA 2ZGVA 4LW8A 3LBHA 1O0BA 1NBIA 2HF8A 1PI3A 3P9YA 3BTSA 1N2EA 2BEWB 2J0SA 3V2GA 1QYXA 3HYLA 2HK9A 4XCVA 5TT1A 3BXZA 4M9QA 1QF6A 1A5TA 2DU8A 4X94A 5BXYA 2E49A 1KJZA 2OBLA 4K5QA 4KO2S 1LKZA 2ECFA 1AHNA 4EMBA 3ZDFA 1E3EA 1GL7A 1XE3A 1JU3A 2OBMA 2PUHA 2AH5A 2WWWA 3CINA 3JYHA 1PTJA 5BSMA 4YUWA 3A6KA 4ND8A 2YQZA 1P5RA 3IBTA 3T0FA 1JL3A 1JWAB 5CVUA 2RHMA 1RYZA 5HA5A 2G0AA 1MV8A 1BEEA 3I4CA 4LY9A 4RY8A 1TJ3A 1OW3B 4YI5A 3ZW9A 3K4PA 1M8GA 2IZ1A 4X95A 3EGIA 4KODA 3EFOB 4BXOB 2IYUA 4I1RA 4D8YA 3UMMA 4XWAA 3ORRA 3UJDA 3GDFA 5CDGA 2A1UA 2ANBA 3QXJA 4Q66C 2G08A 4BE9A 1W5TA 1OF1A 1Z5ZA 2D2VA 1Z33A 3KB8A 5TVGA 1V0JA 3M70A 5B6PA 5CPBA 5FWYB 1DO2A 4EJMA 5CFNA 2FYTA 1N0VC 4D4JA 5FTWA 2MSKA 4HQ6A 2XMDA 3FKSA 3HMQA 2Y71A 1FFYA 2JFOA 1N5OX 4R0VA 4I36A 5I9TA 4EB3A 1C8KA 1MQ9A 3K96A 1J5EB 1TC1A 3OZTA 3PXAA 5K09A 4OJYA 5B58C 2XDQA 3PEWA 1E4EB 2PYIA 4HNAB 4MI1A 1O0CA 1KDVA 1ODCA 3B1ZA 1ONOA 1NUSA 4WN9A 5PGMA 3SE7A 1K66A 1R6DA 2CMHA 4FFMA 3W2IA 4ARVA 4BWVA 1WZEA 3KYIB 3BKXA 4JJZA 3BBPA 5BYKA 4RY2A 3GP3A 3WB9A 2BW0A 4YFVA 4W5QA 4F3RA 1E63A 3Q72A 4LJ5A 4FMDF 2QE7A 4M7OA 4PN7A 4QYXA 1XQYA 5BNTA 1XK6A 4B17A 1XP8A 5CIYA 3B13B 4OL0A 1P6QA 2VH5R 1H2RS 5AKIA 2FOLA 3D6NB 4LY0A 3SAJA 2OUIA 2HCJB 3QENA 4XARA 4D4KA 3Q9UA 4NBVA 4HFRA 5AVSA 4ILKA 3PLAE 1VKHA 3URMA 2NN3C 1XMSA 3WQQA 1SOAA 1XD9A 2JHPA 1TW2A 2WU4A 2XUQA 3D4PA 3BQNB 4YN3A 4HHEA 4DUGA 3VPAA 5C8YF 2GEVA 5C3UA 2J7PA 1F12A 1U99A 1VHTA 2PAFA 3MERA 4QT0A 4TTTS 1QFJA 4C30A 3TN7A 1K8ZB 1A9XA 1OGJA 2ILVA 3KD3A 2Y8EA 3OZAA 1TX4B 3QUCA 2H59A 4FDAA 4RLHA 5BRJA 5C53B 2LPMA 3KOXA 1NY6A 1QO9A 5AKZA 5H4GA 5AIBA 1JIJA 4R8LA 2P90A 3KKMA 1CS0A 1KYYA 1L5ZA 1XAGA 3DLIA 1L5NA 2CB0A 2CEAA 421PA 2ZIGA 1BO6A 2ZYTX 1EA7A 1V1MB 3OFNA 3LSTA 4PONA 3L7OA 1WUJS 4HATA 4ZMRA 3TQRA 1AZWA 1X3SA 4TSKA 2YWGA 3AYXB 4JD5A 5BV8A 2XTJA 4Z51A 5TIIA 3ZIUA 1WUYA 1EWQA 1Q0QA 2O05A 2OV6A 1TZ2A 2VDNB 1ZL0A 3ONFA 2GQ0A 4O2BB 4F6CA 5HR5A 3N6RA 5IVKA 2XAAA 2AYXA 1QIMA 1MX3A 2VP9A 3FGZA 2AF3C 2YZ2A 2FPUA 4BB9A 2YC4C 4IS2A 4OP3A 2HLNA 1VPLA 2Q3EA 3LCVB 3UAZA 2Y4NA 3F96A 3GN2A 3PXUA 3I39X 3LQKA 1XB2A 4BMDA 3O7WA 3V1KA 4C76A 5F2NA 4PFQA 5J2UA 1NYLA 2BEVA 1IUPA 3G23A 4GPIB 4TL8A 3RYFB 1LPAB 4A6DA 4J1SA 1X1AA 5CLFA 4HXFB 1MU0A 1P61B 1E2IA 4BKUA 1SUPA 2MU1A 1U63A 2GK3A 1J97A 1ZUIA 2D0OB 3M4YA 4TUYA 2O0HA 3U39A 3V8QA 4ZCIA 4D74A 4LVCA 1NMEA 1AS3A 1Q22A 3RNOA 3LQ2A 1EUQA 3SBOA 1MABA 2ODNA 2HIGA 3JQPA 2RI0A 4IXNA 1WF6A 5AW9A 2X1MA 3ND5A 5AI8A 4QVKA 3ROMA 4B4WA 4UUQA 2I4NA 2VJYA 1KI3A 3PNOA 3IEVA 3CRRA 4E1VA 3ADPA 4CLDA 4D2IA 1XF1A 3GGCA 4PX5A 2ZCJA 3UPTA 3V4SA 3K0CA 4CKXA 1W5SA 1KI6B 4JIMA 5FUVA 2ADMA 3KWLA 5E0OA 3FPBA 3IUPA 2AZTA 2D74A 3VJMA 5BXQC 5I8WA 3AQ4A 1X0XA 1OX4A 1YB1A 3IV9A 3HWRA 3NIGB 4E5MA 4EYKA 4Z4EA 2IYTA 4LYDA 2G0TA 4Q24A 1EZ4A 1RJWA 2EZ4A 3NWOA 3ZS9A 3BG5A 3VJLA 2G6TA 1SQSA 4OUKX 4PYIA 2P8SA 1EP3B 2YVLA 4FNOA 1RHUA 1T0PA 5AO9A 5I7VA 1PLJA 3QFRA 1JVSA 3BBLA 1RWMA 2DKFA 4ZALA 3WLQA 1CP3A 3KRTA 2OCPA 2QT9A 4ZEWA 3RHZA 3K9CA 1PCXA 2P2DA 1USUA 4NCBA 4TS3A 3IPYA 4K9PA 2YXPX 5LUAA 1AZSC 5K0SA 1PK9A 5KPDA 3IIIA 3QKRB 4IXDA 2IEZA 4BJ6A 2R4TA 3NTRA 5EEHA 4MR9A 1TVMA 1LVUA 2Q3LA 4TTPA 4CMKA 2DWUA 4LYGA 4NNJA 5AFSA 1D5WA 4ND7A 2ZRAA 4QUJA 3VNBA 1VCMA 2COEA 2Q07A 3H5RA 4OO3A 3SIPA 2ZR7A 4IQ8A 3RFFA 2DB3A 2NO1A 2Y0BA 5DBHX 4BDTA 1N5MA 3ZQJA 1US8A 1LV8A 2HAEA 3SKXA 1ST2A 5C2JB 1EFCA 4OX9Y 1Z06A 1T8WA 3FLBA 2QMZA 2QL7A 5TMDA 2MYNA 2Y67A 1PEKE 3K32A 1KAOA 1S1CA 2B8NA 1QQTA 4YCLA 1VJGA 2W6NA 4ALJA 1TFRA 2XECA 2ZATA 1Z9BA 3D4LA 4OQ4A 5FOVA 1FS6A 2I1VB 4PW0A 2VNSA 3GI1A 1LEHA 5B53A 2FG6C 3UIEA 2RI1A 1WQ4A 4J0HA 2QJRA 3EJWA 4Z49A 3FOCA 3EVEA 5DT9A 3EC7A 4GP7A 1L8XA 2SICE 1QO7A 4RHTA 4UUNA 3C1TA 1RWKA 5GJVC 2DGDA 2I6TA 3KC2A 1SG9A 5JPDA 4AP6A 3D5QA 1E2JA 1PWYE 4YRGA 5L3SB 4O5OA 1WBJB 1KJQA 2GPYA 4Y6RA 5JFTA 1M5RA 3ZV3A 3NEPX 5AMXA 2C96A 2FLVA 5BN3B 1DJOA 1NP3A 1YRWA 2BMVA 3HTXA 2WZQA 4A36A 2H9AA 2B21A 1E5VA 2IYOA 3CT6A 5AXBA 2Q9CA 1PG0A 2CFIA 1P5HA 5KNCH 1NLYA 4V03A 3M6IA 3ZCRA 4P7BA 5JNLA 3IILA 3LU1A 5EKTA 3T4UA 5AUNB 1FZTA 1SCBA 1UXHA 2GAAA 1SZPA 4OXIA 2UDPA 2RMKA 5IMSA 1U8CB 1E6KA 2IITA 4CNBA 2R9VA 1GKYA 2Y93A 4V1CI 1D04A 5C46F 4OJNA 4UVHA 5SZKB 3SOZA 3IHTA 4ENQA 8AT1A 1I6WA 1KYWA 2R5WA 4CM4B 3HB7A 4ZZ3A 1XZIA 1L5HB 4LJ9A 4D9KA 3SF8A 3ETHA 2R7NA 1ZRSA 1I8TA 4NU6A 4Y9SA 1UC8A 1MGOA 3G2PA 4G41A 4A2QA 5T3UA 4EG4A 2J4FA 2EW1A 4MW7A 1I5OA 3BMCA 4MVJA 3SYKA 4QTYA 2FSSA 2PD4A 3DAFA 1L7PA 1VGVA 2F1KA 2UZ1A 1U6KA 4FMBB 4OBBA 3EVCA 5EMMA 1JEYA 1EJ0A 4G97A 1UH5A 2GN8A 5JALA 1XZKA 5KOJB 2LD4A 4CG3A 1YIDA 3AR6A 3UMYA 5DH9A 1NVFA 4NJEB 2IBMA 2MSLA 3A6FA 3N75A 3OA0A 2XOXA 3TUJC 5D01A 2P75A 4DR4B 4FKZA 4MLCA 1QANA 3ZIAA 3L1JA 2CXHA 1C1YA 3FVVA 4KNWA 1YFKA 4XOIA 4JI1B 4C0JA 4EF6A 2FP4B 1RC8A 2VRCA 1DRVA 5B2EA 3M4ZA 4HWRA 4G9GA 4PM4A 1FZQA 2YN2A 3TM5A 2PV0A 1QNLA 1HSOA 1SURA 2CBXA 3D0OA 4FXPA 4YMVA 3T8YA 1J0AA 3EX7C 4LDAA 4UCFA 2G4LA 3G2MA 1W59A 2D7CA 3AP2A 3MWGA 4DY4A 1T5LA 3QVGB 3WLRA 3DM5A 4K2HA 2PKEA 4F45A 4U3JB 5EHIA 1B6SA 4NL4H 2PR7A 3CWZA 2XAUA 3E81A 4NZOA 3FWKA 4EUNA 4RQUA 3SDBA 2AUNA 1TAHA 1YA8A 3PDIB 2PD6A 2QG4A 5JYDA 4J0GA 3WK7A 1P9NA 2OORC 4J0CA 2OWEA 1ZGJA 3PNQA 2PKXA 2QX7A 4RDIA 4EDFA 2VATA 2AX4A 4CT0A 1H05A 1JQBA 2Z5VA 4K81B 1S1MA 3OSZA 5DM70 3U44A 4HOYA 3R3JA 1XZDA 1SBCA 1YK1A 2Q7XA 4KLZA 1PF7E 4HGNA 2Q4EA 3K1JA 4A10A 4YHHB 5ADHA 1V7ZA 3LLVA 3RYIA 3DPUA 3LUFA 1P44A 1ARZA 1SXJE 1MW9X 3T38A 1T36A 3UB2A 5HNKA 1YR1A 4NS4A 4CMIA 3FTDA 1BXRA 2FF7A 3DL7A 4JLDA 3RG8A 3N0RA 1Q0PA 2QRVB 3EZ9A 2OYCA 1KZ9A 3VDNB 4DW8A 2WJAA 1HE5A 4DA6A 1F2VA 2IUFA 4OGLA 4KAFA 1UBMS 2XNSA 2A5GA 3DVQX 1ZA2A 2FK7A 2GHTA 2XF8A 1M72A 4MDFA 4EGAA 4A26A 2RC5A 2ZIZA 3QJGA 4RACA 3U3JA 3EGDA 1Q19A 4J1TA 3GJ7A 1V2HE 4JIGA 1Z08A 5JBQA 3L77A 5EFZA 4H77A 4EO7A 3OTIA 5IK2D 2I99A 1T26A 2NAFA 3OETA 5LBUA 1FJXA 2Z9CA 1WKVA 5JXGA 5H80A 1H0KA 5KC8A 4Y2GA 1Q0HA 1XKLA 4CG2A 4F56A 1K63A 2QU8A 3EUAA 1T43A 1BHO1 5IF3A 5HRUA 2XIJA 3THXB 1N34B 1P2DA 2D2EA 3DE2X 3FR7A 4E5PA 5C1DA 1C7FA 3L6RA 3TRDA 2HL6A 5F1YA 1G55A 3OIFA 2MR5A 2EDCA 2EKDA 1PW7A 3VZPA 2XCUA 3AG6A 2WHEA 2Q9BA 2ZS7A 1PKEA 3NTOA 1E0AA 1ISRA 3NWBA 5DGCA 4LHZA 2YS6A 3K9LA 3LWZA 4NK5A 3O9MA 4CGYA 3V8EA 4FUQA 5YASA 3W5DA 2B35A 1ABFA 1DCMA 1I2MA 3KPJA 3PHGA 1GFIA 4MUGA 5JYCA 1Z28A 2YWXA 2F7SA 4D8VA 2IOQA 1GADO 1SKYE 5FBLB 1FEZA 1B8PA 2W2KB 3J81k 2ZYVX 1ODTC 1ZRNA 3H4IA 1CJKC 1OLSA 5EXTA 1CLEA 3Q87B 4DMCA 2ZIXA 1ICEA 1AS0A 2CSXA 1C8LA 1JALA 3L8CA 4IVQA 4ZCPA 4P7FA 3VPSA 4BMYA 2EX0A 5JXWA 1T3GA 4KIGA 1ZS9A 3ICWA 4IDOA 4EY6A 3NHSA 4UEOA 2YHAA 3E5MA 1P5FA 2W37A 4G0VA 4L22A 2VSYA 1KXZA 4EHKA 3KSAC 3DFFA 1Z5VA 4MKXA 2HA0A 3RGGA 3KZXA 4K6OA 3EZ6A 4PFJA 2AYYA 2UYYA 2E3JA 3F9RA 4JGGA 4YGYA 1QGYA 1RMYA 3TVTA 4E5NA 4TXNA 1O6BA 4YQZA 3L1HA 4MUYA 1NVMB 1WDWB 2NZJA 5ALTA 3VU9B 1TA9A 5ESDA 2BHRA 1Z26A 4IHJA 1GG9A 2NO4A 2WG2A 4PG4A 4L8VA 4CLRB 2Q49A 2HA6A 2WG1A 3TZLA 1XA4A 3F7TA 5CYPA 2HLDD 4HGRA 3T7SA 5IEJA 5P21A 4F2GA 3C74A 3VUEA 3P2KA 1HFJA 2RDMA 1XMQB 3JZFA 2R7KA 5BPFA 1NJGA 5FO0A 5JCXA 1KTIA 2A0XA 2OHFA 2PZ8A 4N3AA 4PQEA 1KQ3A 5EIFA 1NJFA 1OI2A 1V1JA 2KS6A 2W0SA 3KYDA 2Y6VA 3QIAA 3QVKA 3D7SA 4JLSA 4K86A 3C41J 3ADOA 3EGWA 4ONEA 3SCZA 4I81A 4KV9A 2DHEA 4BO8A 4EPTA 3GPIA 4COOA 3ZWQA 4NFHA 3DMGA 4L75A 1M8FA 1EK5A 1LX7A 5BVGA 3AJ8A 4Z3OA 1LI7A 4G5FA 4DYDA 3G7UA 3I28A 4ZC8A 4C7VA 1C4OA 1LB1B 1RZ3A 2AFIA 2YMQA 3D6VA 4JJFA 4B09A 3ZHTA 2G80A 5ARBA 1H3NA 2FMKA 2XPCA 1PJTA 4MR9B 3K1ZA 3AEUB 1QS0A 2DQSA 3ELWA 2XI4A 1VE3A 3QPUA 5DGDA 5LR6A 2PS3A 3ZOKA 1BX1A 1JDNA 1G3MA 1Z8FA 3DBHA 3MN1A 3PFKA 4M8IA 1MUUA 4ZANA 3TQOA 4RM3A 3X1KA 1XCOA 3CVOA 1NI3A 3DMTA 1UMDB 4TMXA 1TO1E 4BC0A 2AMVA 4MV9A 4OK6A 2OV1A 3DC7A 4MVCA 5JV5A 1QH1A 5KZMB 4DNOA 1HWYA 4MPPA 2XMBA 4XPZA 1X7ZA 2D2IA 2H18A 3EPPA 3KEMA 3KYBA 3P32A 3GDHA 4U3JA 2OKCA 4RVCA 2CNNA 5DOZA 5C3MA 1CSEE 1U28A 5K7SA 1NW8A 3PQFA 4LJAA 5CX1B 3H83A 4H1UA 4KWEA 1NXTA 3FJOA 3G79A 5HDQA 3SHWA 1JA1A 4CL8A 1MJGM 10MHA 1SOVA 3BGDA 1YJCA 2XE6A 5J63A 2IEYA 1KKLA 2BCJQ 4MARA 4U9UA 2O0KA 4B6RA 3BWVA 3K20A 4F93B 2JFZA 1R9GA 2FHPA 3H18A 2YH2A 4BAGA 4JP8A 1KDTA 1RAHA 1DWPA 4MQ6A 4ALLA 4G8DA 1FMCA 5F3DA 1S9DA 3BN3A 4XVQA 3QVWA 4HDMB 5DBGA 1GZ3A 5IDYA 4UNPA 2IGBA 3SE0A 3VC7A 5ICSA 3NBQA 4OXQA 5LZ5A 1BH6A 3IUEA 5D85A 2C77A 1KEVA 3C4VA 2I8AA 5JSKA 1WP4A 3UMSA 4HX5A 3OFVA 5IKXA 4NECA 4ZVKA 2E5WA 1U8TA 4ZXPA 4N0MA 3IAXA 1TLLA 1RWOA 3TTXA 1JH8A 1QZUA 4MYHA 2IZ0A 5SY9A 4B7CA 4Q4HA 4DTCA 1KZ1A 3NV7A 2ZDGA 3TFWA 4EMUA 1WVGA 3IPLA 4MQLA 2F67A 2W9XA 1LBSA 1SU8A 2WKPA 4G2TA 5JC8A 2MSNA 1VE1A 4M0FA 4QUHA 3NNNA 5FTJA 3OFSA 1W76A 2NACA 3DV0A 4X64B 2V5AA 3EF1A 1SQ5A 3Q0IA 1I1OA 1C3XA 2KSQA 3NC4A 2HU2A 5HYVA 2HU7A 4O4JA 4ETIA 1NTRA 2PU5A 2ZWVA 4HDSA 4D9HA 4QJBA 2YFYA 4QFBA 2IX9A 4KRFA 3DD5A 3P8ZA 3MUNA 1LQ2A 2EDAA 5ED4A 3VTFA 3D3WB 3DQQA 2VDWA 2WY2D 3MILA 1X7YA 1T8TA 3DV0B 4ZXFA 3E9DA 3O4RA 2ZIVB 4TTVA 3P19A 2MCFA 3CLTC 4BIIA 4YRRA 5EJ9A 1RJ9A 1M2OA 5L8VA 2W2VA 3QE3A 2GZ1A 5EHZA 4AMBA 4BCCA 1PJCA 1YDGA 4HDCA 5LL6P 2WYHA 1WW2A 3UWSA 5EMKA 2RGWA 4M8SA 4W5TA 2O8CB 1K75A 3ABIA 2PWAA 2HWWA 5DNWA 1RP7A 2RJNA 1RQRA 1XQVA 1MC5A 1VMEA 3ESQA 4HCJA 2V8BA 4UBOA 3PSAA 3RYCA 1ATIA 3LBAA 1J25A 2J0UB 2PBZA 4YRPA 3CLRD 2DR0A 2YYAA 4P3NA 4UE3S 5PNTA 1I2BA 1KI9A 2VPXA 3NT2A 4KMMA 1SY7A 3KE8A 1U3VA 3IALA 2MSEB 1M73E 2QGFA 3KQYA 2YWHA 2Z8XA 4C0BA 4YO8A 5FUWA 4AM8A 4DR1B 2Q46A 4EG0A 2JKZA 3IMFA 2ZSEA 4PPGA 2QNBA 4RK7A 4B9EA 1BX0A 4KO8A 4MB2A 1D4OA 4NFLA 1E2LA 3FPAA 2YN4A 4Y3UA 1U8AA 2UYGA 3RUEA 2QT0A 1EX9A 2WQZA 1U8UA 4Q3KA 4ETMA 3RC3A 2P3SA 1OVGA 2DUUA 1G8FA 1FFSA 1UDAA 4N0QA 4EEZA 2XCIA 1AE1A 4NE2A 2HRBA 3W34A 3TSZA 1YKSA 3GJTA 5THXA 3TLBA 2XCTB 1AZLA 4OLHA 2N3ZA 4YPFA 3L0YA 1X7XB 3CGGA 4MS3B 1VB3A 2VK8A 3U0VA 4F11A 3VVLA 3AETB 2OXEA 4D6PA 5IJ9B 1T3LA 4A6EA 2X5NA 2DC1A 5DCYA 3OUTA 4KREA 1U2QA 3L7CA 3BD9A 5E4FA 4R98A 2KW5A 1N36B 3G89A 3GIDA 2A9QA 2WV7A 4Z9XA 2I5PO 5K8LA 5A0TA 4QEKA 4B80A 2PA0A 3OOHA 2F62A 3LP6A 2HIAA 1PV4A 4WK6A 3L0DA 3PUHA 1D2NA 1NIPA 1JA0A 2CJWB 3HUDA 3JZIA 4R1PA 2WNIA 3WDSA 1Y8QB 2Q6KA 2Z57A 3BOSA 4EY8A 5IJ9A 2H51A 2J9XB 4J7AA 4QICA 3HWWA 2ZSKA 3SPXA 1KSFX 2OILA 3TQFA 3CRQA 3T7AA 2QTHA 1PV2A 1RQLA 2G36A 2E6UX 1R66A 1B41A 4FI3F 3LA8A 2P2GA 3DKVA 2ZT7A 5EMLA 4IYRA 3SC6A 1GRCA 2H85A 2QQGA 3TIIA 4EK9A 1BS9A 1EDEA 1SXJB 2FPIA 2PNFA 3RJZA 2PJDA 2ZTMA 4FE4A 4KZKA 5C7OO 3QM1A 2OL4A 4ALMA 4OEHA 1UFOA 2B0CA 1U04A 4R2HA 3ZXYA 2AW5A 2ET6A 1ZG3A 3DJFA 3FUVA 4YP7A 1L7XA 2ZSHA 1G8YA 2XMPA 1MIHA 5B4VA 1VJDA 3KM0A 1ZOPA 3CS3A 821PA 1T8YA 4Y1RA 1J00A 1Z34A 4GPZA 3B2NA 3I01A 1YDMA 1F38A 2QJTA 3OM0A 4LYHA 2Y1LA 2ZSUA 3QI2A 3TSWA 2VYQA 1GQQA 5KTNA 5K6AC 5HMLA 4ZU1X 1R1DA 4HJRA 2DPLA 1HLFA 5CG2A 1ZR2A 1IQUA 3UYKA 3SHTA 4CEJA 4WGGA 1XOIA 3PG5A 4P7KA 1JXOA 1U6JA 4GRAA 5CVJA 1JNXX 1UFRA 3DBVO 5K8JB 2OEPA 3DGFC 1YL6A 4HEQA 2NT3A 4AMUA 1JFFB 1O03A 5DWVA 5FL7A 2AG8A 3WQSB 5A4DA 2A3RA 2VUUA 3LBYA 2EKBA 4LPSA 3H2HA 4OREX 1MB0A 2XDWA 1VJCA 3BXPA 1D4AA 2VWQA 1YR7A 2QVBA 5KO2A 4B3HA 4INZA 1Z6ZA 1DIAA 1ZGGA 3JTEA 3PFHA 4M0DA 4PGFA 1LK7A 1U7XA 3N5KA 1YMQA 1IZZA 4WJLA 1GAJA 2DH5A 2J48A 5HKKA 3PXBA 4AZVA 5C81A 3CH4B 1BFDA 2ACVA 2BJHA 3FD8A 2ZKLA 3HFGA 2C5HA 4MNTA 3JQBA 2JDIA 3G9QA 2NV0A 5EI5A 2X0IA 4HS4A 1PUIA 2CVQA 3ASUA 3LWNA 3N8HA 5LOVB 3TW6A 1ZOOA 1LPOA 4POAA 2V97A 4RGQA 2O7VA 3G59A 1XRQA 1GGNA 3EEYA 1Y9DA 2EGUA 2XQKA 4WK2B 2D8MA 2NO5A 1FVHA 1SHTX 3DWFA 1COWA 1TNDA 4WBNA 4DZZA 3GAMA 3ACDA 3EWNA 1FJHA 5BV0A 2QAGA 3MJRA 1FXWF 4A03A 2Q9UA 4YAJA 5BRAA 5BR7A 5KWIA 1ZM4A 2WYOA 3DLPX 1MXHA 2AXEA 5D6NA 4ZAWA 5CAEB 4LMPA 1NRWA 2P40A 2P4EA 2ZVDA 3RDPA 4GQIA 3STWA 3T3IA 4P84A 1GGFA 1RQXA 3TMKA 5C8ZA 3KWMA 4IDCA 2ODAA 3VMFA 2ARKA 4OL9A 4ENTA 4LCEA 4F6RB 4XX0A 1KZYC 2OMKA 4C3ZA 1HFEL 1U8FO 4GWGA 4QUBA 1XCMA 2FZCA 1M2HA 4ALKA 2P67A 2DM6A 3DLBA 5U9CA 1QCDA 4HUQB 2ZI9A 4S24A 5E2AA 3JARA 3KQSA 4G0OA 4OD0A 5J58A 3EZGA 4O3FA 4RPJA 4LMAA 5JCPA 1BWQA 4CTOA 4JI7B 1FUEA 2UYQA 3G8DA 4FSDA 5EQFA 3OQIB 4EJSA 5ALVA 1NHGA 5DNUA 4MVYA 2A7XA 2PGXA 2YV4A 2XVYA 3NTVA 4QUIA 2QY9A 4UHCA 3R23A 1YU6A 2FHSA 1W2WB 4GMXA 4IUCS 4QPZA 3RYTC 2CFCA 2C7VA 4K3UA 1JVNA 2YQ5A 3OJ0A 2QSUA 1NW9B 4QYSA 1L7RA 4YVFA 4CI9A 5IKMA 4I08A 3W6OA 3K5PA 4FYXA 3CLSC 5T41A 1OE0A 3UUWA 3X1ZA 3JPYA 3SEAA 3DZDA 1RM4A 3T1OA 1E1CB 5HUQA 4K9QA 5K3EA 4LN1A 1U2ZA 4A23A 1LLQA 3WR5A 3WL4A 3C5WP 5CK4A 3ML1A 1X80A 1KORA 1I0LA 4L5YA 3VAZA 3I37X 2Z4TA 3E5NA 1EZZA 3SC2A 4GHWA 4Y9RA 3TLYA 3DDCA 1IXRC 1SHZA 3PNKA 4NU5A 1I4DD 2J0UA 1E4EA 3IR6A 1JDSA 1BD3A 1Z4NA 2H06A 2HHLA 2FSUA 4HNAA 4YDSA 3CA8A 3MAJA 1JSRA 2OD2A 2YBDA 3BGSA 4YT5A 3ETDA 2QTGA 3HJCA 3R5TA 1BKSB 1OREA 1PDVA 3BICA 3P0FA 5E6RB 3TW0A 1GD1O 1ORTA 4HLCA 5CU7A 2NXNA 2QD1A 3PC8C 4YNBA 1UP6A 2Y66A 5AOVA 2IE8A 3SZMA 5JASA 1P6UA 5DYNA 4KK4A 1H9CA 3E22B 3T5PA 2NTNA 1PO7A 3OZSA 2HLPA 1FS4A 4PZ0A 1I3OA 3RAGA 4BP8A 5IC4A 2ROQA 5AOBA 1R6BX 1OYYA 1UM9B 1ZOSA 4NJMB 1AGNA 4BQIA 2UZ1B 3BRWD 2A84A 4BV3A 4WCFA 1ODJA 5F4BA 3FKQA 3RH0A 4CQLB 1M75A 3AEXA 3F4LA 3JY6A 3LKDA 3NBZC 3IB6A 1OIVA 4JNCA 3T9AA 5DX8A 2D7DA 3VYVA 2P5TB 2BI8A 3VR5D 2IZOA 3TTTA 1O6FA 2O5VA 2A86A 2Q6OA 1JJBA 1FP6A 4GC9A 4H08A 3U1TA 4D8TA 3DHEA 4OI4A 4YCDA 4TMFA 3CWCA 2QZSA 4GLOA 2WJGA 4HWOA 2QL5A 1CY7A 3AIOA 3F98A 3I1FA 4NNOA 3D7LA 3LWBA 1Z18A 2OO5A 3CJTA 1APBA 2CL5A 3OQOA 1P7CA 3SZLA 4AS1A 4R31A 2HK7A 1FJ2A 5DN6A 3SC2B 3ICPA 3AGQA 2P0EA 1BQ3A 3J7TA 1XTIA 1E3DA 2BP7A 2GYWA 4G63A 4UEWA 3TI7A 3PUWA 3GLHA 2CN1A 1C4WA 1Z0DA 2OV8A 3AHGA 2PMEA 4URXR 2JFFA 4MUJA 4EGFA 2R1VA 4U5XA 2W6ID 4B3FX 2NXEA 3D7KA 6ABPA 3BHIA 1QHEA 1PQWA 5AUQA 1SU6A 1UADA 3C3DA 2DAPA 3FSRA 3WIDA 1W52X 3CT4A 4KC0A 4OK3A 3TE6A 2FW8A 1MBZA 3D6MA 3VHXA 4IPTA 1C3OA 4TS1A 5H0IA 1U1FA 2FEAA 3ILYA 1I36A 3F71A 1PWHA 4N41A 3RF7A 1NC3A 2ZUWA 4KXXA 2GAJA 4G24A 2OCDA 2VPPA 4PYQA 3DMRA 1ZM3A 1Z7WA 2QRVA 5EIEA 1B6RA 1D2MA 3OG9A 1EWYA 4H0NA 5HQ3B 3EFEA 4IKOA 3KZOA 3G8YA 3O95A 3Q1LA 1T1RA 1YONA 3TR6A 2CD9A 4DV1B 1T6ZA 3KJXA 1B3RA 3X1JA 4A5SA 1LBHA 5I9MA 3VZBA 2FXIA 3T12A 4H4EA 1GCAA 4OHMA 2WK1A 3QH4A 1CIJA 2A9VA 5T67A 4DZTA 1N5KA 2JVIA 1IG0A 4DLPA 4HH0A 1TVKB 3C14C 3T52A 4HZUA 4TTIA 3WBKA 4Z0TA 4FB4A 4CW7A 4WASA 4GKVA 2UUCB 4YFYA 5A62A 4ZEMA 3CZMA 1RWPA 2PKWA 3LT1A 2WJWA 2AJTA 5L45A 2C7PA 5AJUA 3ETJA 3K05A 5IM5A 4RVUA 5SZJA 2Z5LA 1GTG1 4UM7A 1XXHB 1T36B 4W9NC 3S2IA 1LF5A 3NHPA 4L02A 3IPAA 1X39A 4C0QC 5FFFA 3IX7A 1DBVO 3SX0A 1ZI9A 1KFBB 3IAAA 2JI4A 4JT8A 2WQ7A 4KE7A 5B1IA 1HTBA 1IU9A 1P39A 1LVGA 2MMCA 3GA0A 3ZU3A 3M6AA 2QM0A 3U3MA 3EVGA 2BFNA 3MOGA 3I62A 1G64A 1F4LA 1GR0A 5M3BA 1PUXA 3TIFA 4QXOA 3V32A 3KQOA 2GWHA 4K6MA 4LWOA 4BX2A 5KSYA 2ORYA 2R1UA 4BRUA 8MHTA 2EKZA 4I1YA 1YS1X 1AK2A 1MO6A 4YQYA 5DM1A 3ZDXB 1P0QA 1CUWA 1NYRA 1S9HA 4Q7QA 1A77A 5BYBA 1PTKA 4AS3A 3Q6MA 5HCNA 4CQNA 4OBEA 1YAJA 2C5BA 3Q9SA 3PNSA 1T2UA 3E9YA 4IILA 4LJ8A 1WJGA 5GONA 3SM9A 3T5DA 1U6IA 1F2DA 4WBNB 1DIHA 1YACA 1NTOA 1G41A 3P4YA 4GI5A 4PC2A 3UJ8A 3ZBQA 1C9YA 1UZAA 3AF5A 4EYOA 1KPGA 1OX4B 4O1IA 3ORFA 4F4UA 3EZYA 2GYYA 3FTQA 1XMIA 3HXTA 5IHXA 1F06A 1EXWA 2VQ3A 3I0ZA 2XMGA 5IZ4A 1MRNA 1SQ6A 6REQA 2VF7A 5CTAA 4C6RA 5CHEA 5HE8A 3WISA 3MK31 2V7TA 2RAUA 5CW2A 2ZVJA 2RE8A 4C7KA 1EHIA 1JW9B 3NUGA 1QUEA 3KSRA 5IZCC 3S6JA 2AVNA 4PHFA 1JFVA 2HJ9A 5JD4A 2FR1A 5HTOA 3EF3A 3KLBA 1SPBS 2ABWA 3COWA 3EXG2 5AHOA 1DADA 5REQB 4R71A 3E7FA 1U1CA 3KD2A 4HFNA 1RHRA 3BTOA 1IPFA 3ZHRA 4IV5A 4C07A 5J4LA 1NJ6A 1WCXA 2SCUB 3EXFB 1KJNA 3HB5X 1S2NA 4NEGA 3ZV5A 4YT8A 2JK0A 2BGKA 2YYYA 3KOWA 4UHEA 5BQ5A 8LDHA 3HR8A 1TJ4A 5G0SA 2RHBA 1SUSA 2ONYA 2GZHA 4M76B 2CLSA 4Z5XA 3B6ZA 3U7QB 1ZISA 1NAIA 3VJKA 5CA0F 1BXZA 3IIMA 5HF8A 1E3WB 1JG4A 2BFWA 2QW8A 2ZI3A 1A71A 1Q11A 4XW2A 5E6SB 4C0WA 4FEGA 3C24A 4V0QA 1IZYA 1E9FA 2C97A 3H2JA 3WKDA 1UM9A 4NJMA 4BEBA 4R1NA 1N2ZA 3ZWDA 4H7FA 5B6JA 2D1YA 4EDHA 1ZK3A 3JZDA 4L3WA 4YJGA 4N12A 3AY3A 3E05A 2Y2VA 4EENA 4Z8XA 1WD5A 4FKBA 3THWA 5LLDA 3B70A 3EBPA 4PC1A 3W2HA 3CZPA 2VG8A 4GE0A 4GKKB 2WUGA 3CFYA 4MMYB 2EBHX 5IMBA 1C3LA 4CHTA 4G0UA 4MYTA 3B3JA 4J2OA 5K3AA 4LOIA 5D86A 4C0XA 4JWTA 3BDIA 3HH8A 5DF1A 1YQDA 1C3EA 5HS4A 4CIWA 2P6MA 3KDAA 1N6IA 1UWLA 4EY4A 1E2FA 2G4VA 1BXGA 2X5XA 2PPLA 5AJZA 1J1IA 2NTJA 2H1WA 4P2BA 1ZMTA 3A4TA 3R0VA 4ZQFA 3RSOA 3STVA 3A04A 4JYAB 4OJKA 1RZVA 2VXCA 3RVNA 3X1YA 3GRRA 4Y0NA 2B82A 2FN4A 2XZTA 3FVWA 3TZKA 4YR9A 1SKBA 2ONKA 4IG9A 4U6NA 4DXAA 4U8GA 3OF2A 4NZMA 3R3HA 4UQLA 4FFLA 1LDMA 4HLNA 2R1TB 4FGWA 2AZMA 4OIMA 5CVTA 4TZ0A 2V4UA 1NBMD 3EOZA 4LXHA 2V7XA 1DAGA 2CZGA 2PVPA 4M36A 1U8ZA 3HDHA 1VJ5A 1YVEI 3M3HA 1FLDA 4X93A 4J7CA 4F46A 1R37A 2GEBA 4OHZA 3JQAA 4U4AA 1PNRA 4XEUA 2WAXA 1ZIXA 2JGRA 4GLJA 4O0MA 3EGXB 1ZQ9A 2ZB4A 1JT9A 5HEKA 3RRXA 2ZWMA 5CB4B 3LRPA 1BCSA 2FN9A 1FX0B 1E9BA 4H0CA 4EW3A 2LXNA 5EKXA 2I87A 3BSSA 5CXQA 1LPSA 2HW8A 4NZPA 3WRXC 5FADA 1UJMA 3FDIA 4JUAA 3UT5B 5IULC 1YA6A 3RT7A 1AK9A 2ERXA 4Q3BA 2E18A 3AM3A 4OQYA 3I5MA 1ADFA 3HYCA 3JU3A 3M0EA 3ISJA 5F52A 1QC5B 2BTQB 3VISA 3RT9A 5BMVB 4FIDA 3CU5A 1XLUA 2PQ2A 4GRIA 3C5EA 3V48A 3AO0B 3GH1A 4XCQA 4B2PA 2C29D 1G8SA 5AKXA 1QAMA 2BUAA 4TTAA 2IH4A 1H2EA 4HDSB 4JLOA 1M6HA 4C4TA 2BKEA 2Y05A 4L9SA 3M1YA 1N1EA 3PHBE 4PPQA 4WXPA 2IE0A 4DLZA 1ZU5A 2HY7A 1TM5E 3NT5A 3GLSA 1WTAA 3S68A 2CVOA 1YB2A 2GZMA 2OG1A 3K6KA 4G1VA 2VUIB 3U3KA 1CV2A 1P7VA 1YIAA 4F60A 4K9SA 4EKYA 5KHOC 3IMKA 4LZLA 2F1JA 2FETA 1GQ2A 1KBQA 1H1TA 3OO0A 5BMOA 3KHSA 1G21B 3SHOA 3V00A 3VR4H 4BOYA 2B20A 2Y0EA 1KDYA 1VYVA 4FNGA 2HEGA 2BEUB 3W3AA 4OQPA 1S0UA 1XNJA 5IXSA 1FSPA 4IRUB 2E7ZA 3HUEA 1K7YA 4QPCA 1GNSA 4BVFA 4P80A 1Z3IX 2H29A 3D3WA 1J9GA 5LDDC 5AJTA 1WPRA 4Q9LA 4N5IX 2XA2A 2FX3A 4HX2A 1A8HA 1B43A 4MI9A 4W5NA 2VJNA 4R0NA 1BFUA 1E1RD 1JTEA 1QHHA 3L1IA 1NXPA 4UEQA 4A5OA 2GAOA 3HRIA 5KS2A 4CEHB 2ZYWX 5AW1A 3AF2A 5KTMA 2OD7A 3H5AA 4L72A 3UMGA 1R0RE 3SJAA 1QHNA 3H16A 3WP1B 1NFRA 1W29A 4HJXA 1T9KA 4DA7A 1A8SA 1ZK2A 2H65A 3T35A 4Z4GA 1UFKA 1RHKA 4ZDWA 1XTBA 4XXHA 5TY0A 3WSWA 3PNMA 1L4HA 1MRZA 1SXJA 2FPIB 3WGKA 4C6TA 4LYAA 3ZGZA 1JNYA 1FDOA 2JGAA 3TJZA 4DY6A 4QECA 3CZ4A 1Z2CA 5DBIA 5SY4A 2HX1A 3V2UA 5JMOA 1T2DA 5L53A 2OQRA 3OHSX 5K8IA 1TIKA 2QVYX 3A6GA 1H94A 4F06A 2B1RA 3ZJUA 2XEXA 1PNVA 2LKDA 5DMXA 2D06A 2AFIE 4YCMA 1E7SA 4UOEA 1Y1PA 1TDJA 3V6MA 2CJWA 2WWHA 4NNPA 2PYDA 1KO1A 1IB6A 2JAXA 2ZP1A 2WSSA 4DR2B 2OFFA 3MRTA 4HAYA 3ANMA 4D79A 4WKGA 2GXQA 1JUDA 1XZQA 1IUKA 4FINA 4PNZA 3ZN2A 1SBZA 3LT0A 1I51A 4Q9HA 4AJ2A 1YA4A 1IOZA 4B35A 3KFXA 4WKOA 2JIRA 2CDNA 1NL3A 1YFZA 3I1JA 2AFIB 1PDWA 4TYWA 4NENA 2I2XB 3AR3A 5LZ7A 5BSHA 3EISA 3F47A 4LE1A 4W5HA 1TADA 4HZIA 2HYIC 2ZI4A 2CMGA 2Q27A 3GZJA 3H75A 2EFEB 3G5UA 1H93A 3FPSA 3IUBA 2PVCA 3HCFA 2BE7A 4MQMA 5AJWA 4JLBA 4WN3A 1FTWA 2ODTX 3WRXA 2FPOA 4RPKA 1SBIA 4HEJA 2ZT8A 4EO4A 3C4QA 2GM3A 4F96A 1RYFA 4JC0A 3FROA 2OV2A 4F5YA 4XLTA 4O2BF 2JASA 2O1EA 1SU7A 3BE6A 2WWYA 1H2AS 3H9BA 3KZVA 1FW8A 1W5AA 1XWWA 4G2NA 2JIMA 3KYJB 1Z4LA 4NMXB 3JASA 5DSZA 1XZNA 5F7JA 2LGJA 2VQ6A 2B7BA 1I10A 4QODA 1KJIA 3RSCA 1IRXA 2QVGA 3ZDQA 1WETA 2VEOA 4TXMA 4YLEA 2CXOA 4ROTA 3O8RA 1V41E 4CLOA 1IEWA 4AMZA 2ODWA 4XLLA 1ZC3A 2CF5A 4H59A 2IEBA 3O0TA 3CLVA 2INGX 1UQRA 3V8PA 3ESAA 2QV7A 4R84A 4LF4B 1U3WA 2ZJ1A 5DSTA 3RD5A 4CUZA 3JATA 4DQXA 4XJSA 1SCIA 4E2XA 4OB7A 3MC1A 5EP1A 2X22A 1L7AA 1UPBA 3PFBA 1XFAA 2AGVA 3KB1A 1NN3A 3KJQA 4LJ6A 1L5MA 4NBNA 5L6MB 2H5JA 2CJYA 2A4KA 1TQHA 1PSZA 2RHLA 1ZFNA 1WSWA 2A94A 3MVEA 4GSYA 1WQ1R 2GKOA 3LF1A 1LFAA 5B64A 1RRVA 4X85A 3J81A 2JLUA 1UBRS 3BJIC 3OE7D 3QKSB 1V5WA 2H2GA 4UBJA 1XZGA 1A7KA 2I3DA 1IMOA 1J8VA 1GZHB 3M5WA 2OBXA 4WNCA 3KZ1E 4FX2A 2PZAA 3LY8A 4V3CA 1NRIA 5LJIA 1OH8A 4LMBA 5EJ5A 5BWCA 4US2R 2AOXA 3QF4A 4CCYB 1LBQA 5KYYA 1CUVA 1T2EA 2QK4A 3EW9A 4H1VA 4M9RA 3WGVA 4DR3B 4E1BA 1KP3A 1B3BA 1II8B 2PR2A 3FETA 3OOSA 2OQVA 4BFYA 3FCSB 5F78A 1N77A 3INNA 5LA6F 1JMYA 5BSWA 3VO1A 3DOIA 3WL6A 5HILA 2IXAA 3K0FA 2A33A 5D2CA 1VSUA 3GLGE 3MT0A 4YALA 2BFEB 4BGVA 1FLAA 1BMTA 1T1JA 5KHAA 4KBGA 3I9FA 1PR5A 1LGYA 3DLAA 1WSDA 3FBGA 4OFWA 4XDHA 2DVMA 1Y1QA 3OT1A 4YAEA 2A0FA 1OA0A 2NVUA 2WD7B 2XOKA 4UTPA 4HLDA 4N3BA 5LD2C 3TNFA 1WHSA 1YWGO 1WDMA 3DMPA 4KVFA 3ZGYA 1EBUA 1CZRA 3FIUA 3MUFA 4G0MA 1T5IA 3PHCA 3P1JA 3C1AA 3L4EA 3IR7A 1AG9A 3QPVA 2H7YA 3NHJA 4QOFA 2VP6A 5A9SB 4IFIA 4O3MA 1DCKA 1JKJB 3D7NA 3MCTA 4P0TA 1U2RA 1LF0A 2GHIA 2IVFA 1Z47A 3KKQA 2OA0A 1S02A 5DNCA 5F3RA 5C35A 2ZUFA 2XBLA 1E9CA 3H9QA 1TF5A 3P2EA 4GZMA 3OFJA 1KAHA 4HNSA 2C4NA 2ZK7A 3Q2IA 4P83A 2XNHA 3BB1A 3M4NA 2G9UA 3B2QA 3R7NA 1Y9JA 3JAWB 4I4LA 2GT1A 4XH9B 4ER0A 3LX8A 4XIGS 1XMOB 3WKAA 3BK2A 3O4IA 2G17A 4P3YA 5FTNA 2CXRA 5GTDA 1JSZA 1UFVA 1XDGA 3P2JA 2Y2UA 3H2IA 4CXMA 5C52B 4L8LA 3RQSA 4KTTE 1Y6JA 2YR0A 4A8JB 4BFWA 1A98A 4PBRA 1ZLYA 4R2IA 1LRLA 3UAGA 4FWBA 1DTSA 4LS3A 3WIEA 1IWPB 2FZVA 1GDTA 1K88A 2EJUA 2ZCVA 3SJ7A 2YOFA 1O2DA 3L0SA 4LC0A 3HJTA 2JCBA 4QTZA 3IA2A 2XT9A 4BVEA 5KQSA 2J5KA 3J80A 1N8SA 1ZXBA 4JHLA 5CB0A 1YB4A 3LVFO 1CZNA 1EJ2A 3EA4A 1UBUS 3GXBA 3LIIA 5AK6A 5HCUA 3T7CA 1FYXA 1VA5A 2MWMA 2X2OA 1ZD1A 4OXKA 1DMRA 1G5FA 5NULA 1MQAA 1H1LB 3GFPA 3DQPA 3O4HA 4INJA 5ISMA 1NMXA 3FW1A 4HAXA 3U49A 1NSFA 1W4BA 5JWHA 3ZWBA 5DNYB 4MGYR 1T6YA 3EVBA 2MINB 2IJGX 4N5LA 3GMIA 1VE6A 4EY3A 3RWOA 1TC2A 4JMPA 5F5NA 1T9CA 1B0AA 4Y2HA 1VZ2A 1YQUA 1NUHA 1SQGA 4IOMA 5TRTA 3RROA 4D5GA 1M0TA 1JYSA 1C0PA 1HG0A 1D0IA 2XMQA 2BGGA 4NIMA 1R0CA 3GROA 4TV8B 4ZC1A 1HA3A 1GPKA 1BYIA 3KG2A 4WX2B 3RRBA 2W2XA 5TV2A 1K0UA 5KJ1A 2PUAA 4CMEC 1LS6A 3VZDA 1C3OB 2V6MA 1EB9A 3HPQA 3WRYC 1L9XA 1J8FA 2CYCA 1TCCA 1ZYUA 3D7MA 3O8OB 4AO6A 1C1DA 2H8GA 4OSOA 2BM9A 2D5CA 3ED1A 3MBKA 1QO0A 3TPCA 3TQTA 2BHSA 2J9ZB 5KWEA 1QRTA 2ZBFA 1RXWA 3UWOA 1D6MA 4AKEA 1HQKA 2DE0X 5FPQA 4DCGA 5BR4A 1C8VB 3M2TA 1E8MA 3HSKA 1UKCA 1Z75A 3HY3A 4AFNA 1E92A 3F67A 1AKYA 3U31A 4FI3C 3AZQA 1IPEA 3CHYA 3ESDA 4OQLA 1T5TA 3C15C 2O3QA 3B8EA 3DNPA 3D6AA 3VR6H 4DC0A 5I01A 1WZNA 4QGAA 4HDRB 4NH4A 1YI1A 1T9AA 2C59A 2I80A 3VKVA 3ZCTA 1Z6AA 2ERYA 2V5UA 4Z9YA 1G4HA 1RC0A 2OBFA 2JBHA 3NTQA 3QOYA 3TL6A 1MV5A 2Y1GA 5HZMA 3TQQA 4K9RA 3OIWA