2R8ZA

Crystal structure of yrbi phosphatase from escherichia coli in complex with a phosphate and a calcium ion
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
181
structure length
181
Chain Sequence
LATCYGPVSADVMAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGYGIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKLDEAKGQSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
publication title The Tail of KdsC: CONFORMATIONAL CHANGES CONTROL THE ACTIVITY OF A HALOACID DEHALOGENASE SUPERFAMILY PHOSPHATASE.
pubmed doi rcsb
source organism Escherichia coli o6
molecule tags Hydrolase
total genus 62
structure length 181
sequence length 181
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2r8zA00
4HGOA 2ZG6A 2R8YA 2YJ3A 2EAUA 5AK4A 2WHEA 1ZRMA 3N28A 3R09A 1WR8A 3J7TA 3SF0A 5ALTA 3BWVA 5AM0A 1QQ5A 5E0OA 3R9KA 2O9JA 3R4CA 4Y2SA 4OHFA 5ALIA 2AUTA 3QU2A 2FDRA 5AHXA 1NRWA 2FEAA 2YMPA 3QUTA 4YCMA 3PCTA 3SMVA 1JUDA 1TJ4A 3RFUA 4GXTA 3U7GA 3UMGA 2MU1A 2HHLA 4IG4A 4BX0A 4QJBA 2HF7A 3PDWA 2G80A 2JARA 3SLRA 3WKBA 4G9BA 4ZEXA 5ALOA 2HF2A 1L6RA 2B82A 2G08A 4F72A 3AR4A 2B1QA 5AKJA 2YBDA 5AI0A 4FE3A 4YGYA 4YIKA 5ALEA 3EWIA 1U2SA 1TJ3A 1WVIA 4EENA 2B8JA 2C88A 1U02A 1T5TA 4BEVA 4IFTA 1ZD3A 3AR9A 1Z4QA 1Z5GA 4Y2RA 5AI8A 1S8OA 4L6CA 3WKAA 1U7OA 5AVZA 3TLMA 4Y2UA 2ZXEA 1NNLA 1LTQA 5A3QA 5AVVA 2QLTA 4XPZA 2OBBA 3L5KA 1VJ5A 1WPGA 4CE6A 4GIBA 3ZWKA 3WK8A 3NAMA 3U19A 5A3SA 2Q4TA 2X4DA 3L8HA 2BDEA 3F9RA 3QU4A 5ALJA 4B6JA 1WZCA 4HGRA 5AVQA 3FPBA 4BBJA 3U7HB 2WM8A 3IRUA 4I9FA 3N5KA 1T5SA 3E81A 2P27A 3OCZA 3W5DA 1Z4JA 2RAVA 2YY6A 2ZBFA 3AR5A 3NUQA 3OCUA 2HI0A 4ZEVA 3NANA 3SHQA 2WFAA 1RLMA 2YN4A 2GHTA 3E8MA 3RF6A 1RKUA 2IOHA 4KNWA 3W5AA 4AS3A 3PGLA 4DFDA 2G06A 4H1WA 1TJ5A 3IJ5A 3U13A 5AW2A 1RMQA 4UAVA 1RKVA 3WKDA 1K1EA 2NYVA 2R8EA 4Y2YA 5FP0A 3WKEA 1U2TA 1PW5A 5AM1A 4UATA 5AICA 1CQZA 1S2OA 3N07A 2FPWA 2JAWA 4MUMA 1RMYA 3S6JA 4DWOA 4BEWA 1YNSA 4MWOA 4JDPA 3WK9A 1Y8AA 3CNHA 3HYCA 4RETA 4YIHA 5AI9A 3ZX5A 1YV9A 3MN1A 2HCFA 5ALZA 2B30A 5ALMA 2R8XA 1QH9A 5ALNA 5AKLA 4UARA 4UW9A 1ZS9A 2G0AA 4Y3UA 4CF4A 5AVXA 3SKXA 3B8EA 3EF0A 1Q92A 3NALA 2ODAA 1RLTA 1RMTA 3L1UA 1L7OA 1SU4A 3P96A 3ET5A 1Z5UA 3L8EA 3U7EB 5AK3A 2HX1A 5AKGA 3ED5A 2I33A 5ALYA 3ZTYA 4EELA 1EK1A 2C8LA 3NRJA 4KN8A 2WF6A 3U7FB 4BNDA 5AKXA 5AM3A 4UM5A 3L1VA 4G63A 2WF7A 3QU9A 1RRCA 2C9MA 3ZI4A 5ALKA 1NF2A 4NWIA 2GFHA 1F5SA 5AK5A 3AR7A 5AI5A 5ALLA 3N8GA 3M9LA 3QUCA 3I28A 4DCCA 2JGAA 2FPUA 3WK4A 2B1RA 2ZBDA 1AQ6A 3AR6A 1XVIA 3NASA 3DAOA 2AGVA 3L0BA 4Y2JA 2IOFK 4BNDB 2FI1A 2IYEA 3QU7A 4NAVA 2OYCA 1KYTA 3OCXA 2IA5A 1Z4OA 3OCYA 1EK2A 3HLTA 2DQSA 3N1UA 4UMDA 4UMVA 3SKYA 2FUCA 3ZUPA 3OTQA 3I1YA 2YJ6A 2B8EA 1TA0A 3MPOA 1RQLA 2YJ4A 2GHQA 1J97A 4C4RA 5AKYA 3KOOA 3WKCA 1Z4KA 2VKQA 2OA0A 4XQ0A 5AVUA 4L57A 2YFYA 3E58A 2FPRA 1IWOA 4HYTA 2Q5EA 2P11A 2C4NA 4UMEA 4EX6A 4KYTA 1O08A 5AW6A 5ALXA 2P69A 2HEGA 3A1EA 2AH5A 4UASA 3FPSA 4UAUA 5AW3A 5AVWA 3I6BA 2OM6A 2YMLA 3A1CA 3D6JA 1Z4PX 4ZEWA 4OCZA 2PQ0A 3UMBA 4CNQA 2EARA 3NIWA 5IT4A 1N9KA 2C8KA 2FPSA 5ALQA 3ZU6A 1L7NA 4KNVA 3WK6A 5AW4A 2WF8A 3KC2A 4C4TA 4KX5A 1U7PA 3AR2A 3KD3A 2FUEA 3ZVNA 2Q4RA 1Z88A 3DDHA 3MC1A 5AKEA 4KX3A 3ET4A 5AKIA 5AKKA 4J2TA 2RB5A 3W5BA 4NABA 1X42A 4FYPA 4NV0A 5AVSA 3W5CA 1YS9A 3UM9A 4YCLA 3B9RA 3OPXA 3L0YA 4J03A 1TE2A 3QYPA 3KDPA 4HGPA 2MSNA 4AS2A 2P9JA 4RESA 2GO7A 3ESRA 2CFRA 1RLOA 4BX3A 4QQFA 5ALFA 1FEZA 3DNPA 3VAYA 3E84A 5AM4A 4L6AA 5ALWA 5ALVA 2RBKA 2WF5A 2JAUA 5ALDA 4UU0A 1ZD5A 5AW7A 3ZTWA 2AMYA 3DV9A 3ZVLA 5AIBA 3B9BA 5ALGA 4EZEA 1RPZA 3L7YA 3ZWDA 5AW8A 1VJRA 5AIAA 2O2XA 1L7MA 3ZVMA 4UMFA 3EPRA 5AVRA 3QGMA 2YMMA 3ZW7A 1Z4NA 1RDFA 1MH9A 4HGQA 5ALSA 1XPJA 3L8GA 2I7DA 4CF5A 2G1AA 4OD0A 1N8NA 3SD7A 5AVTA 2R8ZA 3A1DA 2I55A 1YMQA 3QLEA 1RKQA 4UU1A 2RARA 2I6XA 3QXGA 3KBBA 5AK6A 4DW8A 3AR3A 2CN1A 4Y2QA 4UM7A 3EF1A 2D2VA 1T9ZA 3AR8A 2WF9A 2EATA 5AKHA 1ZD4A 3L8FA 4C4SA 4Y2PA 3WK5A 4YH1A 4JB3A 2I54A 1YDFA 2PKEA 1LVHA 1YJ5A 3FZQA 4I9GA 1QQ6A 3BA6A 3MMZA 4XE5A 2HOQA 1Z4LA 1L8LA 4XOUA 1XP5A 3FM9A 4E88A 5A3RA 2CFSA 3U26A 1Q91A 1QQ7A 1RC8A 4BX2A 3WK7A 5ALRA 1O03A 2HO4A 4OFZA 1ZOLA 1L7PA 3KZXA 2NO5A 3ZX4A 1SWVA 1ZRNA 4FFDA 1VFPA 5AI6A 1CR6A 4Y2TA 1ZJJA 3QU5A 5AM5A 5AW5A 4Y2XA 2JAOA 3WGVA 1L8OA 2BY4A 3PGVA 4YCNA 3QNMA 4Y2VA 2FPXA 5AESA 3A3YA 3FGOA 3FVVA 3WGUA 2ZOSA 1ZD2P 3QX7A 2HSZA 4CF3A 3QUBA 4EX7A 2YMQA 2QYHA 4AP9A 4F71A 3M1YA 3L0CA 4HGNA 5ALHA 3K1ZA 2G09A 2ZBGA 2PR7A 2W4MA 2NO4A 3CZ4A 4PNHA 5JJBA 4O8CA 1SWWA 2HDOA 2I34A 3OCWA 5AW1A 2W11A 2IOFA 2W43A 5IS2A 1J8DA 2YJ5A 3I76A 5AM2A 3QUQA 2G07A 1RQNA 2BDUA 4NFLA 5IT0A 3UMCA 5AKZA 2CFTA 5AVYA 5ALPA 5ALUA 1Z4MA 5AI4A 3OCVA 4BKMA 4EEKA 1Z4IA 4BYGA 2ZBEA 3IB6A 3GYGA 2B0CA 5AW0A 1QYIA 5AW9A 3ONNA 5T41A 4HAIA 3ESQA 2GMWA
chains in the Genus database with same CATH superfamily
4FFRA 1I2BA 3TL3A 5JYDA 3K0SA 4QECA 3GUCA 2VA8A 5CDFA 2QQ0A 2F1RA 3IELA 4PCVA 3OQVA 1P44A 1RHQA 1P1HA 1DWPA 2QA5A 4D8VA 5LXTF 4M54A 1ZN9A 4ER0A 3N28A 4GR4A 1O6CA 2HZ7A 4BVHA 4EUEA 1XZJA 4X7MA 1AGNA 4Z7QB 4KR6A 2HEIA 5HTOA 4B3BA 2PSEA 3KT8A 3ZW8A 1G38A 3MWEB 2VAWA 3T1TA 3IHKA 5B64A 1ACLA 3BXFA 1N2GA 4IW3B 1EFHA 3CLVA 2WU4A 3CUTA 4QXQA 1P39A 1ODLA 4GPBA 5CMLA 3S2SA 1QTIA 4ENPA 1SCUB 1KJZA 2JAHA 3FUCA 4PCAA 5JNRA 5J4VA 3HXMA 4MV5A 4F91B 5AUNB 3ACBA 3GCWA 3TZ6A 3U80A 3DMTA 3A1FA 4R3WA 5FL7D 2RCNA 3OY2A 3VR5D 3PCTA 4ZXFA 1QRUA 2P9GA 4Z86A 1V6SA 4QSHA 3AVQA 2WSSA 1KFKB 4IG4A 2YVUA 3F73A 4NDNE 2H1OA 1H94A 1UR5A 1E2GA 3TRJA 3AF6A 1JJBA 2VHEA 2WWYA 3E53A 3BM5A 4PVDA 1E5XA 1CW2B 3MAGA 3J81k 1ZUIA 1F2UB 1KZ7B 1U8TA 2Q8PA 3NVAA 1G59A 4XJVA 1TZJA 1Q19A 2B1QA 3AR4A 3FZYA 3L9WA 4Q4JA 5B6JA 2AOXA 4TWBA 3RVPA 1RS0A 2RHOA 3GLKA 2P1ZA 2OD2A 1U02A 1XJCA 3C6XA 5DM1A 4D0RA 3AL2A 4MW4A 4DQLA 3QMVA 2WLTA 2OQIA 1HLFA 5A5VA 4F6CA 1JQ3A 1UL1X 4L8WB 1FPMA 3WGIA 3TF5A 2Y68A 4E4YA 4KLNA 1DG1G 4EYGA 6GPBA 5AVVA 5CDUA 4H2DA 3PF8A 3QW4B 4PTLA 4CMCA 1XALA 4MJ3A 4GBMA 4MQ5A 4QQNA 2J4FA 4Q4JB 3BRQA 3RVBA 2AOTA 2DBYA 2GJ8A 2RHJA 4AQYB 4YUVA 1ZL2A 2PJRA 3F1LA 4DLTA 4BGVA 2HLPA 1PKEA 4NKRA 4P0TA 1VPDA 1OLUA 1DIRA 1LI7A 3Q12A 5DWDA 3S7TA 2NSHA 3SI7A 5B5SA 2DLCX 1NFFA 3QELA 4R0NA 2C77A 2FP3A 3OJ0A 4OQMA 5C0OE 5I6DA 3IVMA 2J6CA 1RFGE 2GZ3A 1DEAA 1XMIA 3V3TA 4B6EA 4DDUA 3T7CA 4WZZA 1W35A 4N5DA 1IAQA 2BM9A 3GP5A 1OIVA 2AOTB 4V38A 1QDLB 1OI7A 3EAQA 5GP1A 4Z51A 1OTHA 1GNTA 3GPBA 5J47A 4LHXA 2A0WA 3O7WA 2COKA 3D3KA 3M81A 3H5RA 5GM2A 1XTIA 1OLUB 3AESA 1H9BA 2X9VA 2HU7A 3RIYA 1RJFA 5HR5A 1T1IA 3OCUA 3QELB 4EATA 2CLLB 4RYDA 1IONA 2XUDA 2CEAA 3KEOA 3JZFA 2QTVA 3WA7A 4NMWA 5F1YA 5IMBA 4P34A 2X3FA 4F9EA 1ENPA 2ONCA 3QEMB 2OXIA 4I81A 5JZMA 3M82A 4JUAA 2R6JA 4PEVA 2FFJA 4RSMA 5JRZA 2R7MA 3PVSA 2P62A 2W00A 4OJYA 4EYEA 4U2GA 5DIZA 4PO3X 3NYQA 3H6KA 3K7EA 1VIYA 2WWXA 2XZDA 2HCTA 4EVSA 2Q7XA 3G2IA 1G7RA 5KDDA 2IYQA 1E4YA 1J2UA 1M0SA 2WICA 3AESB 3QTLA 1V39A 4URUR 3U13A 4J1QA 5EAIA 2P7HA 4TXMA 4A27A 2MR6A 4RH1A 2Q3EA 4D7AA 4QLBA 4OGKA 4CG2A 4ZPJA 4GM4A 5I51A 2WJAA 4B3RB 1R4NA 5BV8A 4QREA 1YZYA 3I5AA 1Q1QA 4W8OA 4JYZA 4NRDA 2EJBA 1T3HA 4NEQA 3BF7A 3CR7A 1IXSB 3OLXA 4CKYA 2FW9A 3VR3A 4D3SA 3HKBA 2WJGA 4MUFA 2CL0X 1AN0A 5FCDA 4GMGA 3E82A 2ECQA 1G98A 4LS3A 3AMVA 4TRRA 1SXQA 2DY1A 4ZRNA 3RS5A 1N8SA 4R3NA 3EGDA 4NR0A 4YIHA 3LBNA 3ZX5A 3OC0A 3CNQS 3NTOA 3L41A 2O0KA 4YDSA 2B30A 1R4NB 3D4IA 2PMWB 4K9MA 3NV9A 3PE6A 1VCOA 5KHOC 4NP6A 2GDJA 2VUIB 4HNSA 2QLJA 4M1EA 4H7KA 4ZARA 2QXTA 1E7YA 2QZPA 5BSRA 5JANA 2ZBRA 3N2ZB 4IZHA 5DK6A 3HKBB 1E96A 1NVVQ 3A58B 3LQQA 1M8PA 2I5PO 2Z6VA 3C6BA 1MZVA 2TMYA 4IJ6A 5E2BA 5H80A 1G8YA 5JS6A 1QVVA 1KMIY 2ZYGA 1O87A 4JP3A 3HADA 1IMJA 1M6VA 1I33A 3B1VA 3HRIA 4JB0A 4WKOA 3K9NA 5DB4A 2J9XB 4D3FA 5HWSA 1HMYA 3MCWA 1Q1GA 2EFHB 3L9XA 2WZBA 3RS0A 3KHSA 2Z04A 3KJXA 4A6XA 3I0ZA 3NU1A 1WJGA 4OMUA 1K5HA 1T0IA 2OV3A 3NONA 1MTOA 4MAAA 2HHJA 3NBKA 4MI9A 3RG8A 5CDYA 3LUBA 4FVTA 4NYIR 4BLSA 1NVWQ 3BXPA 4BFWA 1WZEA 4UM5A 3PXGA 3INTA 2A4MA 2YXNA 1CV2A 3T4XA 1M6VB 4N01A 2RHTA 4F4HA 1RRCA 4QPNA 1N6NA 1OXMA 2OD9A 5CUQA 4Z2YA 4IIJF 3FVQA 3UC5A 4FT2A 4BFXA 1M7GA 1UBJS 2PKCA 3CW8X 1R8XA 3LQFA 4FYIA 4HDOB 4LXUA 2IYSA 4E5PA 4ZICA 2VUHB 1OBCA 4IXWA 3CEHA 5FR2A 1HDXA 1I4OA 2ZBDA 4Q82A 5FFMA 1RPNA 2UZ1A 3PGKA 1RSZA 3IFSA 1C8VB 3FMIA 1LPPA 1F9AA 3WTBA 1Q0PA 2ZRAA 3GLHA 3KQMA 5CLHA 2O54A 5CCDA 5A9TA 1QFSA 1WUIS 2XMZA 3ZQ6A 1FUUA 1X1SA 1RYYA 1GQQA 4F21A 2W6PA 1XVAA 2WG1A 3P5BA 1OXXK 1Q7EA 3OCYA 3FYDA 1JDJA 3C1TA 4ZVUA 1QJ4A 2GN9A 2Y0PA 1NMXA 2OK7A 1PG5A 5F5XA 4IXMA 2EQBA 3V33A 5FUWA 2WUDA 3N39C 3PDCA 1TZMA 4UBNA 1QDUA 1NVMB 2VH1A 4DUGD 4F38A 4DSAA 2UZ1B 1VG9B 4OJQA 5JHGB 1STOA 3GLHB 3OU6A 1QYRA 1TF5A 2H48A 2QRGA 1ONOA 3ETJA 3I92A 1QCYA 3GAMA 2DRIA 2FQQA 3T35A 2ZSFA 2VAVA 5I9TA 1WETA 2WFMA 3GDGA 2AOUA 3KQOA 4PO8A 2DTEA 4G23A 1E94E 1H0SA 5HF5A 1PFYA 2J41A 2V97A 3MMXA 2JAXA 3LGXA 2YV4A 5JFGA 1WWKA 2OPBA 2COEA 2W98A 4X3PA 2TS1A 4OTZA 4JLKA 4URXR 5DN9A 4NMMA 4TMVA 2FX2A 5IKXA 4F97A 1P75A 4B74A 4WXRA 2ZTMA 5AHKA 3RGWS 5E6SA 2FEPA 2PUWA 1KBOA 1Z37A 2EFYA 3V1KA 2LDBA 3KJNA 4RMIA 4LAFA 2Y6UA 2PQ0A 2HMVA 4Q3LA 4M76B 2Y2UA 3KDSE 1IIBA 1TMOA 4M9SA 1YBVA 5DKFA 2XYHA 3FE2A 2C00A 4R2IA 3G89A 3IEIA 1MO3A 3AUKA 4JIMA 1P4AA 4DCUA 1W59A 3MXTA 3JZMA 2E55A 1BWPA 3RBZA 3O3CA 3H3XA 5CK4A 4QU5A 4KGZA 4D41A 3GAFA 1CQWA 2HA5A 4KIJA 3TOXA 3VKWA 4B3XA 1G9TA 3DAGA 4JI4B 2X0KA 3JWEA 4Q1BA 5E6SB 3W9BA 1GR0A 3GUHA 1ZKMA 1LW7A 5CYPA 4E51A 5EPOA 1I1NA 1K6XA 1P60A 2IU3A 2V7UA 3DL4A 3IV9A 4MEJA 1YU9A 2XNDA 4YCLA 4NDZA 2C61A 4XFKA 2YUTA 1FB5A 4J1SA 1CY1A 4LOHA 3DHVA 3V48A 1QB7A 3CE9A 1XRLA 2NVUB 4AS2A 4YJ2B 4BRZA 5AUOB 3HUEA 4EI2A 1AZLA 4GECA 3H3JA 2MSWA 3S7ZA 1K92A 4N8EA 5FAXA 2GPSA 2H59A 2AR9A 4J4TA 4Q3AA 5TDHA 1XNQB 2CJYA 4IIBA 1H4QA 4L6AA 1Q16A 2JD1A 3NWJA 1R0LA 4U7WA 2F8LA 2VDRB 5ALDA 4CCYA 4RTJA 3KAKA 1EFLA 3BFJA 3DBRA 5ECYA 4DM7A 3GHHA 3TX2A 1U0TA 1N33B 2W6OA 1Z7GA 3VO2A 1DELA 1KAEA 2RGGA 3DZHA 4QUJA 1R6UA 3GRFA 3SX0A 3NHFA 1BD3A 2WD8A 4H4DA 4LMRA 4QTTB 4UM8B 3KLOA 3N5CA 3QQPA 3ZVMA 2AMLA 3RTEA 1W8DA 5DF1A 2GT1A 3GWZA 2FZEA 2XIJA 3OZUA 1A82A 1NM5A 4NE7A 2DETA 2Z3WA 4CFSA 2PCLA 2VT6A 4CCYB 3U61B 4Q7EA 3V7UA 1G8HA 1SUFA 1Y1KE 3DBRB 3FR8A 3PQ3A 1YDHA 5BUCA 2AKYA 3EQZA 1ESZA 3L6CA 4RLHA 3DOJA 4BVLA 2EHJA 2V7EA 4DB2A 2WDZA 2X14A 2JFOA 1G0NA 1RKQA 3GAAA 3E35A 1CP3A 1K9VF 1NJ5A 5K6AA 3T38A 1FDIA 2QMOA 3NOVA 1L5RA 4CIVA 5A6VA 2VQ6A 1A8UA 3EC2A 2QN8A 2WJYA 4AURA 3DGFC 3I8SA 1UFRA 4Q9HA 3GLVA 1XROA 2BKVA 2C5BA 3OEHA 3A7DA 4PAQA 3GFBA 3C4QA 2J0QA 2P9TA 3HWWA 2ET6A 3C3MA 3R3ZA 1L4MA 1MO4A 3E27A 3LLUA 1QF7A 2W58A 3TJRA 3ZIDA 3DAHA 1T2DA 2J9ZB 2ENUA 1OLOA 2L69A 3HR4A 4EW3A 3WRXC 2AX4A 1U3GA 2F6RA 4KKVA 4D0LB 2W2KA 1RVV1 4LJSA 3W9UA 3M49A 4M1MA 1U8XX 4LXHA 5TJ9A 3TQFA 2XBLA 2EX0A 2P1RA 4AFNA 1VYTA 4BZZA 4KQ2A 2QYSA 1LXCA 2Z8XA 3QSGA 2GPWA 5LB4A 1B8NA 4RO0A 2GHIA 5SZHB 2YBEA 4OK6A 2Q99A 2GZSA 1L8LA 4AX4A 5B3JC 1WXWA 1J8FA 3H42B 2ILTA 3TNDA 4PONA 1M6YA 2DY0A 2Z56A 1P4HA 3ID6C 1SBQA 1K5GA 4IUCS 3EW9A 2OXCA 5IUKC 3F3MA 1SH7A 2PUHA 4Q4HA 4U2KA 3KHTA 4AJJA 4AZ0A 5FLXA 1V9CA 3WX0A 2W2KB 5CNIA 3TKYA 1NUQA 1JR3E 2EKPA 3GQBB 1QXSA 3BREA 1NW4A 1W25A 3WDSA 3KS9A 2AJDA 1PEYA 2ZS8A 2Z1DA 1MABA 4R8RA 2HBZA 2WSIA 1B3RA 2WHXA 5EUQB 2P65A 2Q1YA 3UO8B 2J3JA 2AI3A 1BFKA 2DVMA 2JBWA 4EKYA 2FF5A 3HH8A 3R8FA 3V9AA 1B0PA 2EJVA 4HQLA 3MK31 4QUDA 1KQPA 3H5AA 3O75A 3HC7A 2C3OA 4Y2XA 2JAOA 2FQYA 5FOTA 2WUEA 1RW4A 1RNLA 3QNMA 4D3ZA 4DWJA 1TK3A 3C5WP 4ZAWA 4AZ0B 1DARA 3DLHA 1ODFA 3A3YA 1C7ZA 3FGOA 4DJFC 3FDFA 3FDXA 3JX9A 5LLSA 3X1MA 4PQFA 1JS1X 4LRWA 5DHUA 1PS0A 5EE5B 1MABB 1KRHA 1VJCA 1DLJA 1ISFA 2YQ5A 4C3VA 4DA6A 4RF5A 4W5QA 3DPUA 1T13A 1ZWLA 2W2NA 1MOSA 3G88A 3IDFA 3UWPA 4ZYYA 3D7RA 2C94A 1HF3A 5KAMA 1KDZA 2H85A 1B23P 1O6BA 3G1TA 3A6ZA 3L84A 4LHWA 4UREA 9LDTA 1RZUA 3AHIA 3JRWA 3A3KA 2WWVD 1FDWA 1FDRA 3JARA 4IOMA 2YC4C 5ADHA 4MS3A 4D9JA 2OMKA 4M0DA 1GFZA 4RM3A 1OH7A 1O58A 2XUZA 3FHTA 1CJVC 2ZCVA 3I52A 1XKLA 3AM5A 2B4QA 3F3YA 3VR4H 3PX7A 4MIOA 3AWDA 4Z49A 3GRPA 3GLGA 1LDBA 3WY9A 3BWCA 4NEGA 5DEIA 4QGFA 2V9ZA 3W2FA 3LYHA 3NXSA 4DIBA 1RWPA 5KS2A 3Q7EA 3KYDA 3ASUA 1XVLA 3OA0A 1I5RA 1YU6A 3JARB 4YQYA 4IEEA 3KXLA 5IWAB 1KYVA 1MVNA 4MS3B 1FUYB 3IURA 2EP5A 3V00A 3EVEA 3KKQA 2HKIA 3SYNA 5T41A 1CNFA 1DAGA 1A69A 1Z0ZA 1X1EA 2XQIA 2FRXA 1OX4A 1XWIA 3H4TA 1BG6A 1N57A 2NGRA 3GLGB 4HGOA 3L40A 3NHWA 3T3GA 2JGMA 2HXGA 1I2AA 4ZOQI 1VL6A 4WEQA 1G2IA 1GKLA 1QNFA 1ZP6A 1QFZA 1WEHA 5AK4A 4KYUA 1C29B 2WHEA 3NGMA 1VIAA 3E1SA 3W1WA 3KYDB 1FP4B 1KNXA 4RY9A 4XQGA 1P5JA 2L18A 3JQGA 4RIHA 4MKHA 3VYRB 2CHEA 2POCA 3CRNA 1W96A 2PO5A 4L95C 1Y9EA 2R8BA 5TGDA 1G55A 3RVMA 3KG2A 1OKKD 3EZFA 2YR0A 4DR1B 3JSXA 3SLKA 5E0OA 4TVSA 5EKTA 1OX4B 4RA9A 1GZ4A 2BCJQ 2M1XA 3R4CA 5CCXA 1NVAA 1CUBA 1FYVA 1GFIA 1N0HA 3GJ8A 1KBZA 4ZMBA 2BHNA 5C3MA 4YO7A 2GKGA 4P7GA 4WVFA 4CKZA 4YCCA 1B8UA 1MJ5A 3JQGB 3FHJA 3TLKA 1JIUA 1TQHA 4AKIA 2XH8A 3ZDXB 1Y7LA 2G6TA 1NW6A 5EKUA 1HNXB 2IC5A 3E3OA 1NU8A 3GA0A 1LNZA 2B37A 4FOSA 4M6WA 5AXCA 2IHKA 3C8ZA 3HNOA 4HPWA 4UAGA 4RA9B 4RMGA 3LY5A 1A96A 1VLMA 3DOHA 3LC0A 2MSDB 5HKLA 1TPZA 3PPXA 2BMJA 2D6FA 1TRHA 5EIOA 4IXDA 1U2SA 3ZY6A 3QE2A 1FFYA 2O2EA 2IOYA 2MYTA 1NM5C 3TKLA 5I7UA 2W5UA 4BEVA 5K0BA 1I1OA 1VMEA 1UAGA 4LF6B 3LQRA 3AR9A 1GSOA 4AMBA 4W5HA 5DI9A 1WO8A 2E82A 5DTEA 2GM4A 1CF4A 3NTQA 1HYQA 4G0OA 4M6WB 2GZRA 2B36A 3IIIA 3IVAA 2YNMA 2OYSA 2PX0A 2QLTA 3D5EA 2FR1A 2WIAA 4I2NA 4O02B 4YRTA 3UV7A 4N48A 1UJ6A 3OICA 2VBGA 4KPUA 4M1TA 2XE8A 5CJPA 3RIHA 3WWOA 5DI3A 5EJ7A 1TNDA 5AUQA 3SYKA 2UXBB 1L4KA 4D79A 4EDFA 3V2HA 1UKYA 1QK4A 3K5IA 1B4DA 1A9OA 4X6YA 2IITA 5J9FA 1D5CA 5D1HA 5HSGA 1J22A 3JRXA 4FDTA 3PG5A 1YDEA 2JEZA 3F6EX 3O94A 3HCRA 2O07A 4TT3D 5JD5A 5ALJA 2FLKA 2OCYC 3R20A 2J59A 3G79A 4G1BA 1U8YA 4EIWA 1GLVA 5E2AA 2M32A 3BN3A 1AKEA 3RVJA 5TPZA 2D1RA 4HATA 4JKIA 2RGWA 3RUPA 2BOVA 1K08A 3HYSA 4KG7A 5COBA 3QWBA 3NP7A 5EEGA 5BSGA 5DI3B 4I6EA 4TSKA 4WGFA 4R71A 2QR3A 4Y18A 4O4HF 4CVNA 3RYIA 1BZYA 1IBSA 1DBWA 4HWPA 1YL7A 2DLDA 4XRRA 5CG2A 2TMDA 5LQMA 4ZEVA 1FX0A 3JY6A 1JHUA 4HH1A 1TIPA 5L3RA 2PT6A 2BD0A 1D09A 1TKBA 2A14A 3HJCA 1JMYA 2WM3A 4E30A 3EGOA 5EVCA 4KJXA 2GHTA 3T3HA 5D84A 1C1YA 3MF4A 2Z83A 3B2QA 1W1UA 1LLUA 2R7LA 2Z9DA 2EF0A 5G2OA 2V7QD 4IVPA 1GP2A 3G2NA 3MTQA 2QW1A 3U81A 1GTZA 2KM1A 1Z45A 2IY9A 1H2FA 2OE2A 2QNRA 3N0WA 5CFQA 4G1VA 4F56A 4FB5A 1GN9A 3PEYA 1FX0B 2QU8A 1ACJA 3FJYA 2HWKA 1K1EA 2JDIA 4Y2YA 4JVMA 4HX9A 1IHOA 3LBFA 2WHQA 4R1LA 3LA6A 5KZMB 4TQAA 1WUYA 3KJGA 5DW0A 2FPWA 4H18A 2TMGA 3QKUA 4ZZIA 1V8PA 2UYGA 1N5MA 2F43A 3KSMA 4E0BA 4N5IX 4U4AA 1PD1A 4EOGA 2Q29A 4XDHA 1HT3A 1P2UA 3WLIA 5AI9A 5F12A 2WHPA 4W5OA 1XAIA 4TTIA 2H2WA 2XNJA 4AP5A 4BP9A 5JISA 3GRYA 1M8KA 1KOJA 5FLYA 2X6TA 1E3TA 1QONA 2GXUA 3WQQA 3I12A 3I05A 4TRJA 3AXTA 4WXYB 4EYQA 1KK0A 1USUA 5KNBA 2CBZA 4MGYR 4IUBS 2XE6A 4UFNA 2IIVA 1LSSA 1ZM3A 3RAPR 4FT4A 3STWA 1IN8A 1MGOA 1P2TA 3ZV5A 2JPDA 2ZJ1A 5K0EA 3P96A 2BBOA 2OCAA 4L0MA 2OFXA 3W79A 4DKJA 1K63A 4PWZA 4LV5B 4E5MA 1CYEA 3FCUB 2QRQA 2WHPB 1JPJA 1PYDA 3MCVA 3QFCA 2C9CA 4JELA 4JP1A 4MVJM 4D80A 1A88A 1E4OA 1A5ZA 1SHJA 4JCCA 3S3TA 5LQKA 5AKGA 5DLYA 2I33A 3Q7QA 3QZUA 5ELXA 3T3DA 4GX2A 1PFKA 3LX4A 2GBGA 4M53A 3REFA 2XRMA 2A9PA 5FPKA 3AUYA 4GOND 1EK1A 3MS4A 4D4KA 1PNRA 3AVVA 2CJFA 1JU9A 2Q62A 2X7XA 2NXEA 4LECA 2CHVA 4IMRA 4TMFA 4IIUA 1EHYA 4X0EA 3FTCA 2P7IA 3OSUA 2JF0A 3EBLA 3PFWO 4MAFA 3HO6A 5KPJA 1E89A 3WLNA 5GWXA 2F3TA 1QOPB 2GFHA 2ZKIA 2J3QA 3O9ZA 1J24A 1V3VA 2BAGA 4P4TA 5EXXA 5BW6B 4MVXA 3QEJA 4BU0A 2FPUA 3WK4A 1WABA 1E79A 2QQFA 3HCBA 5DIFA 1MGPA 1BVRA 1SB9A 2D2FA 2L0XA 4H3SA 2K6GA 2W6MA 4UBIA 2OXTA 1OH8A 1UWLA 2IYEA 1TTHA 4DMRA 1Y8QA 3I5YA 4IRUB 5K3DA 2IS2A 1RJDA 4L7VA 2C2XA 1KU6A 1KVQA 3RVLA 2AG5A 4K6MA 3RWBA 1ZCJA 3PQCA 1IN7A 3DLCA 1NBME 4ZAZA 3PUIA 5TIIA 3IYLW 1CRZA 5FKJA 1FFSA 3SKYA 2PGOA 1NL3A 1RQXA 3U44A 3ZCSA 1O3YA 4BFLA 2I03A 4G09A 5DSTA 2R11A 3I1YA 3OTQA 4LHYA 3TQSA 1KMMA 5EP3A 4A4DA 3PRJA 2YRWA 1TA0A 3OLVA 2I3AA 5FI0B 1CQXA 3TNYA 3WE7A 1FPQA 3EUEA 1V45E 4DGQA 1PT8A 4C3UA 1BX0A 2N3ZA 1H6DA 1H05A 1XQVA 3DO8A 3PQ8A 2JLYA 4UVDA 2R7KA 1J8YF 3AUFA 3DB1A 3FPLA 1YO6A 4X20B 2WA2A 1JVBA 2OO5A 3LW7A 1FBTA 2YFYA 3U44B 1V8FA 2WVHA 1FVOA 2H54A 1LLQA 1KYQA 5CYGA 3H65A 5KEIA 1P9OA 4UHCA 5A5EA 3FCEA 2J5QA 3DCNA 4OV6B 1LBHA 1PS9A 5F2OA 1IZZA 4UASA 2BUAA 1XZAA 3MRXA 4LA4A 4UOQA 2FWMX 1C3OA 3T7AA 3U6BA 1QO0A 5JCJD 2NP6A 2XXAA 4JC0A 3BFPA 3F97A 1P5FA 3DEIA 4Z0NA 3D8NA 4CMEA 2JFUA 3GZJA 1C41A 1EX1A 1FXUA 1JDSA 2D8AA 3WK6A 3O2JA 4B6SA 3EPKA 1A2BA 3WICA 4ARBA 1ZH0A 1IATA 2VJMB 3DTTA 1ZCAA 4EVRA 3WWDA 1RM5A 1V5WA 2R65A 4K46A 4B3TB 3E15A 1CERA 5KQRA 3EVCA 5BSTA 1O77A 3UMSA 5GTDA 1EVYA 1C3OB 2OSBA 1E61A 4KIWA 3WWCA 2XXAB 4MQBA 2PS0A 1NW5A 2N46A 4J2TA 4WLNA 5KAPA 5SV2A 1RM4A 3RSZA 1XKXA 2GA8A 3D43A 5KNDA 3W5CA 4RTMA 3K5WA 1T8SA 3LT4A 2YRFA 1F3LA 3NV7A 5EZYA 5KO2A 2BGTA 1CJTC 5CNJA 1A95A 1W93A 3LNTA 3KXDA 5C31A 3JQBC 4FNMA 2IUUA 3QI2A 4EKIA 1HT1E 1JR6A 2FPGA 4JITA 3LO5A 3T5CA 2WNIA 2DSTA 1BSVA 4OPMA 3PI6A 2ORWA 1WZIA 1W49A 5KTOA 1M5RA 3C87A 2X9LA 1C30A 5EZYB 2CNBA 3AETA 3DO5A 1HYGA 3MBKA 4TTVA 1GOTA 1JQDA 4UM9D 3VZSA 1ZD9A 4X24A 4ZK2A 1EAMA 3H2HA 1JSLA 2CT8A 2FPGB 4Y30A 5AIAA 2CLEB 4QASA 2QN2A 1L7MA 4RD0A 5EESA 3U4MA 2X2FA 3PKIA 2XKKA 4TTTS 3D6AA 3D1VA 4JNKA 4UBLA 4IKOA 1NF8A 1YRQA 2VF7A 1HDCA 4A7PA 2QJRA 4CQLA 5DCLA 3FKJA 4H7DA 4QDZA 5JC1A 1EESA 1GGHA 1I8TA 1U9JA 4HH4A 4RKFA 4UUBA 3UT5A 4ABYA 3F6PA 1NUHA 3KQVA 1C30B 1GADO 4B2IA 5JD6A 1LC3A 1Y1PA 1YH3A 2I4OA 2R47A 2V74B 3AETB 4KFRA 2X4IA 1UXGA 3D31A 1QG0A 3EMKA 5CDSA 2QD2A 4AL4A 3PPWA 1YMQA 2XUQA 4OLJA 3ZJTA 3M3HA 3MJVA 1GD1O 3DR5A 1VDMA 1V4NA 3WVNA 4PM4A 3ADDA 4KO8A 1CE8B 2ANCA 3H5OA 5AK6A 2V1UA 1WMDA 2EIXA 3PYMA 3S2ZA 3QXXA 3UMRA 4DDKA 4TWZA 1JZTA 2FUG6 1JP7A 2HUPA 2DGDA 3PIRA 1JKMA 3R0XA 4CQLB 3UMYA 1H1TA 1QNLA 4R8VA 3EF1A 2AW5A 4K2AA 3UT5B 3VNVA 4NOMA 4C29A 2A92A 3EY9A 4U02A 5I8ZA 4JH0A 3C3EA 3PL1A 4N3GA 5C52B 1FFGA 3OEYA 4GSLA 3HGMA 3KSAC 4JI3B 1JG1A 1DC5A 1IUOA 1KDRA 4MOWA 3V8BA 2BFWA 1NFQA 2OWEA 2AG6A 4M7OA 4X84A 3A2KA 2OC4A 2QX6A 4AMZA 1MOQA 1AE1A 4C03A 1U2DA 3ROZA 3KLPX 1XCOA 4X90A 1YE5A 4RMHA 3KEMA 1H2ZA 1G8SA 1YR6A 2F9MA 4GZ3A 2A67A 2JK1A 4WERA 5FADA 3WQHA 3GGCA 1D04A 3LX8A 1IB6A 1R18A 3K94A 3EG5A 2EGGA 2HMTA 4L9SA 3R7BA 3ETDA 4J7AA 4LVCA 5JFOA 4JUFA 5AD1A 4V0ME 2HF9A 1MXHA 4PLCA 3PA6A 1HQKA 1HSOA 3PUJA 3F5QA 3NWEA 1BHQ1 1T3GA 1ZVMA 1Q7RA 2V7GA 1NMYA 3R3WA 4QBIA 1Z17A 3AGPA 2JBAA 1RHJA 2OFFA 5LMZA 1HE1C 3CSUA 3AEYA 4PBSA 1NI4A 4GQIA 2BMFA 3WWPA 3AVPA 2H2DA 4FFPA 5TEWA 3B12A 4Q3BA 4IDNA 1KR2A 3OFNA 4FFDA 3WA6A 4D97A 5JI2E 2P1DA 2C1XA 3FCSB 1ZAYA 1Z6XA 4WECA 3JPWA 2J3HA 3CPJB 1YT5A 4K28A 1IBKB 2DXIA 4XH9B 4MYSA 2Z8ZA 3P45A 4M8NE 1E2FA 1P3JA 1CUCA 2PGIA 1PJZA 4BQQA 1M2OA 1W4CA 2YN2A 3KVVA 4UC0A 5P8WA 5LQAA 1YIOA 5GIPE 2JBAB 3VRHA 4DV4B 4D5GA 1D0VA 4AZTA 3K16A 3RKUA 5KJEA 4TYWA 3O8QA 1NI4B 1A2OA 2VJDA 2CUTA 4MWCA 1JJIA 1YE8A 3MNFA 5AJUA 4EX7A 1EXDA 1LLCA 3ECSA 1PNTA 4OGWA 3WP0A 4CU2A 1ZGHA 1XZQA 3HU1A 4MUXA 1WDLA 1XYGA 5CBPB 4IFEA 2VZ9A 4X9XA 2HK6A 3LHFA 2ZKLA 1RLIA 1E1RD 3TAHA 3TLGB 1E58A 3W8NA 3I6IA 3FWNA 1M2OB 1RWKA 4JVLA 4M9UA 4B84A 4E15A 2GD0A 1OBHA 5JSKA 3VVMA 3AIMA 3QENA 1APBA 4IDAA 2W4QA 2HDOA 1ND5A 4DV2B 3IHWA 3OCWA 4JAVC 3O8QB 1JHVA 2OO5C 2OAP1 4O08A 3SF8A 1J6UA 3G17A 1TAGA 1P72A 2D1SA 4KQ1A 3QUQA 4RZIA 2DECA 3WR5A 1NJSA 3MTEA 3CEMA 2G1PA 3MINA 2AHOA 1XDBA 2AF4C 3KFVA 3IBSA 4OUDA 3MMSA 5AOBA 3SIWA 2VRNA 3UT0A 5ALPA 4YAGA 5AVYA 4M1WA 5BSWA 5IF9A 3G7SA 4I50A 2WMOB 1P1BA 3MBOA 4R7GA 4EARA 4R6WA 3EBOA 1Z6AA 2EF1A 2BM1A 3BHIA 2GERA 2QR2A 1JL3A 4CMEC 2HWYA 4PG5A 1KVTA 1EVLA 4RD1A 4WOPA 4OY3A 5K0CA 4G36A 1KEZA 1T5OA 3SF8B 3UKDA 4C6SA 1EVEA 1LSUA 4IGFA 2EYUA 4E94A 1VGVA 3HWX1 2FG7C 1TMKA 5CW1A 1ECBA 5HEKA 4RKYA 4YFYA 3GJ5A 4CEIA 1IZ8A 3MINB 3TPCA 1N6OA 4OUDB 2VSQA 3CZ5A 2AXNA 3EOZA 3G82C 3OKAA 1TMGE 3LGSA 4DY4A 4I50B 2GSDA 3II6X 3GMSA 4IIJA 4ISBA 3TB6A 1GNRA 1W94A 1PWZA 1P4RA 1X1QA 1JW9B 3HR7A 1R64A 2YVLA 5KX5F 2RGDA 5FL7A 3KUKA 3RYTC 3SE7A 4DA7A 3IOMA 2HA2A 1YZHA 1L5LA 3IAS6 3HLYA 2M6LA 1ADYA 1ZM4A 5F2KA 2GEKA 5EHIA 1SUDA 1LLDA 3P27A 5FTJA 4ZU6X 1TVKA 3BE8A 3CR3C 4ZZ1A 2XB2A 4C0LA 5IAAA 3TGLA 3EDCA 1S5PA 4BEJA 2JFFA 3O2NA 5A71A 3EVBA 5JSZA 4CEIB 4PYNA 3PK0A 3QG1A 3O8BA 2ABWA 2EBFX 5C1OA 2C92A 1G41A 3STXA 4IIJB 4JQSA 4X63A 3MCZA 5DTMA 3F47A 3TPFA 4J0IA 2ZI9A 3PNSA 4KAAA 3WL8A 1YGPA 3ZLUA 9ABPA 3EXEA 5KTMA 2O3JA 1WKCA 3QPCA 4H7PA 1THMA 1JEOA 3A9RA 5EJMA 3WLJA 1FVFA 2CUZA 2MT9A 2VP5A 5HPYB 5CXQA 3ROQA 3TNLA 2C5SA 1N5OX 1TVKB 1K7YA 2PUDA 4DMKA 1I3NA 2CV1A 3BXHA 2ILVA 2PEYA 4J9VA 1DIHA 1MR3F 2VH5R 3M7IA 5A1TA 5JSZB 2X5XA 4M86A 4M1KA 1A3CA 2MYNA 2CFIA 4KXXA 4NJEA 2OHVA 3PD7A 4IIHA 1D6MA 1SU7A 1FUEA 3LT2A 4DGSA 2P6MA 3HABA 1KP3A 4YPFA 5JI3E 2Q3MA 1ZVVA 1Z4QA 3EXEB 2EX4A 4EW1A 2DFVA 4GBJA 4HAVA 3ZXSA 1Q1AA 3FSRA 5BT9A 2GTIA 3K9HA 3CT4A 3QV2A 5D5PA 4W5NA 2I71A 1E2LA 3EYWA 2HCBA 2C84A 2RIRA 3A6LA 2C99A 4WCFA 3P2YA 3V4ZA 1DADA 3QLVA 4B32A 1UF9A 4WD3A 4CE6A 4B8WA 3BZUA 4GL4A 3U19A 4GUAA 3B20A 1V2HE 1SBHA 1A71A 3GRUA 4NJEB 2Q4TA 4RPLA 1F8UA 3WRYA 2X4DA 4IX1A 2NPOA 2BFBA 4JOBA 4FBGA 4MKFA 1LDMA 4JJIA 1L7BA 5G0WA 3GRAA 1B41A 3V7FA 3FWHA 4BJHB 5G4LA 3LCRA 4ETWA 4OX9Y 1C3XA 1EG7A 1G5PA 3P9IA 4MW6A 3ZOZA 3L3BA 4C0SA 1ZJZA 2PA0A 3GFQA 1US8A 1YOVA 2P2NA 1OF1A 4M49A 3A1TA 4N03A 3B5IA 2CNOA 1JQEA 2GUWA 4WCFB 3NBYC 3WYAA 1CY7A 2OO3A 4Z8YA 1RWWA 1E8MA 4DV1B 4BNJA 1TYAE 4CR7A 4GGMX 4WA8A 2H17A 1JSCA 3JYQA 2C2YA 4WACA 1GUAA 1GPH1 1I94B 5MN4A 3TMKA 4DIFA 4LC9A 3K9LA 1VHDA 4A26A 1T4MA 2BFBB 2M6SA 2Q5IA 3LSTA 1GPLA 1VMDA 5C32A 3PICA 3LW8A 3SYLA 2E5FA 2RHDA 5BN1A 5JDIA 4RC9A 4AKSA 2GRAA 3NANA 1ECJA 4C43A 1N3IA 1US8B 1YOVB 5FULA 1DJLA 4DTIA 1C1DA 3BJMA 1KERA 5CEFA 2KLBA 4KDEA 4F4DA 3Q7PA 4F86A 3PFIA 4MUEA 1X8KA 1RBYA 2G0NA 2GBLA 3BE6A 5CVDA 4B3JA 4F04A 3PWTA 3VBCA 3IV6A 3KYIB 4J2OA 3UB3A 4EITA 2XUAA 3BGVA 2X40A 4AKTA 2RKOA 3GJRA 1UEJA 3OZTA 4Z2AA 1SK8A 1TEZA 2JCXA 3I37X 5ICMA 5JSUA 2HADA 3LZDA 1NMSA 3WDLA 4BVGA 2GSWA 2IYRA 2AQIA 4KMMA 3EBPA 1IDOA 1ZG3A 4NYMQ 5I7AA 3GLFE 3NKLA 4XD7D 4EKNB 1PW5A 4NBWA 3LPLA 1TM3E 4O29A 1PAUA 2I6FA 5FI3A 3V4LA 4F45A 5KCZA 1DX9A 2CZQA 4WCDA 4EY8A 1E3MA 1VE9A 1HFJA 2Y3IA 3DQZA 3WAJA 3TLYA 3FW1A 2ST1A 2YZ7A 2O05A 4OSOA 1MEJA 2ZANA 3QVMA 4UOZA 3TTYA 3KFXA 2UXDB 3IMEA 4RK0A 4OJMX 1S8AA 3RQIA 1YJQA 2MIIA 3C8HA 4FMBB 2P4EA 4UHFA 1U3CA 4CU5A 3AWIA 1UK9A 1BXRA 4MDFA 1X1RA 3DGEC 2E4ZA 2LE0A 4BECA 4FNOA 5JY1A 1IEWA 3KB6A 2VDMB 5BV0A 2AJ8A 5G1NA 4LWOA 5D85A 5AVXA 1WBDA 2BKUA 2J4CA 1S96A 4OATA 3VYUB 3RVOA 4BZWA 2C82A 2NOAA 5FBWB 3IVXA 3CX7A 1XVVA 2AQHA 3K9CA 4EI8A 5IULC 3G5AA 4KACA 5K8CA 1G4HA 3G68A 1JILA 1XMOB 1JKFA 1GL9B 3DJYA 3PUKA 2SKCA 2ALJA 2ZT5A 3OZWA 2OTCA 1NYLA 5A9SA 1W0CA 1BXRB 4AZVA 4EUHA 4LK2A 4R9RA 3TQOA 2AZXA 4UHDA 4XX1A 3T0GA 3E7XA 1RHRA 2ZJZA 4H7IA 1GARA 1YK1A 1KFBB 3A1VA 4WFQA 4XJTA 3FTDA 3ENNA 2O0JA 2Y8EA 1GSIA 3DDUA 4E2XA 2XRZA 2HHAA 3QU9A 1B8VA 1BGVA 1ORTA 3U3OA 4FGSA 1NPDA 4BWGA 3CHYA 4DAEA 1EB8A 1YFKA 4CPDA 1RU3A 3BHJA 5FI1B 5FL3A 1F5SA 1W5BA 4LZJA 3TOSA 1KEVA 3QUCA 3UAZA 1PFWA 4QO7A 5IBQA 1QRRA 1GRRA 1LX7A 2AEEA 3K5HA 4GO1A 3A9CA 1E3SA 4JJZA 4HEQA 3U7RA 3L6DA 1S2GA 3CFYA 1XVIA 5TMDA 1UXIA 3DAOA 1T6ZA 4FCVA 1UJBA 4EAAA 2H51A 1NOIA 3OPMA 2IOFK 4JLVA 4GEKA 2Y1EA 3GOHA 1KEPA 4XIFA 3NFYA 3NHZA 4LXYA 3LNCA 4OGFA 2E7ZA 2ISCA 3CJRA 3VH1A 5EGSA 2ATEA 5BURA 4IQGA 1W4AA 2Q3FA 1M9NA 3KYCB 4P36A 3NW9A 1SKQA 4QPZA 2FW8A 1JMKC 5LYYA 2WPNA 1JT9A 3GARA 1SUSA 1I14A 1CUZA 1KE2A 3LUCA 4JBWA 1UK7A 1ZUWA 1ZJ5A 2B8EA 2Z3VA 2HQRA 5EHGA 3SXJA 1Y6FA 4LE2A 1N0WA 3PJRA 1I2DA 5HQJA 4G0WA 1NBIA 3DVRX 2OV4A 4M99A 1L5SA 1Q1NA 1EBUA 1M66A 2B92A 2HNKA 2XA2A 5DEOA 3QLTA 3PSHA 1XCMA 4KI0A 1L1QA 4IL5A 3MIIA 4QYWA 4DMCA 5KVAA 1WXDA 4JLWA 3MJFA 1KWGA 2HNBA 2NPFA 1VLZA 1U6JA 3FOAA 3QTBA 5KNLA 5KVSA 3C8UA 4Y1GA 1GTG1 2XZLA 4CXMA 5CFPA 2XCQA 2I3GA 2ZRGA 4KYTA 1Z15A 4HMQA 2Q8QA 4G5OA 2AH5A 4OBXA 1XEAA 3TCKA 1Q3TA 3HJRA 1D2CA 4NIMA 1OFGA 4KR9A 1ZGAA 1QHGA 5DXAA 3Q1KA 5EMJA 3TLAA 5BUSA 4I5DA 4C21A 2VAMA 2FWJA 4WCFC 1JJ7A 3K35A 2V3WA 3UMBA 3QLVC 2R79A 1CK4A 5G02A 1GVNB 3NHRA 4IMJB 4F2WA 3FTFA 1BDBA 1P61B 3WRYC 4GSYA 1RRPA 4YMUA 4NVRA 4PLFA 4EQ6A 4TM7A 4BS9A 3H9QA 2FR8C 3W2HA 5LJIA 1RWNA 1ZESA 3A36A 4RPIA 4P7JA 4EPYA 2W2MA 1LUAA 1P31A 2P5UA 2WIKA 3D5QA 4RF4A 1Z47A 4ENVA 1P1KA 2AD1A 2I29A 3COZA 3MPUA 4OHVA 5L7WA 2ZDQA 3OI7A 2ZJ6A 4FTWA 4EEXA 4QNNA 1XRMA 1PL7A 1UEXC 4ROSA 4EZIA 3Q5EA 4TUYA 4E5VA 3NHMA 1OFIA 3AVYA 3AF0A 4L9AA 1CRQA 2OVFA 2DKNA 1Z5NA 1MJGM 2VOEA 4BGUA 5IEBA 4CQMD 1W47A 2IUFA 1BEZA 1TZ2A 1UBMS 4J0GA 1QWOA 4EQ6B 4OYRA 1RLOA 4BNZA 4J3NA 1HDZA 3PBKA 1LF5A 1XG5A 1QYXA 3DBOB 3IAM6 3N6VA 3ROKA 3RTCA 3GU3A 3FCYA 3SE0A 5AOVA 2ES4A 1NLFA 4J0HA 3NBXX 4KFSA 4L5JA 5M7EA 5K4GA 5LDHA 2C0QA 2CDBA 3GWGA 4UU0A 3TTXA 3IO3A 4TUYB 2WU0A 3VM6A 2QT9A 3AQ4A 1NZJA 2ZU0C 4TMXA 1CZNA 3B89A 2IDZA 2SNIE 4KUHA 3TZKA 3WLEA 5EJ6A 4D8XA 1PR0A 4O2BF 3U40A 5EIBD 4M1QA 4ILKA 5GJBA 4GX0A 2DB3A 4GNRA 3C16C 3GRRA 4L8FA 4X54A 2V4ZA 5HYVA 1PJRA 4L3WA 2FG6C 4MV0A 4GPD1 2WSBA 2PH5A 5JWHA 1PYGA 3HKEB 1XYVA 2PL5A 2H57A 2FGKA 1S2LA 4LRQA 4X8HA 5AVRA 1RRKA 4YJFA 5FJJA 2YIMA 2I6UA 3R40A 2QTTA 4BJ3A 4Y9SA 2PT9A 1A5BB 3M2PA 4RADA 5DULA 3WGJA 1HOTA 7REQA 3LFHA 1DBRA 2G1AA 4TXJA 1CG6A 1SPBS 3TTTA 2HCJB 4O1HA 4TQUS 1C1HA 1OHHD 3CLSC 3EFEA 4WZAA 1A5SB 4NAHA 1UZAA 2BGIA 4FD3A 4P2GA 5BN4A 3F90A 1E62A 2BFPA 4PGHA 3QLEA 2FE4A 3ZLTA 4DLRA 1VM6A 2VHQA 1X7ZA 2B9EA 1AK2A 2XGGA 3E22A 4P1ZA 1S2IA 3PFCA 1KQOA 1NHWA 4YJFB 5F7XA 2J0UA 1AM4D 3DZ8A 5I8PA 2IZ7A 4XQCA 4ZKEA 3W5HA 4DQDA 2KE5A 7REQB 5IG2A 2CLOB 3DDNA 4GLJA 3FNFA 4HNTA 3F3KA 2Z9CA 2YUIA 1NVEA 2ZDGA 4WZAB 5J58A 1F8GA 2ODNA 3QHQA 5JSHA 7YASA 4TYQA 3GGDA 1EFTA 3HRKA 1LZLA 4UDNA 2HLHA 3NAZA 1YDFA 2IL1A 4K9SA 4MGHA 1FRFS 4WA7A 1X7ZB 1DQNA 5ETJA 1WAMA 1LSOA 2WNHA 2I7VA 3FZQA 3E22B 3L6OO 4HADA 4OU5A 4RVOA 2DR2A 3COWA 4AYWA 1DV1A 2J0UB 1G3IA 1YBAA 1ZLYA 4DAOA 1F4PA 1FLVA 2OLEA 3UG6A 1G20B 1L3IA 2WD7A 3VC7A 1NE2A 3B7PA 4GOJA 1KO8A 1QQAA 3HLKA 1U0RA 4O4HA 4FS3A 1CY0A 1OW3B 1ES9A 1VIVA 4HQFA 3ZZ1A 2B2NA 4I14A 4MYUA 3TVTA 1XI2A 4E88A 1EJ0A 1K8ZB 2Y1GA 1E20A 1Z2OX 1JR3D 3QA9A 3BBPA 2E1PA 4F4UA 3ISVA 1EWQA 3WK7A 3N2NA 5C8DA 3PUWA 4IFIA 4MXDA 9GPBA 4DR2B 1DE0A 3VX3A 2RJ3A 4QLAA 4R40A 3AYXB 4BTLA 3OZGA 5KBYA 4JI7B 2LVBA 3CLRD 3G1UA 3PFBA 3CH6A 2WD7B 4C14A 3PD1A 3OM0A 3PEVA 5I4BA 2EOAA 4LDRA 2WHYA 1DBSA 3FSJX 4G0NA 1H22A 2G7MC 2VWPA 3EB9A 4O4HB 4YRAA 5AW5A 5KYKA 2OOSA 3ZW9A 2OHHA 4LNHA 5EHQA 1U1GA 2ONYA 1GUZA 4V02A 1XZIA 2XD9A 4B3GA 1XJWA 3IUQA 3P0IA 1AQYA 1B0UA 4C0KA 4RE5A 4MUIA 1HI9A 5AESA 2ATIA 4F3NA 1FFAA 1S9HA 1GNLA 4J7XA 2P3OA 2W8ZA 3T3NA 5KIAA 4LZWA 2A1TS 3GMIA 3TSOA 1GAWA 3ZEAA 4BAZA 5LC1A 5T8KA 3UHOA 4H0CA 4L9RA 5IAKA 1FTYA 2H11A 1YWGO 4YRBA 1PG0A 4XGQA 1E7WA 1XLVA 2BVNA 2DOKA 2I6GA 1YQWA 5BV1A 5KU7A 3LUJA 5L3QA 1NVUQ 2JIZA 4JLNA 3N0TA 2YYZA 2GFQA 1WW8A 3ETLA 2VWQA 3RC8A 6AT1A 4DDVA 1BU5A 4NCIA 3G8YA 3D7KA 3CONA 2P6NA 4TLCA 2B0JA 3BL6A 4FOTA 2ZATA 1KY2A 1N3LA 1P6UA 1QVRA 1RBMA 2ZJ3A 4PZPA 1KMNA 1E69A 1YB5A 4KSBA 4KWTA 2I1VB 2EKDA 2W37A 2ZWPA 1XTZA 3EHDA 5FOUA 1P62B 2II6A 2G07A 3OD1A 3QIVA 1QF9A 1DKMA 2GPNA 4WPGA 4RU1A 1N5RA 3A1WA 3CF4G 3RSGA 4YUAA 5JVDF 3DQQA 3KQQA 5U4QA 1B76A 5L3QB 3ASVA 3T5TA 3AVXA 1YZGA 1HH4A 1WDMA 3E48A 4QIHA 5HF6A 5M5BA 3F9IA 1GPDG 2VJAA 4LGYA 1D6SA 4E5KA 4OHWA 1PU2A 4N6GA 4EEKA 6PFKA 4NONA 5C8YA 4BYGA 1O94D 2B0CA 1IJFA 4Q5IA 4PYRA 3ONNA 2GPJA 1EVKA 1TW3A 4GW3A 1Z6GA 3GX1A 2ZULA 1QZUA 3R6LA 4QTZA 4PXAA 4BKOA 4DREA 1QZ3A 5F3DA 3F5FA 2V59A 2V6MA 3EA4A 3QBJA 2VI5A 1IOVA 1OKKA 1KAMA 4Q00A 3SU8A 1WMBA 4YMLA 3JWPA 3UBMA 5F2NA 4MV9A 2OGTA 3OEED 1MP0A 3S2UA 5JNWA 2WP0A 1R6DA 2IXGA 3B51X 1YRHA 3O7MA 4G1EB 4M8IA 3T0IA 2G6BA 2A0KA 2O6HA 3E9QA 3WNQA 5JDCA 1SUBA 3CRVA 5C8YB 4WFIA 4EAQA 1XXLA 2P67A 2VF5X 1R0ZA 1DC8A 3NDJA 4H4EA 3OU7A 1E9BA 4CDNA 1MEEA 2BRUC 1SKBA 2XTMA 4PN7A 5HCUA 2PSFA 1R6AA 4YI5A 4LDQA 3A4VA 3LAWA 4P5EA 2QOEA 5LZ5A 1ECFA 3BL8A 3P97A 4I9HA 1NAIA 3IQZA 1NLZA 2PQ2A 4GU5A 3TG2A 1AVTA 1XE3A 2RI6A 1ZBDA 1MFPA 2WTXA 4FOOA 4ZQEA 4R8LA 3BJZA 3EZLA 3OECA 3G9TA 5LDDC 3EEQA 3GGGA 5LZ2A 5DCWA 4YCMA 5C53B 2CLKB 3UT6A 4JROA 2VNSA 4EL0A 2JFHA 1ISRA 4GXTA 1GZ6A 1QIIA 4LJ8A 4JV5B 3LBAA 2AUNA 5DMXA 5THXA 3IUNA 4PS0A 1PFGA 1U8UA 4AJLA 4Q48A 2WKQA 3SFZA 4YNBA 1KZ1A 2EYQA 3TQRA 5J4HA 4A2QA 3B3AA 2PX8A 2ZUEA 2IXTA 4UHJA 3OM8A 2G08A 1X9HA 1BRTA 3V2GA 1H65A 4PZUA 4UU7A 1QTQA 1ODIA 3QX3A 2HRCA 4XEHA 4ZCRA 1MV8A 3OF2A 2OCKA 3OEWA 1YSCA 1DO0A 2QX4A 3DWFA 3WMRA 1EG2A 5KSWB 2CNNA 3DM9B 2I9PA 4TRMA 1UZLA 4PRYA 2CYAA 5K4HA 4NY1A 4LMPA 1QSGA 4RK7A 4FE4A 3LKVA 1E5QA 3NOOA 4KRFA 4BU1A 1SIUA 3HV0A 2PWAA 3WJAA 2XXJA 3NDIA 5JO9A 1CDEA 1Y9ZA 3DAYA 5EHXA 1SVLA 2O3QA 4TT3A 3IDQA 1HURA 1Q0TA 2H8GA 3C3WA 1YZLA 1E6WA 2QVGA 4G0ZA 2PUVA 4JBLA 4JWTA 4GIBA 4E2FA 2ONZA 1OAAA 1CIJA 1CQPA 1MW9X 3JYPA 4IKEA 4ROTA 5A3SA 1Y81A 4H1UA 5KI6A 4LNAA 3WHIA 1YZ3A 2FAXA 1C0EA 3GGPA 1E0JA 4RY2A 4D4HA 5BQ3A 5EJ4A 3BIXA 3CV3A 5J1TB 1MW8X 2YZKA 4P38A 3E03A 1AQIA 3IXLA 4B7CA 3OSZA 2P2YA 3CQ9A 2CNWD 2QIPA 4Y67A 3W2IA 1E60A 1WSAA 2VT2A 3FZEA 1Q0LA 1W85B 3VPAA 2CK3D 3RIEA 5K0TA 1Y3FE 2SCUA 5IZCC 1EWTA 3PC8C 2BR5A 2OZKA 1ECPA 2C5AA 3DFMA 1MIOA 4LW8A 3IQDB 5JH7A 4CIWA 1JYFA 1H1DA 1MVLA 3LD9A 1TQ4A 3DV2A 1IG3A 2X6RA 3DLBA 3LV8A 4HAXA 4HB3A 2DTXA 2DR0A 2V7QA 1JG2A 1VPEA 1UDCA 3CX6A 4NNPA 3SC3A 1U8AA 3WLSA 2FG5A 1OBVA 1IWBB 2SCUB 3L8YA 3NC4A 4FZJA 4QNMA 2YN4A 4J7UA 2P2DA 3TSWA 2DH6A 4UNSA 4QM6A 3LHSA 4JENA 1Q15A 1XQ1A 3FMOB 3VPHA 4DMUB 1Z82A 5CVJA 2HXSA 5JH7B 2FUNB 4KNWA 2BTEA 4BKPA 1ABEA 5E8JA 3MRVA 4EO4A 1V48A 2CXRA 4L4SA 3KU4A 4BMXA 5LR6A 3H2GA 3OQNA 3C7KA 1ETUA 3IJ5A 2UKDA 1NT4A 3PJDA 2H7VA 4W4TA 1HXHA 4KQIA 1DKNA 3GD5A 3NKVA 4TKVA 4R01A 2IP2A 4W9RA 3AFGA 1OZAA 3ZHXA 2XBUA 5AM1A 4DA8A 3GLIE 1MOPA 2SKEA 1HR0B 4M83A 1CQZA 3RROA 4UCFA 2DKOA 4N3AA 2WIGA 5EMMA 4A03A 5JEDA 1RMYA 1X1TA 3FNQA 4RPHA 4LQ4A 3ESDA 3GF4A 1IN4A 3TIVA 4QU8A 2R00C 4OYLA 4URFA 1R12A 2YIVX 5IXJA 3HU2A 1RWBA 4Z3OA 3SC6A 2E1RA 3UGTA 2CXPA 5T8KC 4PSCA 4JUIA 1X8LA 3DZIA 2O5CA 2ORVA 1LPBB 1SVMA 1R4ZA 5KTPA 5C5CA 3DMPA 3I4LA 2FPPA 5ADWA 4TKVB 3A1NA 3HN7A 1DFHA 1QH9A 2PL9A 3L0ZA 5E8RA 2GEDA 4DC1A 5KYWA 2X41A 4HNAA 5E7MA 3OJEA 1ULAA 2J3EA 1OXTA 3UH1A 2P4HX 3MWFA 2ID8A 1L4HA 3NALA 3HB4X 3D8UA 3OX2A 3LP5A 5AJTA 3LYAA 4UTOA 4EA6A 2HU8A 4GS5A 2EG9A 2GCOA 5HHTA 4C5BA 4B1FA 5A0VA 5G3YA 3K53A 4RV4A 1YL6A 4FHZA 4MDHA 1Z5UA 2XOKD 3QWIA 4PZCA 4QU9A 5EZ6B 4Z4CA 2FPPB 2C5GA 2YFQA 3CUUA 3JQQA 3A2LA 2Q41A 5HFNA 2E4YA 3A05A 3OJFA 4R1OA 4X3CA 4CIXA 1HEUA 3AHEA 4LOJA 3OVMA 1ZW1A 3VX4A 3G6WA 4CT5A 2C0PA 2P4QA 1DAHA 2WD9A 3C74A 3I04A 4N3CA 1YVDA 1PQWA 3NNSA 4WOBA 5D7BA 8OHMA 3DLTA 2BWJA 2GCOB 1JQBA 3H16A 1EFCA 4HWKA 1SCNE 5TB5A 2NVBA 2DBRA 2HCRA 5ALKA 1JA1A 5HRCA 2FPOA 4Q9DA 2ZQYA 4EJFA 5IX8A 3BH7A 1OAOA 1P7ZA 4W6ZA 4DCCA 5IWCA 1B42A 4J4HA 4NXMB 1E6UA 5JDCC 1JX6A 2GJKA 1USIA 5JXHA 4DDHA 5F7OA 3MILA 2R1VA 2ZRKA 4ITUA 4G24A 4KR7A 3CCFA 4GPIB 3DMGA 2PL3A 4JJKA 5ARCA 1LBTA 3D4LA 3KUXA 2OYCA 4UTNA 4ARIA 4IJQA 3RS2A 2V55B 2VRCD 4B5KA 3RTAA 1RM0A 2V6BA 3LL7A 2PY6A 2AI1A 2REBA 3VVLA 3T4EA 1TD9A 2RI0A 1DINA 1GPKA 5HIJA 5CW2A 3RSCA 3AU8A 3P7MA 4OSPA 1H1LA 2YHIA 4IWYA 3IL2A 3X1ZA 4G1CA 3FFTA 4G5RA 3CZQA 5IXYA 1Y1SA 4AC9A 4YP9A 1QQBA 1FFCA 1HTTA 3EQ6A 4XTCS 4G65A 4ZVPA 2I78A 3IKVA 4N7MA 3Q8LA 1R50A 4BLOA 2CHFA 2VNIA 1KZ4A 1D8TA 4PSUA 4A1OA 4BMPB 3I5UA 4C76A 2OB1A 4DYVA 4AJ4A 5JWRA 3UJNA 3JQFA 2OA0A 5AVUA 1GSAA 1S8FA 1U31A 1H1LB 2YHIB 3A27A 2V0NA 4XM0A 3C6YA 3KKZA 2J7KA 2C42A 3Q3VA 4CN9A 5B4VA 1POXA 3EEIA 3OLCX 3WMFA 4WKGA 1J70A 2HNAA 3OZAA 3W7VA 3BH6A 2IEDA 4CR6A 1G17A 1W30A 2BHSA 2QZ9A 1GTL1 1JSRA 1N6PA 2AX3A 3N58A 4E6PA 1RYDA 2XWBF 3EPHA 2HLDA 4QVKA 1PBTA 1QLJA 3VISA 4GAEA 1YQUA 1NZDA 2EARA 4LDPA 3ZD8A 1L5KA 1X9IA 1O5OA 1JE1A 2BP7A 2WPDD 4KFCA 2C8KA 4FQ8A 4JA0A 5IJAA 3WSTA 5FHQA 4TXNA 2WF8A 4EG1A 2G9ZA 4PIVA 2L2QA 3UWSA 5LZ9A 1EDDA 3QYAA 1P4GA 1WLSA 4PFQA 2B99A 3IQGX 5GADl 4HBZA 3F8TA 4R2XA 2P30A 1JZSA 3KD3A 4YDQA 3K70B 1CLEA 2HC9A 2GZ1A 2J6BA 3PT9A 1DUVG 4ZN6A 3Q10A 1YBFA 2OHOA 4ND5A 5AKIA 1HKHA 2C2OA 4EPXA 1X42A 3LMKA 3VVBA 5JMOA 1KO5A 1XELA 4U6QA 4P7BA 4UQLA 4IIXA 2CBXA 3OPXA 4C4YA 3A3OA 4EKGA 2DWQA 2IWRA 2HMAA 2QHXA 2IE8A 4W7SA 4LF5B 1LSJA 4Q0MA 3GLUA 3DEJA 2Z2ZA 2GO7A 4Z3KA 1N2JA 4B4UA 1N5IA 5IJWA 1UBEA 1YQQA 3ERCA 4NOJA 3GH1A 3U9TA 3OZVA 2AD5A 3CNEA 3V6LA 1DXOA 1XD8A 4AJHA 4RUKA 2Q2VA 4GBGA 4TV8F 5LBIA 4EGJA 3JQDA 4XDYA 2WUGA 3MCUA 5K0ZA 4I0WB 4DJ5X 1G8MA 3Q8WA 1XWFA 1F1BA 2F3RA 5BT8A 1KSJA 1DG9A 1EKXA 1TYBE 2FX5A 2P75A 3KJIA 4K9LA 4L15A 4D9IA 1RPZA 1IRXA 1SD1A 4H0FA 3GLGE 4HS4A 1J8MF 3H2KA 2FH5B 1OZHA 3G5UA 5B2FA 3TLEA 1YC2A 5F1KA 3PDIA 1T43A 3KQUA 1VJRA 4ZVKA 3Q3JB 3RNOA 3WAKA 5DM0A 4ED9A 3TJZA 2YKGA 3MA0A 2IEIA 3IUJA 1Z4NA 1RDFA 1CY6A 2FZ5A 3ILHA 2EL9A 3UA4A 4HGQA 4E7OA 5BYBA 3AZOA 3QEBZ 4YDRA 1GTVA 4Q16A 1DOHA 4CLRA 4NZPA 1RAIA 2OORA 3MLAA 3EODA 1FIUA 4B71A 1AB6A 2RK3A 2R8ZA 7GPBA 5C8VA 2QZSA 2X0IA 4P2BA 2IYLD 4O5AA 4CM4A 1CEYA 3ETGA 3AOEC 4TTRA 1BQ4A 3PDIB 1DB3A 1O1YA 1ZITA 1DU4A 2DQYA 2PTGA 4LJ5A 4OJNA 3V46A 1CJKC 2J6IA 2JGFA 2Y1OA 5CTJA 3AHJA 3DP9A 3GPCA 3AK4A 3TTSA 4WUTA 2XCSB 5CK5A 1UBUS 3RU3A 1E6CA 3D6TB 5K3EA 5IH7A 4CLRB 5J2UA 5ARBA 3KZOA 3I30X 4GXQA 5ERXA 2PZEA 3FAKA 4MGEA 4CFZA 3F1KA 2O5RA 4L5IA 2BEUA 4BO6A 2ECOA 4CM4B 1K86A 2RJNA 5L95A 1NXWA 1R5NA 3L7JA 4ES6A 2HPVA 5T4EA 3TH5A 3T94A 2PKEA 4RS3A 4J43A 4OHYA 2P0YA 4Y1FA 1GQ2A 4Q1AA 4LQCA 2R6FA 2WYWA 4W8GA 1MX3A 4INZA 4LC1A 4ZP1A 5B3KA 5CFMA 1SCBA 1MB4A 1AS2A 4X6XA 3M1AA 3NGLA 1E77A 2RH9B 2WJHA 4RIEA 1ADBA 3A25A 1DXQA 1AGXA 1TO2E 2OVBA 2V6IA 3PF9A 5J2UB 2HDWA 4FZVA 4N12A 1NQWA 4BEBA 3VHRA 3F49S 3H0EA 3JQ7A 3T1HB 1OE0A 2J0VA 1MB9A 1ZH6A 4IHQA 5M3BA 3PC4A 2QTMA 3GROA 2XGJA 4NXNB 1QQ7A 1RC8A 4BX2A 1GY8A 1HLGA 2YZ2A 4HFNA 1RVDA 2XB4A 4R9VA 3WV5A 4JGIA 1O03A 4AT1A 3KZCA 4PN3A 2ZPUA 2AKAB 4MS4A 4LFAB 2IUSA 1OAOC 3JQ8B 5F77A 4C3OB 3PGA1 4TWRA 3VNRA 1EJ6A 4LY3A 5G0SA 2B6HA 1YQ9A 3E2PA 1B0ZA 4BTVA 5JCPA 1GXSB 1KXZA 2YZGA 3WGZA 3WHKA 1VTKA 5ICCA 1LKZA 1CLUA 1OPXA 3TNFA 5A5DA 3QVUA 1X86B 5HUHA 3JQ7B 1E1DA 3QU5A 5AVOA 2VPTA 3QV1A 4K6OA 5E3IA 3QWFA 4YP1A 4YFVA 1WIWA 3WHLA 5HS4A 1N6HA 5ED4A 2J9RA 2WB4A 2ATVA 2PKQP 1A7UA 1U7XA 4OXXA 1ULBA 4XOIA 3UXHA 4YHHB 2QVXX 4MS4B 4I7EA 4K9PA 4XVQA 3AJEA 1Q7GA 4ALNA 4KGVA 3JCZA 3M6FA 4HYYA 3LDHA 4HLNA 2G36A 2F8MA 4HQKA 1HFWA 2AG0A 5D2CA 4FOLA 3FIUA 4UD2A 2VDLB 3LTEA 1HC7A 1P6XA 1YB2A 2H4HA 4QOFA 5ALHA 3RFVA 4P9NA 4KXUA 5GZ3A 3FWPA 3SR4A 3FTEA 3R3XA 4PANA 4IGIA 1P0FA 3NZEA 3CZ4A 5C2JB 5EEHA 1P1JA 4KQCA 2V5VA 2HRBA 2VEDA 3JQFC 5TE9A 1QRDA 1YACA 4F3RA 1RABA 2W43A 4HDQB 1H2BA 1DPFA 3DVSX 3LC2O 2F1OA 1A77A 3V97A 1U8FO 3ZE8A 5JCZA 4PU0A 1E1QD 3MRTA 4CN8A 1G3MA 1RQNA 3CLTD 4WY2A 5LLDA 3K70C 5IT0A 5CB6A 2NO1A 5AKZA 1P5HA 3L8CA 4FILA 4PLHA 5EPUA 5LFAA 5C8XA 5F9MA 3G2MA 3O8OA 2OEPA 2Z8YA 4LISA 5J1SB 1Y5LA 3D3EA 4RMJA 1M6WA 4HNQA 2EG5A 2HQ1A 2C57A 3TQHA 3LHIA 3IPYA 4RH3A 2XA9A 1C7EA 5EUMA 1CU1A 3E05A 2ERXA 2Q1WA 3LOQA 3ZNNA 5DBOA 1JQKA 1RKBA 1Y6ZA 3JV7A 1U2QA 3ESQA 1QFMA 1M8GA 1ACMA 2FUKA 3K0FA 4RAQA 2QRHA 5FOWA 5HW0A 3QG5A 2XUGA 4QUEA 3BSWA 3MWYW 4OBBA 3OMWA 3UTCA 4NU8X 3O8OB 4NL4H 1OOEA 1QZTA 2V8OA 1KVUA 4FZRA 5AJXA 4OI1A 5I7EA 3PRKE 1WCYA 1UXHA 4ZCPA 4BNUA 4RK4A 1SXJA 2ICAA 1HX7A 4MVJH 1NE7A 1JDUA 1UC9A 3IJEB 2AMFA 1DRKA 2HTFA 2QUAA 6ADHA 3UY4A 4LI3X 3ANNA 2F1JA 2PAAA 5CITA 1HDEA 1B73A 4RNCA 4X1YA 4LGVA 3SWWA 3FCAA 3B1JA 2AYYA 4PFKA 3K0FB 4W7IA 1F06A 5HE9A 4ZCSA 4GI2A 4LTMA 2FXIA 3FOCA 3HHEA 2H92A 1QGOA 3FKSD 4EFLA 1ISPA 1PZFA 4S12A 4ZYTA 1KY3A 1L5HA 2RGAA 1XJ0A 4AXBA 5JSQA 1BOOA 4TS9A 4P84A 4WHMA 1UPUA 3T7IA 4C2TA 2EZ8A 4NH0A 1SXJB 1YCDA 2VJOA 2YASA 1I1HA 4JJ7A 5I47A 3F5SA 3F8SA 3DMHA 5ANRB 3ZYCA 2XCRB 3X43A 4J0KA 3WKBA 5I7RA 5CEEA 1QYWA 1XB2A 3KALA 2V45A 4MWSA 4PGGA 1VRVA 4X1YB 5GONA 1GIAA 3EAFA 1DRVA 3UMFA 1BAPA 1XTBA 2GS9A 4TLAA 4HAWA 4QJ5A 4G5HA 2IXFA 3ESAA 4XSVA 3IHTA 4YGYA 1L5VA 2VDKB 1H66A 3EZ9A 5LMUB 4ETMA 3FWKA 1L5HB 1Y9JA 1N2EA 1Y6QA 2OXEA 5D1NA 4DPMA 3H2IA 3DLAA 4R7ZA 3EGIA 4UZEA 3W90A 3HN6A 2FTKE 4YTEA 3RJMA 3CCCA 3OOSA 4JYBA 3QPUA 3PVCA 1XTKA 1Z13A 3C0KA 3K9QO 3ZZUA 3L7CA 4FGLA 4IFBA 4ISCA 4DLXA 1BH6A 1T1RA 3VKVA 5GONB 3KWMA 6REQA 4KE6A 2QDKA 1U0FA 1XEWY 4ENRA 1A7AA 2GXSA 2PX5A 1E9AA 1G63A 4CM5A 5C4MA 5JNLA 3USES 5B1IA 4HAOA 1L9XA 3UIEA 4ENWA 2QLMA 3F4BA 4KLAA 3BQNB 1X7YB 1I4EB 4ZU1X 1KDVA 4CM9A 1V8DA 4N82A 3PVZA 5FOVA 1ZH8A 2ZRJA 4NBVA 1T4CA 2PYIA 2FSSA 4ITVA 2J33A 4S35A 3F9RA 1RZ3A 4ZYUA 1G60A 1WB6A 1WZCA 3DOFA 2ZWAA 3EXHA 4J2HA 4IRXA 6REQB 5FOXA 2NZYA 4MTCA 1NQVA 3OFJA 5DNAA 2D59A 3U7HB 3KYJB 2ZJ7A 3IB3A 2QVCA 1XRQA 3IAXA 3X2SA 1E98A 1OX6A 1GPAA 3QKSA 3CRZA 3DHNA 5A4DA 3R0QA 2W70A 3GIDA 4C6TA 3VA7A 1J49A 2D2XA 4COKA 1UPAA 3E81A 1NQAO 2ZRHA 4XGKA 5MHTA 2W4IA 1EXWA 2E5WA 1VLJA 3ANTA 3NXKA 3W5DA 2QJWA 1T4CB 2Z58A 4OYHA 5BYKA 2VHVA 4K0KB 2HI0A 1W5SA 1RI1A 1XL0A 2YIJA 3HMQA 3HP4A 3EXHB 3KE9A 1GPYA 1XJ5A 4HAUA 3HXOA 1MRNA 2FOLA 2QP9X 2XVMA 4ADSG 5JYEA 1H2RS 1TZBA 5J3JA 1GFSA 2CLFB 1GGEA 3C39A 3QLJA 3OAAD 2VPXA 4PPQA 2EP8A 2DHQA 3QKSB 5K3CA 4AF6A 4WUVA 2HFKA 4XD7A 4XUEA 5IZ4A 4C6TB 3UZUA 1D9ZA 2R6HA 1ZVJA 3F8WA 3B78A 2GI4A 3RE1A 3U49A 2X22A 2EP7A 3GY0A 2VJCA 4QPCA 3ZV6A 2H1WA 4C1NA 3QHPA 2Z43A 2B2XA 2RBEA 5ITVA 4FXPA 2AZTA 3CF4A 4FEYA 2WU1A 1L4FA 5AK0A 2B34A 2O2CA 2X0FA 1XQYA 1D7AA 3IAUA 4EO9A 1OT3A 4O2RA 1KSGA 2QBYB 2LXNA 4AROA 1WB4A 3TKAA 2PMKA 2VNAA 1J9ZA 1JEEA 4L5CA 1QOQB 1UAYA 5CXXA 2VRBA 3GUZA 5L51A 3IEKA 3FHCB 2XX3A 3ENZA 4X1OA 1V3UA 3Q2KA 3BSYA 1QIFA 3SR3A 2HCFA 2G5CA 3I01A 5KJCA 2EKBA 1JEYA 4R1PA 2Z4SA 4UUOA 5DHFA 5CH5A 1VE3A 2DERA 2G0AA 4HC4A 1GRQA 1P9RA 2IF0A 3OE1A 3HYLA 4I1UA 4FWBA 3B8EA 2ZE7A 2B3TA 3ENVA 1DAEA 4JVSB 3EA5A 1M83A 3OTGA 4DJEC 1XRPA 4D44A 1XZFA 2NUPA 4UBMA 4UUQA 2OBMA 3SXPA 4EG6A 3PPYA 3LL4A 3E7FA 1RXCA 1Z34A 2OV8A 2YHSA 4Q1CA 1QF6A 2B21A 1X74A 3OCCA 5FLKA 5C4GB 3ITKA 4F3YA 2JIQA 2VHWA 3NIBA 1MEOA 4RDCA 2DE0X 4N47A 2G5GX 1JEYB 1NIJA 4B79A 1DEKA 1DUIA 3P2MA 1DEXA 3GH3A 1LI4A 3F5MA 3K20A 2ZVJA 1RRMA 2HRZA 2LD4A 1NN1A 1W2GA 1EFKA 3DHWC 1ADCA 3NVDA 2GKSA 2H1CA 3ZCQA 3V1LA 1O6ZA 1D1SA 3SQWA 3L4SO 1NY6A 1U9IA 5IKMA 2ECFA 4LRXA 2D7JA 3D02A 1HT2E 3LDAA 1W6UA 1J7KA 2NUPB 2XI4A 3SHOA 4CDGA 4EFMA 3ISJA 5THQA 2QXYA 1IIRA 2P6UA 3ED1A 3P9XA 2ZSIA 1OU4A 3JRNA 2QE6A 1SC6A 4HP8A 1RI2A 4YRIA 2NV2B 4FSDA 1PZEA 2LKDA 2WZCA 5BN5A 2JGAA 1JBQA 1Z8NA 4L6IA 3ZWAA 4BO1A 2NSYA 2PE5A 1AX9A 2VUUA 1WNFA 1R00A 1EYZA 1DWOA 3NATA 1XCPA 1SXJC 1Z06A 1AV6A 2FOIA 4CKWB 1Z73A 3FTQA 5JTUA 1L7QA 3GRCA 1K6JA 1UBSB 1D1TA 3C5EA 3KQPA 1Z6YA 3GUUA 3IR7A 4WFJA 1F2DA 3I39X 2P35A 1TVCA 4JL8A 2NM0A 3JZIA 1OTXA 4NPHA 2QRLA 1TA4A 4TWIA 2LCQA 5BOSA 5FBVB 3KT3A 4KK4A 3F7OA 4NICA 2O59A 1QC5A 2PRSA 1YR3A 2O2SA 1FL9A 3D6MA 3IEUA 2JGNA 4P3PA 3KEGA 5EQJB 5TV2A 4FSHA 3QFTA 4HFRA 2FZWA 4LNUA 3K71B 3ABIA 1WXHA 3UKJA 3TR0A 3BULA 2OQRA 3WLKX 1II8A 2CYCA 5FDFA 3E3MA 2QAIA 3KOOA 1OGJA 2XVXA 1PV1A 1YXMA 4FPXA 4OREX 1P7CA 5BOSB 4RTQA 5TJHA 1PEDA 3GVIA 4R83A 3V7NA 1QYCA 2O5EA 1QC5B 1R0XA 1QX3A 3UAOA 2PMBA 2AUMA 2R86A 3AIOA 3ZLBA 3CY6A 3MTJA 4C08A 4UTZA 4XX0A 4TS3A 4OQNA 4DXAA 4DHEA 2JFPA 4LNUB 5JD3A 1BXKA 2FEWB 2HEGA 2Q50A 2H1LA 3WIEA 2RH8A 3TRIA 1II8B 3VTAA 5CVEA 1XDWA 1T4BA 4ZT6A 1UMDA 5C5IA 1WSBA 2V4UA 1U8CB 1WF3A 1XU4A 4GDMA 3TD2A 2WAOA 4KQMA 3TD9A 5HKBA 3THXA 4NG4A 3A0UA 2V7PA 2C58A 4PLZA 4AN0A 2J3LA 1CZHA 1RD4A 2VXCA 3NTRA 1E5VA 2X19A 3GEHA 2V98A 1L4NA 1TECE 2WBLC 1WXQA 3DCYA 4YBRA 3WWYA 4CTKA 2ZP1A 2N1BA 3JWGA 4XX0B 3A10A 3HDHA 1CQJA 2REXB 4E09A 3THWB 4CG0A 1PGNA 4B6RA 4CQMA 2TYSB 3EXHC 2VHZA 4TPKA 5K3SA 1TTTA 1OI3A 2WILA 5HX7A 1V1JA 1T9GS 2JZNA 1GT91 1UMDB 3JAWA 5CXSA 4DDWA 2I8LA 4FYPA 4YECA 5J63A 4R0VA 2J46A 4MAMA 2ON6A 2OL4A 4RVUA 4RDXA 2NSDA 3THXB 3B9RA 1GTSA 4JL5A 5FB3A 5CH8A 1LC0A 4JT8A 2JD2A 3USZA 3DDWA 3M6UA 4FC7A 3LXXA 4INJA 5T4HA 4HLUA 3SQLA 4RESA 1W1IA 1KZ9A 4KO4S 3VU8A 1U2PA 1PNOA 1ZSVA 4GVPA 3RNLA 1AXGA 1CFZA 1FTSA 3KKEA 1NBHA 3QM1A 1G3UA 4RGQA 4CQMB 3NYIA 4OI2A 2KLHA 4QPJC 3THRA 2JAPA 3GEGA 1A7KA 3LP6A 1XU7A 3QMMA 3A1SA 1VMAA 5C7LO 4YJ3A 4OK3A 4CQJA 4ZIRA 5BVGA 5AW7A 1CUEA 4HQ6A 5ESWA 2L42A 2CNKA 3OM9A 5H5JA 2QKYA 3EXAA 4EZEA 4FM9A 4HEA1 3ZWDA 5LIPA 3PCRB 3CVVA 3VO8A 4BFVA 3EIHA 1VA4A 3SXUA 4IJ5A 1FFEA 1Y8CA 1M7BA 2IHTA 3BIOA 5B3AA 3EPRA 4EF4A 1HZZC 2TMKA 3QGMA 3H6GA 2NU6A 4ZC8A 1VE5A 2YMMA 4W7HA 4GKBA 1M2KA 1U3VA 1KH2A 3W05A 1BDHA 4AUMA 1ZHOA 1BOFA 4YJ3B 3AUJB 4ZIRB 5K01A 1P1RA 3OZBA 2NIPA 4KWEA 1GN8A 5BVGB 1M73E 1N6KA 2AVDA 2CSUA 1U7DA 2HIAA 3PB3A 4LXGA 4Q39A 1Z0KA 1M6EX 3IT3A 4E5YA 2UUAB 2BTQA 4HRXA 3ADCA 2MMGA 3WQBA 3CVUA 3PRHA 2BSQA 2G71A 2CMKA 2Z0MA 1NLMA 2HGSA 4RF2A 3SXUB 3UJ9A 3WRWA 4N7BA 1SNYA 3PWSA 3DE0X 5DGCA 4OA8A 3QF7A 2G25A 1Z68A 3AHFA 3QXGA 4BMDA 1A50B 1RM3A 5HKOA 2NU6B 2QUBA 2GK3A 2RGRA 4NESA 1PDVA 2ZI3A 3I4FA 4CG3A 1E6LA 2QD5A 3GN2A 3NR2A 3DVQX 3ZQJA 4CJXA 5LBUA 1IXYA 4NHEA 2H3HA 5KQMA 4I46A 4BN0A 2ZE6A 1Q95A 3ND5A 3BKXA 4FLMA 2BTQB