2R8XA

Crystal structure of yrbi phosphatase from escherichia coli
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
181
structure length
181
Chain Sequence
b'LATCYGPVSADVMAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGYGIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKLDEAKGQSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
molecule tags Hydrolase
source organism Escherichia coli
publication title The Tail of KdsC: CONFORMATIONAL CHANGES CONTROL THE ACTIVITY OF A HALOACID DEHALOGENASE SUPERFAMILY PHOSPHATASE.
pubmed doi rcsb
total genus 62
structure length 181
sequence length 181
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2r8xA00
2ZBEA 3ZVLA 3OCVA 3ZU6A 4BX2A 3SKYA 1RLMA 4RETA 4UMVA 3NRJA 4BNDB 1S2OA 3U26A 1Z88A 1QQ7A 5AKKA 2AMYA 4BEVA 1N8NA 3BA6A 3QYPA 5AW2A 4B6JA 3HLTA 4Y3UA 4OCZA 5ALPA 2G07A 3B9BA 5AVTA 5AKLA 4Y2QA 3GYGA 3PDWA 3ET4A 2IYEA 4KN8A 2B1QA 5ALMA 4JDPA 1L8OA 3I6BA 1Z4JA 3DV9A 1RKUA 5AM1A 1YV9A 3WK8A 5AVWA 4AP9A 2OYCA 4BX3A 4L57A 5T41A 3ESQA 2R8ZA 3EF1A 2JARA 3ZWDA 4BX0A 3OCWA 4KX5A 5ALQA 1QQ5A 3AR2A 4UMDA 1SU4A 4BBJA 2YJ5A 4HGQA 2ZOSA 5AM2A 4DW8A 5ALGA 2CFSA 5AI0A 4O8CA 4UU1A 1RRCA 1O03A 4KYTA 1U2SA 3ONNA 1Z5GA 3OCZA 2JGAA 5ALHA 4C4RA 1J97A 3QU2A 1Q92A 2IOFA 2Q4RA 1KYTA 3D6JA 2FPRA 5AM0A 5AHXA 5IT0A 1RPZA 3HYCA 4QQFA 3NUQA 4JB3A 1LTQA 2IOFK 3KOOA 4YH1A 1Z4OA 1LVHA 2YJ6A 4Y2TA 4EEKA 5ALSA 2GHQA 2YMQA 4BEWA 2DQSA 3B8EA 2JAWA 3R9KA 3QXGA 3CZ4A 4L6AA 5ALDA 5ALOA 3AR9A 1FEZA 2P11A 1WR8A 3UMBA 3DAOA 3J7TA 3QX7A 5AI9A 2I7DA 4XOUA 5AKYA 3WGUA 4G9BA 2VKQA 5AK4A 3BWVA 1ZJJA 1Q91A 3WK6A 4HGNA 3WKCA 4Y2RA 3L8FA 3SHQA 4UMFA 5AKGA 4OHFA 4YIKA 2RAVA 5ALTA 3ED5A 4AS2A 4XQ0A 1U7OA 2C4NA 2HF7A 4UM5A 4NABA 3L0CA 4ZEXA 3R09A 2WF8A 3KZXA 3WKEA 5ALVA 3ET5A 2CN1A 3WK5A 3KC2A 2HCFA 2RBKA 3ZI4A 1RLOA 5AVSA 2B8EA 3UM9A 2ODAA 3FPSA 5AIAA 3FM9A 2B8JA 3MC1A 3WK9A 2PKEA 3QU9A 3WK4A 3WKAA 3EPRA 2R8XA 3AR7A 1Z4MA 2HI0A 3I1YA 3IB6A 3ZUPA 2Q5EA 4J2TA 3IRUA 3L1VA 1TJ3A 2B82A 1T5TA 4Y2PA 2D2VA 1XVIA 5ALYA 5AESA 5AK3A 3L8HA 1RDFA 3WGVA 3PCTA 5AI6A 4UM7A 3L7YA 2ZBFA 2R8YA 4PNHA 2C88A 3ZWKA 2B1RA 3L0YA 3AR8A 3SMVA 5ALRA 2G09A 2PR7A 1X42A 2I55A 3I28A 2GO7A 4FYPA 2FUEA 3QUBA 4ZEVA 4BKMA 3PGVA 4IFTA 2RARA 3A1CA 1YNSA 4Y2JA 4YIHA 2G80A 2FUCA 3CNHA 3QLEA 4C4TA 1T9ZA 3DNPA 4L6CA 3WKDA 4DWOA 5JJBA 3KDPA 2HOQA 2HEGA 5AW8A 3L1UA 1RQLA 2HX1A 1TJ4A 1J8DA 1TA0A 3N28A 3IJ5A 2O9JA 5AKXA 1S8OA 3ZW7A 3QUCA 1U02A 3UMGA 2FPWA 2W4MA 3UMCA 4H1WA 4CF5A 5ALZA 1VFPA 2OM6A 5AW6A 2G08A 3U7EB 5AW3A 5AW7A 3RFUA 2W11A 1U2TA 3B9RA 1ZD5A 2HHLA 5ALEA 3NALA 1YDFA 4EELA 3MMZA 1RQNA 3K1ZA 2NYVA 2C8KA 4HGRA 1QYIA 2P69A 5IT4A 1Z4LA 1RMTA 5ALUA 2W43A 1RMQA 4NAVA 3ZVNA 3SD7A 2P27A 2YMMA 4NWIA 5AVRA 5AM3A 4GXTA 2FDRA 3N8GA 1VJRA 3ESRA 2EATA 4IG4A 3W5DA 3FGOA 3OTQA 4UARA 5AKJA 3FVVA 2MSNA 3QU4A 4UASA 1RMYA 1RKVA 3QGMA 4KNVA 1L7PA 4NFLA 4F71A 5A3QA 5A3RA 4YGYA 1U7PA 3RF6A 5ALKA 1AQ6A 5AW9A 4UAVA 1CQZA 2FI1A 1Z5UA 1SWWA 3E8MA 1ZRNA 2I54A 2YFYA 5ALIA 3I76A 3QU5A 3ZX5A 3OCXA 4G63A 1Z4KA 2HF2A 1QH9A 2C8LA 5AI5A 4BYGA 1K1EA 2C9MA 2OBBA 2WF6A 2MU1A 2WF7A 4CF3A 3W5BA 4HYTA 2ZG6A 4E88A 2RB5A 2AH5A 2BY4A 3W5CA 3S6JA 4EZEA 5AICA 5AI4A 3U19A 1Y8AA 5AI8A 5ALLA 5A3SA 2I34A 3F9RA 1N9KA 2YMPA 3M9LA 1ZRMA 5AVZA 4I9FA 1NF2A 5IS2A 5AVXA 2YN4A 1PW5A 4Y2SA 3DDHA 5AVUA 2G1AA 3KD3A 1Z4QA 5AM5A 5AW0A 3M1YA 3TLMA 2O2XA 3A3YA 1WPGA 5AM4A 4Y2YA 4Y2UA 1TJ5A 3QUQA 4NV0A 1CR6A 3N5KA 5AKIA 3QU7A 4CF4A 3OCUA 1Z4IA 4DCCA 2NO5A 2Q4TA 2R8EA 3SLRA 3ZX4A 1SWVA 4DFDA 1RC8A 1YMQA 1T5SA 3AR4A 4GIBA 5AKEA 2QYHA 3FPBA 3OCYA 2WF9A 4EX6A 2B0CA 3KBBA 2EAUA 5AIBA 1L8LA 1YS9A 1ZD2P 4RESA 4Y2VA 2AUTA 2FPXA 3L0BA 4XE5A 1EK1A 4OFZA 1NRWA 2PQ0A 3E84A 2G0AA 4KNWA 3U7FB 1TE2A 3AR3A 1MH9A 2HDOA 2I33A 1XPJA 1RLTA 2JAOA 2YMLA 5ALXA 4HGPA 1WZCA 2JAUA 3N1UA 3EWIA 2ZXEA 4YCNA 1L7OA 1NNLA 2I6XA 2YJ4A 4J03A 2ZBDA 2YY6A 3WK7A 1F5SA 3SKXA 4FFDA 2YJ3A 1YJ5A 3A1EA 3VAYA 4EX7A 1RKQA 3EF0A 4UMEA 5AW1A 1ZD3A 1L7MA 2GHTA 2FPUA 3U7HB 2OA0A 1WVIA 4XPZA 2AGVA 5AVQA 4UAUA 4CE6A 3E81A 2FPSA 2BDEA 5AKHA 3MN1A 5ALFA 2P9JA 2BDUA 4QJBA 3L8GA 4AS3A 2EARA 3NANA 3P96A 5AVYA 1L6RA 5FP0A 2WHEA 2ZBGA 2IA5A 4HGOA 5ALJA 4MWOA 3N07A 1Z4NA 1ZD4A 4KX3A 5AKZA 2HO4A 4FE3A 1JUDA 2GFHA 3QUTA 3E58A 1XP5A 3L5KA 5ALWA 4C4SA 3NIWA 2FEAA 4UU0A 2G06A 3ZTWA 2CFRA 4Y2XA 3QNMA 1VJ5A 3L8EA 4YCMA 2WF5A 3A1DA 1EK2A 4I9GA 3FZQA 3MPOA 5ALNA 2NO4A 3U7GA 2IOHA 3NASA 4YCLA 3ZVMA 5E0OA 4HAIA 1O08A 2YBDA 2QLTA 5AW5A 3W5AA 4UW9A 4F72A 5AK6A 2B30A 1Z4PX 1QQ6A 4MUMA 1ZOLA 3AR6A 4BNDA 3AR5A 3OPXA 2CFTA 5AK5A 1IWOA 3R4CA 3ZTYA 4OD0A 2X4DA 5AW4A 4EENA 4ZEWA 2GMWA 1ZS9A 2WFAA 5AVVA 1L7NA 3WKBA 4UATA 2WM8A 3SF0A 4CNQA 3NAMA 3U13A 2HSZA 3PGLA
chains in the Genus database with same CATH superfamily
1YJQA 1YFJA 5K99A 5TGDA 3HACA 2DOKA 2SBTA 3WL7A 5FV4A 1BROA 2VYND 3DYBA 3PZBA 4FW8A 1A88A 1JHDA 4OJKA 4WD3A 4RTSA 3MJDA 5FWNA 1E3TA 3SE0A 1GLNA 3QKUA 4PYLA 4RXTA 4YRFA 5BXQC 1ZUIA 1WHTB 2ILTA 2Q6TA 2DQ4A 1DKOA 2OGSA 4YVFA 4JLAA 4ZTZB 3O4HA 2QTFA 2HRBA 2O7VA 3FB4A 4B3FX 4ARBA 2W2VA 2CL6X 1PFUA 4LXGA 4EK9A 1VRCA 1WXEA 3O4JA 2OXRA 3SS8A 3ZDXB 1CNFA 4OHPA 4U9IS 3GROA 3NIGB 4HB3A 3YASA 3IB3A 4U8GA 2RH9B 4IFEA 5IDYA 4LYGA 1DQYA 2P2YA 1MRSA 2VYCA 2FV8A 2ZWVA 3BAZA 3CF4A 4JJ7A 3WWEA 2Z2IA 3KS9A 1JHOA 3L9WA 4RHXA 4RTJA 3C98A 3QOYA 1EAYA 4IMIB 1X94A 1C81A 1E6EA 1IXKA 1V7PC 2FLWA 4KR0A 2X22A 4AXXA 3T41A 2J9FB 3RYIB 4PLYA 4ZO8A 1V1MA 2R4TA 5JWOA 3DBHA 1EWTA 4N7RA 4BP1A 5KO2A 2PBRA 4HUJA 4GXQA 4HOYA 3ICOA 1W30A 4K9QA 5ADHA 4ZN6A 2Z5VA 4EY6A 1SNYA 1RKUA 2BHLA 1Y3CE 1HE3A 2XWPA 3T15A 2ZRDA 1L0BA 3RSQA 3RTEA 2WE7A 1V1MB 1V6AA 3WGKA 5HR5A 1E2LA 1OI2A 5A9SB 4G23A 4GYWA 5EE0A 1UJBA 5DWQA 1L2TA 2NO1A 3DL0A 1TJPB 3EC1A 2I4LA 1TYBE 1UFOA 2IJGX 3F74A 5F3DA 1ECGA 1N5JA 2ZB4A 4KX5A 5H3HA 1VECA 1TLTA 5BSHA 2XH8A 4ZVKA 3MGCA 1E20A 3BK1A 1GCGA 2VP4A 1L1EA 2PSDA 2XNSA 1T26A 3C6ZA 1RP7A 1YU6A 2CBZA 2CCJA 1X70A 2ST1A 4QLOA 2XNKA 3X2FA 3EA4A 4UU1A 2HDWA 4CV1A 1CFJA 1N0HA 3W3AD 1KAEA 1QIDA 2V74B 4I6GA 1HE8B 2JDIA 3V8PA 1TK9A 3ABZA 3PXGA 3BG5A 3W79A 5C4MA 4M1ZA 1TCUA 2VF2A 2Z4RA 1DMRA 4IH1A 1CUCA 1KYTA 1PWHA 4AU1A 4XFKA 3VSEA 4RD6A 3IP1A 1OSNA 3DZBA 3P9CA 4NU8X 4WZAB 5LLDA 3WB2A 3DUFA 3FOCA 3RPEA 3N0VA 2XYRA 3LHIA 3ZGYA 3H2SA 2GM3A 4JB3A 4KVFA 1V8ZA 4LZOA 3VSCA 1LTQA 3JQ7B 4JLPA 4U6SA 3BS4A 1FU7A 3QVXA 3V4ZA 4DV5B 1XDWA 1WB6A 1NT2A 5DNAA 3U3DA 1N9GA 1CYDA 1YACA 2CE2X 3NOXA 4OBXA 1QYWA 3IV9A 4XVQA 3VGPA 1SBNE 3NEJA 2FSHA 4CLXA 4C4PA 1T9AA 2JBAB 5EKXA 3GDOA 1LJLA 5IYZB 4K6HA 3MS7A 5EEHA 3G8AA 4ILEA 1SUDA 1E5XA 3NNDA 4KWIA 1WLSA 1JFLA 4DYDA 5DX8A 2GPSA 1Q3TA 2CLMB 4AUKA 3QM1A 3M2TA 4QUJA 1E89A 3UT0A 4M8LA 5LYYA 4EATA 1N36B 2VQFB 3RKSA 4RF4A 2IUEA 5AKYA 2C5SA 4DCJA 1MGOA 1N2BA 3TIXB 1Y7HA 4OXYA 3VDQA 3NYRA 3RYHA 4JC0A 3VZPA 3JTMA 4KZKA 4ARVA 5KSZA 1AF4A 1XJQA 2WA2A 3NBFA 4Y2RA 4CLEA 1I5OA 3WLEA 3C16C 2RHGB 4I0WB 4E7OA 3WSTA 4UAJA 1CR4A 2GJ9A 5CIWA 1XXHB 2H2HA 3BXEA 4DABA 2J9RA 2OAP1 4AT1A 1P2FA 5CK5A 4MUGA 4EHIA 4PQEA 1C8LA 3AW9A 4U2CA 1RXYA 3H42B 3P97A 1PWXA 3HCNA 4NX2A 4DV3B 2JB9A 3K35A 5ALVA 3CT6A 3AL0C 1KEUA 1LDMA 3IVMA 4F04A 2QROA 4N3NA 2H0QA 1TZJA 2WSLA 4DCNA 2FW7A 2OG2A 1MUUA 3EXG1 2NVWA 3O2NA 2AZMA 5J43A 2ZU6A 1P7CA 5TIIA 3KQHA 3C45A 4C87A 3OF2A 1ECCA 1B41A 3TOXA 1Z0JA 2WZCA 4JJKA 4P4LA 3JQGB 5EZQA 1M5TA 4ZVRA 1O0CA 3IEVA 5JS6A 5BMVB 1JLKA 3IPLA 2XZDA 3DBOB 1KPIA 2OC4A 3HFGA 2GAFA 4MUHA 3WYEA 4PQGA 3SWWA 2AXEA 4BLUA 3KXIA 3REGA 4QUHA 2REBA 5JY1A 1RWXA 1JJ7A 3IRUA 4YV2A 1DL5A 4F84A 2B20A 1OREA 4IIJB 1T5TA 4MVWA 3MOIA 4HAWA 2Q7DA 1Y7TA 1P0MA 1L5ZA 1ZO8A 3KKOA 3M6FA 2X7XA 3HSKA 3L7AA 1E7QA 4JU9A 4Q1BA 5D1NA 4DLKA 1HL7A 3AIMA 1FFXA 3TINA 1A9YA 2A5FA 2UKDA 2X6TA 3H75A 4WY2A 4BDTA 3HH8A 4PLTA 2RGXA 2PZMA 2R8YA 4QGGA 2QNIA 1KXZA 4DY4A 5DHSA 4ZK6A 2C88A 3GLGA 2OQVA 4UVGA 4U7JA 4XXHA 3TI9A 2ACEA 2BRUA 3OD1A 1BO6A 4QAQA 4YT5A 5FAXA 2WVAA 4FYPA 1HFWA 5F2KA 4DMKA 3G5MA 5DP1A 1GG5A 1OU0A 3GNQA 2V7VA 3OE1A 2MDTA 5TQ2A 1KNXA 4J3JA 4QC2A 5DNEA 3TX2A 4YCCA 1JECA 3RIYA 4XZ3A 5I9NA 1XTPA 2AHOA 1R9MA 2GPAA 3EFEA 3LLCA 4WT7A 1DFIA 4X3OA 3QXJA 3ZBTA 4KPFC 2N1MA 5T6BA 3GPIA 3K15A 2PXHA 4P92A 2QLBA 4QYIA 4JKOA 2FF7A 4L6CA 1HMYA 1MW9X 4DA9A 3O26A 4FDMA 1VMIA 1N75A 1XLWA 4UPVA 1JIUA 2ZRBA 2DGDA 2JFWA 5GZ6A 5G2OA 1P7VA 1V39A 3DD1A 4G5HA 4HB4A 2IH5A 3N86A 4I5EA 1FIUA 1NT4A 2C97A 3SFZA 4TYQA 4D81A 3QUCA 4DLAA 2QMQA 1ATIA 1WUKS 3A31A 4BUCA 2ZJYA 3HLKA 5AK0A 4CVNA 1GSHA 2Q0QA 2HPZA 1I2MA 1VFPA 1RCTE 2EQAA 4U2BA 3TIVA 1G3RA 3C5HA 1ADBA 4GYKA 4FW9A 4MIOA 3FPEA 4PBRA 5C1PA 1OZ0A 2QN1A 4Q34A 3ACCA 5CU7A 2HYIC 2ZJ8A 4NXNB 4ZCMA 3OD5A 1FXWF 1UC4B 2DCMA 3ONEA 1WHSA 5ALEA 1JHXA 4Z3OA 5BOVA 4HXEB 1ZGZA 5B1DA 3BC1A 4I3HA 4MDHA 5YASA 1MX3A 2QQ5A 3MMZA 4PCVA 4RQBA 1S4MA 3ORSA 4ZCQA 4CQLB 4EB0A 2C8KA 1G2OA 2YHSA 4HGRA 4X95A 5K2MA 5C8VA 1F7UA 4H4DA 2A0KA 4Q1CA 4GLOA 1PR2A 5IJ0A 1VIMA 1S2IA 1D5CA 4N7MA 4J43A 4CV2A 3CHYA 1OA0A 4PAMA 4C3UA 3U0VA 3AKZA 2VVTA 1M75A 2PK3A 4GXTA 4TTPA 3IXQA 4WDRA 1EXVA 4GICA 4QXAA 4XLLA 3IBFA 1JIJA 4KGZA 2X4IA 4C5BA 4CM5A 2JLCA 3RHZA 1AQYA 1OMOA 3HMKA 3CG0A 4X9XA 1PBNA 4NFLA 1ZI8A 3WIUA 1GGEA 3G2QA 3TLGB 3VC7A 2QV0A 1Y42X 3A0UA 3CGWA 3GN1A 3ZDQA 1PL7A 2A5LA 1WUIS 2HDNB 2HL6A 2OP1A 4Z0HO 4Z54A 5JECA 2YFYA 3QXXA 4H08A 1F12A 4WOJA 3R74A 4UKDA 2PSHA 4MMZB 4E30A 3B3AA 2HF2A 1T2NA 1J7KA 3KT3A 4O1IA 2CLCX 3JAMA 5IBPA 4I8IA 4EHDA 4EKGA 1X0VA 3THSA 2EFEB 1M67A 1HM5A 1KP9A 1QKJA 3RBXA 2I3ZA 2VTKA 3DB1A 4BMPB 3KQTA 2I3DA 2FJ0A 4ZOCA 4EZEA 3H7IA 1LI4A 2WA1A 1OZGA 3TJRA 1VM6A 2W93A 1GQSA 3GB9A 4N82A 1D2EA 2X4GA 3O8OA 3FCOA 5EHNA 5TT0A 2CV1A 1GL6A 1I0IA 2F1JA 3HQ4O 4OJMX 1JQLB 1WABA 4RU1A 3QK7A 1BMFD 4WFIA 3GMTA 2G0TA 2J5RA 4DMLA 3QYAA 1U0TA 3EQZA 4M99A 3B1WA 5TB5A 4DSNA 2P4SA 1E94E 1TU0A 3AC0A 4HEJA 4O5OA 3UMSA 4I1YA 3HU3A 4GP6A 1Z8FA 3ZCUA 3IHLA 1XZLA 3W8NA 3P5SA 5KTTA 4E2WA 4R84A 3FTQA 2GBIA 2HXYA 1ODJA 5AM4A 1E3JA 4F5EA 3IT2A 4IIJF 4DZZA 4WLNA 1OF1A 2VPIA 1CR6A 3U1VA 3ADCA 1M83A 1R5NA 3KZ1E 4CF4A 2JGRA 3F4KA 2IU6A 5DHTA 4JL6A 4NZNA 5JSYA 2GTIA 2QIPA 1CZOA 2IK8A 2D1TA 3L0IB 3ZX4A 4ZKDA 2IY7A 2AI1A 1TUBB 2HD4A 5G3ZA 2JPDA 3T7DA 5HWSA 5INTA 5K3AA 3H6HA 1NXTA 2IGTA 4QBFA 4CR6A 2V58A 3OTHA 3P20A 4LK3A 4L6IA 3U4AA 3PC3A 1YCHA 3KKLA 2NZWA 1Z7WA 3CZCA 4H7PA 3LDFA 4HDQB 5E1DA 4Q7MB 2QZSA 3DBIA 4IIGA 1GZHB 1JFVA 2CVPA 1FJ2A 1DUSA 5DYYA 3OEHD 4HRXA 4Z3DA 1F2TB 3AJ8A 3TMKA 2FMUA 4BNKA 5EZ6B 4BNYA 4MGEA 1JG3A 3C5VA 1CJKC 2WWHA 2LPMA 3HYSA 4I4NA 1NE7A 5TMEA 3R8XA 5HCNA 4CLHA 2O0LA 1YIAA 4UNQA 3SJAA 3M6UA 1TO6A 2HGSA 4PV7A 3LPAA 4KPGA 2IT1A 2H6EA 1I24A 1S1CA 3AHFA 4HAUA 4J1TC 4HEQA 4CL8A 4F91B 3F5QA 3R6WA 4EUFA 2MYPA 4ZJPA 1ZIXA 4NHEA 4RVFA 1EKXA 2I1VB 1USKA 2OV4A 4P33A 3ZYZA 5F2OA 4HDCA 4DCTA 1N9GB 6NULA 1XFAA 2VYFA 2I6SA 1VCMA 2EGGA 3MIIA 2RJ3A 2C4TA 3R6GA 1P2GA 4FFNA 4P93A 3GFTA 2M2IA 1HO3A 3HB9A 4ZV9A 1B76A 1JR2A 3BRCA 3O38A 1WV0A 3UAVA 1JTEA 4DNXA 1OH6A 3PQ7A 3FPCA 5CH3A 3V2IA 1GZ7A 3BFKA 1JAXA 2WAMA 3LBHA 2WHXA 4N0MA 4QVGA 2FR1A 3VAYA 5J2UF 1TQ2A 1DC4A 1BSVA 4Q3BA 1EFRA 4WK0B 1H5UA 2V5AA 1HG1A 2GHTA 2DG2A 2QA5A 2QI9C 2VBGA 2YZGA 2K7ZA 4XB6B 3H84A 4W5JA 5HP4A 5HZKA 3PUKA 4QLAA 2AGVA 4F21A 3NDRA 4D9MA 1MT0A 3KR9A 1H2WA 2X5OA 3IELA 4V39A 2G8NA 3G68A 5BNZA 2P5YA 3PENA 2IXDA 2V7TA 2Q62A 5LMZA 1NBMD 3QVKA 3BDVA 3K9NA 3QHAA 4NPHA 2QRMA 3COYA 3I53A 4YV7A 4NCHA 2R6GA 3R77A 4KQFA 3USZA 1YDEA 1UDRA 1R4ZA 2WG1A 4BVJA 1Q0TA 3ZGZA 4MRSA 3BWEA 3KSZO 4D6PA 3SQXA 2ZPUA 1R27A 3OZXA 4KLCA 4C7BA 1F3LA 1TQDA 4FDTA 2XCTB 4V0RA 1VJDA 4FWBA 4U5QA 5TT1A 5HDBB 4PQYA 4IEEA 4EUHA 5EG5A 1SA0A 1CG6A 3PR1A 2B4YA 2XAAA 4ZO9A 3RTGA 1UZMA 2AKAB 4NESA 5C34B 4JSYA 5CLQA 2VCYA 2XBLA 1A7JA 2H3HA 1LTHR 1QFXA 2CFRA 3HYTA 1EVZA 3GVPA 4L5BA 4YJ2F 4ZO4A 3F7OA 3K0BA 4LHZA 1T5OA 1G66A 2A9FA 2Z95A 1QHEA 3CCFA 3A1DA 3C8DA 2HA5A 3GEHA 3JWEA 4BTEA 4Z4GA 3AINA 2A9QA 1FTWA 4DPKA 1JR6A 2C29D 3Q0TA 3FCAA 4I50A 1BA2A 2BBSA 1CF9A 3H2JA 2AR9A 3OQ1A 4I55F 2D54A 2B2CA 1G4UR 3EDMA 4LY3A 2AEMA 1BX1A 1ZN8A 3EFBA 4Q93A 2Q4BA 3W5AA 1AZTA 3HADA 1OIXA 1BFKA 3ZU3A 2IPAB 4MQ5A 5FTNA 3UWOA 5DYGA 3TZ6A 1IXYA 4FE4A 3ZCTA 2EKLA 4PHGA 1Y9AA 1M5RA 2FRDA 4F1JA 3CF6R 3ZHSA 1ORRA 2VK4A 4UBNA 2D0OB 3ESXA 1I7DA 4IVQA 4BECA 1JJIA 4L3VA 3FAKA 2GMWA 3BIWA 3L04A 2UZ1A 4KQEA 2FSPA 4KR7A 3GLHA 2PLFA 2AQKA 3ILXA 4CT4B 4KGXA 3R0XA 1LRJA 2A0YA 5LLTA 2C4HA 4RVNA 4MEBA 3SC2A 1C2YA 3P0FA 4LF4B 5DI3B 1AD2A 4IL5A 4B3GA 1WPXA 2OG1A 5B30A 1QTRA 3PGLA 4O4LA 3OLQA 4QU0A 3TLKA 4DA7A 3RYCA 4Q12A 4ZOEA 4I4IA 2EF0A 3C3KA 1RXEA 5H16A 2NSYA 1M3SA 3O7WA 3G13A 2PS9A 1J49A 1I33A 2ZBRA 3BWMA 5ES3A 1EWKA 2GHRA 4OHVA 1B15A 2NU7A 3DAGA 4M9QA 4BRUA 1E3IA 1NFQA 2JIMA 4I36A 4KBGA 5I4BA 5LQAA 2P0EA 3GRKA 4O33A 1EPUA 1FX1A 1I0LA 2HU7A 3DL4A 1QC5B 3FNBA 3WMFA 1MB9A 2FCAA 3BERA 2JGKA 4R5MA 5AVTA 5KTRA 2WJ3A 4DQLA 2B8TA 3QVGB 1VBFA 3NHKA 4DG5A 2IF2A 2JGFA 1Z36A 3QG5A 4AKSA 3ABIA 5K6AC 4L3OA 3E9EA 2IY8A 4WZZA 3ZZNA 3E7FA 3WIEA 2B1QA 2PJUA 4Z1MA 2M6KA 4YRBA 3RUAA 3HDGA 1G8AA 4JDPA 4XVRA 1GRRA 2Q1WA 2Y1CA 4ZYVA 3HBMA 3OOYA 3ERCA 3UQZA 1JR3A 3JQAA 4IW3B 3D4OA 4X1YA 5FBHA 4DQDA 2BL4A 2FPMA 4NCJA 1D2GA 1MHTA 4B5KA 1FTGA 3L8MA 2PT6A 2CV2A 3IXMA 1L3IA 4ESVA 3LZDA 2VWPA 3UA4A 2D2FA 2YBEA 4JU8A 1NBAA 4HH4A 4C4AA 1R37A 4NYMQ 2OKCA 5EYPB 1DADA 1KRHA 2P2GA 3BD7A 5ALQA 4ZDWA 1N4AA 3AR2A 2HA0A 4EM6A 1DTWB 3WB1A 4BBJA 2D8MA 3L8YA 1XTIA 4OPMA 3T1HB 3KT0A 4DZRA 2ZT5A 2WWFA 1NXSA 2JVJA 1DTWA 1GTMA 1KHTA 2I6FA 3LPNA 4PLVA 4BQEA 1T2AA 4IXNA 4RVHA 4S0XA 1PFQA 3N39C 4XEUA 4MVJI 3WIDA 3MIZA 1DJNA 4DMFA 2Y1EA 4XOIA 1T3LA 3C5EA 2P67A 3CZQA 4ZAFA 3TSZA 4ZJZA 4ZOQI 2VAPA 1R3DA 2GEJA 3GO4A 5HMLA 5JCPA 3MINA 5MF6A 2RD2A 1CNEA 1TCBA 5DJ5A 4PAQA 3BWBA 3PNLA 3ADKA 3MQFA 2HWXA 1QX3A 1X87A 2I4TA 3GUVA 1IQ0A 3L6UA 4TKZA 4UD2A 2Z43A 3EW7A 3NHAA 1WY7A 3C3DA 1MW8X 4QOIA 1I3NA 2IYYA 3AHEA 2EFHB 2F3TA 3BH6A 3OEED 4OJTA 2YHUA 3UAZA 5G0SA 4V1CI 4J1NA 1TUGA 3F5FA 5CURA 1GGHA 3JZMA 4QUIA 3HCAA 2GB4A 3WG9A 4OX9B 4ZT4A 3K1AB 4BVGA 1PJTA 1UJMA 3LT5A 3L2OB 5DWVA 1Q1NA 5JSFA 4HBGA 4I5GA 3HJHA 5G4KA 3TM5A 1EX6A 1RPAA 2P6NA 1LBQA 4XQEA 4C01A 5AJHA 3OX4A 4E4YA 1YIDA 1F9AA 1DG3A 3GGJA 4HPXB 2AFHB 2CUNA 3PUYA 4P4UA 2C92A 5EWJB 1SXJE 1Y5NA 1SVOA 1L5NA 1VYHA 3O91A 3A4IA 3NOQA 3NKLA 4Z51A 3CR8A 3I3SR 4KXXA 5H83A 3R40A 3RC8A 1YRLA 3AYZB 2IYUA 2YRWA 4MI6A 4PN7A 5IAKA 4LF7B 3FUUA 1FQOA 1II8B 2AW3A 4UVIA 3C3JA 4LZZA 5TQ0B 3MMPA 4BUZA 2F3UA 2JAPA 3ABOB 2A2ZA 2F00A 4NECA 2H63A 3BD8A 4ZTBA 1WJGA 4ES6A 2AYZA 4UHEA 1P6UA 1IM8A 1GNQA 1E3WA 1J8VA 1TCAA 3C6MA 2EWWA 1U5CA 5LP6A 1NNSA 3IAUA 3ZLBA 4LZPA 3JQGA 4QBKA 4XYMA 2I78A 3MWDB 1NV9A 4M76B 4K3VA 3ZUPA 3QPBA 4D4IA 4CIXA 1B2LA 3KPWA 1QQTA 3Q85A 3EXIA 4LOHA 3N87A 4CI0B 1SIWA 2B82A 5LM3A 1K8QA 3MRVA 4KO3S 3NDBB 3ZIUA 3NCHA 5HRAA 1DIGA 2P9BA 3GH1A 3HR8A 4HB0A 2QMOA 4IRUB 2PV0A 3CPHA 1STOA 1QHHA 2FP4B 3B38A 4Z9FA 1JNXX 1OZHA 4AX8A 3FCCA 3WGVA 3CNNA 4WBNB 2WILA 1ZINA 1NQTA 2BI4A 4CF6A 4LQLA 1KTVA 3LA8A 3O9ZA 2NUPB 2VJKA 1CVRA 3GGGA 5HK9A 5EKUA 2R7KA 2NXWA 3HUTA 4G1CA 3AIIA 1D04A 2UYOA 4AMBA 2WWWA 3FE2A 3AR8A 1C30A 5ALRA 3R1IA 1G9SA 3WBJA 3LY8A 2ZAIA 4XQ9A 4EGCB 3RSLA 1J2TA 3F1LA 4YI3A 1FRFS 1ZVQA 3LOQA 2UXDB 1F2UA 4XYEA 4GU5A 3ZK7A 4AKEA 5LQMA 4PFJA 3VV3A 1DGQA 2QEQA 2ZSFA 3JRXA 4UXHA 2FFHA 1P1JA 2RARA 2BR3A 3FR8A 3VAAA 1CEYA 3M1LA 1PKEA 2E4WA 2PKWA 4KYVA 1VLHA 2ATEA 4M7RA 4A4DA 4LC9A 3LKZA 5KWSA 4DR6B 3TOVA 4MUKA 3VR6D 4P5EA 5I4CA 4BAUA 4NCXA 1ZSVA 4AZTA 4FNOA 4Z4HA 2W2MA 1N4DA 1W4AA 4EJFA 1DX6A 4IIDA 3H2BA 5C37A 3Q9UA 3GFQA 5LKAA 3LT0A 4DKJA 3HCFA 1Q1AA 4EGAA 2BP7B 2PUDA 5K03A 5AQ1A 5IC4A 4JLNA 1TK2A 4ZI7A 1QF9A 2YRXA 1JQJC 1ZA2A 3FPAA 2O2ZA 1I30A 4WKOA 1PR5A 1JQAA 5GY7A 3PPXA 3ZD6A 2FHSA 1GGKA 3CRRA 2GGSA 1IWBB 1LY1A 4JLKA 4KYUA 4MPJA 5DYNA 3QOXA 4EITA 1EXNA 1A8SA 1NMZA 4I3FA 4LC0A 4X6LA 1NI3A 1GU7A 4Y0AA 4BYMA 5GTDA 3HA3A 3II6X 4RM3A 3W0LB 1CC1S 2NN3C 2LNDA 1TM7E 2PFSA 4I50B 2I3AA 3WI7A 3V7UA 1W9HA 2HFJA 3QJYA 3PX3A 4XJXA 1UPBA 2G17A 3WVNA 4YLYA 1N78A 1LS6A 4O2BA 1YAHA 4L8LA 1F9EA 5IT4A 4NCNA 3Q9NA 4YC7A 2O3TA 1J0EA 2F55A 5FOQA 1W59A 1BDMA 1QX4A 1RMQA 1X1QA 1MJNA 3D8UA 4Q4AA 1WD5A 3ROTA 1M6HA 4RD0A 4C2TA 1YVPA 3KETA 2R9VA 2VA9A 4KO1S 2X14A 4BGUA 1G7CA 4A92A 4GDMA 3EYAA 5HUHA 4WA8A 3R5TA 5EWMA 1DCFA 2V4UA 3DCNA 2IEAA 3OJ0A 3QY0A 5COQA 5FNVA 5TGTA 4E09A 5I9TA 4BEJA 5AXCA 5KQGA 3DF9A 1ST2A 4MW0A 4AC9A 3OT1A 1AF7A 1KKLA 2R4UA 3DE5X 4GSLA 1FFAA 4BNUA 4TRJA 2O3SA 4V2UA 4AFNA 1KY5A 4CKYA 1XRSB 2GN4A 3N6VA 4ZCRA 3MWGA 3WSWA 4IRMA 3X1JA 1R12A 2JHAA 2XD9A 4X0EA 3QEBZ 2IZ1A 1T1EA 2CLKB 4BTLA 2BLLA 4B43A 2D5BA 5ALIA 1QRDA 2HREA 1ZMOA 3SK0A 4C06A 4MGKR 3M6LA 1BC5A 2HJHA 2C2BA 2CKMA 4JYMA 4MUYA 4DNFA 3FWPA 3X0DA 1SBYA 1G18A 4FEEA 2D7CA 4LVCA 4Q05A 2K87A 5FWDA 2O1XA 4WBNF 4ND4A 3UB2A 4H18A 4DL9A 4IQ8A 2PX2A 4MQFB 4FI3F 1D4AA 1QG4A 4GF5A 1SBQA 1C4XA 1KGSA 1PSZA 3QE0A 2ZYUX 1C3EA 5AICA 3SHVA 4M3NA 5D3MA 4OYLA 1ZM2A 5B2EA 1Z82A 3UYKA 4LJ8A 1AMNA 1FFSA 3FTDA 3R6DA 4PF1A 4EQ6B 2G9QA 5IT9A 1A9QA 4Q3NA 3GLIE 1ZUNB 4IAOA 1OWNA 2C84A 1N1EA 3LL4A 4X8HA 2O2GA 3OQMA 1QZ3A 3BMXA 3EIQA 4E07A 4L78A 5BVGA 2FWIA 1Y5RA 3GEGA 5LDHA 1UMKA 3VNUA 1CEQA 1TZCA 5LXTB 2WM9B 1NJ6A 2IVFA 4Y2SA 5E7IA 3FOAA 3HPRA 4TTJA 2OC9A 2VDWA 5TVKA 2UZ4A 2HTEA 3I34X 2KLBA 3NV7A 2FMXA 4Y7CA 4REQB 3GOQA 4R1SA 3PNKA 3IXLA 1EYZA 4D9NA 4HSGA 1EINA 1I8TA 1KY2A 2C9YA 2HPVA 2JZCA 1PDWA 3MYYA 4OHCA 4R1LA 4Q00A 3RG2A 1QPZA 3HTXA 3AT1A 4M1EA 2A5DA 3R8CA 3OIWA 3MB8A 2Q5OA 1WQ4A 1N2XA 3HVIA 1TAHA 1C7JA 3PYMA 1QQBA 2H2IA 1S2DA 1C9MA 2HFKA 3L0OA 2Z3WA 4E21A 4ZIRA 3LPLA 5E2BA 3JQ8A 3G0GA 2FMIA 3PT5A 3IBYA 4FSDA 1NAIA 2F43A 4N0EA 4RGQA 3ZY5A 4BO1A 621PA 4D25A 3L6RA 5AKEA 4LAFA 5JRZA 2E3JA 1NV8A 1KQOA 1J8YF 2G36A 3M6AA 1TLFA 3TPCA 2I2WA 4NJMB 2IEBA 1COWA 4D8TA 3KBBA 3FVQA 1KYXA 3DXXA 3OZEA 2CDAA 3JQ8B 4KMRA 3VO9A 4CDGA 1FDIA 3L4JA 4WXHA 3V97A 4LMPA 1MB2A 2VHXA 3JQ7A 1JVBA 1SCBA 2HHAA 4MJ7A 4NK5A 5CNMA 1HEIA 2Z2KA 3E7XA 4UUNA 2Y93A 2BGNA 3ODGA 2QMYA 2P9HA 3DHVA 2Q3BA 4EECA 2CGEA 3JAWA 5FUBA 4CCAA 5KTPA 2IHKA 2A9KA 2W2QA 1D2NA 3DULA 4RADA 1NXXA 4HDSB 1FX0A 1PJ8A 1TE2A 3R3UA 3GOHA 2X3YA 1GUZA 2KM1A 1QO0D 3BTSA 1ISSA 1LK7A 4PPQA 4EGQA 4HX5A 1QANA 3LNCA 2ECPA 3RK4A 3O1HB 3RU2A 1L5RA 5FRDA 1OAOA 3WP0A 1F0NA 2WT4A 3G79A 3MT7A 2UXCB 3L8CA 3R3YA 2YCLA 2PVSA 2N75A 3IUPA 1VLLA 1DRUA 1EUDA 4YMGA 4RK0A 1Z5NA 4R8SA 2WQZA 2SKEA 1S01A 4LDJA 1GIAA 4DM4A 3H1BA 5FI5A 6Q21A 1JT9A 4HWRA 4F6RA 4ZQEA 3V6LA 1VHLA 5MN4A 1TZKA 4NBTA 4UMEA 3GV0A 4G9GA 4Q1AA 4REOA 1OLSB 4X66B 4ND8A 1UAAA 1XVLA 2HC9A 4QDKA 3TXYA 4B3CA 1Q12A 2YV4A 3OLXA 3TOZA 4WPGA 2QTAA 3PA8A 4QNMA 4TSFA 4F3RA 5K4GA 1NZFA 1H2HA 4PLGA 5FKJA 5BN4B 5K45A 2BEJA 1ZIOA 4FEGA 3E9ZA 1U90A 4ACAA 1WLYA 2WWGA 5EHZA 5EJIA 4GKBA 4EFNA 1NJFA 4WVLA 4TT3D 4KIJA 1RRVA 4F2WA 2GTHA 1ARZA 2EIXA 4BE4A 3P19A 1GCAA 4F9FA 3KR2A 4MDEA 1BG6A 4ZANA 4TYMA 2M1XA 1E1NA 2WUDA 3FDZA 3OU7A 4JZYA 2J3MA 3ANNA 5FPHA 2V7UA 3N07A 4EUSA 3AM4A 4X62B 3CVXA 1WUHS 1DAKA 4FE3A 4C03A 2H5IA 1YQWA 1GJRA 5HE9A 3VNBA 3ASVA 1OIVA 2P7IA 4JT4A 1EJ0A 2BFOA 1XP5A 1IBCA 3ICWA 4ZCPA 3FDZB 1CS0A 1G2QA 4L16A 5AXDA 2ZATA 1ZAKA 2H29A 4YMIA 4ZREA 3EPLA 1VCIA 1ES9A 1JR4A 4XTRA 1QIKA 6REQA 4JBIA 3FWNA 2W2LD 4LZNA 1EBBA 2A5JA 2NZJA 4Y2XA 5IVIA 3V1TC 1JSRA 2VNSA 1BXKA 2P3QA 2EGHA 1V9CA 3JR3A 3K9CA 4R0MA 1GYRA 3RRBA 2OZKA 3MPOA 1G8KA 5MGBA 2XIQA 5E0OA 1FFHA 2I8LA 2YX1A 1U1FA 4IVPA 4K9SA 1DG9A 4QUAA 2R1UA 1MZVA 2B4TO 4IIJA 5HA5A 2DXIA 4L74A 3VR4H 1TEHA 1U99A 3C3MA 3T1OA 4CMIB 3Q5DA 3KTDA 3CEAA 3FAZA 3WL6A 1F8XA 2F6RA 2CHUA 1VE6A 1Z2CA 4XCQA 5EL0A 4JI5B 3RVMA 3VU8A 3ABSB 3R3WA 4UXJA 5ILOA 3W9BA 2J46A 5CDFA 4EPXA 2X2FA 1TKCA 2IDMA 1ZLYA 1Q22A 1DTSA 4FI3C 1ISPA 1QCYA 4O3FA 3ZS8A 2X0NA 3IBTA 4JUDX 3NYWA 4LKRA 4G4SO 3CZMA 1TDJA 2GBLA 1GM5A 1CUXA 1ODIA 4LF6B 4L5AA 2J4CA 3TTWA 4DDMA 2J6IA 3UV7A 4CM8A 5B3KA 1QP4A 1NU6A 1P73A 1TMOA 1XL0A 1X8XA 1WDMA 1VBMA 3GRVA 2B35A 2VZ0A 1X1TA 3L02A 1D6JA 1G21B 5IDVA 2QORA 3H05A 1N92A 1DBVO 2HSZA 2Z1NA 4JELA 5EHQA 5L7TA 5LXTF 5F98A 2QLJA 1I36A 3ASZA 4QXQA 2A9JA 1CTQA 3ONFA 4MS3A 3E9YA 3TFQA 4M36A 3MTEA 2EHJA 4WJZA 4O02B 3V9AA 2H2GA 4INJA 1DJQA 3DLTA 1T4BA 1X7YB 2LRHA 1ULZA 4BP9A 1WDKA 4HNRA 2LW7A 1PG2A 2ZUSA 2QZPA 1Z88A 1VIDA 3LCMA 4BEVA 2XITA 3HJUA 2H8KA 1EI9A 4HATA 4OG2A 3AQ4A 2JATA 3BA6A 1DO2A 3RGWS 2R79A 4X7RA 1EGVB 1T25A 1UJ6A 2NSJA 3IUYA 1ZOOA 4AIIA 1SB8A 1RJ9B 3KB6A 4O4LF 4UJ3A 5DT2A 5L95A 1UP6A 4JI3B 3PDWA 1USUA 4IDPA 2IYEA 5FUWA 5BOSA 4PTYA 1CUEA 3L4BA 1O89A 2D06A 1JVNA 3W7VA 3D8RA 3L6BA 3PNOA 3ROZA 3X1ZA 2BC9A 5EXPA 2RHMA 5LB4A 1ZW1A 5HMMA 1P2BA 1A7KA 1OYWA 4I6JA 4K28A 3PDIB 2GSDA 4MPDA 1ZGJA 5AM1A 2NV6A 1M2WA 2X5XA 4O4IB 2GO1A 2OYCA 3T0FA 2A6PA 1AY0A 3GFBA 5T41A 2IHVA 1FC0A 3NVAA 3P0RA 3QFFA 3E82A 2WJVA 4HB2A 4WN3A 3V7FA 4E2YA 5IX8A 1MO3A 1OIWA 1S5PA 1F4VA 1CU1A 1KEKA 1YNOA 5ADVA 2XWQA 2YICA 3KM0A 1ZH8A 4Q9KA 4FYXA 2W8BB 3CN7A 1WXFA 1XLVA 4G01B 4NTZA 4MSUA 1VBKA 5ES4B 5GZ3A 3VHXB 2YJ5A 5K3FB 3PC4A 2NTEA 1LFAA 4BKRA 3NR2A 1ESDA 4LXYA 5A7HA 2WSSD 3LBNA 1A72A 1POWA 1U2SA 2X1HA 3ONNA 2HA2A 3LVRE 3GP8A 1JDNA 1SC4A 4HDMA 2XQIA 2UZ1B 4QQKA 3P9PA 4JOBA 4QO7A 2HIAA 1SKBA 1VGRA 2PANA 3I2FA 2V6IA 2Q4RA 2XECA 1I3OA 4U0JA 1CZRA 2AMFA 3H5IA 3PKZA 3K9LA 4EUEA 5CDFE 3D6JA 4U7DA 4GE0A 4YJHB 5HF6A 1RBYA 2GLTA 1PK9A 3R44A 4FOTA 3INNA 4V0NA 2R00C 1DOHA 4ZYYA 4KYIB 4IWNA 4WLVA 2J3QA 4NONA 4Y2TA 4HAZA 3HU5A 1UKCA 2OZPA 2QTZA 1Y9EA 3E61A 1EX9A 3HDVA 5ALSA 3RTAA 2ZJAA 3SEAA 1Q2UA 1SM4A 4ENUA 3HI4A 1AXGA 3INGA 2L18A 3QHPA 4HUQA 3AWIA 4DQUA 3LC0A 3NYIA 2IPOA 5HQTA 4MUBA 2R4QA 4J0JA 3B6IA 1ZICA 4OSPA 2Y0EA 1H0HA 3EIEA 3G2MA 4LZLA 2JFVA 3AIOA 1REQB 2JH8A 4G8JA 5EWLB 4DJDC 2CXSA 2H5LA 4JXZA 1SOAA 1IATA 1PW7A 5BR1A 4DR7B 1DI0A 2X0IA 8LDHA 3RU7A 1VGVA 1AKYA 3BWVA 3S0JA 3BMOA 2E48A 1J0CA 1CCWA 2RK4A 3EVEA 1RM5A 2V96A 1SUFA 3I45A 3MBIA 3PJFA 5F3RA 5JDCC 4HUTA 2ZDQA 1HETA 1E9RA 4OQDA 4D8YA 4DN6A 3RSZA 2ZIVB 4LA4A 1G6HA 2Z8ZA 2PZKA 3EPJA 3ANXA 1UWLA 2JCGA 3NBMA 2RGWA 4A0RA 2QXYA 4OYRA 1NTOA 3E70C 4IS3A 4QRHA 3U6BA 4B7CA 4ZEXA 1AKVA 1VPTA 2XKKA 3ZS9A 4LF9B 3NUGA 2I7XA 3ILVA 1ZNXA 4AYTA 3V1YA 3ANTA 3WK5A 1SOUA 2PD6A 3LC7O 1VSTA 3LY9A 1GPAA 3OFND 1HDRA 3UMJA 3GJ5A 4MV5A 1L7AA 1IY8A 2ZQYA 3TK1A 1XTRA 4ZGBA 4A5OA 2VJCA 4N39A 4PZ0A 5LC1A 1TD9A 1Z0KA 5AIAA 1T9CA 2PT7A 2XF2A 3NFYA 1W47A 4EYEA 3C2QA 3WKAA 4G0OA 721PA 4BLSA 3IB6A 3I23A 3ITNA 3H8SA 1KJIA 4U3JB 1ZIYA 1YMVA 4N5DA 4CM1A 3AI2A 4RDCA 2VNKA 4OQLA 1KAOA 3ZKAA 3U1TA 1CRQA 2GFQA 2R6CA 4OGFA 3AGPA 1Q19A 5KHLB 2XMQA 3M3HA 4Q7KA 5KIAA 3U7JA 4CEJB 1U7WA 1P39A 4UUQA 2ZJ2A 1E60A 2NV0A 1RHJA 1FP2A 3FCEA 1EX1A 1TVKB 3E7WA 2VP3A 2P68A 2GRAA 1PZGA 1YR8A 4YUYA 2Q9BA 4S1NA 4W4TA 4YAIA 3ZWKA 3U49A 4F2PA 3TNFA 3QX8A 2X2OA 3PR3A 1T1IA 1OB2A 4G4GA 3T7EA 3ZDFA 4CR8A 3NXSA 1YJAA 4FZVA 1L5GB 1JFSA 5LIRA 1F60A 3EPPA 1H2RS 2FEMA 2PWBA 2VAXA 3EFOA 4TMVA 4Y1FA 4YCJA 1JDBB 4TS1A 1Z62A 4DUGD 1BDHA 4NAHA 4FKZA 2PL1A 4M53A 2FUCA 4K40A 4KWTA 3H0CA 1J42A 1DAFA 1V11A 1XRJA 1PLLA 4GZ6A 5EN4A 1L5HA 1TYDE 5I45A 4CEIA 4BFTA 3JALB 2BEVB 3VMFA 4AYWA 1R4NB 2OV1A 1CRPA 1NQAO 3G3EA 3I09A 2BVNA 2AFIB 2DFLA 4I4TF 1E1KA 3MQ4A 3P2OA 1YWGO 1A4UA 2DVMA 3NPMA 4RLSA 1P9RA 4GXRA 1YS6A 3TLBA 1KJYA 1BJKA 5DH9A 2A84A 4K9KA 1PTJC 1BVHA 3HO8A 1KNQA 2WD8A 4ZKEA 4HMOA 2AQ8A 2WZDA 3JS5A 5EXDA 3V8MA 1R5BA 3OSZA 4M89A 1CQIA 3VZQA 2BBWA 2BGGA 2WY2D 3K1JA 2H4ZA 2F67A 2RGNA 3B9RA 1EM8A 1THMA 1ZD5A 3LHSA 3PDIA 2W2OA 4KAFA 2HHLA 2B4KA 3AJ9A 3NBYC 1ZC4A 1SIUA 3KFXA 3C39A 3HP1A 1YDFA 5M04A 4JB2A 1FRNA 1ZXLA 4PQFA 4AJ1A 4BCCA 1RQNA 2JIRA 2PXAA 2C2OA 3CF0A 5FBRB 3I9LA 1F8FA 2YHAA 4QRIA 2OHHA 4ENVA 5K3SA 1C8KA 2J41A 3WFJA 2F48A 2BSQA 2PT5A 2Y05A 3B52X 4G09A 3ZVNA 4ZT2A 4A03A 4N5HX 4P8RA 5KJEA 1AKWA 2FP4A 3EVZA 2CD7A 1MB3A 2G5TA 1ZKMA 3PA6A 2CWWA 1KIAA 3EVTA 4WASA 4FWTA 3O0DA 2Y0CA 4R9UC 4O2LA 3VR4D 1RQPA 1T43A 5CBKA 1AH2A 2QM8A 1WZEA 4I55B 3EXFA 5DULA 2PD3A 3H7AA 2JH3A 3WISA 1TW2A 4QEDA 3D1VA 1H2XA 3WK8A 4AZSA 3I5XA 3GUZA 3PIRA 1A76A 2Z6QA 4X20A 1J56A 1QNLA 2KHZA 4U2DA 3VR5D 3FKJA 1EZZA 4IHJB 4QBTA 5CYOA 1M2OB 1G21A 2PS0A 3KWMA 5JR3A 1C0IA 1QGZA 3TUZC 3HVHA 3K0HA 5CJ2A 5CNKA 3DZIA 3KKPA 2C9MA 4PG7A 5FEMA 4DBVO 2GF2A 4QYWA 4HYTA 4IHJA 1RABA 3WHIA 4D6YA 4D96A 2RB5A 1ENYA 1Y81A 3LX5A 3B70A 3GRCA 4EY8A 5IKPA 2RI6A 3ESYA 5LQJA 2HT1A 5ARCA 1TT5A 1INLA 4XPIB 1EJ6A 5A5DA 4DBZA 2FSVC 5FA5A 4KAAA 3NMUF 3MS2A 3LOUA 2ZSKA 2PXCA 5LOVA 2WBLC 3OLVA 4CMJA 4NYIR 4FUQA 3MYRA 3GVHA 4PZUA 5EIWA 4AP5A 3MD9A 5LMNB 2GVDC 4JAVC 3ZQ4A 4B3JA 1Y9ZA 4ATNA 4JQYA 5ELXA 3UTCA 4PRYA 1TQ8A 3KWJA 3E9DA 3I04M 3E48A 1NF2A 3TI7A 4PZEA 2LTAA 1A98A 5K9ZA 2FGKA 6GPBA 2FJPA 2C5FA 1JLLB 1Z2NX 3PTLA 5J59A 5J47A 1T91A 5HW0A 1NBIA 1T2UA 1Z4QA 3FDXA 4G37A 4NBKA 4FX2A 3M1YA 2F3PA 2B21A 4S1PA 5JCXA 1VZ2A 2ZSEA 5HUQA 3DNFA 2GUWA 3F98A 2LCFA 3T6KA 3ODPA 3F2IA 1U2DC 1Q6ZA 4I4TB 2REQA 4BNJA 1XVAA 1QGAA 1XYGA 1NVGA 5HJ5A 1WZUA 2RAPA 2W0SA 4ENRA 3TS1A 4LVUA 1IRIA 4Q4AB 1L7BA 1US8B 1XAHA 2XE8A 1EFVB 3M8KA 3VOBA 1H2EA 5K0EA 4BQRA 2Y1KA 2VL7A 2FDXA 4WE3A 3RVJA 4GIBA 4WNYA 4BNNA 1Z3CA 1QR2A 1VZ3A 2VUSA 2YINC 3GBPA 1UFQA 4PVDA 2G7ZA 1WPRA 5KINB 2NU9A 4F4UA 1WWKA 4IFBA 2LIVA 4LQ4A 1NFRA 4NE2A 5B3AA 2VDUE 2PUCA 4B74A 3WB0A 1U4NA 2I4OA 3DV0B 3KPYA 5FXMA 4RMHA 1GG2A 4FC6A 3KRTA 4BN0A 2G82A 4R71A 4MXDA 3ZI7A 3WRYC 3R3VA 1Z6QA 2QE7A 4NXMB 3FLAA 4WACA 2EBUA 3BJMA 4B80A 1XD9A 2WP8J 2XRMA 4Z53A 1BJTA 3B1XA 1DCKA 4QPPA 3NWJA 4NU5A 2TMDA 1C9DB 4N47A 1SKAA 2ZE6A 4GBED 3G0BA 3ZQKA 1Z8NA 4AN0A 3K0FB 1KJJA 1EAMA 1G16A 1KR2A 2XCQA 4HHEA 4RPGA 5EA2A 3HO1A 2XV1A 1E9FA 1N0WA 2CK3D 2O0KA 3NPAA 5EJAA 3WADA 1GA1A 5JNLA 1O77A 1GSOA 1M6VB 5K5EA 2AE2A 4LHWA 3TW0A 5A04A 2RKBA 1YOBA 1GL9B 2ZBDA 2ZKLA 1F5SA 2NW6A 1N25A 2BDTA 2XMCA 2QAGC 2BZGA 1E1QD 3OE7D 3QI7A 1G5FA 3UT5A 1UBOS 4NOJA 2GYWA 5AW8A 2WSMA 4E70A 3P4YA 1ECPA 1EFHA 4UNNA 2WJPA 3ORYA 1M8FA 4EGFA 3MT8A 3MJRA 2I4MA 3M6MD 3TNDA 1DJMA 1GUFA 5J1SB 3IQXA 2FUG6 1QCZA 1NKVA 1IOLA 2CL0X 4E0BA 1JF8A 1AQIA 3O5AA 1SHKA 4UCXA 4WZBA 2DWUA 5HFJA 3DEAA 3V1UA 1DAEA 3N8KA 3BMQB 2V03A 4LTNA 5JXGA 1EGHA 3OU2A 1M6YA 4Q9LA 3QJ5A 3S5JA 1VP9A 1QZTA 1Y89A 4HDNB 4REQA 1WXIA 2E6KA 2JA2A 4RVOA 3U9LA 2EZ8A 1SKYE 2P6RA 2AFHA 1RWMA 2KWIA 4IMPA 3UATA 1QFMA 4M0DA 2PH1A 4WGGA 1ZM9A 3MWJA 2JW5A 2CLOB 3CE9A 5LUBA 4CU2A 2C5BA 2OWEA 5BWLA 1I1QB 1VXOA 1XEWX 2O8VA 2DHRA 2QD4A 4BMDA 2A1TR 2C57A 1EMDA 2JRLA 2COUA 3QKIA 4PFSA 3R3HA 2PGLA 3NRCA 1VPDA 2VZEA 5A0FA 4YAWA 3QUTA 2H4FA 2ZRKA 3E58A 3ND6A 4BFVA 2BGTA 3BMCA 1N5IA 4Q82A 2KMLA 5F9MA 3C6KA 4H6PA 3SZMA 4CG3A 1OAKA 2ZSAA 1PG5A 4AZ3A 3QTLA 3IILA 4A0GA 3OJEA 3SXPA 2WJAA 1RCUA 2JK0A 2CZCA 3U3MA 4YCMA 5CXQA 5K6TA 4DAEA 1MVNA 3ZWMA 2NXNA 3QX9A 5FPSA 3FLEA 2JIZD 3WLAA 5HK8A 1MX5A 2XB9A 3H83A 3LDGA 3AM5A 3EIOA 4AJPA 1T9GS 4IDFA 4V3CA 4HQLA 1U0EA 1VB5A 5BQXA 4ML3A 3FG9A 4D92A 1ID8A 4KRXA 4DPMA 4CKXA 5FA8A 4TTVA 1QQ6A 3KLPX 1BA3A 3A6KA 4XCVA 3PFWO 1TVKA 4OLBA 3AR5A 1XL1A 2CFTA 1FFEA 4GYJA 3WL5A 1EIZA 2P9ZA 3EMVA 1LGYA 3QX3A 3HGMA 1VG9B 3NVKI 2WTMA 4J94A 4KSBA 2EZ9A 5CAEB 3K8QA 4BV3A 2L82A 3D1LA 1MD9A 4PFQA 3TW8B 1JIXA 5CG2A 2C99A 3L8ZA 4YQFA 1GV1A 3ECCA 4N6NA 1Y7IA 2PBLA 4WNCA 2ZETA 1EE9A 3LWBA 4LYFA 5ARDA 3STTA 3HL0A 2WT8A 4ID3A 1ISJA 1O9GA 4NZYA 1JWBB 4R68A 4CNQA 4G0QA 2GRJA 4WFJA 2O8EA 1COWD 4L27A 1RJEA 3Q8WA 1Z0FA 3PE4A 3ZC3A 2MTBA 2BTEA 3EZLA 3LBIA 2R2AA 3EE6A 3LKVA 2QRKA 5CXSA 5DLDA 1QRAA 5DI9A 1SKUA 1Q11A 2GJKA 1ZNZA 5A2GA 4R4JA 3AJDA 3MA0A 2VTBA 4MQ6A 3T12A 3G02A 4F38A 4IP0A 1U65A 1F5NA 3QKRB 4URWR 1N7GA 1HKUA 1Q7RA 1XELA 5AKKA 2P2ZA 3W6UA 5BV1A 1AHHA 3LCJA 2JANA 3ZHZA 4BWVA 4INOA 4JZKA 2DFPA 4QXRA 1E2MA 5TMBA 3UWMA 4EA8A 4EJSC 1NQ5A 3KJFA 1XDGA 4KG7A 4YRZA 5I8WA 2UYGA 1U8EA 4LKOA 5ECGC 4RSMA 4QD3A 5DSTA 2WSSA 3NXKA 1JLLA 1PJ2A 1YZVA 3C0KA 2CLFB 2XOXA 4GOKA 3S1LA 4AXBA 2ZUBA 2DCUA 2EVWX 1E1QA 2AN5A 4FPXA 3REOA 4FB4A 2M32A 3RVQA 2VHVA 1NMEA 1FP4A 2FZGA 2ISSD 4BASA 4B76A 3F6CA 5JNUA 2QTMA 4MKXA 4BX9A 1VL2A 5I4KA 5IP5A 1YV9A 1HRKA 2GBPA 1LW6E 1CY4A 1R0CA 1LQTA 2FPPB 2H4JA 3A14A 3IGFA 5DK4A 3G7UA 5EJ6A 5JUWA 1JPJA 1XQXA 2GN8A 4F2DA 4ZI2A 3QPVA 1RZVA 4J4HA 5HVNA 1Q15A 5FORA 4IM7A 1GKLA 1L7QA 1QSGA 4LFAB 2ZREA 1U3FA 4W1PA 1CF4A 4TMWA 3NH6A 5TR9A 4EMTA 3DLAA 4EYQA 1XTTA 4JS0A 4P54A 4KOEC 1EE2A 3KTAA 5D5QA 1R0KA 1I80A 4GRIA 4ZVLA 4E15A 2O1SA 3VDNB 4IS2A 5JANA 2GPBA 1IBLB 1U9ZA 2OTCA 3FETA 3JSXA 4B84A 1L5SA 2AG6A 3IQEA 1WL8A 2EOAA 4BKOA 3FYUA 3HBNA 2FPKA 6PFKA 2FWNA 3HY3A 4NC9A 2DKNA 2OM2A 3A3OA 1ODTC 5HG0A 1F6BA 4Q3KA 3LZCA 3RTDA 5EIEA 5K01A 1SY7A 4NV1A 5I8ZA 2PMEA 4D4LA 3UEOA 1HDCA 5DM70 3T34A 2HMUA 3K09C 3PXCX 4QODA 2A0WA 2IIQA 1HDIA 2CXPA 2HJWA 4JX9A 1IUNA 2G5CA 1GTZA 1K6IA 3PUWA 4AJEA 1YUMA 1X7YA 2P2DA 4QYTA 4HZUB 4D99A 4DUGA 2Y99A 3AUSA 2PLNA 1MJGA 4OKIA 3ZDYB 1SZDA 1Y1LA 5AP9A 2ENWA 2Q1TA 4EMUA 1VI2A 3PU6A 4AJJA 3W2IA 4FQ7A 2F62A 3AR9A 4MP3A 4U7FA 4GOLD 1ISHA 3N76A 2JJ8A 2X86A 2XRYA 1JHRA 3KJQA 1SCUA 2YZ2A 1HX7A 2PWZA 4PLHA 4FZ5A 4MS1A 3BTOA 3AHGA 3NHSA 2ZYIA 3EZNA 1NOKA 3IVGA 2EKQA 4FILA 3CLRD 2X0DA 2BJWA 1JMVA 2JASA 4LCJA 4X91A 1ADYA 1P74A 3QKSA 1DBSA 3A9WA 3R41A 1O97D 4GUDA 2GM5A 3LWDA 4ZPJA 4N5NA 1EFVA 1OJLA 1JDVA 2WIJA 3GPDG 4CCYA 4CMGA 2D7DA 4DIEA 2XQFA 4UZSA 4ZHSA 4MQ4A 4O29A 2HF7A 2BEUA 3WKEA 1ENZA 5EIOA 4EHNA 3IE0A 4FINA 3SHWA 2CN1A 3AI7A 3NHWA 4KQMA 3OKPA 2HCFA 2ZDHA 4PNZA 3PCXA 1KK2A 3EVAA 4RVCA 3WNBA 3H1PA 2ZJ1A 1NLFA 1VRWA 1JWAB 3QQPA 4R5HA 1QB8A 2HMTA 2XJ4A 3C5WP 2WJJA 3FHLA 1NF9A 1VKHA 4DEVA 1A5BB 4DLPA 2CYAA 2JFHA 3EBOA 4FGSA 3QVWA 5B58T 4NH0A 2WVJA 1E4YA 3RV4A 1U9IA 2NZYA 3ANLA 3AY0A 3Q7RA 3VU9B 4B75A 4ZFNA 1OH8A 3F5MA 3KE9A 5KB3A 1PI3A 2V98A 3ROQA 1B6TA 2OBYA 1OJ7A 2JIQA 5GM2A 2V45A 1RQGA 1W1UA 2J5KA 3NM4A 4YO8A 4KXLA 4RSGA 3TTXA 2Z1MA 5J4HA 5FLXA 1PYDA 3BSFA 4TN1A 4EAAA 2J7PD 2WVHA 1ZD8A 3OKFA 4G4JA 1L1RA 1ZHHA 3SBXA 1SCNE 2NTYC 3KSRA 3OQVA 3VKGA 3I2JA 4PRLA 1QUEA 4J7AA 4JSTA 3PCTA 2CT8A 4XCXA 1P75A 3I0NA 4OMUA 4Y6RA 2O1WA 5GPBA 2HB6A 4MV3A 2DQYA 4EGSA 2VR1A 3EGDA 3P2YA 3GJSA 1JHMA 2OCYC 1E7SA 2AJTA 2YFQA 1EG7A 2WIBA 3CBGA 3GFOA 3KYCA 4LFCB 3LL7A 3OICA 3RSHA 2JIPA 3E4DA 2NVOA 5A9TA 3AF3A 2I1LA 2Q4DA 3D6HA 5CUQA 4L9RA 4GEGA 2PLAA 3GCXA 3HDTA 1GXSB 5BYJA 1DUVG 1XQ6A 3BKWA 3HXTA 4J29A 2ZIFA 4CMAA 3AFOA 4MLCA 4DG9A 3GG2A 5AOVA 1K6JA 3Q2OA 4FHEA 3GLVA 3TAHA 1O58A 1QIEA 2UZ3A 2CNWA 3W5UA 1RM3A 3KAJA 1ZJYA 1ETUA 1XYVA 4HCJA 3IDSA 1C1XB 4U9HS 5F64A 2PUEA 4NBLA 2I80A 4FOSA 4O59O 2GM4A 3T5AA 3NOVA 3R5XA 4JN6B 4YAJA 2ZT7A 1J5XA 3V9PA 1QJ4A 2HX1A 2JHCA 4N65A 3NG1A 4QO8A 4Y7DA 1F17A 2AFIA 1RACA 5CMLA 2EL9A 1YR6A 2AMLA 2YQ4A 3IQDB 3FSJX 5AKXA 4B3DA 2XGJA 1ZSNA 2B98A 5FJIA 1X1BA 3PKJA 5DO9A 1YXMA 2FPWA 3T95A 2GJSA 5ELLA 4TYWA 3QUSA 3AJEA 2E49A 1Y34E 1U1CA 1D1PA 2G63A 1BVRA 3P9KA 4B6EA 4YT4A 3NC4A 2JZOA 5F1YA 1FQJA 5EP4A 4DG8A 2XMZA 2HIHA 4M1QA 3QFRA 4ZT5A 4FC7A 5DF1A 3S2YA 5JC8A 4RV9A 2QN7A 2XSZD 1BE6A 3M3PA 3KL2A 4BZPA 3PUIA 4NP6A 1O95D 2WWIA 4QUEA 5TX7A 4MULA 4RZXA 3QW2A 3GUHA 1DBIA 3L93A 4PYRA 3TLYA 1DBWA 2WFZA 2RONA 3K2IA 5HF5A 2JKYA 1VRVA 2W43A 1V37A 3JZDA 4MPRA 4ALNA 4JITA 4NFHA 4WZ6A 3EIUA 5EGNA 4AUNA 1CVLA 1YDHA 4JB0A 5G3YA 5CFPA 1ZH2A 3O75A 3DOCA 3TN7A 3BBPA 4X8OA 2ZLBA 3SJCA 2GJ8A 2PU5A 3FGOA 4EYGA 5SICE 5KYGA 1LXCA 3U4IA 4K03A 2XRFA 4FXOA 2G9NA 1UQTA 3QG1A 3JQCA 4L2IA 1JKJA 2PL3A 1FMTA 5DHRA 4D74A 2I2FA 1OLXA 1BVYF 1XZFA 4WEQA 1U7PA 3B9PA 4YMUA 2NZ8A 1E5QA 2EJTA 2PZJA 2OFXA 3B1KA 3CLKA 4XQCA 5T8KC 5EIHA 2CLDX 4MGYR 4TYPA 4U39A 3VKUA 5TF4A 2X9LA 3QBVA 3A4VA 4U2GA 1PR1A 3AEYA 3OCJA 1NR1A 4ENSA 3URKA 1WF6A 2OECA 1YCGA 1HORA 4Y9DA 4DLNA 4DB2A 1FDSA 3IKMB 3G5TA 1W5BA 4BYGA 4M0CA 2NYRA 4A7PA 3SQDA 3T1YB 1K97A 2W8ZA 4HLNA 2EQ5A 1UOQA 1ZLXA 2PM8A 4TXMA 5H1YA 4KWEA 1D2CA 1KEZA 2BOVA 3T35A 4S05A 1I14A 4OAQA 4IJUA 5BOSB 3CMMA 3ZWWA 4ZPXA 5L4SA 2C5EA 1E6LA 4DF3A 4YEDA 1JSZA 1OZFA 3OA0A 3PK0A 4RXMA 1BXRB 5HM6A 4D7AA 5EY5B 5JI2E 1ZYUA 4OAOA 1KHHA 1XRQA 2X77A 3D6MA 3NT2A 5I4IA 1QH1A 3AMVA 2PT9A 2QLNA 3IEPA 4F8JA 2PTHA 3F8WA 4HDKA 5LJIA 1B3RA 1ULAA 3JR7A 3L0ZA 4QJ3A 5A3JA 2POQX 2B5VA 2WUWE 3I9OA 3KB8A 3QSGA 3WNVA 5FTLA 1A82A 3WMXA 4PYNA 2O7SA 3L77A 1OFVA 1PWEA 2AJLI 1K4MA 5IS2A 1OZAA 2FEWB 2E4ZA 4GPD1 3EJ6A 4V0ME 2PUAA 3S5UA 4NOKA 2C1ZA 5C81A 3BSWA 4FKMA 3GG9A 3AL3A 4IHKA 4OTZA 3WZLA 1SXJB 1ZGCA 5GQSA 2ZM6B 3FVWA 2GK3A 1CNMA 4Z4CA 3KOMA 1CQPA 1PR6A 2IPXA 1OX5A 5EUCA 1EWQA 1EVQA 1VL5A 4XD7D 4C7OA 3HP4A 3UGJA 1MTOA 3AY6A 3MGGA 4RORA 1TB4A 4M7PA 1JAYA 2VNHA 3H2GA 3KSUA 4JYPA 1AGPA 5CR9A 3TZCA 1KE2A 1B3BA 1GPLA 4RGVA 2XLBA 3A28A 2WNIA 3LTEA 3PX2A 4CIAA 3IOEA 3LX4A 1YK1A 4BGEA 4UULA 3FH0A 4HZIA 4MWCA 3AVVA 3LGXA 4BQIA 2AN4A 2PQ6A 3TM4A 5E38A 1WS6A 2C9DA 4TLDA 2DQZA 3TUIC 1SQ5A 1GTL1 2R66A 2QE6A 4B6GA 1Z0SA 2R1TB 4LSZA 3C7CB 3O83A 3B5IA 3C3PA 3GLFB 2YC2C 4DQVA 3OZDA 1HTBA 1YR3A 4CHTA 4OFZA 4M0MA 2HR1A 1L4KA 3M4ZA 1KO4A 3CYFA 5GMOA 4CBVA 2HNKA 1LQ2A 2B36A 4JC5A 2DWPA 3O2SB 1ULBA 1BXGA 1WO8A 3LA6A 5GONB 4MW5A 4YJ3F 3VOAA 2VSFA 4PTZA 4XB1A 2J3HA 2A4MA 4A8PA 2D6FA 4LQDA 4UJ5A 2A8YA 1GN9A 4PBTA 1VG0B 2W70A 8AT1A 3G8CA 4KQHA 4OB6A 3JQ9A 3FRHA 3SQLA 4G8CA 1ONNA 5FQNA 3KAQA 1UKYA 2OZLB 2VDKB 2XI4A 3N1UA 5J9FA 4Y9SA 3LD9A 1ADFA 4GEKA 3B51X 1VG8A 1E64A 3KEFA 1CUBA 1WAMA 4BNIA 2YJ4A 4J03A 4B79A 2YY6A 5MFPA 5U1PA 3SS7X 1B74A 2BW0A 2IZ0A 2CK3A 2NU6B 4XAQA 1TI7A 4EFLA 2OMKA 5LUAA 1P1IA 4CXMA 2XQVA 1G3QA 3QVJA 5L9AA 3H65A 3H8VA 3HRKA 3MWEA 3LF2A 3TPZA 2JAHA 4ITUA 4E2XA 1P3Y1 3CCBA 4P4TA 1SG9A 3D2AA 5DHAA 4B2YA 5C3MA 5AW1A 4I1RA 4NZOA 1RXWA 1OXSC 1NJ5A 1OVGA 3Q7SA 1Z6TA 3SGLA 1E3MA 5BW5A 2H52A 3W77A 4TRRA 1VL0A 1ZWLA 2FE4A 3W4JA 4NDZA 1TVCA 1XZQA 5T4HA 1H6CA 4A3SA 2GCPA 2C9BA 3JQAB 2ZW9A 1YI0A 4IDEA 2E7ZA 3DKVA 1GA6A 4BQOA 1W5SA 1JMKC 3K9WA 3DFIA 3GJ6A 1N1MA 1TLLA 3K73O 3BF8A 4GBMA 4DNOA 5CD1A 4CCYB 3EODA 1NLUA 3D7SA 4ESOA 2XOKD 4ZTUB 4KAJA 2CLIB 1L6RA 1S02A 4IVRA 5F35A 3OX3A 4C2UA 2Q8PA 3ESCA 3I4FA 4I46A 2BELA 2HU8A 4S2UA 1VBNA 3ZE2B 1ZUWA 3AUKA 3O4RA 4PFKA 4DRZA 2GAIA 3M83A 4KX3A 4B4WA 4FT2A 1C0KA 5A1JA 1UQRA 3FNHA 3R7WB 4JYCA 3N9IA 3GLKA 1H3NA 1LUAA 2C9OA 1M54A 2IP4A 2W2KB 1O94A 2WPNA 4EB6A 1QG6A 4QASA 1XPRA 4PHHA 1U2RA 2VNJA 4ZZ1A 3HA2A 2AN9A 2G6TA 1QO9A 4BIMA 3PHGA 2QX9A 4NJEB 2MINA 2YN2A 1H65A 4AZ3B 1M6EX 5JDCA 1FX0B 3ZVMA 3ORHA 4JP2A 4R7GA 1U6IA 4MCIA 3MMNA 2FVXA 3ZJ4A 2PV7A 4D44A 5FTMA 1G5RA 1XTBA 1V9LA 2C3YA 5AUQA 1HYQA 4MWGA 4CLDA 4MGZR 4D02A 4LF5B 1ZOPA 3FCYA 1CDDA 2UU9B 4IIBA 1AKQA 3RLIA 4OF4A 1QHGA 3WRVA 2XKJE 5IPFA 3EGOA 4W5HA 3SR0A 3ZU5A 4DUPA 9ABPA 3BL6A 4UBJA 4C3ZA 1S3GA 4OUDA 3WQQA 3VDMA 1JYEA 4ALJA 1U0GA 3O8BA 3K2QA 4L9AA 1XLTA 1A77A 3F5SA 5CEJA 2D2IA 4HNTA 3WB9A 3FRJA 1AC5A 5K1ZA 5LZ4A 2C4KA 3MAJA 4HS4A 5DPMA 3G9TA 5A1TA 3P9NA 4D8XA 4UBLA 4R8VA 3QPAA 2PGJA 3I6IA 5D5HA 3VJLA 3ZVKA 3NAMA 5LQSA 2V0CA 1MO2A 1NX9A 2WYHA 3KPVA 3U13A 4F8EA 2Y3IA 3GRPA 3WOHA 2FUG1 4BNVA 2VXOA 2UYHA 1UBJS 3HYLA 4RD4A 4EY7A 1AGRA 4NQRA 2NO7A 1O5TA 4BMXA 5JQGF 3ZU6A 3AHJA 2OLEA 3LP5A 3ZD9A 3S2IA 3T8YA 3KUUA 2Q3EA 3VNAA 2QTWB 4CFZA 2WHPB 3I64A 4NRDA 2Z04A 3FX2A 3FOZA 3JYLA 3SXJA 4W5NA 4O1HA 2ORVA 2R6HA 3NDIA 4FSHA 4MKFA 3OUUA 4ZP1A 4BVEA 2VQ3A 1JQKA 2QMZA 1SPBS 5BN5B 3GLIB 2JCSA 2K4MA 1U5AA 2C2KA 2DYKA 4AVYA 3QYPA 4XH9B 2PZLA 2JGLA 4B6JA 5A3QA 4G8DA 3NNSA 4UFOA 4IZ6A 2WJHA 9LDBA 3ENWA 1GGMA 3Q2KA 2OD7A 5CNJA 1H85A 5L6MB 3O95A 1V26A 1K88A 1ADGA 2CNWD 2QDXA 3LY7A 4Q4DA 3UB4A 4B2LA 1YB6A 4H7DA 2YXNA 2B9VA 4BNGA 2HHJA 3KYJB 2OOSA 3DVQX 4F4CA 3A9VA 1OVMA 1YQUA 4YRTA 4JHXA 2ZCJA 1EUCA 5D01A 5ALMA 3SX0A 4HPJB 2QMHA 4CM9D 1T15A 5BPHA 1BMQA 1O96B 4IIVA 1UF9A 2ZR0A 4BQNA 1QIJA 3D0KA 1X39A 3DV9A 4TMZA 3KYIB 2CBXA 1YI1A 2CXOA 5CW2A 3UMVA 4LTMA 4AP9A 1WXHA 3HDHA 3IUEA 1D0SA 2GOYA 3BH7A 3FIUA 5KAMA 2P9EA 1UBEA 3NUZA 4LBZA 1YGPA 1ISFA 3GZJA 4LMRA 2GVNA 1U2EA 3ETEA 1KOJA 4XUCA 3ZWDA 4AN4A 3UBTA 4IDDA 4KUGA 1Q77A 1U1IA 2DHDA 2EQBA 3RF7A 2NNWB 4QKQA 3UICA 2C2MA 3UW1A 1P3JA 4JWKA 4YRPA 4E5YA 2BHRA 1M2OA 2QR3A 3KJNA 4HN2A 3TRFA 2H4HA 1P19A 4C6TB 2CFSA 2G88A 3ZGOA 2NTJA 1ZRHA 2HBRA 2I2DA 2FPGB 3EGVA 3OKCA 2RGEA 1D2HA 4MRPA 3TW8A 1Z5GA 3DOIA 3HCCA 5KKNB 1YB4A 1Q92A 1K92A 1BD3A 4II3A 2O8NA 4WHMA 4LRSB 5I7EA 3UGTA 1BHSA 1PFKA 1N6NA 1KDRA 1KH1A 3E35A 1XZDA 4BV8A 2F1OA 5C7IO 2QNRA 5LQKA 3F5DA 5IC5A 1IXZA 1PRYA 3SF8B 3QVSA 1A9ZA 4Q16A 3DZDA 4IYJA 4X1OA 4XRGA 1EESA 4N6GA 5IM5A 4GWKA 2Q6VA 1KP2A 2GZSA 1O57A 4XGRA 3HVRA 1CBUA 2DQSA 2H0RA 2CDCA 2GR9A 4KGVA 2OE2A 1QPGA 4IHJF 4L7QA 3SM3A 1Y1PA 2HUPA 4CW7A 2P6OA 2XWBF 3L7MA 3KCNA 1O95C 1ZZEA 4IJ6A 3RUPA 1W0JD 2V7QD 3KU1A 1I3LA 4TKLA 5LNK1 1ZX1A 4I7EA 1EUYA 4KHPB 4GX0A 3SBOA 2XMSA 3AF1A 1UKZA 1Z5VA 2IEYA 4H6VA 4E5DA 3W06A 2ETVA 4CL2A 3BGDA 5AI9A 4W9RA 4BVAA 3E0QA 3D3WB 1ZK1A 3KVRA 1EFKA 4GLBA 5JQGB 3DT8A 3GLQA 1HKHA 1DHTA 1LSOA 3GEIA 1JT2A 4YB8A 5HDQA 2VPYA 3CURA 5BYBA 1V41E 1GNPA 5HIAA 3B85A 2PBZA 2R47A 3HVJA 3PGXA 1VHQA 3WNQA 4YALA 4JUFA 1RWPA 1OXBB 1YQTA 2HK7A 2PRZA 3K31A 4NBNA 5ALTA 5KWIA 4ZICA 3LWNA 4TMKA 1JG2A 3OX2A 2BI7A 4NE9A 4KFTA 1NQVA 2QTVA 2PE5A 1YAJA 1JYSA 2BGWA 4EW1A 1W36D 1DO0A 3G6WA 1EBUA 3HJTA 4ICIA 3I05A 2R0QC 3WWCA 3HUFA 1LPBB 3QI2A 2A9RA 4JQOA 5JMPA 4OLHA 3IP9A 5G4LA 4HK4A 3PLAE 4IV0A 3EVFA 3FTPA 1E2IA 4W1RA 2RFLA 1GPBA 4B47A 5JPIA 3A25A 4TTIA 2H2DA 3GQBA 5DYTA 3D8NA 3BGOS 3D59A 2ZUTA 3B6JA 1R8XA 1U04A 2B8JA 1KZGB 3IAAA 4ZC1A 3FSEA 3KJZA 2G71A 3OQIB 3CWCA 3TLZA 1AUXA 3I58A 1EXDA 1QG2A 1Z28A 1ML4A 1Z4MA 1GZSA 2VP5A 3I1YA 4MRMB 4I5DA 3DJYA 2GCGA 3I42A 4HAOA 4F56A 4F7WA 1NVKA 1Q6YA 4E5KA 4IV8A 5K8IA 2IXEA 3PNQA 4Q18A 2OP0A 3V1KA 2A33A 4PGAA 2CXNA 3TTSA 3CF4G 3KELA 1AUQA 2PQMA 4BU0A 1XHEA 5E4YA 5GJWC 3TKLA 1A5ZA 1NNEA 3T5PA 1EBFA 2IIPA 1DJLA 4D0GA 3QLJA 1VE1A 1V16B 5K51A 1I01A 3CZ9A 2I9PA 5DBOA 4RTMA 2NV2B 1WBBA 1QWOA 4PNHA 4BRZA 1N7JA 4RCYA 2B1RA 4YRRA 4RTRA 4S04A 3DTYA 4CM7A 2I55A 3L6DA 3PYXA 5BURA 4EMBA 3CEPB 4L1KA 4ZOAA 4BKMA 2X9NA 5J2TA 5K0GA 4KNYA 4R2LA 3AH8A 3C48A 4PPGA 4OMFG 1YNSA 5DFAA 3K5PA 3AF6A 4P0PB 5LU8A 4P2GA 4DGQA 1XI2A 5KWEA 4GECA 3F6BX 4RFVA 4UUOA 3QLEA 2CJPA 5H9WA 4HQKA 1RYHA 2BMVA 2VJAA 3ACDA 1EB9A 1SU7A 3LZ6A 3K0EA 3PTZA 4FYHA 1H4VB 4DTIA 3JATB 5EPOA 2Z6UA 2P90A 4TV9A 4HLCA 5BR8B 2R60A 1G3MA 3BMQA 3TTVA 4ER5A 1ZK3A 4O2AA 1JDZA 1N5KA 1RQLA 3RHFA 4H16A 3SYNA 2IHNA 2CMDA 3TE7A 3LGSA 3NDPA 4F3TA 2XB2A 3U17A 3FTCA 4LJSA 5KQPA 1PNRA 4MDFA 4TV9B 4NDAA 4YP6A 1E2JA 2RHCA 3UAGA 3QWAA 3HBLA 3HO6A 3KFLA 1E6UA 4GI1A 5KNDD 3BB1A 3N53A 1T3HA 3DOEA 4DSZA 5ECWA 2AMVA 1YRWA 2ZE7A 3I9V1 2WWVD 5ALZA 1ZI6A 2VWGA 1MN6A 2ZAOA 4YTEA 4RCVA 5FOXA 3CXUA 2DUNA 2QOEA 2IYQA 2YWCA 3GAMA 1QO0A 5HE8A 5M29A 1TZBA 4DUYB 1L5WA 4CZ2A 3UYLA 2RCYA 1ZD1A 1CY8A 3GJ3A 3OPYI 4H1HA 4BZQA 1ESEA 5FPYA 2QW8A 2OKGA 1M2FA 3STXA 4D41A 1UKVY 4NATA 2EHDA 2ZRCA 4D4HA 2VJOA 3TD6A 4OATA 3UG7A 4JXJA 1A8IA 5THXA 8MHTA 2D0IA 5DDIP 3GT0A 3LLUA 4D9EA 4AG5A 2WJIA 2JI9A 4KQIA 4KR9A 3TQOA 5EI5A 1J1ZA 2I62A 2CC2A 1FDVA 3F3KA 4H27A 1Y33E 3TVTA 4HN9A 3LSYA 2IYNA 2D1QA 3OSUA 1G5IA 4FN4A 4JY7A 2O5CA 2J30A 3PQFA 5FOUA 3R9IA 3HFRA 1MRZA 4DJFC 4UREA 3KJGA 2ZWPA 1UBUS 3ESRA 4N12A 2A3NA 3I6QA 4B1FA 2AC4A 2QP9X 5A6VA 1O0BA 3FVVA 2O48X 2X58A 1OWMA 1Q83A 1I4LD 1ZPDA 4EYOA 2O0HA 2OHGA 1TTHA 4NCKA 3CO0S 1DKMA 1KXJA 1RKVA 3HXLA 4P3NA 4R6XA 4YN3A 3RC3A 4XJVA 1P5FA 4N76A 3VYTB 3QFCA 3VO2A 1TRKA 2FSVA 4A15A 4F6RB 2BTQA 1FXWA 1W49A 3ANYB 3Q7TA 2H5EA 1KWKA 4A10A 4UUMA 5HZHA 1SWWA 2JNWA 4LJKA 1QH8B 3EWAA 4MW1A 2I1WA 3WRYA 1OPRA 1X13A 2CW5A 3N0WA 4L4ZA 3LX8A 2D1RA 4DIKA 5CJJA 2ICAA 1AMOA 3KQMA 3GLGB 4RK7A 5CM2Z 3W2FA 2PD4A 2WF7A 5DGIA 1C4WA 1K06A 4IYRA 5AMXA 3S3TA 2RCNA 1DUIA 1N57A 4F5WA 1NJ1A 1PKXA 2GT1A 4L07A 4YXWA 1TJYA 1WSDA 4G0VA 1IOVA 3H19A 4U2EA 2XMPA 1EDBA 4XRRA 4PYJA 2M98A 3FW1A 2NXJA 4IGFA 4QTXA 3RS3A 2J7PA 4FGKA 2RGRA 1MA0A 3U40A 3U9SA 4C0KA 4G1UC 4G5SA 3KQSA 4I19A 2YCBA 5JO9A 4CIDA 1J2YA 3LDHA 1R0ZA 5TPZA 2G25A 3ELDA 2LCQA 4RDXA 3O8OB 4J1SA 1YHZA 2JKZA 3H1AA 1DINA 4KITB 4HLDA 4FLMA 4IO0A 2J4DA 1O4VA 4OXNA 1C1DB 3ND5A 4C89A 4JFRA 2ZI6A 3FF1A 3HEAA 3K1YA 1M2HA 4XX0A 4X3PA 2AOUA 2EFGA 3HVUA 1SEVA 3I1JA 4UNSA 4H7EA 5K20A 1TEVA 1MFPA 3WIBA 2RMKA 5E7JA 1E1RA 4MJLA 1K89A 1E9VA 4UZFA 3KUDA 4L72A 1NVTA 4Y2YA 4C07A 2F59A 1VG1A 1TJ5A 3GFFA 3OPNA 3QA3E 5HIJA 2DERA 1GCUA 1SC6A 2YNMD 4BFWA 3D6UA 2OFWA 5FL3A 2AB0A 2PX3A 2VJYA 3LECA 2QLLA 3ZU4A 4PG4A 2YXBA 4YRNA 4QTTB 4J0CA 5L7YA 1G0OA 1ZJ6A 2Q4TA 4JR0A 3RFCA 1AV6A 1XCJA 3DDNA 4FBLA 3DVSX 1KJ9A 5CDHA 3HCPA 1P9NA 3P4XA 2AKEA 1U6KA 4LNAA 2OO5C 3AETB 4CDNA 3CNEA 1XCMA 4AK9A 2RHHA 3D8HA 3IR6A 2AG8A 2MCFA 4OO3A 3MWYW 2EAUA 2GYVA 1V5EA 4TTAA 3EQ8A 1AOXA 1Q7CA 1II8A 5TQ0A 4R51A 2H1CA 2FNAA 5ERXA 3AERA 5WRFA 1J2UA 1W4RA 2H54A 4PIPA 2NG1A 9LDTA 2JHGA 3R3SA 1E59A 4FOPA 2OCIA 1KQGA 2QPLA 1B2RA 1JEYB 3E27A 1HFEL 3GDFA 5TF0A 1RJDA 1D1TA 4HFJA 3CX3A 3OMLA 1JJFA 3MILA 3PUXA 3BE4A 2O4CA 1CEEA 5CT8A 1CX9B 5JNRA 1T0PA 1GEGA 1GDDA 2C4MA 3LT2A 4H7KA 4L8YA 2JFPA 3EC2A 2V4MA 4TRNA 2B7CA 3GJQA 2OBMA 3PEWA 2W6ZA 4U5XA 3SR4A 3WJ2A 3VH3A 3C3YA 1ODFA 3INYA 3HYNA 1L6IA 2R7LA 4BFZA 4US2R 4JODA 4F4DA 10MHA 1MC4A 4OYYA 5JC1A 5KYUB 1BE0A 4NU0A 2H31