2R8XA

Crystal structure of yrbi phosphatase from escherichia coli
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
181
structure length
181
Chain Sequence
LATCYGPVSADVMAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGYGIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKLDEAKGQSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
publication title The Tail of KdsC: CONFORMATIONAL CHANGES CONTROL THE ACTIVITY OF A HALOACID DEHALOGENASE SUPERFAMILY PHOSPHATASE.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 62
structure length 181
sequence length 181
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2r8xA00
1KYTA 3OCYA 1L7NA 2P27A 5FP0A 2FEAA 4Y2YA 3L8GA 2I55A 3WK5A 2O2XA 3NANA 4BEWA 3KD3A 4C4TA 5AW0A 1RKUA 4KNWA 4EELA 5AW2A 3EWIA 1CR6A 3U26A 1RKVA 4KNVA 1AQ6A 2JAUA 3QXGA 5AI8A 3HYCA 4KYTA 1ZRNA 2YN4A 5ALKA 3N07A 3KZXA 2RB5A 4OHFA 5ALUA 3WKAA 5ALNA 2ZBDA 2ZOSA 1QQ5A 5ALHA 1L8OA 3WK9A 3OTQA 3UMBA 2OYCA 3SKYA 5AI6A 2WHEA 1Z5UA 1T5TA 3AR4A 2I6XA 2JGAA 2YJ3A 3W5BA 5AM5A 2WM8A 2R8EA 2WF8A 4J2TA 1ZD4A 4HAIA 2HF2A 4HGRA 1LVHA 3ESQA 3SF0A 2YJ6A 1L7OA 5AM1A 4UMFA 4YIKA 4C4RA 4UMEA 4FE3A 2HHLA 2WF9A 2GFHA 1WVIA 3PGLA 1RLOA 3QU2A 1U7PA 4HYTA 3ED5A 4YCNA 3AR6A 2HDOA 4XOUA 4KN8A 3A3YA 3A1CA 1X42A 4UASA 3PCTA 1J8DA 3AR5A 4ZEXA 1K1EA 5ALSA 3KDPA 2BY4A 1IWOA 4G9BA 3OPXA 5ALJA 4DW8A 2I54A 3B9RA 4OD0A 2G06A 5AKJA 1O03A 3E8MA 2G09A 3WK4A 3NIWA 3ZUPA 1QH9A 2CFRA 3EF0A 4Y3UA 4CF3A 1Q91A 3QU4A 2Q5EA 1RQNA 5AVQA 4CE6A 2FDRA 3CNHA 1Z4JA 1WZCA 3EPRA 4UMDA 4GXTA 4BX2A 2AH5A 1TJ5A 2FUCA 4L6AA 2B0CA 2O9JA 5AVYA 2NO5A 4UARA 3WGVA 3QGMA 3E58A 1QYIA 3ZTWA 4MUMA 3L8HA 5AKXA 3I76A 4CF4A 3GYGA 4HGQA 3N28A 2JARA 3AR8A 2YJ5A 1YMQA 4DWOA 5ALRA 4BX0A 2G07A 4O8CA 3SMVA 1ZJJA 1MH9A 3A1DA 3AR9A 4YCMA 3M9LA 1RKQA 3R4CA 1RQLA 5A3RA 4MWOA 2IOHA 3ZU6A 5ALWA 1QQ6A 3QUBA 1VJRA 1J97A 4F72A 5ALMA 3N5KA 5ALGA 3WK8A 1Z4IA 1NRWA 5ALLA 3U19A 3IB6A 3ZWKA 4I9GA 2RAVA 5AVZA 2GMWA 2BDEA 4QQFA 3SHQA 2FPRA 2MSNA 2OA0A 5AI4A 1N9KA 4XE5A 3QU7A 3U7FB 1F5SA 3DAOA 1QQ7A 4NV0A 5AK3A 4ZEWA 3UMCA 3QX7A 2AGVA 2BDUA 2W43A 2WFAA 3L8EA 1NNLA 5AIAA 3ZX4A 1U02A 5AW1A 4C4SA 2JAWA 1ZRMA 2G80A 3J7TA 2NO4A 1VFPA 3QNMA 3KOOA 2YY6A 4BBJA 2I33A 1JUDA 2C88A 4Y2VA 3HLTA 4E88A 1L7PA 2ZBGA 2EATA 3PDWA 2GHQA 2IOFK 4AP9A 4DCCA 1EK1A 2PR7A 2GHTA 2G08A 3OCZA 3FM9A 3IJ5A 3IRUA 2OBBA 3E81A 3L8FA 5AW7A 3MPOA 4UAVA 1TJ3A 3U7HB 1RDFA 4UM7A 3OCVA 1S2OA 2CFSA 2FI1A 3N1UA 3D6JA 4Y2RA 2I7DA 3FPBA 1WR8A 5T41A 4UATA 2WF6A 3SD7A 4UAUA 5AVXA 3OCXA 1WPGA 4KX3A 2MU1A 4L57A 4EEKA 2NYVA 3M1YA 5IS2A 1ZS9A 3I1YA 4F71A 4Y2QA 1Y8AA 2FPSA 4EX6A 4JB3A 2WF7A 5AI0A 3W5CA 5AIBA 3U7GA 1YS9A 2P69A 5AW3A 1RMYA 1ZD5A 4BKMA 3I28A 2RARA 2B1RA 5AK4A 2PKEA 5ALFA 1YDFA 1RLMA 3QUTA 5AKLA 2OM6A 4FFDA 5AKYA 1XP5A 5AK5A 3FPSA 5ALTA 2HF7A 3W5AA 1Z4OA 2ZBEA 2ODAA 4KX5A 5ALZA 5AW5A 2AUTA 5JJBA 1LTQA 5ALIA 5AVWA 4UM5A 3U7EB 5AKIA 4J03A 3EF1A 3L7YA 1N8NA 1RRCA 1TJ4A 3FVVA 5AW6A 5AKHA 2FPXA 1L8LA 5ALXA 4XPZA 4JDPA 2VKQA 2I34A 1SWWA 3MMZA 4HGOA 5A3QA 5AKGA 4Y2XA 1Z4LA 5ALEA 2WF5A 3WGUA 1Z5GA 2B8JA 4IFTA 2C8LA 3BWVA 3WKEA 3R09A 1U7OA 2YMPA 2C9MA 3ET5A 3WK6A 3AR7A 4RETA 3NUQA 3I6BA 5AK6A 3UMGA 3QLEA 1VJ5A 1SWVA 4ZEVA 4OCZA 4EX7A 2P11A 3OCWA 3FZQA 4HGPA 3S6JA 3BA6A 1U2TA 2HOQA 5AW9A 2HSZA 2Q4RA 2R8XA 5ALQA 1Q92A 3L1UA 2QYHA 3KC2A 3NRJA 3PGVA 4BEVA 3ZW7A 3K1ZA 1RLTA 1U2SA 2AMYA 2P9JA 5AVRA 2ZG6A 4BNDA 3QUQA 1O08A 3L5KA 3VAYA 4IG4A 3KBBA 1PW5A 4CF5A 3ZI4A 2R8YA 5AKKA 5AVUA 3ZTYA 2HX1A 3L0YA 4UU0A 1S8OA 2HCFA 1T5SA 3MN1A 4G63A 2CFTA 2FPWA 3P96A 4AS3A 5AICA 2IA5A 3FGOA 5AKZA 4B6JA 5AI9A 1ZOLA 4FYPA 5E0OA 1TA0A 1SU4A 3SKXA 1EK2A 2EAUA 4YH1A 2B8EA 1YV9A 1YJ5A 3QU9A 2X4DA 1ZD3A 2YBDA 2W4MA 3QUCA 4GIBA 4L6CA 2D2VA 1CQZA 1TE2A 3NASA 1XVIA 2JAOA 3A1EA 3WKBA 2PQ0A 3F9RA 1NF2A 4Y2JA 3R9KA 3ZVNA 4NABA 5AM4A 1L7MA 3L1VA 3ZX5A 2R8ZA 2RBKA 4PNHA 5IT0A 3DNPA 4RESA 1RMTA 2B82A 4UMVA 5ALPA 3ZWDA 3ET4A 1ZD2P 1Z88A 5AM3A 2IOFA 3ONNA 3WKCA 3MC1A 3DDHA 3ZVLA 2DQSA 5ALYA 4Y2UA 4YIHA 2G0AA 4UW9A 2YMMA 2HI0A 2HEGA 2IYEA 4XQ0A 5AVTA 4DFDA 1L6RA 5AM2A 4EENA 3N8GA 4NFLA 5AHXA 1RPZA 4NWIA 2EARA 3DV9A 4BNDB 3AR3A 1Z4QA 5AM0A 3TLMA 3ESRA 4I9FA 5ALVA 5A3SA 2Q4TA 3CZ4A 4QJBA 4AS2A 3E84A 5AI5A 4CNQA 4BYGA 2YMQA 3W5DA 3B9BA 1YNSA 2W11A 3NAMA 3RFUA 5AESA 3WKDA 2FPUA 2FUEA 2QLTA 5AW8A 2C4NA 5AVSA 2ZXEA 1T9ZA 4Y2PA 4OFZA 3NALA 5AVVA 3UM9A 2YFYA 3U13A 4Y2SA 4YCLA 1Z4MA 1RMQA 3L0BA 5ALOA 3L0CA 4UU1A 1Z4PX 3QYPA 1Z4NA 5ALDA 5IT4A 4Y2TA 1FEZA 2YMLA 4BX3A 4HGNA 3WK7A 2G1AA 3SLRA 4YGYA 2B30A 1RC8A 4EZEA 2CN1A 3AR2A 4NAVA 3OCUA 3ZVMA 2B1QA 3B8EA 3RF6A 3QU5A 2C8KA 1XPJA 1Z4KA 4H1WA 2YJ4A 2ZBFA 5AKEA 5AW4A 2GO7A 2HO4A
chains in the Genus database with same CATH superfamily
4TSRA 5FA5A 1ZQ9A 3ITEA 1VL6A 2HXYA 4TV9A 1YF3A 3H9GA 2RHDA 1OLUA 1ZVJA 3R7NA 4HAZA 2UUCB 2HNKA 3ECCA 2ONJA 2GOYA 3HYTA 3JQBA 4X1KA 3K70B 2JGLA 4EFDA 5F2NA 1P2UA 3KYBA 1S8FA 4IDAA 3SEFA 5TT1A 3RVSA 4PYQA 4EELA 4CTJA 2D2FA 2HRDA 4R83A 5ICEA 2FPGB 1AY0A 3IAFA 2V3VA 2XQGA 2D5IA 4IO1A 3TM5A 4ZI7B 4YREA 1T26A 2BI8A 4IJQA 4U2CA 2H4ZA 3L4SO 4OI2A 4UZFA 1W93A 2WIAA 4M21A 5ALNA 1MPTA 4N49A 3UXEA 5IAEA 5DU2A 3I01A 2HJVA 1NDQA 3EEQA 2QP4A 3ORHA 4R40A 4OGFA 4KDFA 5F2KA 4WKBA 5B4VA 2PGIA 3FCSB 1SKYE 3L6UA 4TUYA 2MYNA 3WP1B 5HXAA 1KQNA 3U5TA 2AEEA 3OFND 3Q4GA 1N6IA 1R6TA 2WFLA 1P45A 3DA8A 3LLCA 1Y0BA 3QNUA 4ALNA 4ZGWA 2ONYA 3RUHA 4ND2A 5EQTA 3TLYA 3K0SA 2B1JA 1A2QA 2GNPA 2HF2A 1E7WA 2J33A 3P5BA 1ENZA 1LSSA 3BWEA 4CT4B 3LUPA 3KB1A 3U40A 3O47A 1R6BX 3LP5A 3VX3A 1MQAA 4AJLA 3SOZA 1A8QA 5JC8A 5DGXA 2V7TA 3HN6A 4NDAA 5DNVA 5A9RA 4OSPA 2NZ8A 3P7MA 2WT9A 3GYBA 1QIGA 3ED5A 3K5HA 4N48A 1B4DA 3ZIAA 1A97A 4QXQA 4JJEA 1W5SA 1U6IA 3ONFA 1QHYA 1GAXA 2CXNA 1UJ5A 1YUMA 2NV6A 3AR5A 2WJGA 4ISBA 4KVFA 4B40A 1H0HA 3DGEC 3HZHA 1N0VC 3NZEA 2BPOA 5GPBA 2G70A 1L5FA 2NU6A 2QLJA 1TRHA 3AXTA 1PT8A 1IHYA 1TAHA 3TG2A 3DOEA 5IM5A 1VBKA 3ST7A 4WY8A 4FYYA 4YRIA 4CZ2A 4BJ3A 4AWAA 1CQXA 3TNLA 1W5BA 1KHTA 2VJMA 4HVTA 4Q12A 4NXNB 2X6RA 1O0SA 3OLXA 1X7ZB 4J1TA 2R65A 1JL3A 1N5JA 3RKRA 3UWOA 2Y3IA 3M2PA 2WFMA 4P6VF 5CBKA 3JWIA 1VBMA 3SC2B 1P2FA 4M0PA 3H19A 5D85A 5CFNA 4WLOA 4CE6A 1UOQA 3G0BA 2FDRA 3E22A 1QRTA 4Q9AA 4NHEA 3QFSA 4BVJA 1ZD9A 4RA9A 4GXTA 3V2GA 5BQFA 3ZXIA 2AYZA 2YL2A 3QH4A 5DM1A 5KINB 5JS1A 5I4BA 1DZ3A 3Q3CA 3O4FA 2F43A 5FUVA 1FFBA 4RVNA 1KFBB 3W0LB 5ANRB 4CT5A 1Z2DA 1Z33A 4UDOA 2QG6A 4K88A 4BMVA 3M89A 5IHPA 2WJZB 4DXAA 4MUMA 4OXYA 3G2LA 5H02A 4KSYA 3BXXA 3L8ZA 1XK6A 3T95A 2NNLD 4J75A 5EZYA 3VR3A 3GLFE 2MYPA 3VYVA 2ZQ5A 3G59A 5CMLA 4OSEA 5KQPA 1H65A 3N28A 1I7SB 4Q21A 4AMYA 4PLGA 1TM7E 1XRMA 2QAGA 4KIUA 1GNTA 4F4UA 5DK6A 3CN7A 3DDSA 1AQYA 3Q8MA 1X7WB 1DUSA 2Q9AA 4MI6A 4U6NA 3AEKB 1O6FA 1QNLA 1KSFX 4KUHA 5E7JA 2VHUA 2R7MA 3F3MA 2OLJA 5E2IA 4DV0B 4G9GA 4JLWA 3AXSA 2XCQA 5CB4B 4IXMA 4DIKA 1XZJA 1JXQA 3RSOA 2BFCB 1NSYA 2JGDB 2WHQA 3HJGA 1RQLA 1TT5B 4KCGA 3VA7A 2ZI5A 3N0XA 4AJ9A 3K72B 3K6SB 1VJGA 3ELBA 3EUFA 4C7JA 1R8XA 4AL4A 1U5AA 5JI2E 4D9FA 4V03A 2JDID 4PICA 4RCZA 1Y3CE 3QELA 4U2GA 3PLNA 2VDWB 4OAPA 2HJHA 3AZPA 5IBQA 1PDOA 3GH3A 3LZDA 4XTCS 2GZHA 4Z8YA 1MMFB 4I9GA 4S1NA 5DSZA 4O4IF 2ZRKA 5ENVA 5I3ZA 1DKUA 2CW5A 2GKGA 2GMWA 4NU6A 3TW0A 4BJ6A 5ED4A 1XT6A 1M2OA 3O9VA 3ZWCA 3A6HA 2R47A 4P84A 1R0RE 4NSNA 5ICGA 4YAOA 3CLVA 2J3JA 1ZPDA 2RG7A 4NYJQ 3TEJA 3S1LA 3U44B 3HUDA 5NULA 2AZMA 3LY7A 3H5LA 4PQGA 5NLLA 4F9FA 5BUCA 2AD5A 5CTJA 1QCDA 1RVV1 4A7PA 1DKNA 2QV7A 5IDVA 2PA0A 1DPFA 2CE7A 4TLEA 3WJ7A 4AS1A 3IAEA 4HYQA 2GRUA 1R6UA 3PIIA 3E82A 2FLKA 3KQOA 1YJBA 4G36A 4JQOA 2WSMA 3B1KA 3CLTD 1BRMA 1MX5A 1L1FA 4B2LA 2XTNA 3PDIB 2DHRA 3KKQA 4GM1A 3H87A 2FOIA 3WMEA 1ZW6A 1GADO 2B5VA 3KOOA 3FCOA 1TFUA 5B55A 4UFOA 2MYUA 1VHJA 1XCLA 4IQ8A 2RHCA 1GPDG 3U4IA 4CM1A 5C53B 3GT4A 3QYJA 3AEKA 4C06A 7AT1A 5FWXB 3PPVA 4D6XA 5TIIA 4IV0A 4H9GA 4B3XA 3G5LA 3PDWA 5IBCA 1I5EA 4QXRA 4MJLA 4AP9A 4DCCA 1XZGA 4DEVA 1H3FA 3WLMA 5GZ3A 5A7FA 3ETCA 1VSQA 4G6ZA 4RM3A 4BUCA 2QX4A 5DLEA 3X1YA 3FF4A 3WC4A 2ZIVB 1RQGA 1S2OA 2J0SA 1DGQA 3KQNA 2PXXA 4RVCA 1CZLA 1PTKA 1Z37A 3ANMA 4G89A 4DCSA 2H7XA 4BVGA 1RHUA 2E4UA 3A6EA 1GCAA 3LYLA 2E48A 3WWDA 3OCXA 1WPGA 4QRIA 4DLZA 2AZXA 2EFHB 2W4IA 1Z15A 4NZYA 4XWOA 3H2GA 4L02A 3HU3A 1NRIA 3I1YA 2BGKA 4OGGA 1QX4A 5BUZA 2OV1A 1GTG1 1A9RA 1G3QA 2LPMA 1CEQA 4TLDA 4DDTA 5DXAA 3WLEA 1FYXA 4CKWA 1TVMA 3GVCA 1R0SA 2QJFA 3L4KA 2HV9A 4BCCA 5AIBA 2TECE 4HNUA 2EW8A 5K6AC 4ZVVA 1Z0JA 4KN6A 2O0LA 1SKBA 2Y68A 1T13A 2PFSA 1KEUA 2QZ4A 5B7NA 5FA6A 5TR9A 1LB1B 3COWA 1EZ4A 2FEXA 5KCZA 5AWFC 4ENPA 4BP8A 2ZANA 3AEUA 4JWTA 5JH7B 5IT9A 1Q95A 5FNVA 3JR7A 3NTOA 1Z22A 3CZQA 3TG8A 4HDCA 5CG1A 2P8SA 1LNZA 1WP4A 2HF7A 3H99A 1PP4A 1UXIA 3DXZA 5AOAA 1UT8A 2XH8A 1D04A 2ZYWX 3EIUA 3LQ1A 4EY6A 1UMKA 1VB5A 2SKEA 3UKJA 3HB9A 4ITRC 5IN5A 4J91A 3LMKA 4P92A 4TTJA 2AYXA 5IAOA 1ADCA 1VG0B 3HB4X 3JVVA 3ONVA 3RARA 2VUHB 3VOBA 3L7YA 3LC2O 3MTEA 1HQDA 3ESZA 2B36A 1YZNA 2FA9A 4JC5A 4ZPJA 2Q99A 2ZW9A 4FMCB 3ZCRA 3JALB 4W1QA 3CMMA 4BRSA 5EUMA 2PWAA 2G3YA 3LXXA 3WA6A 1YQXA 1YKGA 3CKMA 3DOFA 1TYAE 5JZSA 1BCRB 1ULZA 5EKDA 4M83A 3UK0A 1E0SA 1JWAB 3E6AA 3GRUA 3QOYA 4EH1A 1BRTA 4YX9A 4Z4FA 1MVLA 5JOQA 2OZLB 3BHJA 1L7BA 2W2LD 3AZQA 1DCTA 4CM5A 1XPUA 2UXCB 2Q8PA 3KE8A 4RVSA 2BP7B 3AR7A 3C1UA 2GBIA 3IDQA 1DX6A 2B6HA 3PQCA 2DR3A 1QGUA 4MUNA 3MUNA 4ND7A 4JBIA 1NJ2A 4ROTA 1CZOA 3CLUC 2XKAA 5PGMA 1MTZA 1SWVA 1WDKA 5GGYA 3KQMA 4OCZA 4OXIA 1K3TA 5DOVA 1CBUA 2P11A 2BM9A 2HM7A 5G0TA 3E53A 1T34A 1RE1A 1OZ0A 3FR8A 1JEYB 1BDMA 4RIGA 5CX1A 1EXMA 1SHUX 2KQUA 3AHFA 1A8HA 4FFBB 1RS0A 2AMYA 1M2NA 3IQZA 4BQFA 1MZPA 4FR5A 3THYB 2R6DA 2E4VA 5C8DA 1BE6A 4QUJA 4EPYA 1N8KA 3PXDA 3SC4A 5G53C 4BP1A 5JADA 1KDRA 5EIHA 2OE2A 4ACBA 1JSLA 2QY6A 4WZBE 3IUYA 3DFFA 1U0EA 3VO9A 5M5BA 3OEYA 3D3EA 3HU2A 5LYJB 1ZUHA 2HIHA 2ZRFA 5B2EA 5I48A 3OAAA 4WECA 4FP9A 3KX2A 4FGLA 3LWBA 4XGNA 4JL8A 1ZOLA 3BZBA 3PGKA 1EWYA 2EX4A 1PGQA 5JSKA 3SY8A 2QRQA 4NBNA 3EEYA 1SVKA 3IL2A 3UF0A 2J5BA 3KJEA 4H6PA 4GI5A 4W8GA 2VSQA 3DFUA 3O4VA 5I3CA 1JQLB 3TI9A 1O94D 2AJDA 3UJAA 3ZGYA 3LY5A 3IE0A 2QUHA 1PUJA 3OT1A 3QWFA 4W5WA 4WY2A 3LL4A 3UJDA 4UPEA 2AX3A 4AF6A 2H4FA 3A1EA 1SVUA 3L1KA 4R16A 3GJZA 2OZLA 4LX8A 1NMYA 4ZVSA 3S8YA 3AKCA 2ODQA 1VHQA 5JD3A 5IU6A 1Z0AA 1I6WA 1P1KA 3BXHA 3DBLA 1N2GA 1W1WA 2R8ZA 3AEQB 5ICCA 4OKNA 3V8MA 3OE1A 5IT0A 4BZWA 3R7FA 4O1HA 4YROA 5LIRA 4M87A 4LDJA 4UBNA 4RTKA 1Q57A 5ALPA 3QYAA 3E4CA 1F1BA 3DMTC 5ICFA 3TM4A 1UBCA 1E2JA 2OBNA 2ZYVX 4ZI3A 4KV9A 2RI1A 2P78A 1C9KA 4PTLA 1RI3A 1KYZA 4X1YA 2Q3BA 4NOLA 3QLUA 1EFTA 1V96A 4LOAA 1YE3A 2PLAA 3II6X 3ADKA 3BB1A 3ZWNA 4B09A 2ZVPX 1ND6A 1XHLA 4KWIA 4X24A 3V7NA 1KNXA 4O1IA 1IB6A 2ZUSA 3C8DA 4CKEA 1ZK3A 3H8VA 4O4JA 3LLUA 5K3OA 4NOJA 1WKBA 4UOZA 1R0BA 2GCNA 4EENA 1Z2CA 3AHDA 4N0QA 3V8BA 4ZCQA 3NT2A 5FPQA 4ZREA 4DNOA 2CLDX 3TD9A 3OWXA 5CH8A 5KDOA 3DV9A 1EUDA 5A04A 1JBQA 5IJAA 2IYVA 2QQ5A 3ISVA 1S8NA 1IN7A 5LSAA 5FPKA 3K0HA 3MBIA 1C4WA 1T3SA 2DUNA 4Z1MA 1ZESA 4C9BA 1U4OA 3LPCA 2UZAA 4FX5A 2QPTA 4UD2A 3MJ4A 4LY9A 3NKFA 1QX3A 3PKJA 1FFEA 2XZTA 1LFDB 2QLTA 1PJSA 4HPXB 1SG0A 2C4NA 4ITVA 1Q84A 1QHHA 3PNQA 1E92A 1E6UA 2PUDA 3RW9A 3CURA 4ESVA 3H5NA 2NVUA 1Z4MA 5E4JA 1FNCA 3Q3EA 2DBYA 3UT5B 1WPXA 3GHYA 3P9SA 3WLAA 5BSWA 4PEVA 1C0EA 1Z4PX 1H2BA 3SS9X 7ADHA 3OY7A 5A2GA 3GFSA 1XPOA 5C7IO 4DR3B 5J2TB 5BR4A 3VPAA 5KX5A 2H0RA 3FVQA 3WK7A 2D3TA 2XUHA 4AZWA 4WIAA 2HBRA 2Z2YA 2RG1A 2NUAA 1FDIA 1UODA 2VZ0A 1NN5A 1YZVA 3LYAA 4U7GA 3WB2A 4FX2A 4G5HA 3WGTA 2JLWA 1Z06A 2PBRA 3ZVMA 1ZVQA 2FMTA 3CLHA 3DP7A 3DWFA 1E3WB 4MDHA 2YKGA 2IUTA 3TJMA 2EBUA 3HDJA 1ID8A 3HYLA 2EHJA 2WIFA 3IILA 4OMFG 3UHPA 4BNMA 5EFZA 1P1RA 4M6WA 3RASA 1S01A 1I7PA 2B20A 3KS9A 4YALA 5ECGC 1UAAA 3TUZC 3AVXA 3AL3A 3VV2A 1GRQA 2XUAA 4C89A 5FP0A 1LJLA 1T29A 1I5RA 4O4LA 1CDOA 2R7AA 4Y2YA 3REFA 5LP6B 1AKVA 1PV2A 2PJDA 3JSAA 3HUEA 5AHWA 1BE1A 1RTTA 2O7VA 4KXFB 1IHDA 2FV8A 1QZTA 1SEPA 2NGRA 4IOMA 4JBYA 3VOTA 4D8VA 4AJKA 5JFOA 2O8CA 5F51A 5AW2A 1CR6A 1Y5LA 2AKYA 1WXHA 2XF2A 3CTPA 3EN0A 5EN4A 4AMBA 4Y2GA 4RK0A 1RI1A 1LZKA 1BWSA 1I30A 5G1OA 4YJ3B 3M2TA 3FXAA 5ALKA 5BSFA 4JZYA 4PQRA 1MB2A 4LEIA 3LPLA 4ZCSA 4PX2A 3QEMB 4C07A 3NM4A 3UBTA 1G1MA 2B78A 3P94A 2BCJQ 4E07A 1PJ4A 2ZBVA 2J32A 3WDMA 2I8AA 3Q1KA 4KV7A 1GEEA 4LHEA 5K6AA 1ZZEA 5A0TA 621PA 1PG2A 1TZKA 4TTQA 4XVQA 4E5YA 3OETA 1V9SA 1EVZA 1XMSA 2VNJA 5MGBA 1YQEA 3VI3B 3BXZA 2LW7A 1L9XA 5B3KA 5BQXA 4J7AA 1PJCA 2Q07A 4HC4A 1QHFA 4PF1A 3QEAZ 1M2VB 2G71A 4WBNA 2J41A 4QYIB 4BTVA 1T5TA 2RKWA 3E23A 3ZPXA 4DEYA 4HN9A 1B73A 1LRJA 1S2MA 2PSDA 2PRKA 1CIVA 1TYZA 4FZRA 1CRZA 4MV5A 3WL5A 4FB4A 2C1EA 3RVBA 3QMPA 3BSFA 3CCCA 3ETDA 5JAQA 1W0JA 4UMFA 4EI2A 4BN4A 2IXBA 4LBVA 2I2XB 4D3DA 3KOXA 1GUFA 3IX7A 5DEOA 1SC4A 2PMEA 3F5SA 3PL5A 4IGKA 1C1HA 3O8NA 2X0KA 4UAJA 2WP8J 1KO1A 1AKWA 3QU2A 3HR8A 4I81A 1CJCA 1RWKA 2ZREA 2VCEA 3V7FA 2C7QA 3P97A 1Z75A 4PYIA 1EFCA 3OPYB 4MTLA 2BGTA 5EQJB 2XAAA 5B1EA 3ZV6A 4HWSA 4BO4A 5JNRA 1T2FA 3WLQA 4CT0A 1WXQA 1VCNA 3NC4A 1ZCZA 1QOPB 4XUCA 4KUGA 1I7NA 4DCVA 2YWDA 1MABA 1QMGA 5K3CA 4RADA 4XM1A 4LWOA 1J9GA 3TW4A 4X00A 3OQ1A 5E3HA 1H2YA 2IV7A 1NN3A 2V1UA 3LC7O 2HLPA 5IJ9B 3NAZA 1QBGA 3EXEA 3K6RA 4W6QA 5L40A 2G06A 3I05A 5AKJA 5C1OA 1XZCA 2Z2JA 4FW9A 4REQB 5I8ZA 4YJ3A 3QWIA 4RH3A 5J4YA 1AO0A 1TUEA 3O93A 1TKRA 2XEDA 1V8ZA 5TRTA 3UGKA 4BMDA 2AFIA 4CF3A 4HNTA 1VLVA 4Q48A 2BKLA 2EFJA 3KOYA 1FFSA 4YJ2A 3ZDRA 2R6R1 1CUIA 3RAPR 5J2UF 3WI7A 5A4KA 1KRWA 3KAKA 1WY5A 3I2JA 3DL7A 4U7JA 4FZ5A 3RR2A 1R4AA 2GN2A 4GOMD 2PBFA 4JJFA 1WETA 3CYFA 4HDQB 5H70A 1XCOA 2C98A 3CNHA 3IUQA 2J0EA 2XIJA 3BFJA 3IMCA 3NV9A 4TGLA 4DWWA 5AR1A 4G24A 5BWBA 1WDLA 1Z7GA 3R44A 2YN2A 3BIJA 1SKMA 4FTWA 3AI3A 3F7MA 3J7AC 2GF2A 2Q6KA 1HE4A 2A0XA 3GIDA 7REQB 1AGRA 3GVPA 4Y6GB 1I2MA 3PDHA 1NVEA 1IHPA 1CULC 4KIWA 4E5MA 4J0HA 2G5GX 5LDGA 1U11A 3DYIA 2ZUFA 3L8HA 5E7IA 3PIRA 4XDZA 3U4AA 1L4EA 4V2IA 3RFTA 1Z12A 3GARA 3VZCA 3KUXA 4U9UA 4N76A 1MHTA 1X14A 1SXGA 1TEXA 5LKAA 1E9BA 2JHCA 1FLNA 3DZFA 4GGMX 5J9FA 1UZNA 1SXJE 3PUYA 1H2AS 1VGVA 1EX1A 1ZRSA 4KQHA 1YBAA 3F6CA 1HLGA 1A4UA 1N5OX 1YDHA 1MO5A 3LUHA 1DAKA 4MKFA 3V6MA 2AMFA 5DCUA 2FP4B 5J58A 3QPAA 3IURA 4HEA1 3T4PA 4EUFA 3HKDA 1JDZA 2A3NA 2QUAA 1P2TA 1XKXA 2C96A 4TQ9A 2H1LA 1XGKA 3M3HA 3TKAA 3BD9A 1ZMBA 2AR9A 3WQHA 1U3DA 1T4GA 5DNEA 1S7CA 2XVYA 1D6NA 3I72A 1O4WA 4BU1A 3DMTA 1EVQA 4FFRA 4F4HA 1GOTA 1KU0A 3HB5X 1PBTA 1G2IA 3Q6NA 5TDHA 4DCOA 2IHNA 2PH5A 3FD8A 4M54A 4FM9A 2QL7A 4GXQA 1JRLA 2IIVA 3QP9A 1GGJA 3GEBA 4G8JA 5ALGA 1V25A 3W7VA 4N7MA 5ALLA 3TVYA 3EZ7A 3PWKA 2GZSA 1SUFA 1G18A 4R1QA 3D2AA 1LZLA 3JVIA 1OYYA 2X4GA 3VVCA 3MTAA 3ZY4A 4YCBA 4HUQB 1NT2A 2VS1A 1SRQA 2FAXA 3D2LA 3GJ3A 4PZLA 3SX0A 3QX8A 4CI9A 1ZJ5A 2N47A 4TTRA 1MCZA 3ZQJA 4CKEB 4ZYZA 2A33A 2FRDC 5MHTA 4J29A 1EM8B 5LQRA 5DBOA 4WKGA 1DWPA 3ILVA 3VVLA 1W8IA 3FDZB 2G9RA 3GJ8A 5HKLA 2Z43A 3CNQS 2AUNA 1MKYA 4FFVA 2IWHA 2Z6UA 5HP4A 1U0LA 2XUIA 4CUJA 3PQDA 3IB3A 3K73O 1VP3A 5JD4A 1U3WA 3ZX4A 1NPYA 4A1OA 3L7LA 4LYAA 4E5NA 2GK3A 1C9YA 3OHMA 5JWOA 4AC9A 3GLGA 1H5NA 3QLVC 4QOEA 1NBOA 4C7BA 2G80A 3WNVA 4UEWA 3N8DA 5T3UA 2WIDA 5TPZA 1CJBA 4LMAA 1WW2A 1UT5A 2AD1A 1L4UA 3KVVA 3NONA 2FNAA 4PFJA 1EDBA 1Z73A 2Z8YM 4DLWA 2V9ZA 1C3XA 2FP4A 1V8DA 5ESDA 1DAPA 1WP9A 1KI6B 1ZJYA 3G88A 4DMHA 4KR6A 3N7UA 2C3OA 1KBZA 2AG1A 2PR7A 3SEZA 3F5DA 2EG5A 3FM9A 3I1IA 3GFRA 1T0PA 1Z6QA 3EVDA 4X45A 1CG6A 5JXJA 4W99A 5G0SA 4ABYA 5T6BA 2VQFB 4Q18A 2CFOA 2IYOA 1KZ9A 5BQ5A 1NZFA 2LGJA 4YO8A 1GKUB 1DIHA 3D6JA 2I7DA 4IIHA 3AVPA 5ED0A 1O7JA 2WAYA 4QYMA 3FPBA 1XNHA 3EIQA 3LQ4A 3PD7A 1T2VA 1TKBA 4OP1A 4R8LA 3UC5A 4CUKA 1I4WA 2X7JA 3QI7A 2PGOA 4GYWA 1JSZA 2EZ9A 2FWBA 2J67A 3K5WA 3Q7IA 2JGEA 1Z5OA 1NSTA 4HRAA 2GKOA 2JASA 3ASVA 1ETUA 1NC3A 4YPFA 5IP5A 1RXYA 3LF2A 4WXYB 1J70A 3LC1O 3LKBA 4F71A 4RQBA 1DRKA 1X1EA 1XZEA 4NICA 4DNFA 4E5SA 1UK6A 5C5CA 3NYQA 1LLCA 1PK9A 1Y1RA 3TW8A 4CKBB 3KYCB 1WSBA 4GMFA 3WLKX 2WD9A 2HA5A 2WF7A 1A4RA 1G8KA 4IKEA 3RYHB 1IBSA 3R3UA 1Y4DE 5EXSA 1G8GA 3KPWA 4PBTA 3KQUA 2ZE8A 2Z8ZA 2NO9A 2E4AA 2ZS8A 4HH0A 3NHWA 3PSAA 1JPNA 1CUXA 1ZOIA 4TS4A 3VKFA 3ZZUA 4YJHA 5EQDA 4ARUA 4KHZA 3FYHA 4L0CA 2EW1A 1ESZA 2VI5A 3NTQA 2Z0MA 3G9UA 3N0WA 3SVTA 5BSGA 5HS4A 2F3UA 3PF8A 3GFTA 1M6VB 1PL7A 1PFWA 1QYWA 4DV2B 4FZVA 4RMJA 1E2BA 2JGJA 5JCOA 1EA7A 5FTMA 4GM0A 3M6AA 2VLBA 2J48A 1I24A 2R1VA 3BCRA 3F6BX 1N78A 2R2AA 4OLHA 4OHCA 4IRXA 4MXDA 1QQAA 1DHRA 2O4UX 2VUSA 4GLLA 4KXYA 3KSBC 2UVPA 1CQJB 1A5AB 2ZKLA 4ZOBA 5IK2A 3QX9A 5C8VA 5CA1B 3R40A 4RIIA 2Q50A 5A5DA 4IDPA 2XYHA 3UY4A 4F1KA 3N39C 4ID9A 4RE5A 3CCFA 5HJ2A 1GNQA 1C3OA 4I4NA 4Y2XA 5K8CA 1XD2B 4MKXA 1CJMA 1Y48E 4IOLA 5KOYA 1P0PA 3IXLA 3BGVA 3OKAA 5E8RA 3NQ41 4X90A 4PAGA 1X1CA 2FY8A 5EYPA 2Z6AA 4O3MA 2ZAGA 3RLFA 3KKPA 3TZ6A 4DXHA 4JNKA 4Q9LA 4B85A 1CY8A 5BP7A 1TA4A 1C30B 4JJ4A 4R1OA 1U3TA 4GWKA 5CM8B 5D3MB 4HVLA 4Q1VA 3IPXA 3IDZA 4AZ3B 4BBAA 4PHCA 3COVA 1OYOA 4BB0A 4CRWB 3GGGA 1AU9A 2A88A 1PR6A 4KXVA 3LRXA 3RVDA 5GZ1A 2GEFA 1U8EA 2A58A 3HA5A 1T36A 4I4TF 1JDNA 4XM2A 2FE1A 1SUBA 3KQVA 4JXJA 4HVCA 5HW0A 1YFJA 1QAQA 1WDMA 4QU8A 5FFNA 1GAEO 3V8VA 2PKXA 4PZUA 4XGKA 1JG6A 2F7SA 1ZW1A 4KVGA 5EKTA 3T9EA 3VR0A 4KYVA 5TGTA 1V8BA 1Z3IX 1DCFA 3Q5EA 1XBTA 2SKDA 1QPGA 4NULA 4KUEA 1VHDA 2MWMA 3DR3A 2XMDA 5AKKA 5AVUA 1X7XA 3A2MA 3VGPA 4Z6KA 2N9UA 5E6UB 3K1JA 1AB6A 1NNUA 2PX6A 3DO6A 3TTYA 3MN1A 3FPLA 2NOAA 3FUXA 3PC4A 2JIBA 2CFTA 1BFUA 3OOSA 3BMQB 2AQIA 2XOXA 3H42B 1U7TA 4IHQA 1C81A 3H1FA 1VL5A 4N7RA 5WRFA 1KR5A 3C48A 5JSZA 1UUFA 4QU9A 5THKA 1CQJA 1HK7A 1QORA 4IFIA 4XJSA 5FADA 1IOWA 4PBRA 5IJ0A 1ACLA 1E6CA 3STYA 1DP4A 4FHFA 3PENA 5K4GA 1SD2A 4IOKA 3OPVA 4DLLA 4YDQA 3RUIA 3LRTA 3GIWA 2WV9A 5FPTA 2H7YA 4DDKA 4DJJA 3E1KA 2QBYB 3LDUA 4JSTA 5JSHA 5HBGA 1I4OA 4RIHA 3ZVNA 5AUOB 1G291 2QVZX 2GBLC 1O5OA 2YQZA 3AU8A 1T35A 2Z1MA 3GPIA 3QMWA 5K0BA 5AFSA 1INLA 3IUSA 4BVHA 3MB8A 2G40A 3E48A 2QYTA 4MS3B 1EAYA 1XDZA 3LUAA 1S02A 4RESA 3P9NA 2QD1A 4FFLA 2C07A 1T3TA 2Z5FA 3A9UA 4KKVA 1KY4A 3V1YA 1GG8A 2J9XB 3B53X 4A6EA 2JHFA 4MICA 1P6QA 3HFGA 2NO7A 4EB6B 4O4IB 1E7YA 4XGRA 1XQYA 4JI4B 2FWJA 1WUTA 1SRRA 4OQNA 4EGSA 1NBMD 2HMAA 3GCXA 1Q7TA 2PX5A 1R00A 2AHOA 2HBQA 4R6WA 1BD4A 3VH3A 4A8HA 3GBVA 2VC2B 2B5OA 4V0SA 5LBIA 5HJ5A 2RGRA 3M3PA 4QTXA 4XIFA 4BNVA 1JKMA 2Q2WA 2EBWA 2YIDA 4CQMA 5IASA 4HBGA 2AMJA 4ID3A 1QGAA 3ROTA 3T9BA 3DE6X 1NOJA 2DAPA 2WJJA 1JDTA 4YMIA 8ABPA 1PR5A 2OZVA 2FQQA 1EA5A 3RT7A 3TGLA 3EFOA 1W4CA 2VQ3A 4ZJPA 3ZEAA 1QS0A 3KVRA 4FOSA 4HQ6A 3SQMA 4KQ6A 1G21E 2QUIA 2IHKA 5DTQA 3TFQA 2VRCD 3FFBA 1MFZA 4JFAA 5I9MA 2X9LA 1V95A 3SHOA 2B3TA 3KDAA 3RT1A 4BQPA 1R4MA 2H00A 4U2DA 1ATIA 3F9IA 2FRDA 1DQYA 2P2NA 1CS0B 4X6LA 2AX4A 3UOWA 3HKCA 2FU5C 1UJMA 3E7WA 3VKWA 1V4NA 1IWPB 1QM5A 2W00A 3RHTA 5B7GA 4Y7DA 1I6KA 4LBWA 4OFZA 4Y9RA 4EMSA 1P1CA 3QVTA 5B57C 3P9IA 5C32A 3ZXSA 2I7CA 2XQJA 1X0XA 3FTQA 4B6OA 3THXB 3IOYA 4ZQFA 2QI9F 2V7UA 3TSYA 1JIQA 3QLVA 4NBWA 3T1VA 1DTEA 4KO3S 3E70C 3TNYA 4RVFA 3UUGA 4BMPB 4ENTA 1ZLXA 4PPNA 4I8XA 4XWGA 2ACWA 3L7BA 4GO1A 4O4HF 2FQYA 2HO5A 2MR5A 2R1ZA 1RAGA 2LD4A 2J9RA 3GT0A 1NI3A 4HGNA 5AOCA 3UCFA 4E4TA 1IVSA 2B69A 1VECA 2AIRA 1JHAA 3V42A 1F4PA 1RC8A 4H6XA 1H22A 1VRWA 4G97A 3C85A 4EY3A 5I9IA 7YASA 4OI0A 2FLVA 4U5QA 3WNDA 1Q2XA 4AJ2A 1WMDA 3ZGNA 1DIAA 2YY5A 4CR6A 4ECEA 3L3BA 3EGXA 5A05A 5AW4A 3DLHA 2YJTD 1VKJA 1FXUA 3EODA 3INTA 5HRCA 1VMEA 3QVUA 4HMQA 4N9QA 1H85A 4HWGA 3L8GA 4MYUA 3ANNA 1ONPA 2GTIA 2OV6A 2AFHB 4GE0A 2GHRA 3D54D 3KKZA 3VR4H 2C4KA 2FSHA 1ES9A 1ZH4A 3TRDA 1XLWA 3GZTB 3JZIA 2XB2A 5JYBA 3T35A 1MDFA 4HFMA 1TLTA 3IC5A 1VGRA 2N75A 4BMOB 3VXKA 4URFA 4B80A 4PQYA 5AT1A 2ONKA 1OROA 1KO8A 2V0NA 3EBLA 3WDLA 1KVTA 4JEIA 4WKOA 3AKEA 1Y3IA 5AJHA 1SIWA 3RBAA 2ZUCA 4RPIA 4QT4A 1JJIA 4HDOB 1XD8A 3PQ5A 5FUXA 3MA0A 3IOEA 2GRAA 3Q11A 2OD9A 2GRJA 3A70A 3KR9A 1XVVA 4BFLA 3DJFA 5BW5A 4BVLA 3K2IA 5J5VA 2PUFA 2JKYA 1Y1LA 1YOBA 5FT9A 3O0DA 2WHEA 3B2NA 3HRIA 4MGKR 4KZKA 3GDWA 2C4UA 4MI1A 3BCUA 1SVWA 1ZUWA 3T3GA 3WADA 1CKEA 4UJ3A 3D43A 1VSTA 1IIRA 3JQ8A 4MPRA 1CNEA 1RRGA 3PC3A 3PG5A 1LWOA 1E9RA 4D9JA 2WLTA 5A62A 2Q3CA 1KJZA 2EJWA 2NT3A 4DIBA 3BDIA 3IVCA 4KQXA 4N18A 4GZ6A 2NXWA 3R5JA 4IJWA 4ND6A 1OIWA 4PW0A 3T06B 5KNLA 1AKQA 2X9VA 5IEBA 1EJ6A 1H3NA 1LQTA 1VKOA 3KZKA 5JR3A 1FPQA 1FFXB 1IATA 3RADC 3IP5A 3JZDA 2XUGA 5G4KB 2XZPA 3TJRA 3DT6A 4HDSA 5CH3A 2YWXA 3IKLA 1XTBA 4KMOA 4K81B 4B17A 5CDFE 1EFPB 2AK3A 4G9BA 2PUHA 4R8SA 5F73A 2YCLA 4D0GA 4DGSA 4FBMA 2BHTA 1FMCA 2VZ8A 1HETA 2VJAA 3BSYA 1FNMA 2EP8A 5IKOA 2AQ8A 3EPLA 3M5WA 1EWQA 1L4NA 5K0SA 4X1OA 4XPIB 4D4JA 4K8OA 1KZYC 3I4LA 1EG2A 3NTUA 2M6KA 4NR0A 1UPUA 4FMPA 1T3HA 1UBOS 1VPDA 3SLGA 1CUBA 3AUSA 1CIJA 1L4GA 3KNZA 1YKFA 4BQEA 1N5MA 2AOXA 3HY4A 3VTFA 4KRGA 4US2R 5JFGA 1NPDA 1MJHA 4NMXB 5EY5B 3VR5H 3KKEA 3ZW9A 2O0KA 1GTVA 3UWSA 2ZE6A 4IIBA 2K2QB 4LXQA 4MWBA 1U2DC 2IYUA 5DNUA 2CNOA 2Q21A 1GCGA 2P1ZA 3JU3A 3LKDA 5I47A 1KE2A 1ZI8A 5IVKA 5CD9A 1F0YA 4UMDA 4HGYA 4PX9A 2HRCA 4J9VA 4B8ZA 1AK1A 2C9BA 2VO1A 3AM1A 4DUGD 3PQ6A 3I9NA 2ONZA 1U1FA 3PUJA 1IXYA 4INOA 1SHJA 3PPYA 4HQKA 4JI2B 3AHCA 2W6ID 3CIFA 4P54A 3N86A 1BFKA 3EIOA 4IPTA 4ZAWA 5AXBA 3VC7A 5KSZA 4IMIB 3VNQA 1GZ5A 2ZJ1A 2EYQA 5BN3A 1E1CB 1EWTA 4GOOD 4F3KA 2VP6A 2J87A 3T1YB 1FYDA 5I7WA 1P0QA 1YHNA 2JCSA 3EDRA 1WABA 2TSYB 3AR8A 3LWNA 4OQMA 4YP5A 1L4HA 4CMCA 2QX8A 4XYLA 3EGOA 4FWBA 1ODIA 4YA6A 1WLSA 3KYJB 1OJ7A 1GSIA 4JYBA 4GYJA 4XVHA 3RV3A 3QVVA 1MOZA 5HDQA 5GOTA 2N42A 3OQNA 4J76A 3OZFA 2GBLA 1CT9A 1NE7A 1FDOA 4V1CI 3C6YA 1NI4A 4F38A 1TAUA 1JHVA 3T7SA 4OKSA 1P7CA 4IQ4A 3Q0EA 4IF4A 4PGAA 3X1XA 1NF3A 1P8AA 1B0PA 4J1SA 4BY9E 2I3AA 4N5HX 1F3LA 2PYZA 2OR3A 5CCXA 3CBGA 4LTMA 1RJ9A 4RZQA 3EIHA 1QHIA 1X1DA 1D2EA 4I1VA 1TAGA 4XH9B 4R3WA 2FRXA 3G2HA 1J8QA 4PSKA 4IUYA 3I9MA 1JZQA 1ANKA 4D8WA 4YUYA 4R7ZA 5BOVA 2JFXA 1MTOA 3IIMA 4BNTA 1I3MA 2VYVD 3QKSA 3UAGA 1FYFA 2R84A 1U6KA 2BEUA 2BKVA 1NR1A 3LCCA 3UNXA 3ZWKA 4BC1A 1N2EA 5EIXA 5CCEA 3EA0A 4EO7A 4NJOA 1SHLA 1H2FA 2I0FA 2PX8A 2Z9BA 3TRHA 2P2YA 3BIWA 3NP7A 3QE0A 1EFKA 1WTAA 1YR8A 2DOKA 4M0CA 4QDOA 2JAPA 2XSZD 3TTWA 1L5SA 1MG0A 1QQ7A 2DCUA 2WWTA 4S1VA 3GAZA 5AK3A 3B2EA 4Z0NA 5HFAA 5FTLA 3HC7A 2BI7A 4URVR 1T8UA 4K9SA 1JEQA 1IAQA 2AGVA 2FJ0A 4Z4IA 3AX6A 1REQA 2PMWB 4M1TA 3IVXA 4X97A 1SULA 2JFYA 2IQ5A 5LMUB 3T9CA 4JZKA 5DBGA 2O57A 5F12A 2RE8A 2W4QA 3H9CA 3Q3VA 1I1OA 1ZITA 5DTRA 2EERA 4TYMA 4YO7A 5G0VA 1CP3A 1JHXA 1M33A 1NTOA 2J9FA 3GLKA 2AOUA 3LW7A 5CX4A 3M0EA 2VDMB 3HJBA 3V46A 1V2GA 2ET6A 3EE6A 4L51A 4DCPA 5EWJA 4HV4A 1VI5A 3HLTA 4LZWA 4PSAA 2Q1TA 4OFWA 4AECA 4E88A 4LQ4A 4I4IA 2YJNA 3HCNA 1KDOA 4X7RA 5A9SB 5SY9A 5BUQA 1F0PA 1LY1A 2WWFA 2I1VB 1GPAA 2R6ZA 3ZBUA 4B3DA 4JJ7A 2G1PA 1DJLA 1NW3A 1G8YA 1DDGA 1T4CA 1WHTB 1U6JA 2DHCA 2QXUA 3P0FA 4QJ4A 3RVOA 3OM9A 1G8SA 4OQXA 1DLJA 4QXMA 4R8MA 1P7WA 5AVJA 2XQFA 2HQOA 2TMGA 4PLWA 2FQWA 1NVKA 1VPLA 4TKVB 1CLEA 3SEAA 3VI4B 1G41A 3KXIA 3SZLA 1MIOA 1XB2A 1E2FA 1RR6A 1TVKB 1MP0A 1OTYA 3D7SA 2PSJA 2Z9DA 3NWBA 4HDRB 4RD3A 4OATA 2C2ZA 5A5GA 1PW7A 2ZYGA 1JTEA 3CTMA 1AHNA 2G0TA 2P0AA 3KV1A 5B1IA 1ODLA 1Q1GA 1W5EA 5D5PA 4D9BA 3O2SB 4PYNA 1KS2A 3W6UA 4ZCRA 2QGFA 3CISA 3DFIA 1VJCA 1WULS 1QR6A 1A5TA 1P29A 2YZKA 3B38A 3PNYA 1W6UA 3VYRB 1Y8AA 2FPSA 4UHEA 4Y67A 3UJ8A 1OA1A 2GVDC 3FLEA 4FEYA 4FHZA 4N0DA 3RJMA 3WLOA 2HWYA 1HV8A 4UTXA 2ZRCA 1QYRA 2DG2A 5F64A 2BEWB 2C82A 1VZ3A 4JD5A 1C9MA 2GDJA 1U9CA 4IXNA 4QGAA 5HBRA 1VE7A 3I28A 4RGYA 3JQDA 4GWLA 4I5FA 1KH1A 1YDFA 4IEIA 4FKMA 3BEOA 4QBTA 1W4BA 4MCJA 4UE2A 2F90A 4KLAA 2NU7A 3TL3A 4ER5A 4WNAA 3KQPA 3B20A 1EI9A 2VJNA 5CLJA 1K8XB 1D2HA 2DPMA 3LBAA 1QTRA 3IH5A 5AKYA 1ZN7A 3PITA 3IOCA 4FCTA 2HKIA 1JMVA 4BKQA 3JYLA 5AQ1A 4OK5A 3LV8A 5AW5A 1P2DA 4F2PA 1JR3E 1Z0DA 2AEJA 5AVOA 3GAMA 1GPJA 3QBEA 1DJNA 2CHQA 1F20A 1KK2A 3H6GA 1LTQA 4QHYA 1DZIA 4ZJYA 3JAWB 3CG4A 3U7EB 4J03A 5JAIA 1GN8A 1AURA 4M1YA 5B6PA 3FPEA 4GPBA 9MHTA 1YJXA 3IR5A 3GD5A 5MN5A 3MCTA 3SX2A 3ZQUA 1IUOA 1E69A 3NUGA 3G3EA 1VTKA 4YBZA 4ECAA 2IZOA 1IJBA 1CNMA 4B3RB 2D54A 4R4JA 1RD4A 4E46A 2W42A 2UYHA 3KTFA 1X8KA 4A92A 3RQIA 2AL7A 3CF4A 3LRPA 5JS2A 3GW8A 4BFXA 1QIJA 3WLJA 2YR0A 4P38A 2DJIA 3ZCQA 2QZ9A 4RTJA 2XOKA 2IPLA 2VATA 1MNAA 3WK6A 4FGKA 5DH9A 2YWEA 4FBLA 1Y8QB 3DNMA 3DT9A 3DE1X 3DHVA 5HDBB 2VDPB 4D9GA 1SNYA 2GQ0A 2O2DA 5HR5A 2B4QA 4DA6A 4Z0PA 2J3LA 3UMGA 5T5QA 3TQIA 3LKVA 1D2GA 2YOFA 4NMLA 2EFCB 3AM5A 4X41A 3ZDCA 3W3AD 2XCRB 1N9GA 2X1MA 4FNOA 1U2ZA 4R1SA 3TZQA 2YBEA 5DNCA 1H66A 3D3NA 2PR2A 4RD6A 1K6XA 3NRJA 2X8AA 3EH2A 2WUEA 2XWQA 4J1NA 4YCJA 3DV0B 3WXBA 4UNPA 3KUUA 1IQ0A 5K3BA 1Q1EA 1RCTE 4GNRA 4NRDA 4KPFC 4EEZA 2JA1A 3FKJA 3KBBA 2G63A 2QIPA 1TGVA 3C3AA 4R84A 4URUR 3C1OA 3V4FA 1MR3F 3AK4A 2ECFA 3QRWA 2XXAB 2CFIA 3AERA 1Y7PA 2BGJA 2CXUA 1TO1E 4ND3A 4XQGA 5JAPA 1UDCA 4UU0A 1Q1BA 1VE1A 1HKHA 2A94A 2WE8A 4RUKA 4TWRA 2HA6A 3H2HA 4G63A 3WDKA 1N36B 1N2CE 5MF6A 3R3YA 4AS3A 4EG1A 5AICA 3FOCA 2IA5A 3A6PC 1U2DA 4Y1GA 4HDAA 1C0LA 1G3UA 2YOHA 4Z9BA 2Q5OA 2Q46A 2VRWA 1DUIA 1SKUA 1XCGB 1BXGB 2RK4A 2X9GA 3KG2A 2GEUA 5AH0A 3RSSA 4MWGA 1MAAA 1G2PA 1Q3HA 3A1VA 3AGPA 2B8EA 4RMGA 2QA5A 2X15A 2ZWPA 1XJQA 3QU9A 1A1VA 5IG2A 5F2EA 1T6YA 2JLAA 1W9MA 3ADBA 2C7VA 1DQSA 4RH1A 4B3JA 2HCTA 3F2VA 4CDNA 4EHHA 1Q15A 2XVAA 3JS5A 1UAGA 5FORA 5B7QA 2D59A 3BFVA 1IG0A 1JDPA 4LSMA 5L45A 3TQOA 4C0WA 3NT5A 4PVDA 2BSQA 1YZQA 5DLPA 5FLYA 1MC5A 4KITB 4H59A 3IR7A 2VF5X 4WWHA 3G2NA 5J1TB 3ZX5A 5K3DA 1U1CA 4PIVA 3VKHA 3RYFA 3NKLA 5KWSA 1OH6A 1B6RA 4UUPA 1Y33E 2FMHA 2ZIAA 1NDUA 3PGJA 4WUVA 3UK7A 1H9BA 1XRJA 1YQDA 3B48A 2HQ1A 3LXUX 3PYXA 5J2UA 4CODB 4ZHQB 3O4RA 4MV9A 1GGKA 4WQMA 5KQMA 4ODIA 4GPZA 2W8BB 2GI4A 3BZUA 4KPUB 1J7KA 4P3KA 3NYIA 1HEYA 4PS1A 3QTBA 2NU8B 3KQWA 4RWZA 5SICE 2V6IA 4DM3A 4D98A 2NSDA 2Y1LA 4AQ7A 4NARA 4ND8B 1ORHA 4ZZ1A 4MI3A 5IC4A 3O8OB 3DV0A 1QG4A 1CY1A 2PHZA 1OPXA 3T8YA 1QKJA 2CYAA 2D1YA 2Q5JA 2FG5A 4FN4A 4DM4A 5AM2A 3QVWA 2C7RA 2IYYA 4RVDA 3FHJA 5H8WA 2J3IA 4N7JA 5FV4A 2OCBA 5CK4A 1ZKMA 2NUPB 2CD7A 3R9WA 4NDZA 1KA9H 2EARA 4A8PA 2ACKA 3KB2A 1S96A 1IQRA 1IG3A 4KRYA 4NCAA 1TUIA 3UA4A 1CVLA 4HEQA 3SQLA 2WINI 4BVEA 1HNXB 1SCJA 1T2CA 3CZ4A 4R1LA 1PR3A 3ZI0A 1CUWA 3LPNA 1AMUA 2BCEA 1C9JA 1R0ZA 2P41A 4P9NA 2A3RA 2H9YA 1A8IA 2L18A 2YMQA 1NVUQ 4X3PA 3V4VB 1YT5A 2EF1A 4DA7A 1QTIA 3DJYA 2ZCJA 1LTHR 5E1MA 1U0JA 3FDXA 2XZOA 4XLTA 3WAKA 3RAGA 4X65B 2CHEA 3WLIA 4NV3A 3R6WA 4PTYA 1H05A 5DCLA 2OCXA 5ES4B 3WHPA 4NU0A 5JEEA 3RHZA 3AHIA 2PWPA 1Y5NA 2PT6A 3TGWA 3QYPA 3O0TA 5E3IA 3BJEA 2VAXA 3FUWA 4D4HA 3CBQA 2REBA 3NH9A 2W6QA 1IHOA 1OXBB 4KBGA 1NLFA 2CNBA 4O2AF 2I1WA 3I04A 2VOJA 2BGMA 3JD2A 4DV7B 1U3UA 3WYFA 1NIPA 1CP2A 1CK4A 1F9EA 1OFIA 2BMFA 1G20B 1M8JA 2PK3A 1MVNA 3MBOA 3RVKA 1TK9A 4YB8A 4YJGB 2YWCA 3L05A 1YIDA 4F2DA 2PPLA 3KHKA 5C4GB 2DFVA 3UTCA 2WEKA 2PZKA 3S7TA 4NAUA 2JLUA 4C7VA 3PHIA 2VA8A 1YS6A 1NZDA 3L07A 3PR3A 2GO7A 1OWPA 2GNOA 2J7KA 3SVZA 5IH7A 1UMDA 4B8WA 1KYTA 1DTWA 4JKOA 3ZWOA 4O63O 1YAJA 4I4CA 2ATCA 1ZFNA 4H0NA 2AE2A 2OHOA 4MHOA 2EZUA 2ANCA 3CKLA 3K70D 3WFZA 1ORDA 4DB4A 4MQFA 2VH5R 5K3AA 1CB0A 1M34A 2H2WA 2QI9C 3EGDA 4UHBA 2FR1A 2MSKA 4UXIA 4ZT7A 2QTWB 2B6NA 2JVKA 5EFOA 1Y89A 3B6KA 2P9YA 2H4JA 3CH6A 4KOEC 1BROA 3QJ5A 4AKHA 5C37A 4KYTA 3QHQA 3FNRA 1Z07A 1RAEA 2CYBA 4MUYA 4BFSA 3ZE1B 5CT8A 2V54A 2XMSA 2W6NA 4ZQEA 1IM5A 3KZXA 1ZCAA 1XQ9A 3VC3A 3BMCA 1U7ZA 4C22A 1YO6A 5FO0A 3C24A 1GT6A 1I2CA 4IOJA 1D2NA 1FS6A 3BILA 4UD6A 1IOZA 4BATA 4BNIA 3SQXA 5A0VA 3IP9A 3ZY2A 2FMXA 1NULA 1YRYE 2HJGA 3QTLA 4R2WA 1T9GS 1XZLA 1ZK0A 1QE0A 3BQNB 3GRFA 3IPAA 5CGZA 2F3RA 1TKAA 3AUFA 1OTXA 2I6XA 1ZCBA 2R1TA 3TOSA 3ZV4A 1DBPA 3DZ8A 4B82A 3GLHE 4A0HA 4ZPXA 2CSUA 2GEDA 2ZI7A 3W9YA 1IRXA 2BZ1A 1T8YA 4C4RA 2G9VA 1XZKA 4PPYA 3B2QA 5A4IS 1CR4A 2GFHA 3CUTA 3PGLA 3UMFA 3RS5A 2ZJOA 4FSHA 3L0SA 1I14A 3KPJA 1DDOA 1G5PA 1Z2PX 2VRNA 1N25A 1IK6A 3F0TA 3C39A 3OO1A 2ASEA 3GDFA 5E4YA 1JEAA 4E6EA 5JWRA 4LGMA 1DRVA 4IJMA 1C8VB 1V5EA 4RSHA 4O2RA 3QA9A 2X0EA 3T0IA 4RHXA 2BMJA 2ZSJA 1OI7A 1YB1A 4ALKA 2CSXA 1UINA 1GQRA 2ZWMA 3CEMA 1RAAA 4WFIA 4N0EA 1E7MA 5ISMA 4GKJB 1KAGA 2AUMA 1HT1E 2VK2A 1IWOA 5M04A 1ZIOA 2HRRA 2AF3C 2BOVA 2JJ1D 5GTDA 2MSCB 3K1TA 2PNFA 3P9PA 4C2AA 4WKPA 4RFVA 1KO7A 2B4TO 1JB1A 1XEWX 4TS9A 2QW0X 2RC5A 1YE8A 4AIRA 2HDWA 3HWRA 1HM5A 2GN4A 3E2MA 3R8CA 1XRPA 3HSYA 4NYJR 4MQLA 3JD3A 2V4ZA 3LLVA 5JJCA 2HIMA 1BXRA 3MERA 2R62A 5F9HA 1QHXA 5I7SA 1JHPA 4JQZA 5J4KA 5ITVA 2W6CX 2H2GA 1DOHA 4BKUA 2JLYA 5EC8A 2PMDA 2QR5A 3B85A 2O1SA 4AYTA 4CMKA 3NTVA 2CXRA 1RQNA 4XWAA 6Q21A 2NPOA 2ZAOA 2VSYA 2C5SA 3QVLA 2WU1A 1SXHA 4R0VA 3TSWA 2F17A 2ZUBA 3DBOB 4GKBA 1Z4JA 4KQEA 4PLZA 2A78A 1SZDA 4DJDC 3C6BA 1Z5WA 4WFJA 4FLEA 4H3SA 6AT1A 2GO1A 3NHUA 1B6TA 1CNFA 4LY0A 3QY9A 2DTDA 1NKTA 1Y6JA 1NJ6A 4H3KB 4Q6WA 3IJEB 1L3IA 3N9IA 3T5DA 4JXZA 1RPTA 5DI3A 1R0XA 1RAHA 3HVRA 1D6SA 2QNRA 2Y8EA 5IZCC 1R2QA 2ODBA 1OHHD 5COBA 5ENDA 1B23P 2PGNA 4P4SA 3PS9A 1WQ1R 2OGTA 2WIKA 4ZWNA 6ADHA 3JPYA 2ZT7A 5A6VA 4J16C 4K2AA 5AVKA 3STTA 4LFAB 1EFVB 2PD4A 3E0XA 1QB7A 1YMQA 3FFTA 1N6RA 1PX2A 4MA0A 2QD3A 3HWSA 4NG4A 4I4TA 4UNIA 4BX0A 4CFSA 5DBFA 2ZTHA 1SC6A 1G5QA 2JFVA 3LCUA 4MROA 3AETB 2Q0HA 3GJ6A 1L7VC 3GRAA 1IN4A 1OSNA 4GLJA 3SDBA 4Q3DA 4RVUA 4M76B 1MFPA 5CT9A 4RGQA 4BRZA 4QOSA 3F5QA 1IN5A 1GTL1 1WEHA 3OM8A 4YCMA 3OF3A 4RQTA 2PRSA 2Y66A 5JCPA 2XITA 1ICIA 3DUWA 4TWBA 1GL7A 1JZSA 4N65A 2IYZA 3OIDA 5A4AA 4R2JA 2EC5A 1QV9A 2PJZA 4H7EA 4HQ0A 5AD1A 1J97A 1ZHFA 2Y1GA 2ZYHA 1P31A 3NAQA 2R11A 4RIEA 4AG6A 4B4KA 2FG6C 4TYQA 2VCHA 3ZV5A 1K86A 3N5KA 2V7VA 3WK8A 2D2EA 4GWGA 3ZE6A 4XM0A 2YQ4A 4M7OA 5JY6A 2GBPA 2X1LA 2LZ0A 3DM9B 2RAVA 2R4TA 5DK4A 3GVHA 5BUSA 3JD0A 5C51B 3DHNA 1RW4A 4UE6A 4A15A 2BKUA 3GGSA 4GLBA 3A0UA 4MYSA 2IXDA 1PU2A 3HCFA 5KCMA 1NFRA 2P3OA 5AI4A 4HN4B 4JS0A 4EM6A 1SUAA 3W6ZA 1E3DA 2KSQA 4L5BA 2Q27A 4OLJA 1GL6A 5LQJA 1PLLA 2VXBA 3MG9A 3PFHA 3EPHA 3VUFA 3HA3A 5C1IA 4ZOQI 3J80A 1WLYA 2DM6A 1R3DA 4OXQA 3L41A 1WU8A 3K2EA 3ZJ5A 1U4NA 2VPQA 3EAGA 2H48A 4KZPA 1M1YB 3ROZA 4AJNA 3GUYA 2XUZA 3OEHD 4YQYA 4JVLA 5MGNA 1I3OA 2XW6A 1NYLA 3QEBZ 1ENPA 2EKZA 4O4HB 3PDJA 5JQGF 4CJXA 1E8NA 2OPBA 3GZNA 5U4XA 4YT5A 4MB0A 2PZEA 1U1GA 2BCGY 1XTPA 3Q7PA 4FIDA 5KYWB 4N54A 1L0BA 1II8A 3W3ZB 1H4QA 3DHWC 4OGWA 4D82A 1H4VB 1YJCA 4FGZA 3DEYX 4LQLA 4M49A 4WDQA 3VJLA 1SQ0A 3IV7A 3ZGXA 5IYZF 2QVXX 2ZUDA 3OZGA 1OWOA 2RSLA 4R5HA 3VAZA 4C0JA 3E7DA 2M6LA 2G08A 1FE8A 1ZJ6A 4G5YA 4IVNA 4Q7QA 4C3OB 1KZ1A 3CNEA 1WZNA 3L8FA 2JAHA 3ICPA 4HB3A 1TF2A 1UDAA 1IK4A 4YMHA 3RG8A 2OCAA 4MSUA 1GFZA 2CXPA 2REQB 3DYBA 1R5BA 1GPWB 2J3QA 3O3CA 4K05A 1QDLB 4KAAA 3R6TA 3X1JA 3L0OA 1P3JA 1E0DA 3GJSA 3QBDA 2ZTSA 3JSXA 1WR8A 1Z8FA 2AG8A 2XJ4A 3A1NA 3KHTA 4IILA 4NFYA 5T41A 1NG1A 2RJOA 2CLKB 4OIFA 4QUGA 1IVYA 1IIBA 1T5DX 2I1QA 3FIJA 5CHEA 1L8AA 3EG9A 5EMMA 1RBMA 3ENWA 4OL0A 5CJPA 2O05A 1U2QA 4JYMA 8ADHA 1DC7A 1Q3KA 2YZMA 4YPOA 1VKRA 2FMFA 3H0KA 2XGOA 4HNSA 2NAFA 2V3WA 2PIDA 2DLDA 1YIAA 2ATEA 1P1BA 2QORA 5AI0A 5I9SA 3CUEF 4CFYA 4X54A 1PL8A 2P9EA 2Y1KA 3FHCB 1ZD5A 5FULA 3C16C 2UYQA 3PE3A 4F2WA 3EEOA 3WSTA 1NA5A 2IZZA 2OGZA 3B3QA 5AK4A 3ZBPA 3LU1A 4ZO4A 1N34B 5HFJA 1ZEMA 1P2BA 3QK7A 4ZQGA 2VVTA 4QQNA 1RP1A 4AQDA 5ADWA 3HS3A 4Y1RA 3TIIA 1N1EA 3TR0A 4RFSB 1QV7A 3AUJB 4GKVA 5L3SB 4BCBA 1H2RS 1G66A 3FPSA 1C0KA 3AIIA 3WIBA 2HTFA 1RZ3A 3VDMA 1NLYA 3BMXA 4NZZA 2R8BA 2P3LA 2FVYA 3UICA 1KMHB 1FFAA 3A9TA 3G17A 2OCYC 4BLSA 4QM6A 5AKIA 2EWVA 1ECFA 1UC5B 4OXRA 3TRFA 2DLCX 2QJWA 3TAUA 1CEYA 1NKSA 1JAZA 4EZIA 1JQDA 1GZ6A 1V8PA 4ZOLF 1NMZA 1HDOA 2E89A 3UJ9A 1OH8A 4HNHA 4B3CA 2REQA 2MINA 3LUFA 4EFNA 2M1ZA 2UXBB 3C1TA 1LPPA 3OZAA 3QBVA 4IDCA 3UQYS 3ANSA 1E1RA 3VC1A 2YYAA 4V0LA 4HDNA 4WBSA 3WWCA 3A1FA 3AV0B 4HXEB 1Z17A 3TH5A 4RZHA 1YSCA 1F14A 1EUQA 2G6BA 2WILA 5DX8A 3THRA 5JT1A 4II2A 4G86A 4MQEA 2XR1A 2V1XA 5EERA 1U0GA 2OZKA 4ETIA 5T7BA 3QVOA 3DUFA 1S8AA 2AA3A 2FPPB 5FPSA 2E5LB 1CC1S 3WRWA 4LJKA 5SZJA 3D8UA 2R5WA 5AUQA 4D9NA 1S2NA 5IHXA 1AOXA 4EX7A 1I1HA 3OZWA 1D4OA 3PHLA 3HKEB 3WHLA 4HTFA 3GAFA 2VJDA 2BFFB 2P0EA 2WJPA 2ZE7A 2HOQA 1M0WA 2W2NA 3AIMA 3KP1A 3TI7A 1FP6A 2OXFA 3UPDA 5JAHA 1LF0A 1LLDA 1Z6TA 2Q45A 2XTMA 4PXYA 5K6RA 1ZU5A 4CDRA 2MOKA 2C1XA 4WOCA 1RLTA 4IIJF 1J2YA 2PXHA 5JMPA 2IH2A 4D7AA 1NW7A 1O58A 4HG2A 4MVJG 3DQQA 3IUMA 1HMPA 5H1YA 1KKUA 2ZIWB 1P4RA 3O8CA 2DPXA 4PLCA 4IHJF 4LFBB 3LIIA 5CEFA 3ERCA 4JUDX 4C30A 1GA6A 1KPIA 3ZTYA 1JA0A 1G1AA 4CLRB 1SXPA 4YMUA 3A10A 5BN5A 1K9SA 4YRGA 4JCOA 5ILQA 3U4GA 2C77A 3CLTC 3JD1A 3FOFC 1JEEA 2LUOA 5FBQB 2XUQA 3EWSA 4UU7A 1AKEA 2HRBA 4Q9NA 3VPXA 1TM2A 2OAP1 2H5IA 3AY0A 5TPWA 4JA2A 4MVJM 4QOFA 2P9BA 3BERA 4C5AA 1WXIA 3PUIA 4XGQA 3MTIA 1YUNA 3AWIA 1FLAA 3D2CA 4X66B 1AQUA 2ISCA 2A67A 1Q6ZA 2W4MA 2X4DA 3MBKA 3FCAA 1GL9B 2D2VA 2RHTA 2VHZA 1T5OA 2GZDA 4M86A 4MAAA 1UBMS 5ER6A 4CQJA 3NASA 1XVIA 2EYUA 2FSIA 1JBEA 1U0RA 2WJHA 3DMPA 5LB2A 2NMVA 3O03A 1ZRHA 1XMOB 5LM3A 3F9RA 1WVMA 1MOQA 5IZCA 2CDNA 2YZ2A 1YCDA 4UTNA 1O97D 5DRYA 1BDHA 1S7GA 1UWLA 3BE8A 4J16A 5BSHA 3IA2A 2DF8A 4IVPA 4YAGA 5KPDA 1U7XA 1H9CA 4MRSA 2VLIA 1SHZA 4BVBA 4WLVA 3QIVA 1JYEA 2JFWA 1Q1QA 1IB0A 3EZ2A 3N0VA 1J56A 5EGSA 5GONF 5EIEA 3ZD7A 4GDFA 5INTA 2O8FB 2NPFA 3HP7A 4RL6A 1T25A 3DDHA 4BGDA 1R7RA 2DQSA 4E33A 4QUDA 3KDSE 2IYTA 3L93A 4IICA 1UZLA 2HU7A 3FYUC 2VIIA 3I64A 3GJYA 3P0HA 5F21A 1XRRA 1Z2AA 2GM9A 3AUYA 3FB1A 3FFWA 1JQKA 3M9WA 3TRIA 4CKCA 1LV7A 1RJEA 1IM2A 2W9XA 4NI5A 1PYDA 1J0AA 2QXYA 2KHZA 3NWJA 5A5FA 3AI2A 2ZBQA 1W2WB 3H9EO 2BBWA 2QOEA 4H7KA 3UO8B 3N8GA 2VTBB 2Z56A 4IH9A 2CYCA 4IYJA 3SNKA 1ZH0A 5B5SA 3I6YA 5TF0A 4FJ0A 3UJPA 4BMCA 4RHTA 1YU9A 2GESA 3VSAA 1U0OC 3NVDA 4XB1A 1P2VA 1BIFA 4RHYA 3E0QA 2JK0A 3NBYC 4MWCA 2D0IA 3TLMA 4AROA 3JWJA 1Y8ZA 5A3SA 4BB9A 2H7VA 2DBZA 3QF4B 4B6EA 1OX5A 3EMDA 3VH2A 3P9QA 1JE1A 3V4PB 2AJTA 2EIXA 4XGIA 3QVGB 4L08A 1MJGM 1HG0A 2QN3A 3O1LA 1I13A 1W87A 1KAQA 1WPQA 2BTQB 1BGXT 3G2QA 4N4AA 4RCVA 5G3ZA 4BLQA 5F9FA 1X7DA 1F6DA 2AW5A 2FUEA 4WZBA 5KOHB 1NJFA 1KXZA 3KJGA 2FEMA 4MVJD 1EDZA 3LK7A 3OFNA 4P4NA 2IOYA 3G1TA 4OHVA 4Y2PA 4EA8A 3U7IA 4KREA 4CHGA 1K4MA 4MI9A 2UZ0A 1GARA 1YIOA 1GVHA 1WDWB 1D6MA 1UBSB 2QM7A 1OVGA 3GY0A 1RMQA 3EVCA 5JCJA 4D02A 3OX2A 4TYPA 4IX1A 1JEDA 4A4DA 3ZTTA 4INPA 1KFKB 2G9QA 2P9QA 3LQFA 5LC1A 1TM5E 4DDVA 3ZHVA 4EITA 3MJEA 1Y4SA 2X5KO 4Z86A 5KTOA 4L76A 1SXJC 1RM3A 2ZJ3A 4MS1A 4JN6B 2WYHA 5JG7A 5TGDA 5K05A 2A14A 5D6NA 1COWD 1I3CA 1SA0A 4IIYA 4Q6BA 1LNSA 5B3LA 2CDCA 3FSEA 2GB4A 2ZXFA 2IS1A 1JJBA 2PKQO 1IZ7A 1HY3A 3BD8A 4BUZA 5GJVC 5E9WA 1TZ2A 2IYRA 2ZSUA 3OCUA 5DB4A 5J4LA 3JQ7B 4KO8A 1OLXB 5IC6A 4MZDA 2C8KA 3MAGA 4LOKA 4M7PA 2B1GA 4OKIA 4L8FA 2HWKA 3H1TA 3MILA 3QWAA 4ZQIA 3AVWA 1H93A 2DH6A 4D4MA 2ORWA 1OFVA 4CIWA 4DR7B 2ISQA 3IMGA 1WB5A 2JHPA 3E15A 3ESCA 4UVHA 4R98A 4Y98A 1EG7A 3N2YA 4EHFA 1BOFA 1DKOA 4ZCTA 5KNDH 3TSCA 2Q6IA 1NP7A 3DVSX 4WK2B 1G38A 1FNNA 4C7OA 5KVSA 3L1HA 1H8HD 2YV1A 5D8DA 4IEFB 1V11B 3U26A 3FVTA 3G8CA 4HNVA 2R1UA 3E9YA 3JASB 3MEQA 2NP7A 4K86A 1GVNB 1RM0A 1K5HA 4LRUA 2RBEA 1GDDA 2QXTA 1KYWA 4D56A 2O8EB 4PSUA 4EAAA 3WHKA 1QH8A 4NH0A 3NETA 3P27A 3SXUA 1N3YA 4N39A 3SYTA 1ZIDA 2XNDA 1ZCJA 2X58A 2P1RA 2B7CA 1MA0A 1PLKA 3A3NA 3H75A 3HDTA 4EAQA 2IHVA 2DPGA 5A5VA 1B0AA 2WTBA 4KG7A 5FBRB 4D97A 2BMWA 1TUGA 4MPPA 3S7ZA 3BWCA 3NLLA 4CV0A 2Y6UA 1RWOA 1PR2A 2G82A 4EG5A 2DFPA 2JD1A 4FHEA 1SBHA 3U0VA 3WTCA 5EE0A 1ZD4A 3JWGA 3RIMA 2GNAA 2WZCA 4DLXA 4YAUA 1OXUA 1OXXK 3HRKA 3SF0A 1IEVA 4ZQCB 1P5FA 4E09A 1SUEA 4QXOA 4CGYA 1KI1A 4ZIRA 2BUCA 3U80A 5IJZA 1LLUA 4UMEA 1II0A 4FE3A 2HR1A 5HK9A 2GPJA 2HHLA 5HIIA 2BRUA 3WRXC 2IIBA 3BQMB 3I09A 1LDBA 2OBMA 5K2OA 5EJ2A 3G0CA 4Q34A 3VMFA 4DTCA 4IYRA 2LVBA 4OY3A 1NX6A 1M7HA 4DQ0A 3OOWA 4YRBA 5A6SA 3RAFC 1A7AA 1A2OA 2GPBA 4QT0A 4RS4A 1KYVA 4X20B 2OESA 4ZVRA 5DKFA 1XDBA 2AVDA 2G1UA 4L8WB 2VXYA 1QGZA 2ZPUA 2ZZKA 4KR7A 1E2PA 2A92A 3GHHA 2II6A 5CBPB 4DV4B 2O3SA 5D5QA 1T4BA 1XDSA 4ZCLA 4JGBA 1PNOA 1W35A 5AP9A 2GYWA 2PT9A 2XADA 5FBVB 5K3FA 2GVNA 2WWIA 4UQPA 4N5LA 2XWBF 1V43A 3JASA 1CTQA 2JDIA 4N12A 4MDEA 2V0GA 2B92A 3VBCA 2RI0A 2XB9A 3WJAA 4FFMA 1MUUA 1ZH8A 1FU7A 1G8HA 5T3YA 4QX6A 4I6JA 4KQCA 4G1EB 2C4MA 2OHHA 1IY0A 1CZNA 1Q91A 2DT5A 3I32A 5EXDA 5F4ZA 1MDBA 3JAKB 5FI1B 3TQQA 4QG7A 4CTKA 4TVKA 2OFPA 2WMOB 2B4YA 2WSSD 2J3MA 4FFWA 2YXBA 3NXKA 4MMZB 1JNYA 3F97A 4L2IA 2W2OA 1ZNQO 4EIWA 2JIMA 4FGWA 4GEKA 1UBRS 3ZHSA 1OFUX 3WISA 2PXAA 1I0ZA 3Q1LA 3SBEA 5D1NA 1L7EA 2DWPA 2Y76A 5DM0A 1ZKDA 5IUKC 3X43A 4NZPA 1CETA 1AX9A 1ZN2A 3A4NA 3GR6A 4YT8A 4MK4A 1M1XB 1JAHA 4V02A 3JW8A 2C5HA 4MO9A 4F9TA 4J4TA 5JPIA 1E2EA 1J0DA 3B8HA 5LDDC 1YTUA 1VHLA 3D8RA 3VZQA 3QPDA 2OYRA 4LPSA 1JDSA 5JVDB 4AFNA 2JARA 4L5CA 1DOZA 4G2TA 5A0FA 3THOA 1TF7A 2DT8A 1N4DA 1RI5A 1UBFA 3F8WA 4UVIA 1YDGA 4JIMA 2OXTA 3BM5A 4PYOA 2ZRQA 3R7LA 4YXFA 1T1IA 2PZJA 4U6SA 2AXQA 1SVLA 2Q3EA 1ZJJA 1QC5B 5DGTA 4JP5A 1D5WA 3Q85A 4D45A 3PFCA 1VHTA 4CMHA 4M89A 1S5PA 1STOA 2JD2A 3H7IA 2X7HA 3IVMA 1OYVA 1SG6A 3NV7A 1JFLA 4YDHB 2ST1A 4XDHA 4TYNA 3R24A 4CM7A 3OZ7A 3K0CC 4DCNA 4COKA 4QUKA 4E5DA 1BYUA 4R3NA 1ODJA 3ORYA 4FXPA 3UT0A 3KAPA 5I7HA 1RWBA 4HOYA 1A95A 1C9NA 2H6EA 2Q2NA 1X15A 4UEJA 4UTRA 1C3EA 4C78A 2UZIR 4QFMA 4ZGBA 1EAMA 1TJNA 1J8VA 1Q0QA 3FYUA 3EQ6A 4MQMA 3ETHA 4PXAA 3A4YA 2WYVA 3PJDA 5ARCA 3L6EA 2OHXA 1CE8A 3CG0A 1TGYA 3HY6A 1V7QA 3I2IA 2P7IA 3B13B 1IEQA 2MSNA 5TT0A 3K5PA 1FSGA 3K2QA 1JQ3A 1OWLA 5KYUB 5DDIP 1XJCA 1F60A 4WZAA 3U7FB 3HJAA 2DFNA 3K4PA 3OIGA 1C5KA 1K5DA 3CX4A 3I52A 3UXMA 1OIXA 2V7QD 2C0CA 2X2OA 2A2ZA 3B78A 1CDZA 1VYVA 2ODNA 5MN6A 5GJCA 3KT6A 4IXTA 2GEKA 4FILA 3L8EA 2VHYA 4DIDA 4K6CA 4KXUA 2H4HA 3RYTC 3ZQ6A 1USKA 3LHFA 4N3NA 3T5MA 4UEOA 2NT4A 3S2GA 3LTNC 4PX5A 1Y9AA 3BRSA 1R16A 4U4AA 1OFGA 1T9AA 4Y0AA 1U8UA 3E9NA 4Q4LA 1RHKA 4OLFA 2ZCUA 2NO4A 1F8XA 2D6FA 2NXJA 1UEJA 3Q9LA 2PGLA 4ZVMA 3ZK7A 2ZU6A 4Y9TA 3CFYA 3N2ZB 3HG7A 5JASA 1VJDA 2YUTA 2FP3A 3LYHA 2GLTA 2WU8A 2ZS7A 1V1RA 1L4FA 3RWMB 1HE8B 4PU0A 3ENKA 2IP4A 4WCFC 1ZM4A 5KKAA 1D3AA 4UU8A 2IOFK 1HKUA 5F33A 1JLMA 1T8SA 3USZA 1ZL0A 2HCRA 3KEOA 2V45A 4RD2A 2PBLA 4Z5XA 2YJZA 2YIJA 2EF0A 1W48A 2XY4A 1SXJA 2ZGVA 3N74A 4X3OA 3SIWA 1H2ZA 3A31A 2OG1A 4X0EA 1KZ7B 1TJ3A 5K6TA 2YICA 1RDFA 1ZNZA 3KZ1E 5E9AA 3WP0A 4LZNA 3ZBQA 4G07A 5B2ZA 3WO1A 4Z4HA 4K0KB 4PN3A 4Q24A 3LFUA 1DEHA 5JO0A 3EC2A 4UQOA 4N47A 3C6QA 3ZC3A 5AVXA 4ZV4A 2QTTA 2FOLA 3DOIA 4PGFA 1PZXA 2MU1A 4PO8A 4I50B 5HKAA 2BEVA 3OU7A 5J5CA 2D3WA 5DHUA 3S5UA 3GLIB 3AFOA 5EKXA 2AG0A 1ZS9A 3D3JA 3G9ZA 3LCVB 4YK7A 2H17A 4RPJA 3O95A 4PWYA 3SFVA 4YEDA 4F4JA 1EIWA 4X7MA 4JU8A 3NHMA 3T34A 5AYVA 4UBOA 4LSZA 5CDUA 2CJYA 4X1IB 4LZZA 3COPA 3S2EA 3W5CA 2EL9A 2F8TA 1NP6A 2H8GA 2ZWVA 3ECAA 1VCHA 4QELA 4XYMA 4CM8A 4JXXA 3EVEA 2B1RA 4XR4A 1I01A 2O2IA 3K0FA 2PKEA 2JIRA 4LF7B 2R8RA 3UK1A 3KTOA 4GZ5A 1IY9A 1P18A 1JXOA 1O8CA 1WCWA 3DC2A 3PIDA 4O2AA 1CR2A 5FOWA 5B58T 3EXG2 5CAEB 3A14A 3UZUA 5EE5B 4BGVA 4EF5A 1N92A 3QM1A 4ESEA 4V1CB 2OD7A 3WYBA 1AH2A 3JWEA 2YRXA 1OBOA 1Q5PA 4P53A 5DE3A 4TV8A 3V5NA 5CDYA 2P4QA 5CYPA 1P73A 4R31A 5HEKA 3SDZA 1GNPA 3LDFA 1GTJ1 1B8PA 5BY2A 4D9HA 1O94A 4B79A 2GWHA 1Q7GA 2H4XA 3EF1A 2DQKA 4WXEA 1TJ4A 3DWGA 4NBSA 2RHRA 2XMGA 2O5VA 4RZIA 1D2MA 3QKUA 1SCDA 4Z2YA 3PNBA 2AHRA 3O4GA 3R7BA 1KRHA 2XMZA 4XPZA 2FDXA 4BFYA 3HXKA 4FDMA 2OFFA 4DSUA 1TTTA 3PR2B 1GU7A 3H6HA 5CLLA 1HT0A 4F6RA 3RBXA 3MFYA 1KOFA 5ALEA 1AKRA 1TJYA 1VPVA 4CL8A 5FFMA 1R5OA 5EL0A 2B8JA 3HU1A 4IS2A 4QGHA 3WRXA 4UBKA 2AK2A 3CZMA 3BWVA 1QKKA 3DVRX 3H2IA 4QBGB 4JODA 3T9FA 3ZS9A 4EUKA 4WESA 1NUPA 4DREA 1B0UA 1NWCA 5BQOA 3V48A 4MAFA 1YQQA 5BMVF 1LVGA 4WXPA 5DYWA 5EZ5A 1WL8A 5JBNA 3QV2A 3K0AA 5JTUA 1XMJA 5E9JA 2BJWA 2VNHA 3C3KA 4W1SA 4DMUB 3LUCA 4I55F 3DTTA 4K9DA 3NUZA 3B1JA 1GKLA 1I1QB 1GV0A 1FTYA 1CRPA 4KKXB 1GKYA 4FMDF 2WNHA 3OQIB 3S6JA 1JDBB 4I3GA 3G2PA 9ABPA 5AUNB 1XJ0A 4EPXA 2QM3A 1Q92A 1ZJWA 1FMLA 2W22A 5FLEX 1ETHA 3BRCA 5IFLA 4C1BA 4RMHA 2MYTA 4DMRA 2AFIE 2WAMA 3EZFA 3CX6A 3ZQKA 1NVFA 2QGNA 5FBLB 3DVLA 5D3KA 1LJ8A 1P0IA 3IUPA 2CNLA 2RJ3A 4OUDA 2Q3LA 2R6JA 4QBHA 4AUMA 2I78A 1W88A 2QV0A 3LHDA 5CIYA 4JH0A 1DB3A 4GYYA 2F4VB 4KR9A 4Z7JA 3ILXA 4B6RA 1QRDA 4TQAA 3BF7A 5BN4B 4Z4GA 2VA9A 3I9OA 3TEFA 4CMJA 4EJSC 1HNZB 1JR2A 3O2JA 4IF6A 5A9TA 4BAZA 3M4ZA 4WDRA 3V6LA 1RAIA 3C7AA 3RREA 4MV0A 3MLBA 4BS9A 3KCNA 3RH0A 1KOGA 3H5OA 1EK2A 1SBYA 2BEKA 2XNJA 2W8ZA 4LVCA 2YDYA 4LXHA 1Z6XA 1U5BB 2JCVA 3ASYA 4WGFA 5CIQA 3VDQA 3SN6A 1PFQA 1JILA 2EP7A 2YOGA 1YS4A 3F2IA 5BNZA 4UDXX 5BSKA 1YC5A 2AZDA 2QT9A 2PZFA 3AM4A 3KUDA 1EWRA 2X0DA 4K3UA 4FWTA 2JJQA 4D26A 1E4OA 1NF2A 2VJPA 3NHRA 3EZXA 1GSHA 5AM4A 1GDHA 3W79A 1L7MA 3L1VA 4MUAA 2IYNA 3ZLVA 1KVUA 2WUGA 3SPXA 3EVGA 5JSFA 3ZBTA 3M82A 2C5BA 1MN6A 2JKZA 3N59A 3GJRA 2VR1A 3K92A 4OHKA 2DKFA 1SD5A 1CXZA 4BO5A 2Z4SA 1I9GA 4BIMA 1KGDA 1MVOA 2OSVA 2XUKA 1I0LA 1ZD2P 3OT5A 5IXYA 2ZLBA 4W5HA 1RHMA 1X2BA 3U31A 3SHFA 2GZ3A 2EKQA 2G6TA 2VTVA 1G5FA 1HDXA 1M72A 4PZAA 4WASA 4OA5A 5KQRA 3M8KA 2A5YB 1Y7LA 3NTRA 2VP0A 1GPH1 3C43A 3M34A 3OFJA 3FPHA 4ZRDA 3K0CA 2FMIA 3TZEA 4C20A 4ZCPA 2O2JA 1N6PA 3BC1A 2ILTA 2A0UA 2QD2A 2PSHA 3CUVA 3NGXA 4BWYA 1U5CA 4H1VA 3RYIB 4GBMA 5L4NA 1AF4A 4N3GA 3U0BA 4GC9A 1NBWB 1V6CA 3BE5A 4G0VA