2R8SH

High resolution structure of a specific synthetic fab bound to p4-p6 rna ribozyme domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
224
structure length
218
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNLYSSSIHWVRQAPGKGLEWVAYISSSYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRAAGMSTYGFDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P4-P6 RNA RIBOZYME DOMAIN
publication title Synthetic antibodies for specific recognition and crystallization of structured RNA
pubmed doi rcsb
molecule tags Immune system/rna
total genus 48
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2007-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r8sH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r8sH01
1U93A 3DJ9A 4PRAB 3BXNB 1TETH 2LABA 4OFYD 4WFHD 4ERSL 5F93C 5TF1H 2OSLB 3FB8B 4FMFA 1CFSB 4OV5A 3O4LA 5DHYB 1U8PA 2FHBA 2NY2B 3D39A 4YPJA 1R3LA 1I8LC 4N0YL 4FZ8H 4PJBF 5I1LA 1HSBB 3VU2A 4AH2A 5ICXA 4LHUD 5EORL 1ZLUH 4X4MA 1U3JA 3UJJL 3VXMD 2A2QT 5ILTH 3ZKNC 5IFJB 4LARH 4KWUA 1F4WL 4M1GH 3VFGH 3D85D 4C56B 2ADFH 2Q3AA 2X89D 4I0PA 1KTLB 1KCUH 4NQDD 1P9MA 3VD4A 4Y19A 3P0GB 1FIGH 1FZMB 4XMKH 1UZ6F 4FQPA 3KYKL 2EYRA 3PJSB 4PP2B 3M17B 4HJJH 4LSVL 5KS9E 3VXRE 3PUCA 2D7OA 1OL0A 3TFKC 3GNML 1QRND 3I02B 3DX6B 3PHQA 1YJDH 5TH2A 5BJTB 4NWTH 5D7SH 4JO3L 5IROC 2ZCHH 4OZIB 2YOCA 5DJXB 1MHEB 5J6HA 4M62L 5BRZD 2JB5H 3WHXA 4FQCH 1J10A 2VLKB 3U79A 4AIZB 3S5LB 2PYEB 3ET9F 4NQTA 3OAZK 3G5YA 3QUKA 3DBXA 2VMFA 2V17H 3C09C 3QIUD 2FH8A 2A6IA 2ESVE 2QSQA 4WTWA 3TT1L 1DCLA 4HBCL 2EIZA 1J18A 3DVGB 3ARQA 1ZVHA 5MENB 1FFNA 2VQ1A 3IJYA 1OGAA 1LMKA 5EN2A 3W11C 1FL6B 1XF4A 5FYJU 3P9MA 4JZNA 5DURD 2NY4C 2P45B 5TJWK 3TVMA 4KKAD 3C8DA 1A9BB 3V4UH 3VFVB 5F71A 1TVBB 2YPLD 2GAZB 2VLJB 4W70A 1AGDB 3MRLB 3C2AL 5MEOA 1K9TA 2HVJB 4FTVB 3LKSA 4Y4HB 2R9HC 5FEBA 1HE7A 3MA9L 1LNUA 4A6YH 3WO4C 1B4RA 4DN4L 1QVOA 3FOMB 1T2JA 2IGFL 3BUYB 2UZIL 3QXWA 4WO4B 5F9WC 3MQIA 3OL2A 4OB5L 1SEQH 2E3VA 3PWPB 4OZFH 4XPTH 1M05A 2JB6A 1ZHLB 5HGAA 4A6YA 2Z92B 1LEKB 5B22A 4D9RE 3QJFA 1N5YH 3DVNB 5EBWB 5IV2A 1D6EB 2F58L 4LSQL 4JREB 1P2CA 2HH0L 3QH3B 5I76A 2IFFL 5JIIA 5EZIL 1VFBA 4WW2A 1YEDA 4HJ0C 1N26A 1LO2H 1S78C 1ZLWK 3MV9A 4I4WA 4AIOA 1JBJA 3QPXL 2E7BA 1OGTA 4TSAL 2NYYD 3NABL 3FO2B 4NQEB 4Q6IC 4RFOL 5C6TL 5C9JA 1BHGA 2NXZD 4RQQB 4TUOA 5I1EL 5JLZA 2FEDC 4GAJL 1IEBB 1S5IL 4Y4FC 1LWRA 5I1HL 1YC7A 4B5EA 3ULVL 4YDKH 1NC2A 1OHQA 4UOW0 1F3DH 3IDMB 5I19H 2X4PB 4BSWA 1T0PB 3OG6B 3QI9B 1LO3L 2H2SC 1KB5B 2A74A 4MJ5A 1GHFL 1QBLH 1YY8B 4PRPA 2FIKA 2GITB 1FO0B 4HZLA 5GGRB 5IK3B 1T2XA 2R0KH 4H5SB 5KN5A 5HI3C 4LK4A 4ZSOA 3SE4C 3QQ3B 3H42H 3N1GC 3GJEA 3JWNC 4P5TB 3BP4B 1P69B 5I30L 3QUZC 3CH8A 1DBKH 1NAMA 1HOCA 1WZ1L 2VE6A 4X9BA 4G6AC 3VGAC 4MAUL 2JTDA 3QNZB 1RHFA 2AI0H 3EYFA 5L2JA 3ZZ1A 1MRFL 2PYFA 1IJ9A 3HE7B 3H3KA 2IBZX 2P24B 2WLYA 3QWRA 4I3RH 4QRSB 3G6JA 1IKFH 1ZHNB 1MHCB 3QDAA 3EO1A 4XZUA 1G0YR 3LOWA 1CD9B 4HMCA 2OR9L 5C6PB 5GGUB 5DEGA 4P5MB 5C1MB 1UKTA 5DMGC 3S98A 4P2RD 2AEPL 1G0DA 1S5HA 3EOAA 3QDMB 3KXFD 2EXYD 3PQYA 3LRGA 4M6MH 3WKNA 1YPZA 3BIKB 4IS6B 4LSUL 5MERB 1DQQB 3LEXA 5T3XH 1DTUA 4K9EL 5DJ0A 4XX1E 1QQDB 4JQIH 5F1IA 5IVXF 1FSKC 1I3GH 2QSCL 2YPVL 4PJIF 5D5MA 3DTXA 5C07A 3JV4B 2OZ4H 2Q6WB 1JPTL 3ARGB 1T03H 1JTTA 3VGGA 3WXWL 1H3PL 4LIQE 1F90H 4NQUA 1U91B 1DQLH 1M7XA 2VL5B 1UVQA 2LV4A 1JZ5A 5FA4B 2YPKA 2OZ4A 2IAMC 2NZ9C 1F3DJ 1ZT4A 1S9YB 3V0VB 3MCKB 3RUGE 1J8HE 3U4EA 2JJUA 3NA9H 4Z7NE 2FHFA 4R97B 3KPRE 3I6LE 2R69L 4PGBB 2WUCL 5C0CD 2JK5B 3Q6GL 3BKJL 3TWCH 4YHNB 1MHHA 1HEZB 2FECL 4RAHA 5F97E 4RMTA 4OCSH 1QPPA 3CSBA 3NCJL 4NRXA 5BOPA 4IHOB 3SDDD 1X7QA 4U6YB 5DQDH 2PO6B 4Q9CA 2F54A 5I1AB 3U0WH 1GGIL 5T5NG 1OAKL 3I2CH 3GSWB 1D5ZA 1YMHA 2XNAB 3O4LD 2X2YA 3WUWB 1KFAH 4ODWB 1IEHA 4DVBB 3WMSA 4DAGL 1HHIB 1GZQA 3VXQA 1I7RA 4OD1L 3CVIH 2BY0A 4I48A 1EFXA 1ZA3A 5CBEB 4J1UA 1GVIA 3MSPA 2RJMA 2J8OA 1WLHA 2GTZA 4U31A 4EDWH 4Z0XB 1UADC 2V2TB 5D96C 4L4VB 4XC1H 4ZAKC 5L0QB 3IDNA 2PNDA 4LCWE 2AJXL 2HMID 2FLBT 3U0PA 4EDXA 5IFAL 2UY7A 1GGBL 1HHGA 3IFNL 4WW1B 4ZUUB 3NTCH 2NCMA 4AT6B 4XPGH 4NQXB 1ZS8A 3VI3E 1OP3K 5E4IA 2YC1B 2P44B 2RBLA 4G9DA 5DQJB 2E9WA 4W81A 3QXTA 1TTUA 2Q76B 1MCSA 4UINH 3B3IB 5CEYB 3TF7C 4UV4L 3S34H 2E6JA 3QIBC 9CGTA 3OGCA 1YQVL 1BD2B 2GJZA 3B5TA 1OGAD 1ZANL 3B2UC 5B3JF 4QWWC 5LAXB 5IBLC 1BVLB 1U8NB 4PJEA 4X6CE 4ODBD 3TVMD 4M43H 5J13B 2VERN 3CC5B 3ARPA 2QBWA 4KROB 5DRXA 4XCYB 4KJPD 4TPRL 1F2XK 4C4KT 1NCWH 1MLCB 4LMQI 3WJLC 4O5LL 3TBSB 2P5WB 3BMVA 4K7PY 5E08H 1P6AB 2DQHH 1A6ZA 3KLSA 3U9UA 4N0FB 1P1ZB 1INQB 4YH6A 1RFDH 1R0AH 1UXSB 1UJTA 3G04B 1JGLH 2ZUQC 5FCSH 1OVZA 4XP5L 3WS6C 3CJJA 4LEXL 2NZIA 4Z7OE 2CGRL 5EA0H 5KJRL 5HGBB 5SWSA 3GM0A 3D39E 3QR2A 3IRPX 4KUCF 5I6XC 2Q87A 5DSCB 3DHMA 2IBBA 1FCCA 5B21A 4TN9A 3JTTB 1AR1D 1AI1H 2R2EA 1YNTA 2C4XA 1MCDA 1JNLH 3VFWA 3LS5H 3F5WA 4ZNCD 5A1AA 1AHWB 4KV5F 1XR9A 1MCBA 3CH1B 4JDVB 1GGYA 1IGFH 2D2OA 2DQFB 3BQUB 1NFDB 1NMCC 1RZJH 3EGSB 5B8CB 3CU7A 1T7WA 4HUXB 3MXWL 4Y19E 4ZYKA 4XRCA 5IOPA 3RPKA 2DD8H 3T8XA 1T89C 3WIIH 5EWIL 2OBGA 4XBPA 2VDMH 3U4BH 4DQOH 5I74B 43CAA 1NBZB 5KVEL 1WT5A 5INCA 1MLBB 4FZEH 4OZHA 1EV2E 3MUGA 5F7EL 4GKZB 4NPYB 1NC2D 2GT9A 3UTTB 2HT3D 1XGUB 5IEHB 2EDDA 5I17B 3N50A 5ICZB 4MNGA 5FUCE 1RZ8A 3AS1A 3ROOA 4GKSA 3HR6A 4DEPB 4UT9H 3EJZC 1H15A 1TCRA 1WCQA 3NACH 4KK5C 2AEIT 3WSQH 5AG8A 1K2DA 3H9SB 4EUPA 1YYLL 3BD3A 1PX4A 1G9MH 3PGFL 3O6KH 4XNMA 3WXVH 1U8MB 3V5KB 2Y23A 1AIFA 1OGAE 4PRHA 5FF6B 5E6IC 2V5YA 3FN0H 5E5UB 1VADA 3U46A 1FGNH 4YWGL 3SOBL 4GW1B 4XCNB 5H8DA 4HBQA 5DA0B 2LAGB 2AJYL 2X4QA 1KLUB 2DYPA 3D18B 5DF0A 4IRSB 3N1QC 5FYKU 2O93L 5F6IB 5FDYA 2D31A 4GBXA 3S7GA 4PJXE 4CMHC 2OL3H 3U1SL 4JRXA 2YD6A 2DJSA 3QWRD 5I16B 3QFJB 4IOFD 3E2HB 4LU5H 3VRLE 2R56L 4LSPL 1KGCD 3PWJB 4FQXD 3ZT5A 3QNYA 3TV3H 3MJ6A 1L9MA 1LP9E 2OL3A 5HJ3A 2Y1VA 1EAJA 1MRCL 5JHDA 4F33B 5C0AD 1WCBA 2A83A 4FHBD 4RGNE 1JHTA 1HINH 3ES6A 3PQYD 3DLQR 5DJAB 3SDAA 2AJVH 4Z7WF 4AENB 4HWZB 3TN0B 2XG4A 1R5IB 3A6OA 5C07D 3HI6H 1ZLSL 2CKBB 5C08B 4DGVH 3FQNA 4N8VB 5CEXA 3MV9E 4E42A 1IC5H 4QRTB 1PG7W 4WIQA 5T3XD 5AG9A 5DFTA 2DF3A 4OF8A 4N1EA 4JKPH 3OZ9L 3TH2T 5H2BA 4IMKC 3CDGA 5SWZA 1U92B 3VD3A 4PR5B 1OD7A 5IIEA 3GSQB 3NIDE 3B5GA 5EUOB 5HHXH 3KPOA 4UTAL 1XGTB 3GI9H 4LF3B 2F74A 5E0QA 2L7JA 3OAUH 5DI8A 2VC2L 1DANT 2IQAA 1J12A 3WKMH 1Z9MA 2FB4L 4PRPE 1KIUA 3FFCB 3MA7A 4WHDA 1PFCA 1RUML 1UACL 5EUKB 5D7JC 1KCVL 3BDYH 4ZSOE 4QTIL 2NX5E 3H6JA 3QHFH 4AJ0A 3MCLL 4NKOA 3TNNA 3QULA 1SJEB 3U7AA 3ULUL 1VDGA 4KAQL 1SYSA 5L9DL 1AH1A 4HFUL 3AXLB 4JG0H 3TO4A 2VIRB 1A3RH 5TDPB 5KW9L 3D25A 3GZKA 3HC3H 1NGXA 3BHBB 4F7PB 5L6YL 4NKIL 4HCRH 1U6AH 1U9KA 4J3XA 1VGKB 1NANH 3WEXA 3TM6A 1Z0MA 4JKWA 2DLTA 4KUZL 3CXDL 4PJGF 4PJDF 3K4AA 1EHXA 3V0WH 1EFXD 1R24A 1MELA 5GISL 2VQUA 3EDKA 4BK4A 3U7WL 4G5ZH 3MNVA 4MJ4A 4E9LA 4M6NL 3C8KA 3MYJB 4OF3A 5AAMA 3GK8H 2HT2D 4RIRA 4GRWE 3JV6A 4K3EH 2BNUB 3X14B 3W9DB 2B1HL 3QEQA 2EYSA 5KSBF 1NAKL 1A0QH 2GTWA 4D0DB 1NBYA 1A4KA 4WV1B 3QCUH 5IB2A 4S10A 1CXLA 1RIVH 3T4YB 1NDMB 4D0CB 1KPRA 2YZ8A 1X5ZA 1CFNB 4KK6C 1DE4B 1C5CH 2P47B 5JPMB 4JPIB 2NW3B 3KDMA 3ZDYE 1SY6H 4QXGH 1XIWA 4PP1D 5TF0A 2F5BL 3GIVA 4RFEA 2VZSA 1MY7A 1TIUA 3K2MC 2P43B 5IBTL 4NGHH 4NCC2 1KOAA 4PRDB 3NFPA 1IL1A 5HYFA 4R90L 1T0MA 4R2GC 3OB0H 3WHE1 3LMJH 3PL6D 4L8SA 5LCVH 2XI9A 1T4KB 4QHNB 5I1JH 1C5BH 4AG4L 5IW6B 2BC4A 2ZUWA 2VLRA 2NW2A 4LAQH 5ALBH 4ODXB 4OSUH 3S35L 2NY1C 5F1SA 4Y5YA 5AUMB 4X80L 4H88H 5MEQB 2EECA 2DBLH 2C1PA 5EO9B 4S1SH 3U4AA 1RMFH 3SY0B 1Q9OB 3IDXL 2LVCA 3QP3A 4I13B 4NZTH 2LU7A 4PV8B 5CJXA 3L5WB 3DV4B 1OM3H 3KR3L 1QLFB 3GUTB 1I3RA 5ANMB 5F9JA 5FAAA 1BFOB 2X70A 3KPMA 1X6LA 2F54E 4RGOL 1TQCB 4MXWL 5SWSD 3FO1A 3FQUB 1KNOA 5DUML 3WFDL 2EDFA 3QUXA 4MYWB 4YHPB 4K7FB 4RNRA 3NFSL 3PGCB 1MCQA 4OZGF 1WUNT 3LV3B 3RZCC 4IOSD 2CDEA 3QDJD 2K7QA 2AJUL 3EYQD 4NN7C 4L5FL 3T4AA 4LASH 5B38B 2RR3A 2DKUA 3T0DA 1INDH 2VXQH 5JNYA 4X5XA 5FIEA 5EU3A 3E6FB 2QQNH 4XP9H 2G5BA 2V5TA 1F5WA 3HZYA 3IJHB 1DN2A 3LKRB 3DI3B 3VMNA 5F7KC 1J5OH 3C60A 4L8BA 5DJDA 4M6OL 3NAAH 4O02H 1GIGH 1VB9A 1I9RH 4QOKA 3DOSA 1HKFA 2X41A 1NGZA 2AGJL 4P3CL 1LDPH 1JI1A 4JJ5A 3KYMA 5FA3B 1MCOH 1FAIL 5IF0B 1I7TA 4LKXB 4FQHB 1DQDH 3F58L 3WNMA 5D2NB 5FO9B 3T08A 4HG4K 1IGTB 2BVOA 4A2LA 4UIMA 1K8DB 3VGDA 2BHYA 2YBRB 3ZE0F 1VFOA 4K7PX 1XCQA 4JZOB 4MA7H 3X13B 4PD4J 5F89B 4GXVH 3L7EA 1I85C 2DYPD 3GSNL 4LNVA 4X7CC 2V9TA 3LPGA 4YO0B 5C0ND 4HKBB 1JPSH 3ARRA 4YFLF 4CMMA 4HWUA 4UUJA 5AYUH 3MRCA 3PDGA 4GBXD 1KENH 4QTHA 2X1OA 3D2UB 4XHJD 2X9XA 4EN3C 3PWVA 3GI8L 2GEEA 4JRXD 2DTMH 5K33A 4H1LB 3Q6FA 4Y4KB 4MB3A 2VZ1A 5EZLB 3W39B 2AEQL 3QFDB 1EK3A 4Z7VE 5SX5H 1QFWI 4HXBL 4NJ9L 1YEKH 4F15C 4E0RA 1F4YH 5AZEL 4KKAC 5JHDD 1T04B 3RVUD 1D9KC 1JGVH 4P59L 3U2SA 4FRWA 1IM9A 1S7XB 3KJ6H 4RA0C 2M1KA 3UTOA 4WI3A 2BVQA 1PEWA 2RHEA 1P7QB 3X17A 4AL8L 1A7QL 3RGHA 4G7YL 1ZT7B 1L4IA 4JFHD 4MXVE 2GJ6E 3QG7L 1KIPA 2H9GA 3HI5L 4NZUH 2F53A 1P4BH 1PW3A 5D1QA 4H8WC 4DGYL 1JHLL 3KLAB 1FZJB 1IC4H 5CEZH 4Y88A 4D3CL 3Q48A 1QFWM 2C3VB 5B39B 1P7KB 4DKEL 5SWZD 3KLDA 2NNAA 3MLRH 1HXYA 3G5VA 1OAXL 4U6XA 3RAJH 2HWZL 4FQ1L 2HVKA 2FBOJ 3SO5A 2DLGA 4MJIA 4G8EB 3RKPA 2CIKA 3KPQB 1EIBA 4Y2DA 5FYLE 1FVCA 1CG9A 4MNHB 4ZTOL 1U36A 3L7FA 2EH8H 5DMKA 1B90A 1ZEAL 4R96A 1ZWIB 4KQ4H 4QHKI 2AK4A 4M8QA 4X9IA 2BY2A 5IB3A 4YHKL 3MV01 2QQKL 2ZCKH 2EDJA 5EC1B 4U1KB 3VG9C 1YMME 4K23L 1I1AB 5CP7A 4G8GA 4PRHE 1QPXA 4AEFA 3SQBA 1YEFL 2NXYD 3BYTA 1MNUH 2V7NB 1CK0L 2YD8A 5ITFB 1DVFA 4PJHF 3A6BL 3QXDB 4OCXH 5F9DC 3HMWH 5CS7A 3GFUA 3RVVD 4HIHA 4K7PL 5EU5A 1PYWB 1H3UA 1S9VB 4L3CB 3QWQB 1I9IL 3O6FB 1N4XH 1M7DA 3QUMH 4H8WL 1EEYA 3HG1B 1NGWB 4O4YH 3C09B 5IHZA 5ADPL 1BVKA 1UB6A 3MRQA 3P11H 3VFTB 1CFVL 2F15A 5EC2A 3KPLA 4KJWD 4PUBL 4JRXE 3TT3H 1I7UA 4KDTA 4XH2B 1CQKA 4WEMB 4AYFA 1PVHA 3DRQB 1NCUA 4HKZB 3MFFA 4UNTA 3RWCA 5IQ7L 5ESQA 4YZFE 2LE9A 4L9LC 2NY4B 3BH8A 1A2YB 3QO1A 2GIYA 4NDMB 3OKOA 3MV7A 1P6FA 2XTJD 3F62A 5F44A 3QEQD 1GCFA 2ZOLB 4GUPA 3SKUD 5HI5D 5GGTL 5CUSL 4OIBA 3NZHH 5F7HA 3RQ3A 3TIEA 1RJZA 1V3LA 3IRZA 2E7LC 1KJ2L 1C5DA 2A6DB 1I9JL 4XCFL 3TP4A 2Z35B 4KGJA 5ICYB 1G7IA 3SKNA 1JCKA 2CD0A 3VW3L 4PLJD 3TBVB 1I8KB 5KBNC 1XIWD 4JRWA 4JAMA 4NOFA 1EBPA 3GSXA 2D03H 1A1MB 1FRGL 4JDTH 4XXDB 2EXYC 3C08H 3VXUE 5IG7B 5SWZE 1N7ML 1UYWL 5ERWB 4WW2F 4P4KA 4FNLH 4UB0L 3RRQA 1KEML 2VLRD 3JTSB 2ATKA 4XTRD 1YYML 3MRFA 4N68A 4XBGA 5F88A 2A6JA 2VISA 3L3OB 5DHVB 1QFOA 1UCBL 4HEME 3KNBB 3FQWB 3ARFA 4P57B 1Q1JH 1U8HB 4HPOL 5K9JH 4LEOA 4Y4FB 5ESAB 3WIHL 1B0RA 4NZJA 3L3GB 5HHOD 3V52L 2I24N 4PJ7A 3REWB 2FO4A 5EOQL 3EYSH 1X5YA 4KTDH 4PG9B 4U1JA 1JTPA 1RUAH 3I84A 4OUOA 5DK2A 1JNHB 5HBBA 2ORBH 4LRNL 1JF1A 2ZOKB 2R0WL 4S2SA 2JIXA 4QRRE 3QUXD 5IGXH 1FPTL 4ZD3H 4LMQE 4M48H 5DD6B 4G6KH 2MTPA 1MCJA 2X4OA 4QY8B 1A7NL 2B0SH 1L0YA 4NO2A 5FGBA 3SDDC 2BJML 3T3MF 3QUZB 4OGXL 4HX1A 2VDQH 1G6RL 2ED8A 3IFLH 1ZHKA 4QF1B 5EOTA 4WENB 5CJQH 3VXSB 1F97A 2I60L 1U8IB 3S8WA 2ZPKL 5BV7L 1BWWA 5GS0L 2Z93A 3LKQA 3QO0B 1TZIB 1Q9LB 1CDHA 5BZDB 5ID1B 2ADGA 3CFJA 1ZXQA 5J1AA 2LU3A 4PRNA 4XBEH 1P9MC 2QR0B 2XQYG 3KWWA 4R8WH 3UEZA 4TRPH 3FT4B 4FQQA 2IALB 4KJQD 1II4E 2HMIC 3BT2L 1GYAA 2H41A 1NMBH 2EYTA 2Y7QB 3P73B 2XZCH 2A73A 3ARDA 4G6FD 3MUZ1 3ZHDA 1IE5A 5E2WH 3H2WA 1S3KL 4YPGA 4OZ4B 4NNXA 1G7LA 2E27H 3AFLA 3QQNA 3QHZH 2HT4D 3IS0X 4RDQG 3TBTA 1SEBB 1YUHB 5FHBL 4OLZL 4S11A 5LGJB 1YJDC 1HXMB 5KSUA 2OI9C 4P9HL 3ESVF 1BJMA 1ED3A 3IDJB 1NBVL 4F9PC 5I18H 1EHLH 3UX9B 1UZ8A 1XGRA 4ZPVB 1K5NA 4KXZH 5HPMA 2BNRD 3MLYL 1VESA 3L6FB 4G6MH 2AJZB 3QWOA 4I3GA 5TF1L 1JUFB 3TVMC 1QR1B 4O2EA 1A7RH 1KTRL 4N9OB 3KPSB 1IM9D 1FZOA 4HK3J 2WQRA 2IPUK 3O6LH 4FZ8L 3HPLB 4KJPC 3TBYA 5J6GA 1RZIB 4MSWA 1EGJH 3RL1A 3RVXD 4GAGL 2QKIB 5GPRA 1UEYA 5ILTL 1PSKH 3T0ED 3HMXH 4JFDE 1AXSB 4M1GL 4KMQA 3VFGL 2IF7A 4QHLB 2ADFL 4X0KA 4NO5B 4ZFOL 1X5AA 4LLMB 1U3HA 3VRIA 3WE6B 4RMUA 2F53D 5D1QD 1EGJA 3L5HA 4I5BB 4KKBD 3RNKA 1H8NA 2X10A 1HH9A 2J8UA 2X7LB 3OKKB 2V2WA 4HJJL 4HW6A 3IXTB 1JN6B 3N1FC 4Y5VC 5DJ6B 1TZGH 4RA3A 5JIKA 1RJLA 3EFFB 2E7HA 1YJDL 2CMRH 1G7MB 5FB8B 3FT2A 2W9DH 2ZCHL 2LVEA 1AR1C 4WW2C 3GJFH 1JK8B 4AEHL 5CEZD 4MJID 4QOKE 2YD3A 2VABA 1QLEH 2JB5L 4Y2DD 2FNBA 4FQCL 2X6MA 1HHHA 2AQ2A 2EDHA 3BKCH 1CGXA 4ZAKB 1I1YB 2AK4D 2O5ZL 3KYOB 5BO1H 2M2DA 3R0MA 4WY7H 5MP6L 1OPGH 1S7WA 5CBAB 1LO0H 4G8GD 2Y36H 4Z8FH 3EUUA 4HF5H 1KTKE 2GSIB 2H32B 2CLVB 3PWLA 2YA0A 2HT3C 4OAWB 3V4UL 2VLMD 3BIAX 3DMMA 5E8NB 4ORGB 4X4ZA 4YXLL 4R3SA 4V1DB 2NY0B 5DMIH 3VFOB 4GG6B 4NNYB 3DUSA 3ALXA 1PEZA 3HNTH 2BSSA 2CPCA 4WWKC 5FKPB 1LE9A 4A6YL 1AGEA 5TE6H 5CSZB 2F19H 1VGEH 4JM2F 4P46D 3QIBB 1Q9WA 2XWBB 4K55A 4RMQA 3QUYC 5T33H 1SEQL 5AYQA 4PJEF 3SGDI 4YC2C 1V3JA 2HN7A 2VLKE 5ISZD 1P53A 2HFEA 2ICEA 1W0YT 2N4IA 3AREC 4XAKD 1N5YL 1JGEB 1TJGL 3MV7D 4G80A 3DV6B 3BP5A 5MENE 3HZVB 4BZ1H 1CLZH 1XF2B 2DL9A 4MWFA 3R1GH 4QRPA 1TENA 4LSDA 3UPCA 2EDXA 3DUUB 3FO0H 1INEH 5IR1B 1CGWA 3FQRB 4EI5C 4OD2A 5I71C 3GDBA 4IOFC 3MBEA 4NBXB 3HHRB 3LDBC 2VLJE 4FQXC 4YAQB 3D0VA 2W9EH 1OF2B 1WEJH 5BZWB 3RJQB 3OKYA 2HLAB 4PJ8A 1SJXA 4LLUB 5ADOH 5HHQA 3B5HA 3GMOB 1NFIA 1U3YA 5CP3H 4YDKL 1WZMA 1SJHA 3BGFC 4U3HA 3IKCB 4PV9A 35C8H 2AAVA 3FT3A 2GK0B 5I19L 1D5XB 5DC9B 1WV7T 4FS0A 5F7LB 5IMLB 5DRZB 4ZQKA 1QBLL 2IC2A 2Z8VC 4ETQA 1UWXH 5CP3A 5TPWL 2R0KL 5F9OH 3ZDZF 5J89A 5J8OA 4Q0XL 3IU3A 3ARFD 3OB0K 4NKMA 4OZHF 4U7KA 3H42L 1LEIA 5EB9A 1B4JH 4G8GE 4ZFZB 3QJHA 3C5SA 4NSKA 2X05A 3ARBA 4PTUA 1DBKL 4YHMH 4W4OA 5HVHB 1MUJA 3AU1A 5DVKA 1MVFA 3Q5YA 3BEWB 3LY6A 3GRWH 5C0BB 2I9LB 3EOYG 5E4EC 5D2LB 4ZXBB 2DJ4A 1RZ7H 5C7XH 1DUYA 4CBPA 2HKFL 2Q7YA 1A5FH 2DI7A 2JIXD 2VITA 4DFHA 3V6ZA 5C0GB 4BFEA 4FQJH 4U1MA 3G08B 4NOBA 3GMRB 1KJMA 3GRWA 3MRKB 1QEWA 1KTDB 4RMRA 1KIQB 4C58B 2ZNWA 2NLJB 4YUEH 1UM6L 5E6IB 3PV7A 4HPYH 5C8JB 1FV1B 2CUIA 1KJVB 4LLWA 1OP9A 4XAKE 5IMKA 1UGNA 4J3SA 4LVHC 3JXAA 1MH5A 3UC0H 3BPLC 4M6ML 1T22A 1B0GA 4PJCA 3TEUA 1CZ8H 4JE4B 1CDGA 3AB0C 5T3XL 1OTUD 3BD5A 1BQLL 3MMEA 1A14H 4CMHB 4JQIL 1I3GL 1NGYB 2DJUA 2RIKA 4HKJA 2OZ4L 5GS1A 1T03L 1F90L 1DQLL 4NN5C 4JO2H 4XNQA 5I8EA 3LCYA 3DROA 4P99A 5TQ0H 2V9RA 3ZKMD 3LEYL 2HT2C 4GW5B 3IETA 2ZKHH 4WUUA 1H0DA 5A2LH 2AKRB 2P5EA 1KC5H 5T1MB 1AGFB 1GL4B 4I18A 5FGCE 5D93C 3EJYD 3O3AA 3UBXG 2P8MA 1XF5A 5D6DC 5DVNA 4EXKA 5GS2H 3ARDD 3NA9L 2BSTA 3IJSA 4WNQB 4MNQB 4ODHL 5EPMA 1JRHH 2VRAA 2X4UA 1TJIL 7FABH 1Q0YH 5TQ2H 3SGJC 2VXSH 3CXHK 4PP1C 2BOCA 4M5ZH 3GSUA 3RWJA 4GFTB 25C8L 3GMPB 4J6RH 1GOGA 1E4XH 2I5YH 4N0CD 1KLFA 3OX8A 3PL6C 5JZ7D 1CDUA 3HTLX 1XFPA 4PJAF 3HKFA 4JM2C 2E7MA 4XVUD 3GKWH 3MRRB 1B88A 5DQDL 5TE4H 3HCVA 1WBXA 4DCQA 3I2CL 2EH7H 3RI5K 3O3EB 1U8JB 4J4PA 4Z7UA 1A6UH 3GMMA 5DRWA 1C7TA 5C09B 3EZ8A 4MS8C 5EZJA 1DL7H 1AO7A 1I8IB 1FVEB 4MLIA 4DOHB 3U83A 5J56B 4JCMA 3P4NA 3OPZH 1KELH 5DJYB 3O4OC 3UJTH 3T2PA 4XWOC 2CUHA 5GHWH 1P84J 4L3EA 1T1XA 4JN2A 1LE5A 4XGZA 1U3HD 4U1NB 2VXUL 3PIQB 5KSAA 1GZPA 3BW9B 2HTLC 1CLOH 3UO1H 1T66C 3DXAA 1H5BC 3V4VH 4JZJC 2X1PA 2WBJA 4QXWA 3GKZA 2DQEL 1HYSD 4IRZH 3NTCL 1BQHG 4YNYB 3MXVH 4PREB 5K9KA 1G1YA 4ELMB 2FWOB 3WNKA 4XNYH 5CILH 5AAWA 1CF8L 3KLHD 5BVJB 3DARA 4HUNB 3EYQC 4XC3L 3S34L 1WFUA 3BYYA 3MROA 4TVPH 5KVDL 3RTQC 1N0XL 5DMJB 1QBML 5I0ZA 1JPGB 4AQ1B 4IIQC 5FOBA 3SKOA 1JYVA 1FGVH 3L1OH 5CGYD 1RZJC 3VFSA 5HVWA 4NN6C 1LK2A 2DM4A 4L4VE 4M43L 4M5YH 4DGIL 2R29H 3WFHA 4DZ8B 2IADA 3DMMD 2CLRB 2J7LA 4NQCA 5EIIB 1J7VR 2LQRA 1EJ6A 1NCWL 4QRQA 1S7TA 1ND0A 4HH8A 3TJEH 2DQHL 2ADJA 3H9ZA 2HG5B 5KS9B 3S36X 2VN7A 3IXAB 3UBXA 4UU9B 1QD0A 1QTYT 4TUKH 3MRIA 4I9WE 1WITA 5HYJA 4HGWA 5DHXB 5EA0L 3SE3A 2NY1B 2RCSL 3DECA 3P0VH 1G9MC 3CSYB 1FFOB 1WF5A 3T0BA 3CFBA 2OTUA 1NUGA 1DBAH 3SN6N 5JOFA 4GBXC 4GSDL 3FONA 3GMLB 4XHJC 1AI1L 4QRPD 1VACB 1JNLL 4D0BA 3T77A 4ZFFB 1KT2A 4DKDC 1IGFL 2NQCA 32C2A 4Z5RA 1RZJL 3MBED 4NUJB 3QPQD 3BEVA 3P9LA 4U6HB 1Q94B 2BVEA 4P2QA 1H3XA 3LQZB 3TZVA 4ZUTA 2P5WE 2B5IC 4JY6B 2DD8L 3QT2A 2UUDH 3RVUC 4FP8H 1NCAL 1CT8A 3ZL4H 2VDML 3U4BL 4DQOL 4PJ8D 2QL1A 4FZEL 1BJ8A 4K3DL 3PHSA 3IFPA 5EBLA 5FXCH 4C83B 5I2IA 3P4OB 1LEGA 1XF3A 3GSNB 1BFSA 2YXMA 4UT9L 1T20A 3O6MH 1MCRA 1UA6H 2V5MA 3TO2B 1B2WH 1OB1B 3NACL 3WSQL 3EYOB 3O0RH 2Y06H 4ZDHA 5IMMB 3TIDA 1XH3B 1R5VB 2MKWA 4DKFH 5C9KA 1UM5H 2EIEA 1G9ML 2AK1H 1M71B 4RAVA 4MDIA 1AGBB 3WXVL 5T1KA 4F2MA 1BQHA 3B83A 1EJOH 4R4ND 3MRHA 5CZKA 1X6NA 3BZ4B 1NFDE 2BRRH 2FECI 3H7BA 1FGNL 12E8H 4LHUB 5DTFA 1MI5A 1B6UA 5HHNA 3TNMB 2VSCA 3CD4A 3VXMB 2KH2B 3A6CH 1QLRB 3D85B 5EU7C 1RVFH 1JFQH 2H3NA 2UVEA 5I15H 3QEUB 3SDCB 2OL3L 5HYQA 1ZSDB 4Y1AA 2H45A 1PD6A 3BI9X 1KXQE 4FFYH 5E00B 4PJ9B 2Q8BL 3KJ4C 1DEEA 3S3JA 4Y5XB 3S88L 2FZ3A 1QRNB 1P4LA 3S36L 4TSCH 2EC9U 3U0TB 3MFGB 2NXYC 4HIJB 1MCKA 5E99H 5FM5O 3RVVC 1HINL 4YDLB 4X6BB 5BOZG 3WN5B 2BVUA 1WTGT 3QIUB 4JANA 1DSFH 2P42B 1OW0A 1QO3B 3RWEA 1L9NA 3IS1X 4XI5D 5IROA 4KJWC 3HI6L 4DGVL 1U8KB 2DS4A 3LSOB 3S97C 5KVGH 2K3TA 1OCWL 2AV7A 5ITBH 4PJDB 2AJSH 1AD0A 1IC5L 1AP2A 4KI5D 4R4FL 3MLUH 4JFPA 4JKPL 4UTBL 5DURB 4F15B 5C3TA 2C3XA 5JW5A 3QNXB 2XOTA 1BPVA 1U3ZA 4KHTH 2NTFA 2YPLB 4U05A 1N3NA 2XTJC 2P5ED 2J5LB 2WAHA 5HI5C 1UB5B 1ADQH 5I9QC 1MQ8A 3IDIA 3VFUB 4Y16B 4UV7H 4KDVA 5E70A 3RDTC 3GSOA 1UM4H 2O26U 3MOBH 1G7QA 2BY3A 2MMXA 2JKXA 1D7FA 3OAUL 4HUMB 3PDOB 4KJYA 3SDXA 4U1LB 1J11A 3WKML 4PLJC 1XIWC 1MJJA 5GS2D 5E5RB 5IB4A 4BSVB 4L8SC 5I1DB 2EZ0D 3ULSB 1SMOA 3BGMA 5C08E 1FL5B 3GB7B 1TPXC 1U0QA 3C6SB 3S5LG 4XTRC 4J4PD 2BMKB 4IOIA 1PY9A 3QCTH 4Y5YC 2OJEB 1XGQA 1WWCA 1C08B 4Z0BL 3D3VA 5GGVH 3FQXB 1S9XB 4BZYA 2VDLH 5EUOE 5JQ6H 3NPSB 2NXZB 5IQ9A 1YN6A 4L3ED 4YK4B 1BBJA 3HC4H 5CJXC 3CPLB 5DUPH 3KPPB 4G5ZL 5HGDA 3W2DH 5KSAD 1J8HB 3GK8L 3V6OA 3VGEA 1FNSL 3T1FA 4K3EL 3NN8B 4X8JB 4Q6IA 4NNPL 1IGJA 2ITCA 4Z77A 2WBJD 3V7AG 1A0QL 4OUUB 2A38A 3IDGA 3BWUC 1YN7A 4GMSH 4OTXL 3FB6B 1RIVL 5ID0B 3G9VA 4D9LH 4D8PB 3C8HA 1A6PA 2VDOH 4ZUSB 5EZOH 1KPUB 5GRJL 3UTSA 4Z78A 2E8ZA 3S4SB 3MRBA 1C5CL 4MA3B 4MHHI 4RWYH 4QXGL 2FD6H 2WK2A 5IHBA 2WWKT 1QACA 2JLLA 1MCIA 3Q3GB 1H3GA 5DS8A 5C0JA 2DWEB 2WIIA 5IHUL 3HS0B 5LCVL 1JWUB 5E8OB 2G2RB 5F72S 5I1JL 4OI7A 4WUUE 5DWUH 3WL9A 4M7LT 1C5BL 2P5EE 1VEPA 3SE4A 3D5OF 5J9PB 3OAYK 2FSEB 1S8DB 3O8XC 1R3JA 2H26A 4LAQL 4TVPD 5F1KC 4DK3A 4U7MA 2YD9A 4NZDA 1T7ZA 5ALBL 4OSUL 4J3TA 2BOBA 3FKUS 3QEHA 4NQCD 4DWHA 3MZGB 2GFBA 2OXGA 3OKDB 4TNWK 1QSFA 2DBLL 4YBLB 3QDGA 4N0UB 4S1SL 4F7CB 5F6HJ 5KOVC 5DEFB 2W0FB 1S7VB 4LCWB 4PJBA 4KRNA 2C5DC 4P2RB 4NZTL 2OTPA 4OLUH 1OM3L 5DJCA 5E24E 4JO1H 3K46A 3ECBA 3FB7B 3VFRA 3VI3F 5HYJD 4X99B 1N2RA 4LLVA 4JM4L 3AM8C 5HY9A 1G6RB 2FL5A 3BVNB 4Z7UE 4MD4B 4JFFD 2W65B 2HT4C 4HAFA 5T1LB 3X3GL 1EUTA 4XCEA 2QHRH 1AO7E 2EDYA 2OJZH 1HI6B 2KUTA 3PGDB 2P8LA 5BV7B 1NEZA 1RU9H 2D7TH 1SYVA 4NRZA 4CGTA 3MRGB 5DJXA 2YUWA 3CZFB 4PJ7F 4X6CF 3RWDB 3I3DA 4LASL 5D1XB 2XWTA 3HLAB 1INDL 2VXQL 6CGTA 1BQSA 4M4PA 5ACZB 3DXAE 3LN5B 4XP9L 3V5HB 4ALAH 1BZ9B 1N6VA 2P4AB 1HHKB 2F5AH 4PTTA 1J5OL 5C0CB 3HUJF 1UCTA 4QRUB 2Z4QA 3DURB 4O02L 1GIGL 1QA9B 4JHWL 4MJ6B 1I9RL 4RAUA 3PP3H 3T0EC 2WWMD 3HAEB 5DVLA 1LDPL 3LQAH 3VFVA 4E41A 1QSZA 1MCOL 4K8RH 4P3DA 3WDJA 4K2UH 5D1QC 1T83A 3MRLA 1U93B 4KKBC 2LTQC 1DQDL 5GRVL 3JWOH 2VZTA 1KUMA 1WIOA 4OV5B 4OGAC 1U8PB 3D39B 1R3LB 1T7YA 2CUMA 4NCDA 5T1KD 5I1LB 2QADD 1UKSA 4AH2B 2R1YA 4R4BA 5ICXB 5BS0A 1DEDA 1ZLVH 4MA7L 1MI5D 4Z9KB 2PKDA 4GXVL 3MODH 5DFWH 3V79C 4R7NA 2DDQH 1JPSL 1JE6A 2GSGA 3TYFA 4QXTA 4I0PB 4CN4A 3RWGA 3L5XL 1KENL 1TNNA 4Y19B 3P3YA 4Q9QH 4Y1AD 3BPNC 1REIA 2RAMA 3CMOH 3LS4H 3F12A 1R6VA 2EYRB 1C1EL 1F6LL 2FX7L 3RA7H 5FYKE 1S7UA 4GO6B 2NY6B 1PG7H 1YEKL 2KDGA 3PHQB 2YKLL 5TH2B 4M9OA 1PKQA 5IBUB 1JGVL 4POUB 1AQKH 4JKLA 4NM4H 5J6HB 5D2NE 3KJ6L 3FO2A 3WHXB 3FN3A 3G5YB 3QUKB 3DBXB 5C6WH 4ETYA 2D0FA 2A6IB 1OQXA 2OI9B 1MFBH 4XPAH 2EIZB 4P46C 4YHYB 4KDTC 3BH9A 1BJ1H 2VQ1B 3IJYB 1OGAB 4NZUL 1P4BL 5EN2B 1CVSC 4JFEA 1QOKA 1XF4B 4P2QE 1IC4L 3P9MB 4JZNB 5CEZL 1OY3B 4ZO7A 3TVMB 4WFFD 1P84K 4GW4A 1XCTA 4PLOB 3FRUA 4OBRA 1MEXH 4ZPTA 4APQC 5MEOB 4KTEH 3LKSB 1ERNA 3RAJL 5IWLC 1IMHC 2EDRA 1LNUB 4OV6F 4IRJA 1QVOB 4JPKH 2KKQA 2Y5TA 1M7IA 2CH8A 3MYZA 4KU1A 1X4XA 2EH8L 4LCIH 4X6EA 1AY1H 4GOSA 5DT1H 1LP9F 3QNZA 1V7MH 3WJLA 1M05B 2JB6B 2OP4H 2YK1H 5HGAB 4A6YB 2FDBP 3U7YH 4BYHA 3QJFB 3GMNA 3HB3D 4XWGH 3B9AA 4QRSA 5IV2B 3BJLA 1P2CB 4BKLA 5I76B 2ATPA 1MNUL 5IVOA 4WEUD 4OCXL 1VFBB 2M26A 3HMWL 1YEDB 5FCUH 5GGUA 4X6DA 3BISA 3MLVH 3O2DH 2BNQD 4O58H 3MV9B 4I4WB 5DDHA 43C9A 1OGTB 2FX8H 5BXFA 1CU4H 2JELH 3D3VD 4IS6A 4CL7A 3TT3L 5C9JB 3LVEA 5JLZB 3ARFC 4TUOB 4YDIH 2QQLL 1OARL 3O2DA 5IVXA 4PJIA 4M9PA 1WAAA 2CIIA 2J1KA 1NC2B 4K94H 3ZDXF 1T89A 1MFCH 4OQTH 3VD9A 4BSWB 3NZHL 3MJ9H 2HJKA 1S7SA 5HHPA 2A74B 4MJ5B 4PRPB 3VFPA 1TCMA 2FIKB 4HZLB 1BJ1J 1F45A 3K1DA 1BF8A 4P48A 1MHPH 2X09A 1RUQH 1MAKA 2WIMA 1GAFL 3UTSD 4Z95H 5KN5B 4Q7DA 3O9WA 1L6XA 2C3WA 4OQTA 4ZSOB 5SV3A 2NX5B 2YEZA 4YEFA 3GJEB 3OAZH 3O2VH 5I8OH 3QIWA 2Y72A 2UYLA 1I8MA 3HG1E 2D03L 2LAAA 4TULH 2D4DA 3MGTA 1NAMB 1HOCB 1L0XA 4RDQF 3SGEH 2GCYA 4JDTL 2VE6B 2Z31C 3C08L 4S0TD 3EYFB 5FK9A 5L2JB 1VENA 1MAMH 1OTUC 4MJ2A 4FNLL 3ESUF 1D5IL 2WM0A 2PYFB 3NCCB 4LVNC 4HLJA 2B4CH 2WINA 4JFZH 2AXHA 4WTXA 3RWFA 2HFGH 3EKCA 1RIHH 3G6JB 4JY4A 5I1AA 5I71B 3EO1B 4XZUB 3SDXE 2DQIH 2XNAA 1HH6A 1QSFD 3QDGD 5DEGB 4GRWF 3ZKMC 1WICA 2VDPH 2Q86A 4PGCA 1Q1JL 1K85A 1S5HB 5JW4N 3EOAB 5K9JL 4JCLA 3PQYB 5DJ8B 3QG6A 1YPZB 1T2QH 1IT9L 3LEXB 1AKJA 1Z3GH 5FYJH 1J05A 4C56D 5DJ0B 5D7IF 3BGFB 3EYSL 3ARDC 1IAIM 4KTDL 5F1IB 4LOUD 3GGWA 5D5MB 5C07B 2AJ3A 1OT1A 2X44D 3DTXB 1JP5A 1RUAL 3ZDYF 3SJVA 1PZUB 5I66A 4B7IA 3RJDA 4GXUM 4MLSA 5DD1H 3T1WA 1UVQB 3VE0A 2SEBA 3CX2A 5IGXL 4ZD3L 4S1RH 5D6CA 5DEZA 1QFWL 2Z8WC 4M48L 2YPKB 4N0CC 3WV0A 3OJVC 3VI4E 5JZ7C 1PX3A 4G6KL 1ZLWH 2B0SL 4XVUC 1Z6JT 1ZT4B 1G9NH 2Q3ZA 3H3PH 3U4EB 1NLBH 2IFGA 4XNUH 1SMAA 3BWAA 1A7OH 3BOVA 4ISVA 4IMKA 5C0EA 2CK0H 2NZ9D 5E4EB 5F21B 1N59A 1HKLH 2KBGA 5K9OA 4HUUA 4WU5A 1MHHB 1IEAA 3LD8C 4LPUA 4NRXB 2HJFA 4UDTA 1RZGA 2AP2A 4XBEL 3ELAT 1X7QB 4TRPL 2F54B 4M4RA 4GLRH 4LVHB 3O41A 1D5ZB 1U95A 1YMHB 3BPLB 5D7JA 1NCDH 1NMBL 1HYSC 2EE9A 3IKKA 1LGVA 4K8RD 3VXQB 1GH7A 1I7RB 1Z2KA 4G8FA 2R1WA 2E27L 4I48B 1ZT1A 3PHOA 1EFXB 1ZA3B 4J1UB 3KLHC 1JZ6A 2GTZB 1QRKA 5GZND 3OG4B 1C12A 3VA6A 2Y07L 4KMLB 1A1NA 1LDSA 5D7KD 3IDNB 5HHMD 1D5MA 5I18L 3U0PB 2JCCA 3GBMH 4EDXB 4Z18A 4OQ1A 5FHAL 4IJ3B 1HHGB 5D93B 4J8RA 5C86A 4L3AA 1ZS8B 4OM0H 1A7RL 4CU7A 2ID5A 3DMMC 2MOVA 1EX0A 3LKPA 4G9DB 4H20L 1IQDA 3O6LL 1EGJL 1CFTB 1PSKL 4H25A 3LZFH 1FL3A 3D9AH 4DVRH 3L95A 1KXVC 4OIIH 5K59F 3BZDA 3OGCB 4NO0A 1V3MA 2GJZB 1E6OH 5JDJA 2MWCA 4JFED 3MO1A 1HN1A 4M93C 1CWVA 4PJEB 1G84A 3BESR 2C1OA 4X83A 1JWMA 1MPAH 4I3SH 1IRAY 4G9FA 5DRXB 2CMRL 2E5EA 3Q0HA 4S1DC 2W9DL 4L29A 1KCRH 1KCSH 4XVTL 4LSSL 1R5WA 3WFZA 1A6ZB 5J11B 4IRJD 3U9UB 4HKXA 3IF1A 3KPSE 1TTGA 3MBEC 3QPQC 4Z7VF 4KHXH 4KQ3H 4E41E 1QYGH 1J0IA 1MJ7H 4PS4H 1IAIH 1N5AA 5BO1L 3IU4L 2LFGA 4WY7L 1U41A 1OPGL 2Z8SA 4KTYA 3HE7D 4PJ8C 5FUOH 2EDLA 5SWSB 4BH7A 1LO0L 4ZOBA 2Y36L 3QFJA 4Z8FL 5DMYA 4HF5L 4CDHA 1EO8H 5BS0E 2C4FU 2BVPA 1UC6A 2R2EB 1YNTB 3VFWB 3F5WB 4KK8D 1XR9B 1N64L 3HNTL 3QDMD 5GRUH 3UYPA 4NQVB 5TE6L 2F19L 1VGEL 2EKSA 4XRCB 4Z7WA 3T8XB 3TN0A 4JVWA 1KACB 4XBPB 4LDOB 4ZNEE 2ITDA 1QBAA 5LGHH 5E8DH 1B3JA 4R4NC 5INCB 3RZCA 3ZYJA 4OZHB 1RAMA 4NN6B 3MUGB 1EA9C 2A9NH 2ICCA 3ARTA 3UPRA 1EZVY 3KS0H 2GT9B 5KZCB 3AS2A 4L4JA 4F37K 5IT2H 2G60L 4HWEH 3LQMA 4MNGB 4BZ1L 1CLZL 1RZ8B 4ZUVB 3ROOB 4GKSB 4FOMA 3T0WA 3UMTA 1H15B 1WTLA 1TCRB 1D3CA 1N8ZA 3FO0L 1K2DB 1INEL 4EUPB 1OP3H 3O9WD 3K7UA 3EJJX 5DYOA 3FZUC 4XNMB 1FYTA 1AIFB 4PRHB 4V1DE 1VSCA 2W9EL 3VXOA 4I77H 4NQDA 1WEJL 3QIWD 4JFEE 3ZKXB 1KSRA 1VADB 5D9SA 3U46B 4ZFGH 5DR5H 1GPOL 4O9HH 1DQJA 2X4QB 5ADOL 2DYPB 3T09A 5EUKA 4JEGB 5HI4C 3PP4H 4FXKA 1DUZA 2D31B 4GBXB 1AXTH 4ESKA 1KG0A 1CBVH 1SJEA 4XI5C 4JRXB 3VRJA 1U8QA 2FEEL 2PO6D 5B38G 3CDFA 1I85A 2VIRA 5BRZA 4CVZA 2MQ0A 2DBJA 2CDFA 4YBQD 5E94A 3QNYB 2OYPA 3KYNA 1RY7B 4LSTH 2OL3B 5HJ3B 4EN3A 1WCBB 4HT1H 5LG1A 2A83B 3ZSSA 1JGDA 1JHTB 2VL4A 3ES6B 5H35A 4I18C 4WHYH 4PJGA 5T3ZE 1B4JL 4NYLA 3SDAB 1RK1A 1BX2B 1AKJD 1CE6A 1UWEH 3NCYS 4N90E 5T5FH 2MPAH 1GSMA 1D9KA 3GRWL 2AQ1A 4D9QD 3PXHA 4GAYA 3FQNB 3MLSH 1RZ7L 5C7XL 3SKJH 1K4DA 5CEXB 4U1SA 4E42B 1A5FL 5FYJD 5KSBA 5IKCA 1J9CT 3O11A 2CDGA 1IILE 1TTFA 3OGOE 3FQTA 5H2BB 2EEAA 4JFYA 3VXPA 3KS0J 4BZ2H 3VXUB 3OKLA 3CDGB 5GRVK 5SWZB 4YUEL 4PJIE 4RZCA 3TH3T 3V5DA 3NCBB 4HPYL 7CGTA 3UCRA 4KKCD 3OKNA 1BREA 4JFOA 3KPOB 3B8SA 3HI1A 3OXSA 3UC0L 2F74B 4WI4A 4NHUA 5DI8B 1FNGA 2IQAB 4P0DA 1KLGA 4QHNA 1A14L 5SV4A 1BD2D 4UMGA 1VERA 3ZTJG 4CW1A 4JKMA 4K71C 4D94A 1WVZA 3SGDH 3MA7B 3ARYA 2W0LA 3KJ4B 4GRLC 2JF1A 3R4DA 4JO2L 4MMXC 4P2YA 1JV5A 2BZDA 1MIEH 1QKZH 2ARJQ 3MUHL 3P4MA 3QULB 1VA9A 2NXYB 1SYSB 5JR1H 2Y9RT 5MHSD 3TO4B 1KJ2A 3D25B 1NGXB 5D7JD 4OFPA 2PCPA 4JG1H 1NLDH 4J3UA 3D1MC 4QHUA 3SQOL 1CIUA 3WEXB 5ANMA 3VFNA 3CFIC 4LVOB 1BFOA 5CD5D 7FABL 4GS7B 1R24B 5TFSL 2VXSL 2FHCA 2XY1A 4M5ZL 1NFKA 5B39G 3MNVB 4J6RL 1OSPL 1E4XL 2I5YL 3C8KB 1FH5L 4RIRB 3JV6B 2NY3B 4K3HA 5D72H 3RHWF 5B3NA 2XTJB 3P30H 3QEQB 2EYSB 2LU4A 2YSSA 1K3ZA 2GTWB 3OJMB 1NBYB 5I9QB 4OZGA 3EZJB 5TE4L 1A4KB 3V7MA 5IB2B 2EH7L 4L9LA 1KPRB 3HZMA 1A6UL 2ARJA 5TE7L 3MLTA 3SJVE 2FBJH 1DL7L 3KDMB 1ACYH 4F7EA 1UXWA 1QFUH 1XIWB 3GIVB 2B1AL 4RFEB 1KELL 2E7LA 4TSBH 3NFPB 1IL1B 8FABA 4KKNA 5JORA 1T0MB 2VOTA 4JO4H 5GHWL 4L8SB 4LP5A 4FXGA 2WP3T 3UTTD 5IFHL 4NO0D 4MNQE 5HVGB 2EC9T 3K3QA 4P4RB 4LLDB 2BC4B 2IANA 3MPCA 5EU6A 3UO1L 2VLRB 2NW2B 3BP6A 4JDZA 3SE3C 3ME0A 3QXVA 4R2GD 5INDA 3H9SD 4IRZL 4Y5YB 4G9FD 4FFWC 3NFNA 3LIZH 2APBA 4NFDA 2JJVA 3MXVL 1DLHA 2R15A 4XCCH 4F37F 2C1PB 4QO1A 1QNZH 4N0YH 2CXGA 4PRIE 4XNYL 5CILL 4O51A 4OLYH 4QGYA 5B3JE 4Z76A 4NC1C 5AEAA 1I3RB 3ZT7A 3ZTJH 3R06A 5F9JB 4TVPL 2X70B 5J12B 3KPMB 1Z9OA 5A43C 4KZDH 4W6YB 2R4RH 4IMLA 3D2UA 1FZKA 5B4MD 3L1OL 3AY4A 3FO1B 4WI6A 3QFJD 1FG2A 1KNOB 5JW4M 1FE8H 3MRDA 3QUXB 3UZVB 5E2TL 3QFDA 4RNRB 1BM3H 2DKSA 3WLWD 4KRPB 3AGVA 2CDEB 4OLEA 3BRGC 3TJEL 2CRZA 1DDHA 3T4AB 5JW3H 1E4WL 3I3BA 5JNYB 1ODAA 4X5XB 5EU3B 3MRNA 3TN0D 3WFCH 2G5BB 4LSRH 3TT1H 3PV6A 4HBCH 1OP5K 2GI7A 4EKXA 3RZCD 2QADC 4KV5E 4TUKL 3SDDA 3C60B 4L8BB 5DJDB 4QOKB 1NGZB 2F8VA 4NZRL 5F8QC 3CVHH 1FJ1A 3LH2L 4JJ5B 5DQ9A 1DBAL 3MLWH 3KYMB 5F7DA 1I7TB 1IAOA 3QHTC 3C2AH 3VXNA 4RISH 2WLZA 1HZHH 3IT8D 2VO5A 3CVHA 3QZWG 2BVOB 1FYTD 4LGRB 4NM8H 4UIMB 2IGFH 4UOJA 4ELKA 1R3IH 5BMFH 4G6FB 1VHPA 4IBLT 1XCQB 2CR3A 4OB5H 4FP8L 3ZL4L 1TFHA 3L7EB 4U0QB 3FFCD 5E1AA 2RQ8A 1WC7A 3WNOA 4CMMB 4XP4H 4HUVB 4ZFOA 1G7HA 4UUJB 3MRCB 2F58H 1OW0C 2IBGA 4OZIF 3PWVB 4MAYC 3CNKA 3Q6FB 2HTKD 4BJLA 1A3LL 3S37H 1A22B 4PJHA 5IMOA 3O6ML 1DZBA 4EZMA 1UA6L 3VCLA 4L3CA 1YDPA 3O0RL 1X4ZA 2Y06L 5MI0C 4NWUL 4E0RB 1UM5L 4LQ1A 3QPXH 4EN3D 5D7LA 3U2SB 4F9PA 1IM9B 4M3KB 4MD0A 1EJOL 4YHZL 1DBJH 1JI2A 5C6TH 2BVQB 1I1FA 1VPOH 1NDGA 4HKZA 3WNLA 3EDEA 2P48B 4QKXB 3TBWA 4U6VL 1KJ3H 4NBYB 4V2CB 4MXQD 2XRAH 3ILQC 1D9KD 3ULVH 1RVFL 4NDMA 3O45A 1FNLA 5I15L 1KIPB 4U1HB 2H9GB 4HSQA 5TDOA 2F53B 5D1QB 4F7TA 2C3HA 4XAWH 1HHJA 1LO3H 1YEIL 5JW4Q 4Z7WE 2A6DA 2OM5A 3HB3C 3NCFB 2XG5A 2HFTA 2NNAB 1HXYB 3G5VB 5KG9A 4NRYA 5CCKH 1FDLL 1NL0L 4U6XB 2HVKB 4MJIB 4WFHE 3MREA 2CIKB 2A1WL 4Y5VA 4Y2DB 5DRNA 4L4TA 1FVCB 1CG9B 4MQXC 3L7FB 5DMKB 4U0RB 2N56A 4R96B 1DSFL 3C6LA 4OZFA 4NUGH 3UROR 4MAUH 5GGQH 2AK4B 5E8EA 4HWNA 4LLQB 4M8QB 5DHVH 4JPWL 3VXME 5KVGL 4U49A 5ITBL 1MRFH 2AJSL 4K3JH 2UWEA 3MLUL 4LRIA 4LKCA 2W9LA 5CP7B 4G8GB 5L2KA 3HE6A 3QAZC 3GBLA 1VFUA 4CJ0A 4NQDE 1CGVA 3IDYC 3V6OC 5DHVA 1MIMH 1DVFB 4KHTL 4QEGA 2ICES 2OR9H 3G5XA 2OQJA 4YFEA 5GSRA 4HIHB 5EU5B 1ADQL 1M7DB 2J8HA 1EEYB 1QRNE 4UV7L 2VDRH 1UM4L 5IHZB 3MOBL 1BVKB 1ZA6B 1UB6B 3MRQB 4C59B 4GT7A 4UQ2A 4LSUH 5EC2B 3EO0A 5E2UH 1I7UB 4K9EH 4KMTH 4TUJA 3EAKA 3QZWA 2VAJA 4UI2A 1NCNA 1IQWH 3MFFB 5BRZE 1F13A 3HNVH 3RWCB 1Q8MA 5ESQB 1XZ0A 4W6XB 1EEZA 2X9WA 5JDSA 4WWKA 3QO1B 1T80A 4GJTB 3OKOB 1I4FA 4YE4H 3MV7B 4HK0A 3D87B 1X3DA 3MR9A 3QUYA 2ILLA 4PJDE 5LGKA 3TIEB 2V7HA 1MSPA 3L9RA 3AREA 3QCTL 2RFXA 4AM0A 4L1HA 1G7IB 4UT6H 4W68A 5E9DA 3SKNB 3TJHD 2YPLE 4HS8L 2ED7A 1HQRA 2NY2C 3KPTA 4JAMB 4CVUA 5KSBE 4MCYA 2VDLL 1JTOA 4N5UA 2B2XH 1RHHA 4LPVA 5JQ6L 3Q6GH 4GMTH 3BKJH 4IEFB 4OM1L 3ZYOA 1EEQA 3HC4L 1PZ5A 4EI5A 4J7RA 2ZJSL 1IAKA 2OX5A 3QO0A 5FGCB 4OJFH 3W2DL 2IH3A 4QCIA 4MX7A 1L7TL 4FQXA 2IAND 4OI9A 4P4KB 4X6DF 3TCXA 5EU6D 4F80A 1UWGH 4J23A 2HLFC 3GMQA 2ATKB 3V9FA 4LOUC 2QR0A 2J6EH 3CDYA 4WTZG 5C0AA 3MRFB 4XBGB 5F88B 4GMSL 5HVFB 2A6JB 5HYEA 4OLVH 1OAKH 3IGAA 2ZUVA 4D9LL 1T1YA 1HCFX 3OJ2C 2VDOL 5EZOL 3P73A 4JRYA 4RGMC 2J6EA 3ARFB 3STLA 5KOMC 1WAAF 2EO1A 5JIPA 2FD6L 4ODVL 1NGPH 3EDFA 3AUVA 1YECL 1X5XA 4LEOB 1B0RB 4PBVC 4HG4J 4DUXA 3CLFH 4PJ7B 2FO4B 4G43A 1YNLH 5GIRA 1F8TH 3D2UD 2C7UA 4U1JB 3EYVA 5DK2B 4F3FA 1WBYA 4M7LH 3S6CA 2AJXH 1JF1B 4OCWL 4U4BA 2HP4A 1WWBX 2IPTL 2JIXB 4S2SB 4ZTPH 4PJFA 1I7ZA 2KQMA 4NKDA 3DX9A 3MV8A 4U6TA 1NJ9A 3B9EA 3UYOD 3J8F7 3G6DH 2R2HA 1MCCA 2X4OB 4FG6D 3D0LA 4NO2B 3F6IA 3HPJA 1T83C 4QXUH 1JF5A 4Q97A 4HX1B 4OLUL 4Y4HC 3QYCA 1QSEA 1ZHKB 5EOTB 1RUKH 2PN5A 3U6RA 1QP1A 2DKMA 4JO1L 1AXSA 3MLZL 1F58H 2VUOA 3LQAC 2W60A 1ETZA 3GIZL 5IVZA 4E5XA 3ZHLA 1MCWW 4K8RC 4OZGE 2KQNA 4U1GB 5E2VH 3MGOA 4U33A 3SPVA 4LVNB 3T0VA 4N9GA 1SJVA 2MJWA 2Z93B 5HDQH 1CTNA 3JWOC 4L8DA 3UYRL 2ICWA 3H7LA 2CLZA 3LKQB 3UTQA 4BQ6A 2ADGB 2QHRL 3CFJB 4FQIH 2VXVH 5J1AB 1T0NA 1VEMA 2OJZL 1BVZA 4PRNB 4ZS6D 5GZNC 2ADIA 2DQDL 4JREC 4ENEC 1RU9L 4FQQB 1V3KA 3BUTA 1OSZA 2VWEC 2NPLX 3OB8A 1BGXH 1MWAH 2EYTB 3VDBA 1N6QL 3ARDB 5EU6E 4N0UE 4PYGA 4LGPB 4ALAL 2DM7A 4YPGB 1QR4A 4NNXB 2D9QB 2H32H 4P2RE 1G7LB 4JFQA 2F5AL 2MCPH 2ZUXA 4XP5H 2EE2A 1MWAA 3KXFE 4I8DA 1CICA 2YA2A 1CXIA 5D6DA 2DMCA 4HDIA 2A77L 1I1AD 5KSUB 2X4RA 3DNKA 1ED3B 1ORSA 1FC2D 1U58A 3ZE0E 4LLYA 3FFDA 3LQAL 2ERJB 1UZ8B 1XGRB 3SBWA 2YR3A 4YHOH 4K8RL 3SGJA 1K5NB 5HPMB 1ZGLM 3O6FD 4HK3N 5HGGS 1EVTC 4OKVA 1WJ3A 3JWOL 3QWOB 3QXAA 4WTZA 4O2EB 5D7LD 4EI6A 2EO9A 3PL6A 1FZOB 5CGMA 1R3KB 2IPUG 4JM2A 3TBYB 5J6GB 5EWIH 3S3PA 2QSVA 4MSWB 5HYSG 3RL1B 1RULL 2NMSA 4KDWA 3MODL 1A6TA 4S0SD 4IRJC 2R4SL 3DYOA 4X0KB 2ICWJ 1U3HB 3VRIB 2YRPA 5C0CE 4KRMB 1U8LA 5CHNA 3RNKB 3CMOL 4XPFH 1HH9B 2J8UB 1PQZA 2V2WB 3RA7L 2X1WL 2N7AA 5AD0A 3ULVD 3HE7C 4M7KH 5CAYB 1NANI 1RJLB 2J2ZA 1J87A 5EO0A 1XT5A 3FT2B 1AQKL 3IFOA 3FOLA 4XP6L 1BZ7B 1AJ7H 1H5BA 4KK8C 4BFIA 1KBGL 2VABB 4JZJA 3SOBH 1YZZA 4BH8A 5I8KH 1XMWA 4L4TD 1HHHB 3O4LE 4OKDA 2AJYH 5D71H 5FGSA 4XXCA 4C54A 5DD5H 3U30B 1OOAA 3F7PC 3C6LD 1MFBL 4XPAL 4X7TA 2BK8A 2JCCF 4HZAA 3NCEB 4RFNB 1FNEA 4X4ME 2O5XL 1K8IB 1CLCA 1BOGB 1S7WB 5ETUA 1NFDF 5GRXG 3QDJA 2XZQL 5L2KD 3HE6D 4AEIH 1XAUA 1E27A 2R56H 4LSPH 3PWLB 3RTQA 4HH9A 3DMMB 2C26A 3VMPA 1MEXL 4R3SB 1I9EA 4YHLL 4IIQA 4CADA 3DUSB 4KTEL 2GJJA 2XFXA 4U3CA 2BSSB 1LE9B 1AGEB 1DQMH 4K94C 1IKNA 1F6AA 2YWYA 3O9WC 2Y4SA 1Q9WB 4OT1L 4LVEA 3RZWA 4OF6A 2O61A 4ONFH 5T3ZL 4LCIL 4V2BA 5F7FA 1AY1L 4R97C 1V7ML 2HN7B 3WS3A 2OP4L 5CIPB 2YK1L 4M93B 3SE9H 3QIWC 3WIFA 4WWKD 2HFEB 2ICEB 2FRGP 4RBPK 1A9EA 1YEGH 5D7LE 4XWGL 3KPNA 4G80B 4PB0H 1WZLA 3BP5B 3QUYD 2FO1A 4MWFB 3QA3A 3W0WA 4QRPB 1AXIB 5FCUL 2XZAL 3K4ZA 3ARED 1RJYA 2PO6C 1KJVA 4Q58C 3O2DL 1CDYA 4OD2B 5E9DD 3WUZA 3UDWA 5I8CA 3MBEB 1Z9LA 3D0VB 4YBQC 5FOJA 3VXSD 2KZWA 4QYOA 2B4CC 4YEEA 3B9VA 4YXKH 4PJ8B 4LBEA 4PGZA 4EI5D 4ZUWB 3IVKB 2IQ9H 5HHQB 2FJFA 1FIEA 4PJ5A 5HYSA 4WGWB 2GW5A 1H3VA 1NFIB 4QTIH 5IB5A 4K94L 1SJHB 3HNSH 1OAYL 4PV9B 4ONHA 1MFCL 4D2NA 4OQTL 3FT3B 5L0QC 3ULUH 1LO4H 5K9QG 4CVXA 4KZEL 3P40A 3CCHA 3S3SA 5KW9H 1BFVH 1EAPB 2E6QA 4ZQKB 4OFVA 2L0DA 2IPKA 2PW2A 4Q6YA 4UZGA 4WUKL 4ETQB 4P49A 5IJVA 3BRDA 4LQFH 4G8IA 3Q1SH 1GGTA 4JRYD 3IU3B 5I73C 4NKMB 1LEIB 2C9AA 3O2VL 4KUZH 2X40A 1JIBA 3ORJA 1ZGLA 4H0HB 5BCAA 3QJHB 4KKCC 3C5SB 4NSKB 3ARBB 4PTUB 1MUJB 4QHMA 3AU1B 4XNZB 3GO1H 2HYMA 5SX4H 3WHE0 4HIXH 5JXAL 5JA9A 1MAML 1IGYA 1DUYB 1G9NC 5H94A 4PJAA 2Q7YB 3RGVA 2B4CL 4XMLH 4JFZL 1YEJL 2VITB 5EUOF 5JIHA 3S35X 5E8PA 3V6ZB 1GGCH 2HFGL 1RIHL 2VDKH 3MV8D 3ROLA 5GSVA 1KJMB 2BHZA 5C2BL 1QEWB 5J13C 2OS7A 4C4KO 3BGAA 4OIAA 3M8OL 1Z5LA 1E4JA 1CGUA 4LHQB 2VZVA 4LLWB 2F5BH 3QISA 5IMKB 1QSED 1ZK9A 5IBTH 1MH5B 1RV6X 1BECA 4HUWA 3DO3A 1T22B 1B0GB 4PJCB 1T2QL 3HFMH 1Z3GL 5FYJL 3MMEB 2V5SA 4AG4H 4HKJB 1T1ZA 4CAGA 5GS1B 1KPVB 5CD5C 4NP4L 4Q9RH 1SBBA 1JVKA 4J3OC 3T3ME 3CUPA 3BAEH 1FFPA 4XNQB 5I8EB 3B2VH 5E56A 3DROB 4S1RL 2WUBH 4UAOC 3IETB 2I07A 5JTWA 4WUUB 1H0DB 1TNMA 4L1DA 4DK6A 4P2OA 2P5EB 4ELMA 4B7LA 3G6JE 4I18B 1AHWC 4HCRA 1I3UA 1G9NL 3AAZA 5DVOA 5I1CH 3O3AB 2P8MB 1KGCE 1XF5B 3H3PL 4K07A 3BQUC 1NSNL 3KR3H 1NPUA 3IAQA 4XNUL 2BSTB 3IJSB 3PDDA 5EPMB 5C0AE 2X4UB 3RNQB 3NCMA 1HKLL 5FO7A 4GQ9H 3PQYE 2Y5EA 4Y89A 4MXWH 1CICD 1YPZE 2KL6A 2BOCB 5I74C 3GSUB 5CD3A 3RWJB 3RDTA 1T1WA 4JQXA 3RVWD 3CFKA 3U48A 3MZTA 5C07E 3OX8B 5D5ME 4HXAH 3T2OA 3LRSA 3DRTA 5L8LB 4P5KA 2NY0D 1X44A 3L3HA 4LPCA 3HCVB 3WD5H 1WBXB 4DEPC 1MFDH 4DCQB 5T3XE 1UFUA 3O3UN 2AJUH 3VGHA 1NMAH 4L5FH 1J86A 1NCDL 4Z7UB 4M61A 4WI8A 1CD1B 3GMMB 5DRWB 3F65A 3T3PE 3VXRA 5EZJB 4JM2D 1SY6A 1AO7B 4B53A 4DW2L 3U82B 4TNVK 1DN0A 4H26A 1MVUA 4Z6AT 3P4NB 2AABH 3EOBA 1G7JA 1FN4A 3B9KA 1F3JA 4JR9H 4L3EB 2XTLA 1FVDA 3BO8A 1T1XB 4JN2B 1LE5B 3VJ6A 2GUOA 4XGZB 4MS8D 1J1PH 5KSAB 1GZPB 3SKMA 2V2XA 1ZE3C 4KVCL 5F6IC 2ESVA 2ZUUA 3DXAB 3GBML 3STZA 1PLGH 1FAIH 4PGDB 5B4MC 4XWOD 2WBJB 1NKRA 3FB5A 3F58H 3P9WB 2ZWLT 1A6WH 2XQBL 1YC8A 5HHOA 3F7YA 2EICA 3OR7A 4OM0L 1FBIL 5F7MC 3HN3A 2HTLD 5KSVA 5IM7A 1UJ3A 1A7PL 1T66D 1HSAA 4M03A 2CJUH 4JY6A 3V6FA 1BEYH 3WLWC 3BE1H 2X4SA 3GSNH 3LZFL 3MROB 4MCZA 3T04D 3I3EA 3ALPA 2VNCA 3K2UH 3D9AL 5IUSA 1E28A 4OFIA 3TN0C 4XX1G 3MLXH 5FOBB 1E6OL 3SKOB 3BIBX 4Q74A 4URTB 1MFAH 3VFSB 3LKOA 4PGEA 4MMZC 1MOEA 1ES0A 1LK2B 1V7NH 4EVNA 5DJ2A 2DQCL 3CLEH 1MPAL 2VLLA 3WFHB 3RTQD 3EYOA 4I3SL 4HXBH 4NJ9H 2DQJL 4NQCB 1W0VA 3BZFA 4EJ1C 2QSTA 5C0DA 4QRQB 1S7TB 1ND0B 5ENWA 1VFAA 1KCRL 3KAAA 4O2FA 5DLMH 4OCRL 5LVEA 2ADJB 1IC7H 3O8XA 2DQTH 3UAJD 3CU1A 2VXTH 5F3HA 1QLRA 4KQ3L 4G7YH 3UBXB 4HIIA 4PS4L 1IAIL 3C5ZB 4FMKA 5F8RC 3MRIB 5HYJB 1KN4H 3SDCA 3HI5H 3LPWA 5ABDE 5EBGA 3SDYH 1OAZH 4WFED 5FUOL 4PJ9A 2J4WH 3CFBB 5EG6C 2OTUB 1V05A 3RIAK 1EO8L 5FFLA 4M3JA 3A0OA 5JOFB 4DKEH 4WHCA 1L0QA 3FONB 3W0WD 4D0BB 4PJEE 5E5MA 1KT2B 3AM8A 3A67H 3ETBF 2EDTA 5ACLA 1OAXH 2HTKC 32C2B 4P9MH 4Z5RB 1BBDH 3BEVB 3P9LB 4NC2B 5JQHC 3MJ7A 5HDBE 2V6HA 5IJKC 4HHAA 4P2QB 2E7CA 3TZVB 4ZTOH 5I1KL 4ZUTB 1AFVL 1CT8B 1RURH 3PNWA 5LGHL 5E8DL 4PJ5D 2QQKH 5MEPB 4EBQH 2BNRA 2A9NL 3ZE2E 4WWID 4O2CA 2D7PA 1RD6A 4MXQC 1J0JA 3EBAA 4QNPF 5IT2L 3IFPB 4JQVC 4HWEL 5EBLB 1YEFH 5I2IB 1LEGB 1XF3B 1T20B 1TJHH 3PABA 5SWSE 3X3FH 2XXMB 5C0IA 1NCBH 5EIQA 4ZDHB 3TIDB 3S96A 1OAUH 3T0EA 2IJ0C 2DLEA 1VKXA 1IVLA 3ULUD 4RAVB 4MDIB 5T1KB 4F2MB 1BQHB 2PW1A 3MRHB 4I77L 1MJUL 3QDJE 4ZFGL 4POZD 3RX8A 5DR5L 1MI5B 5DTFB 4B41A 3AMKA 5EOCL 5HHNB 1CL7H 3K8LA 1G9EA 5GS3A 2IH1A 3CX5J 4TQEL 4UNUA 1ZMYA 2H3NB 1F11A 3ZDZE 2P8PA 3WFEL 4YR6A 3PP4L 2B39A 3OKEA 4LIQH 1AXTL 3CXHJ 4OZHE 1CBVL 3RGVD 4Y1AB 5HYQB 5GGTH 5HDLA 4BQCA 4YX2L 3OJDA 1DEEB 1FHGA 1LO5A 1UQSA 2X42A 4DTGH 2FZ3B 4MNGE 1ZHBB 5HHVH 4XVSH 1CN4A 5IP4A 3DIFA 5C09D 3MX0A 3NIFF 5DK3A 4G42A 4HT1L 2Z91A 4MB4A 5F7YC 1XGYH 1FRGH 3LB6D 3JZ7A 1F4HA 1UWEL 5T5FL 4AK1A 4JANB 2HFFA 3RWEB 3GBNH 1CE1H 3RUGA 1N7MH 1UYWH 2OTWA 4KXZI 1KYOK 1RIUH 2AV7B 3SKJL 3KPRA 1AD0B 1TQCC 2WMPA 1AP2B 4IDLA 5A40E 3HRPA 4JFPB 5MI0B 2YUXA 2WZPD 2MNUA 4LCYA 2BXYA 5HYIA 3V4PH 5JW5B 1RUPL 4P46A 3P2TA 1N3NB 4UDUA 4P2OD 4HS3B 1RZKH 4BQBA 4YDVA 3NOIA 4H0IA 3QUMA 3IDIB 2O5YH 2PTVA 3Q2CA 5ISZA 5TDNA 1AE6H 3GSOB 3WIHH 3LKNA 3MOQA 3FAWA 5JHDE 4OF5A 4J12A 3TJHC 4HEPG 4KJYB 3SDXB 4LNRA 5DD0H 4ONGH 1JJUA 1S7RA 3MRJA 1MJJB 4APQA 1QFPA 5IWLA 3ULVF 3M1BA 3RDTD 1CFBA 1ITBB 2MFNA 3WO4B 5IB4B 4MQ7A 2R0WH 2PXYA 5IBUG 1A4JA 4JFHE 1MIEL 1QKZL 3BGMB 5F9WB 1WBZA 1O7VA 3FO9A 5JR1L 4C57C 2F8OA 3UPAA 5DGQA 1T3FA 1A7NH 2DWDA 1XGPA 2BJMH 4IOIB 1XF1A 2P7TA 3UTZA 4JG1L 1XGQB 1NLDL 1JF6A 3VXRD 2APXA 3CK0H 3RX5A 2COQA 3D3VB 2R0ZL 4PJAE 4NHCH 1NCTA 1BOYA 3B9KD 1JZ3A 3VI4F 4PPTA 1AGCA 2UWEF 2I60H 3H9HA 5IQ9B 1YN6B 5BV7H 2X4TA 1BBJB 5GS0H 3EFDH 1D6VL 4PRBA 5HGDB 3QAZB 1Y6NR 5T1LA 1EMTL 4WGVB 5FECA 2WNGA 3WDHA 1T21A 3E0GA 5EO1B 3T1FB 5D72L 2ESVD 4ODUA 3UJIH 4Q6IB 3P30L 1IGJB 2ITCB 5ESVA 4Z77B 4TYUA 4HGMA 5H37H 1BIHA 3AY4C 3IDGB 1YN7B 4J2XA 3KVQA 2GY5A 4Y4KC 5I1GH 3UTSB 3K8KA 4XMPH 4X6CA 4Z78B 3RIAF 3MRBB 1ACYL 1OAQL 1QFUL 3HAEH 3UZQA 3NPZB 4FG6C 4MD5A 1CXFA 4TSBL 1IAMA 5DS8B 5C0JB 2WIIB 2ZG1A 4QRUA 3HUJA 4JO4L 4PY8J 5F3BA 4BM7A 5FHBH 3VD5A 3LN4A 4YFDB 2XPGA 4G3YH 3H0TA 2Y6SC 3MUJA 4FQLH 1MCNA 1R3JB 4U2YA 4XPBH 3SE8L 2H26B 4N5EC 2EDWA 3QXUA 1RK0A 1Y18A 2BOBB 3ARWA 3QEHB 4D9RD 2Z31A 3VGAB 3LIZL 2XTJE 3QEQE 2GFBB 3G5ZA 1QSFB 4XCCL 3I6GA 3QDGB 4ZS6C 1QNZL 3S37X 3O8XD 1L6ZA 4PJBB 3DO7A 4OLYL 4GAGH 5CSGA 2YN5A 1DBBL 5J4MA 5DJCB 3E3QC 4M00A 1PKOA 2YA1A 3EOTH 1CTOA 4IDJH 2DRUA 3ZE1E 2G5RA 3ECBB 3LHPL 2JJSC 3T2NH 3VFRB 4KZDL 3CFCH 2FEEI 2R4RL 1N2RB 3SDCD 4LLVB 5HY9B 4JHZA 1QG3A 2FL5B 1J0YA 5C92A 2XWJA 3GHBH 4PJ9D 3RX7A 4XCEB 4PB9L 2EDEA 1FE8L 5E7BA 2VJXA 1W8OA 2Q1EA 4ONOA 5GRYA 5IHLB 1I1AC 2P8LB 2AERT 1NEZB 1BM3L 4RGMB 2NY7L 1FSKB 2VLRE 1SYVB 4M8VA 4NRZB 1MJ8L 1A7BA 1XEDA 4AEHH 5HSFA 1ORQA 1Y6KR 3VH8G 2AXFA 5JW3L 3O6FC 4OGYH 2XWTB 3RPIA 3NZ8A 4EEEA 2OLDA 3G6AA 3WFCL 4LSRL 4HGKC 2O5ZH 2IAMB 4XB7A 4PTTB 2MKLC 2FJHA 4PJFF 1TITA 2FJGA 2Z4QB 3NVQA 5MP6H 3WNPA 4LCUA 5HHOE 1TETL 4RAUB 3TC9A 1FNFA 3DX8A 3CVHL 4X4XB 5FUZH 3PWNA 1Q38A 4E41B 1AQDB 3MLWL 4P3DB 3UXFA 1X5GA 4YXLH 2ZCLH 4F9LC 3NIGF 1R3HA 4PJXA 1QBBA 4LGSB 4LARL 4Y16D 4RISL 1HZHL 3ULVC 1S7QA 3HZKA 1JPFA 4HIEA 5LKNA 1BMGA 4NM8L 1R3IL 5BMFL 1KCUL 4JY5H 2R1YB 4R4BB 3V8OA 5BS0B 3JVGA 1KB9K 3L5JA 1EH9A 1FIGL 2UV3A 4XMKL 5DGRA 3X11A 4HWBH 1LP9A 1K4CA 3HMXA 1OQOA 4R7NB 2R39A 2G9HA 2GYSA 2VKWA 4OGAD 5GZOD 1G6VK 4XP4L 1TJGH 3OAYH 4WVRA 2GSGB 3VFMA 3TYFB 4QXTB 1KF9B 2EE3A 3MACH 3RWGB 3C6LC 3MUY1 3L3KA 4NWTL 5D7SL 1TMCB 5HHMB 1S9WA 3F12B 4HWBA 1C16A 3S37L 2DMBA 1S7UB 2CO7B 4HC1H 4LRIC 5DJZA 3HE6C 5D96B 2V17L 2YUVA 5JUEH 1G0XA 4YGVA 3L3JA 4CNIA 1PKQB 3MRPA 1JRHI 3GJFA 3OF6A 1DBJL 1X5KA 2X4NA 4HC1A 1VPOL 1M1SA 2C3GA 2PTTA 1E4XI 2R1XA 1KJ3L 3BP7A 2XRAL 1J8HD 2E6PA 4NO3A 3OSKA 3BH9B 4GG6F 3U9PH 3KPRD 3I6LD 5DZOA 4XAWL 2NR6D 4JFEB 2EIDA 3DPBA 5HGHA 4BSJA 4EQ2A 4OCMC 1UEMA 4GW4B 1XCTB 3FRUB 4K9EC 5TPWH 2Y25A 1NAMH 4Q0XH 4I0CC 4NIKB 5JMOC 4ZPTB 2NX5A 4XPTL 5A2IH 5CCKL 2BNRE 4BELD 2HKHH 2H2PD 4IRJB 2Y5TB 1M7IB 1JYNA 5DD3H 1W0WA 1H8OA 4PY7A 4X6EB 3VH8A 4YXHH 2ENSA 4NUGL 5GGQL 4APQD 1T5XA 3NH7H 4AZ8A 2AXGA 2VH5H 5I75C 1DBMH 5L88H 4XNXH 1LO2L 2HKFH 3T0EE 3GMNB 4GRWH 4K3JL 2PXYD 1JGUH 1U2CA 1JMZA 2VR9A 4BA8A 2YD4A 4BKLB 2ATPB 1MIML 2F53E 2UVFA 2ZUQB 1UM6H 3RY5A 4X6DB 2A6KA 2WBWB 4LCWD 2DQGH 4NT6A 1A64A 5DDHB 43C9B 5BXFB 2VDRL 1A6VH 5I6XB 5DJ8A 4W4NA 1AC0A 2OR8A 1BQLH 1W8NA 5E2UL 4KMTL 5CEZE 3BZEA 1X5FA 4MJIE 5D7IA 1IQWL 1EO7A 3HNVL 5IVXB 3VXTA 4PJIB 4YJZL 5FKAA 5GGSA 1NMCB 3GSVA 3I75A 1XR8A 4MDJA 5T1LD 4X4YA 2CIIB 3DX7A 3HR5A 1Q9KB 1RPQA 1URLA 2AK4E 4YE4L 1IGCH 2AV1A 1BIIA 3UBXI 5GS0D 3LEYH 2R8SH 5BQ7A 5CJOH 1E6JH 2HJKB 1S7SB 1AD9A 5HHPB 3VFPB 4RRPG 3HC0A 3OBAA 1TVHA 3OHXA 5D1XD 2YD7A 3O9WB 3TPUA 1P7HL 4UT6L 4NQSA 2VLME 3L3DA 1UH4A 2AI0L 2DI9A 2YEZB 4J3WA 3DGGA 4WHTA 4UOW1 5D2LF 1JHKH 3PXJA 4ODHH 4ZS7H 1TJIH 3QIWB 2UYLB 2B2XL 1I8MB 3MOAH 4GMTL 2XICA 3RWIA 3MGTB 2GCYB 4I3RL 1IKFL 25C8H 2BVTA 3IB4A 4OJFL 1LD9A 5FK9B 4Z7QF 2W92A 2H6PA 1F3RB 1UWGL 5CINH 3L5IA 1EXUA 5ISZE 1CXKA 2WINB 2J6EL 3RWFB 4JY4B 1G1CA 4OLVL 4N0RA 3MV7E 2Z31D 2VQTA 1UT9A 3O3DA 1PY4A 3O3BA 1HH6B 3D39D 5JOPD 1KXTB 2G75A 1A1OA 2Q86B 4PGCB 3RWHA 1GJIA 1NGPL 2AW2A 4EOWH 3QG6B 1HIMH 1K6QH 2UZXB 1A21A 3CLFL 4R0LA 1AKJB 1J05B 1WISA 3JWDH 1YNLL 1F8TL 4I0PD 4DUWA 2VXUH 3GGWB 1FC1A 4X98B 2AJ3B 4Y19D 5EFIA 5KVFH 5JPNA 3SJVB 4M7LL 5BW7C 5I66B 4EUPG 4UQ3A 4I0KA 1CICC 5EBMA 2DQEH 4ZTPL 4F57H 3VE0B 3ULUF 3MTRA 2SEBB 3Q5OA 2NY6D 3CX5K 5D6CB 2OMBA 1TXKA 3RVWC 1W72H 1FYHB 5I73B 3WLBA 3DSFH 3QRFM 3G6DL 3SBWC 5AWNH 3TWCL 4QXUL 2NY0C 1CF8H 5C0FA 1ZGLP 4OLXH 4OF7A 1CGSH 5CFHA 1RUKL 1CFQA 2BCKA 4OCSL 4XC3H 1CFTA 3T65A 1FQ9C 1W72A 2HJLA 2R2CA 1F58L 3BWAB 1BAFH 4ISVB 5KVDH 5C0EB 4UIKH 8CGTA 2ZSVB 3SHSA 1L7IH 1N0XH 1N59B 1QBMH 5E2VL 5LJYH 2MQCA 5K9OB 4HUUB 4WU5B 5I0DA 1IEAB 3AS0A 5HDQL 5ALCH 4PRIB 4PJ7E 3U0WL 4X5WA 5CJ5A 5EH1A 4UDTB 2HJFB 4DGIH 4FQIL 2VXVL 3RY6A 1KFAL 1RZGB 3FCTA 1FFQA 3VGFA 2Z9TA 2YMXH 5IESH 1YEEH 3CVIL 3HUJE 2R2BA 3O41B 1U95B 5D7JB 3CFEA 1BGXL 2GQHA 4GRLA 1MWAL 2QJDA 4JGMA 4EDWL 1KN2H 1WFOA 4WDIA 4RRPA 4XC1L 4F7MA 4Z7VA 4L8CA 4YDJA 1RZFH 4G8FB 4F8QA 4N1CA 2R1WB 1ZT1B 1O7SA 2MCPL 3PHOB 1U8OA 1P5UA 4DZBB 4HJGA 2XN9A 5F1NA 4RGND 5J1TC 3N1PC 5JO5A 4XXCC 2RCSH 1AC6A 3OKMA 1C12B 5JOPE 1A1NB 2MHAA 4XPGL 4UAOB 4DN3H 1D5MB 4ELMF 5CKGA 2OK0H 1EVUA 2JCCB 4GSDH 4YHOL 4MB5A 4UINL 2DIJA 2GJ6A 2YS4A 4G6JH 4XT1C 4J8RB 1JZ7A 3MV9D 1HILA 3BN3B 4NFBA 4NQVA 3LKPB 3OF6D 1IQDB 5D4QA 1ZTXH 2FR4A 5FYLH 1NCAH 4H25B 4K3DH 1FL3B 2MQ3A 3UAJC 2DTSA 1IKNC 5LBSH 1YEHH 5F6HI 3L95B 5HVHC 4NO0B 4EUPH 5M94B <