2R8ZA

Crystal structure of yrbi phosphatase from escherichia coli in complex with a phosphate and a calcium ion
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
181
structure length
181
Chain Sequence
LATCYGPVSADVMAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGYGIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKLDEAKGQSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tail of KdsC: CONFORMATIONAL CHANGES CONTROL THE ACTIVITY OF A HALOACID DEHALOGENASE SUPERFAMILY PHOSPHATASE.
pubmed doi rcsb
source organism Escherichia coli o6
molecule tags Hydrolase
molecule keywords 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
total genus 62
structure length 181
sequence length 181
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2r8zA00
2C9MA 5AKJA 4QJBA 1KYTA 2FI1A 1RPZA 1TE2A 4KYTA 4KNWA 4L57A 3J7TA 5ALRA 4XPZA 3U7EB 5AI8A 3BWVA 3MC1A 2YJ6A 2HDOA 1L8OA 2C88A 4CF5A 3DV9A 3M1YA 5AVXA 5ALMA 1RMYA 3FPSA 5AI4A 3L8HA 5A3QA 4RESA 2EAUA 2R8YA 4HGPA 5ALTA 4BEWA 4UMDA 3ZX4A 3KOOA 3ZVMA 1WPGA 3KZXA 1N8NA 4UM5A 3QXGA 3NUQA 4CF3A 1ZD2P 3QUCA 3ZWKA 2FUCA 1QQ6A 3L8FA 2P11A 3ZTYA 2B0CA 4I9FA 4UATA 1NRWA 3ZVLA 2RAVA 2BY4A 3HLTA 2G1AA 4KNVA 2PQ0A 3A3YA 3ESRA 5A3RA 4AS3A 1Q91A 2R8XA 3AR7A 1XP5A 2R8EA 3L7YA 4FE3A 1L7NA 3NALA 2MU1A 2IOHA 4UM7A 2C4NA 1ZD5A 5AVWA 4GXTA 5AVYA 1Z4NA 4ZEVA 2FPUA 2WF6A 4O8CA 3QU9A 5AI6A 2NYVA 4YIHA 4FFDA 3ZW7A 2ODAA 1YV9A 1LVHA 4JB3A 1ZRNA 2WF9A 3B9BA 5AVUA 1AQ6A 4Y2SA 2B82A 2HHLA 2HI0A 2WF8A 5AKGA 5ALHA 1S8OA 2MSNA 2O2XA 3RF6A 2ZBDA 1SU4A 2NO4A 3DDHA 3ED5A 2HCFA 4UU1A 5AM0A 1F5SA 2JARA 2OBBA 4J03A 1T9ZA 1XPJA 4F72A 2G07A 2YJ4A 3EPRA 3KDPA 3OCWA 2GMWA 4Y2XA 4DW8A 3FM9A 5IS2A 5IT0A 1QQ7A 1SWWA 1ZJJA 2Q4RA 3MPOA 2Q4TA 3W5BA 2ZBFA 3QUQA 2NO5A 4Y2PA 2O9JA 1RQLA 2FPRA 4JDPA 5ALGA 3I6BA 4Y3UA 4YCNA 4BNDA 2FDRA 2D2VA 2JAUA 5FP0A 2P27A 5ALLA 2C8KA 2HO4A 4Y2QA 3A1EA 5ALEA 4Y2JA 4E88A 2R8ZA 4UMVA 3KD3A 4L6AA 2JAOA 1VJRA 1U7OA 4MWOA 3WKEA 4RETA 4EENA 5AW6A 3L5KA 2OM6A 4UU0A 1TJ3A 5JJBA 2BDEA 5AVRA 3SKYA 3QNMA 2HSZA 3N07A 3DNPA 4HGRA 3QU2A 1XVIA 2G06A 2B8JA 2GHQA 3KC2A 4HGNA 2W11A 3U26A 1Z4MA 1YJ5A 2OA0A 4CNQA 4QQFA 2B1QA 1NF2A 5AK4A 1YDFA 4UMFA 5ALDA 2IOFK 3UM9A 4G63A 3W5DA 1YMQA 5AKYA 4HGOA 3EWIA 5AESA 2VKQA 3R4CA 1MH9A 4Y2VA 2AGVA 3I1YA 2W43A 4UW9A 2HF2A 2YN4A 3AR8A 5AM3A 2AMYA 1RQNA 5ALKA 3WGUA 3WK7A 3QUBA 2QYHA 1TJ4A 4GIBA 5ALPA 5AIAA 3RFUA 3EF1A 4XQ0A 4G9BA 4UMEA 3U13A 3K1ZA 4MUMA 4UARA 5AVQA 4EX6A 3E8MA 3OTQA 3N28A 3VAYA 4NV0A 2AUTA 3HYCA 1Y8AA 2YMMA 5ALUA 1X42A 1S2OA 5AK6A 4ZEWA 3F9RA 5AICA 5AVSA 5ALJA 1TA0A 2WF5A 2HX1A 2ZBGA 3L0CA 2IYEA 2IOFA 5AK3A 1LTQA 3ZUPA 5AKEA 3OCUA 3WKBA 2YMQA 2YFYA 3FGOA 2AH5A 3PDWA 5ALSA 2ZBEA 3QUTA 5AW3A 5AW0A 3QYPA 5AKHA 5AVTA 3M9LA 2Q5EA 3NAMA 2CFTA 3A1CA 2B8EA 4YH1A 2EATA 1QH9A 1L7MA 3ZX5A 4L6CA 2YJ3A 4XE5A 3NRJA 2I34A 4NABA 2FPXA 4BX2A 2CFRA 4KX5A 1VJ5A 4UASA 2PR7A 3E81A 3L8GA 2GFHA 3R09A 1QYIA 3L0YA 2FUEA 2G08A 3I28A 4BYGA 3WGVA 3QLEA 2ZOSA 1Z4IA 5ALYA 3WKCA 2CN1A 5ALWA 1L6RA 3UMBA 3PCTA 2YJ5A 1Z4OA 2DQSA 4BX3A 2I54A 1CR6A 3QGMA 4IG4A 1ZD4A 2B30A 3R9KA 1RDFA 1O03A 1ZOLA 1ZD3A 3L1UA 3QU5A 4I9GA 5AM1A 1RKVA 3B9RA 1YNSA 4YGYA 1Z88A 3AR5A 4F71A 1U02A 1RC8A 3U7FB 3ONNA 3SHQA 2RB5A 3WK5A 3IB6A 2OYCA 4NAVA 3SLRA 5ALFA 4C4SA 2JGAA 1YS9A 3WKDA 5IT4A 1N9KA 4AS2A 5AW5A 1K1EA 1Z4LA 1U2TA 1ZS9A 4EEKA 3OCYA 3L1VA 3N5KA 1SWVA 4UAUA 5AM5A 1Z4JA 5AI0A 1QQ5A 3ZWDA 3U7GA 2PKEA 2P9JA 2G09A 4IFTA 4YIKA 4HGQA 4C4RA 3SD7A 1O08A 2YMPA 1Z4PX 2G0AA 4CF4A 2JAWA 3E84A 2I7DA 2WFAA 1IWOA 3EF0A 3NIWA 2HEGA 3SKXA 5AW7A 3OCZA 1T5SA 1Z5GA 3OCVA 2CFSA 1J8DA 3U7HB 4J2TA 3AR9A 2P69A 1Z4QA 2GO7A 3U19A 1JUDA 3P96A 1CQZA 3QX7A 1RLTA 3UMCA 3N1UA 5AIBA 3CZ4A 5ALIA 5AI9A 3I76A 4CE6A 1EK2A 2QLTA 4KN8A 4YCLA 1U2SA 1RRCA 3W5AA 2I33A 2RBKA 1RMQA 4Y2YA 2FPSA 2WHEA 5ALQA 1WVIA 3AR2A 2FPWA 1VFPA 5AKZA 3QU4A 1RKUA 1RLMA 2W4MA 4DFDA 2ZG6A 5ALOA 2WF7A 2YY6A 3FVVA 5AKXA 1WZCA 4BEVA 4BNDB 4UAVA 4BBJA 5T41A 3WK8A 3ET5A 4EX7A 5AHXA 4NWIA 3CNHA 1U7PA 3OCXA 2YMLA 4KX3A 3PGVA 3NASA 2C8LA 4H1WA 4YCMA 5AW9A 1RMTA 3A1DA 4HAIA 5AVVA 4C4TA 5AW1A 5A3SA 4EELA 4BKMA 5AKKA 1T5TA 3L0BA 3D6JA 5AW4A 1WR8A 4FYPA 5AW8A 1Z4KA 4EZEA 3MMZA 4OFZA 4AP9A 4Y2UA 3WK4A 3E58A 4BX0A 1L7PA 3N8GA 3ET4A 5AKLA 1ZRMA 2WM8A 3AR4A 4OHFA 3FPBA 2ZXEA 4Y2TA 1TJ5A 1PW5A 2HOQA 3IJ5A 5E0OA 3OPXA 2YBDA 4XOUA 3KBBA 2EARA 3SMVA 3WKAA 1Q92A 3WK6A 3L8EA 5AI5A 3ZU6A 1L8LA 1J97A 1RKQA 4DWOA 3SF0A 5AM4A 3NANA 4NFLA 2GHTA 1NNLA 3TLMA 1FEZA 2IA5A 4HYTA 4PNHA 3FZQA 3ESQA 2I6XA 5ALXA 1L7OA 2X4DA 4Y2RA 3DAOA 3MN1A 5ALVA 4ZEXA 3ZTWA 5AW2A 2BDUA 2HF7A 3BA6A 3UMGA 1EK1A 3ZI4A 3W5CA 4OD0A 5ALZA 2B1RA 2RARA 2I55A 3PGLA 5ALNA 5AVZA 3AR3A 5AM2A 3ZVNA 4OCZA 1RLOA 3AR6A 2FEAA 5AK5A 3B8EA 5AKIA 3IRUA 3QU7A 3GYGA 3WK9A 4DCCA 1Z5UA 3S6JA 4B6JA 2G80A
chains in the Genus database with same CATH superfamily
3DDWA 2QLBA 7ADHA 2Q6VA 2DH5A 3CQ9A 1H4QA 1CHDA 2JA2A 2JHGA 4TKVB 2NXJA 2ZYRA 3KXIA 1Y5IA 4TT3A 4A0HA 3DW1X 1V35A 3EDOA 3AVTA 4HP8A 4LDPA 1KK2A 3N75A 4LZZA 3V2IA 5CVCA 1JDBB 1M1ZA 3K72B 1NLFA 2WZBA 1KU0A 4HLDA 5AVXA 1DSSG 1M1YE 2QUAA 5A2QA 3TBHA 4D9EA 3AI7A 3BWCA 1NA5A 3ENZA 3GCGA 2O0KA 4G2NA 1P74A 4NNJA 4CF7A 2MIIA 1Z2PX 2OV8A 3DAPA 3NOVA 5ALTA 5FYQA 2N3ZA 2HMSA 2IYUA 3H3XA 3KOOA 1ABEA 1RYYA 1WPGA 4WAUA 3NTXA 3T3DA 3GNTA 1VBFA 4MRVA 1N2BA 3D4PA 1CETA 2H5IA 3ABQB 4FGKA 1HDYA 3MWLA 4V0KA 5AOCA 1AIPA 2HRBA 5L3SB 1UKYA 3D4OA 1QQ6A 3L8FA 4RPJA 1X1AA 4DXAA 5KOIA 1HGXA 1V2HE 1VP9A 4I9FA 4Q82A 2EKBA 4WZBE 3T9CA 3MHPA 1ORRA 1FQWA 2BY4A 2RAVA 5H3CA 4EPYA 2PGIA 1GO2A 4CF6A 2PUDA 4L3VA 4M53A 1RI1A 2B7LA 1XL0A 2PJDA 2GVDC 1NVAA 1XALA 2B99A 2IZZA 3OLYA 4MWCA 4L6IA 3LLCA 4N0DA 3RFTA 4BQEA 4Z7NB 3IAXA 3GXBA 3X1WA 2R8EA 3L7YA 1CQIA 2C5EA 1U8ZA 1XNJA 5FO1A 4QYMA 1E1CB 3C16C 1U99A 3Q2KA 3PEYA 1ZQ1A 1G0OA 4FT2A 1CY6A 1VHJA 1YZKA 2F3PA 2O1SA 3LYAA 1VL6A 3PX3A 4WZAB 4ZVTA 1TPZA 2GKGA 3G2OA 4M7WA 4TQUS 4ZEVA 2NVWA 5DHRA 4O8CA 1ZICA 4K6MA 1I7NA 3VVMA 1VL2A 3A6KA 1OBVA 3PSHA 3ZE2B 1RM5A 5JAZA 3PVCA 4LF4B 4KR3A 2ID9A 3CUKA 3E9DA 4HFMA 1WY7A 1MAAA 3B6MA 4A6PA 2RBEA 5E6SB 3EGOA 4W7SA 2KSQA 4F6RB 1NLYA 3JRWA 5GGYA 4B5KA 4DA4A 3PIDA 4JLSA 4D3XA 2XCLA 3RRYA 2FVXA 3IBCA 3PR1A 1FBTA 5ETJA 4ZVUA 1YR9A 5TRTA 4IUCS 1L7RA 1S2NA 3WQQA 2QJWA 4FONA 3FNHA 1DTSA 1NJ5A 1YS1X 3KKQA 3PC4A 4GQAA 4ZRMA 5KMGB 3IVAA 3KJXA 2P9CA 2ZRJA 4UU1A 1EWRA 5IU6A 4A1OA 4I3HA 1QKKA 3DDSA 2F00A 4F1JA 3DOUA 1MB0A 1EVEA 1KIFA 4XX1A 5K6TA 1A8IA 4ESVA 2WD8A 2V7TA 4QLOA 5U1PA 2IU0A 3WL7A 2EEPA 3WBFA 1Z7WA 3HVHA 3KT6A 1A9QA 1GZDA 1K5DA 2GD1O 2OEPA 4R8VA 2FN8A 4GZ3A 3NETA 4YRTA 1I5RA 4QARA 3BMNB 4YXFA 2D00A 3G89A 1LNQA 3QI2A 4OKSA 3TCNA 2FFBA 4WN9B 4NMWA 4P53A 3OO1A 4CEJA 3L1KA 2J46A 1Y48E 3L7MA 5E4FA 4BPBA 4OA8A 5A05A 3STUA 1IBCA 1D2CA 4NBUA 3K5WA 1R50A 3TE7A 5I7FA 3ZQKA 4DIOA 1BCRA 1OB5A 2EFHB 2OE2A 2A94A 2XUFA 1PV2A 1NWCA 3I6BA 4J4BA 4NYJQ 1ZXBA 2I2CA 1OU0A 4X1YB 1IQ0A 1X7HA 5DTMA 1K9VF 2QRVA 4L8LA 3S7TA 2QMQA 3EWAA 4FDLA 4LJ9A 5IDXA 4OUDB 1WXDA 4PANA 2ESRA 3BWXA 3L4JA 3GLHE 4EGJA 3R40A 1E77A 3ZDAA 3RSHA 2OZEA 2YDYA 3UVEA 1W0JA 2BZ1A 1TMKA 1NBMA 2P6PA 5IMBA 2HJWA 3VC2A 3VI4B 1ECPA 4KIUA 4KB5A 3N6XA 2PKQO 3GI1A 5C51B 4J16C 4DUYB 2ZIGA 2BDEA 3REFA 1JJ7A 4NFHA 3WL4A 1JR6A 4NPCA 4QPDA 4ZT3A 1XMSA 2FE4A 4GP7A 5D6OA 5LZ9A 5JPCA 2RG7A 1FVHA 1DV1A 2RGUA 2WUDA 3GRFA 1M5RA 2POCA 2VQEB 2DE0X 3U26A 3AWIA 1EG7A 1VMKA 3DTNA 1X19A 3QY0A 2R8RA 1ZGZA 5EJIA 2M32A 4YY3B 4YQZA 3LT2A 1GHTA 1EJBA 2VZ8A 4I50F 3NHFA 1T13A 3GVIA 1F0KA 1ONPA 4BVAA 3QE2A 1YR8A 2PZGA 2FEMA 2VDJA 4HGOA 3HM9A 4KK4A 5K0LA 1MFPA 3EULA 3SP1A 1UQRA 1DRJA 1FX0B 4NI5A 1JKXA 2ASEA 3MTQA 4N3AA 2AMYA 1FFXB 4U7HA 3K9FC 4IHQA 3W6NA 5K6AA 3BL5A 1JLRA 2FOIA 1GKKA 1RQNA 4YROA 3DFMA 1ESEA 1P77A 5I9BA 5BWNA 3VHLB 2ZR9A 5J58A 4RZUA 2JLUA 3QUBA 3E8SA 4FYHA 5TMDA 3ORQA 2ID4A 2VDMB 2QW1A 2C96A 3BBPA 4I81A 2I2WA 1T5IA 4YP7A 4D3SA 3ZXUB 2MDTA 2G76A 3HUEA 4UEWA 1YZYA 3W8DA 1PZNA 5A06A 2TMKA 3E5RA 1GZVA 1U0SY 3M5CA 4ZT4A 4BY9E 1IZZA 3OTQA 1OT3A 1ORDA 3GZJA 2EXXA 3N87A 3SZGA 5JFOA 1R0CA 4KFSA 4XQGA 4AK9A 4FB5A 1J00A 1HT1E 2BTQA 2JFNA 3KB6A 4FFOA 1KO7A 5L3VA 2HA6A 1LBTA 3A6DA 3BKXA 5AK6A 4G9EA 1QV7A 1NI5A 3OE5A 4P0PB 1Y3DE 4O4LF 4ZTUB 2FG7C 4XKJA 5EMMA 5HIIA 1TFUA 4U5XA 4E7PA 1AKEA 1BNCA 3I6YA 4C7OA 4PHCA 2OORA 1FDWA 1NMQA 3I1IA 3MIIA 2P6RA 1GNLA 5JI2E 1YQQA 1RM0A 3CXUA 1B1CA 4Q9JA 4QULA 1USGA 4RGVA 5GIOE 2PLRA 1JAZA 4B74A 4DLUA 5IC4A 3KLOA 2ODQA 4ARSA 1SU8A 2FVYA 2H7XA 3CF6R 3LNCA 5AKHA 4W9NC 5LB4A 4OFXA 2G5GX 1H0KA 2E4AA 3A4IA 3C15C 4R0NA 1YZVA 4AXBA 4AKTA 4BJ1A 2ZDGA 2VQSA 2W00A 4Z51A 4C5CA 3NAMA 1QIHA 2CFTA 2EFYA 2YW9A 2AG0A 1I4TD 4HNSA 4Q7MB 3T3OA 3GIDA 4ZVOA 1L7MA 1RLJA 3EXEB 3I1JA 5IH7A 2JVJA 2IIVA 1DJOA 4OXYA 4AS1A 4YDRA 4AXXA 2CSXA 4M89A 1F20A 2P79A 4QXRA 4IEIA 2J9XB 4R7TA 4Z7OB 3WV5A 1F38A 4BVHA 4YJ2B 2C54A 2VH5R 1KDRA 3I8SA 3MYYA 3UY4A 3PNYA 4XUEA 1MV8A 1V6SA 3U5TA 3A27A 3UN1A 1P39A 2BGNA 1IULA 2FUEA 3ANLA 4GQBA 4BGIA 1WU8A 1L7BA 4L2IB 5DSTA 4Z53A 4EEXA 1USWA 3H2ZA 4PPQA 4UU8A 3PYXA 5JD6A 1EI9A 1UPCA 4FTWA 3O4FA 5C7YA 1UEXC 1WDMA 2CZQA 2I54A 1IJKA 3LY7A 2V7UA 3DLTA 2PKWA 3VU9A 3IE2A 3UC5A 1HDZA 4LGVA 4LXTA 2YOGA 1L8AA 3PPWA 1OA1A 1CRLA 2WKQA 2V7QD 3EXIA 1F2DA 5EUQB 2DXIA 4R41A 3SJAA 3FRHA 4YASA 2Q7XA 3CRZA 2ZSFA 1GYPA 5AK5A 4BBPA 4G81A 2A5DA 1NQTA 4F11A 1F4PA 1HMPA 1P0QA 2C4KA 3WYDA 1R9GA 1IK4A 1JKMA 3PXXA 1YMVA 4K40A 3JAKB 3W0LB 1YBHA 4NZOA 4BHTA 3WNZA 4YFYA 3M34A 4FYVA 4V24A 1NKVA 2OORC 5DRYA 3L0SA 2IW3A 2WYVA 4NAVA 2A9VA 4NZNA 5ICMA 4WUTA 2X77A 1Z3CA 3K09C 4MWBA 4RW0A 5EL0A 4DR7B 1F9AA 2WFZA 3DTVA 1V3UA 2ZBPA 3JZMA 4N8SA 4QHSA 1A5ZA 1DZ3A 3N3AC 2YV3A 4IH1A 1PTJC 3OCYA 3P9CA 1WMFA 2XSZA 3L1VA 4NR0A 5D84A 2WQ6A 1YA8A 3EVEA 1VGVA 4H7JA 1SHZA 2HCRA 4XYGA 1UF9A 3OFJA 5ARDA 1W36C 5EVJA 3MSXA 3UGTA 1ZN2A 1ZWLA 3WNCA 3MCTA 5EG5A 3NBUA 1QGUA 4F21A 4Z4QA 2GX6A 4Z49A 4CKZA 2D13A 3H5NA 5LP6C 2GD6A 1URPA 2G09A 1VMEA 2WLTA 1W4LA 3ER6A 1M8KA 1LSOA 1A3CA 3BULA 4MH0R 4DV4B 5ED4A 1ODTC 1TVMA 2WUVA 1WDKA 3CE6A 1JR2A 1RKXA 3EARA 4TSKA 3SGLA 2R6CA 4ECEA 4D0RA 2PG3A 1XNQB 3M6WA 3TF5A 3OZEA 2ZYVX 3WY9A 2Z04A 1RWVA 3VR6A 5L6LB 5GZ6A 3TAHA 1JQBA 1C7ZA 1P60A 2LNDA 4S3MA 5C34B 4CM9D 3KQNA 4NENA 1L1RA 4RDXA 4EDHA 3MS2A 1LY1A 4HDSA 4OOFA 4RMGA 4EFMA 1LNSA 2CVPA 5LQRA 2R9VA 2QUZA 4FMDB 2O0MA 1IY2A 2C8VA 4MUXA 3TMKA 3KQWA 2KWIA 2Z5FA 4U7JA 5FA8A 1N4DA 1YWGO 1OHHA 1ZG3A 4OJTA 5EHXA 4WESA 1KDVA 1QU3A 4JXJA 1X80B 3K0AA 3CF4A 3OIWA 1UXJA 4UOQA 5DM2A 4OV6B 2WA1A 2XLCA 2BJVA 3IO5A 4O02B 3H0KA 3UMCA 2ILTA 4DCGA 2JFQA 1NBIA 4R1TA 3FNFA 2WIGA 5C37A 4KQMA 3I9V1 5HZMA 3PXBA 1DE0A 1U2SA 1NIPA 4FHGA 3IOYA 2GHIA 4BN5A 5TF4A 4XVQA 2BGTA 1UADA 4ZGWA 3C3AA 1EFPB 4FGUA 4ZOQI 4UULA 5ALQA 5BPHA 3QELA 4BLRA 4DTCA 4MW2A 3HBNA 1T3TA 2IYPA 5JIBA 4LMBA 3MRTA 2IPOA 3AP2A 4X9XA 2R60A 5ULLA 4GI1A 3BMCB 1OF1A 3NTLA 2YWCA 4BMCA 4ZJZA 1H4SA 5F1KA 3DAFA 3EZ9A 2DLCX 1E6EA 2HREA 5CFOA 2VJPA 1WZCA 4LYYA 3PI6A 5DYTA 1TEZA 4BBJA 5A5VA 2ODPA 1T5HX 2GF2A 3LM8A 4AJOA 4EX7A 5LP1A 1GZ3A 2MSKA 4QTYA 3UB2A 2C3UA 4JBWA 4OYYA 3CF2A 3MTDA 4MVJG 5FI1B 4KXLA 4MVJI 3FY4A 3PP8A 1J5EB 4IUYA 4BNGA 1SIWA 1V47A 4LYFA 3T0FA 2XKKA 4ZGGA 5KSZA 5CW2A 5A3SA 3QOXA 5HZHA 5EXPA 3VDNB 3JQ7B 1MIOB 1UM8A 2YIMA 1DC7A 5FA6A 4KXQA 1BJKA 5BYJA 4FJ1A 3INGA 4D43A 4IXTA 4FGJA 1Y9AA 1KI7A 3ACBA 5K3FB 1UBCA 2IIBA 1SCNE 1W5SA 3W3AH 1QFJA 2DBVO 4CCAA 4G1UC 2RGAA 4F4CA 1L7PA 2HK9A 1TCVA 1XHFA 4G5SA 1G1AA 1X7DA 3ZDCA 2ZE6A 1Q1AA 4WFJA 1Y8QA 1C8BA 1R0KA 2NZWA 1A71A 4JQCA 5EHNA 2W0MA 5B3KA 4ZYYA 2AFIA 3U0BA 4OHFA 1YKSA 1RQRA 4ROTA 5CVDA 1J25A 4MKHA 4CLOA 1PW5A 3IJ5A 4IDQA 1DUIA 4RABA 4PVCA 3JYPA 5D3ZA 3USCS 3OCCA 4HAVA 2HC9A 4OVKA 5FOVA 1PJTA 1O94A 4Y6LA 4DCTA 3RV4A 4DWWA 4MPJA 1J2UA 1P2GA 2WHPA 3E22A 3EZNA 4ZI7F 1OBOA 1DCKA 1DIRA 4FC7A 4L8GA 4CN9A 1O9BA 3BBLA 4PIVA 1L4NA 2C2HA 4L9AA 3AXSA 1SXIA 3GMDA 1MDBA 2ASVA 1D1TA 1FXUA 3P2YA 1FTYA 1YVEI 3OUTA 1Z6TA 2O8FB 3WIUA 1A2OA 2B5OA 1FFAA 3NVAA 1UFQA 4HMOA 4TYNA 1Z6AA 4BQQA 1YFKA 3I9KA 1C41A 1L7OA 2X4DA 3U3KA 3DAOA 3GFQA 3NQ41 3TLEA 2IHYA 4Y1RA 3IAHA 5JAPA 4I66A 4ND6A 1I1NA 4I5IA 2WKRA 2H9IA 4CETA 1H69A 1Z7YA 1T4BA 3AL0C 4OREX 1ZA2A 3PGLA 3MGKA 3ANMA 2HQRA 2GCOB 3MOSA 4CR6A 2JH8A 2QXUA 2C1EA 4MKXA 3CZMA 2CL0X 3R24A 4ZO4A 4IDEA 3LHKA 2J07A 1HMYA 3JVEA 4Y9TA 3TLCA 2Q1WA 3VGJA 3NPMA 1JHQA 3E9QA 4HL6A 4RTSA 1KWGA 1OR8A 5ITSA 1JEQA 3BIFA 5C4IA 4DV6B 1KZ7B 4Q1DA 5EUCA 1WXWA 1G7RA 2I29A 3Q4GA 2CNDA 4NZYA 4LCBA 3OIYA 3R9XA 3H3JA 3TKAA 2QAIA 3ELWA 1K27A 3ZR4B 2C7QA 2KBFA 5TMPA 3GLHB 4HMPA 2H1LA 9MHTA 4XWKA 1XJQA 3WHPA 1JSCA 1JWLA 4W6QA 2DQYA 2CL6X 2ZBVA 3TB6A 4EKEA 1B2RA 3SQNA 2V58A 3ZDDA 2IEBA 3WYGA 2ZRKA 3ZY2A 1SD1A 1AJEA 1H2ZA 4HUQA 1J5PA 2VAWA 3EVGA 4JLBA 1L8OA 4Q02A 1P1JA 2J87A 2Z3ZA 3PEFA 4M60A 5F2NA 4PCVA 2NV0A 2I4LA 4YAUA 2DERA 5ALMA 3FPSA 2AF3C 4HPXB 5FNVA 3SM3A 4BGEA 1C30A 3QH4A 4OBXA 1QPZA 2GA8A 1J1IA 1WDLA 4XR9A 5I8PA 4XCQA 3RG8A 2WM9B 4RZIA 3CPJB 4AQ7A 3ORRA 2XMZA 5BMOA 4HH1A 1TCBA 4GR9A 2SCUB 1GZUA 3F3YA 4NONA 1Z3IX 2CDNA 4LRXA 3NIBA 4HSEA 5F78A 1MZVA 4MO2A 1Y6RA 4E70A 3W6PA 2JB9A 4CEHA 1GGFA 5CLJA 1A98A 4AL4A 3IP5A 4Q3LA 3P9QA 1THZA 3Q6MA 3TOZA 3I2KA 2ZJ8A 2NNLD 4KAJA 4FK8A 4N0EA 1FMJA 3KWMA 3CR8A 3F47A 3HY4A 4N5MA 2FTKE 3P4UA 2CDCA 3D54D 1LDMA 3HXOA 1QLWA 2WVHA 1GDDA 4QPZA 1ZONA 3KJHA 4L02A 2A6PA 4YCJA 3K96A 3ZWAA 4UM7A 2VPPA 4WZBB 4YJ3F 4P4NA 1E2EA 1FNDA 3ZQJA 2CUZA 1COWA 3TDKA 1BOOA 3P4XA 4D8TA 1KY4A 4PLFA 4KR6A 3KZOA 3OWXA 3W2EA 1VB5A 2ZFUA 4I9UA 3ISTA 2A3NA 1UZUA 1YL5A 2VDLB 3P2JA 1FFHA 2M6LA 3SWWA 4GFDA 2BI8A 4KGVA 4JB3A 3MGCA 4PYKA 1KP3A 1VHWA 2OCXA 1RVV1 3H18A 2B69A 1XCGB 1B0AA 1NBME 1TLTA 3LIPA 2RC5A 4I1YA 5C4MA 2HPVA 3FYCA 3H6HA 1CDOA 2R4UA 3BFPA 3GUCA 1GAJA 1G8MA 3CH4B 4O08A 3SZMA 3SXJA 4DR3B 3HUUA 2O2XA 5BNWA 5IAJA 1FXWA 1LX7A 2FSUA 2ARKA 4MVJE 5LDGA 2F55A 5EJ7A 2W98A 1ZRSA 2DU8A 2JZOA 4JLMA 3S29A 3ZDQA 3C3DA 4QRIA 3P9KA 5D8DA 4BLOA 1GLGA 2FK8A 3LYLA 3MCZA 2RHRA 3SKVA 1EZ1A 3R0XA 1IIBA 5I5GA 4DYDA 4L5YA 1RE1A 1UPBA 2R66A 3OZXA 4E2ZA 1R6BX 1UBEA 4NARA 1M7GA 5FLEX 2OMEA 4QPJC 3KBOA 4GKAA 3P52A 2HKIA 1PQPA 2Q2VA 5ADWA 2DMRA 5TPWA 5HCUA 1W44A 2P8JA 5AJUA 1E7QA 3B6EA 5TNXA 1U7UA 3V8PA 4HBZA 4KXXA 1R0SA 3TZEA 2HK6A 1IQUA 1XKQA 1LK5A 1EP2B 1KOFA 1NXSA 1QVZA 3BORA 1NTRA 1NOJA 3HDGA 1UKVY 3GF4A 5DIZA 4DQVA 1UZLA 1GPKA 5E2IA 1JG7A 1SOUA 3PDHA 4GX5A 1WO8A 4BO1A 5B7QA 1MW8X 1SRRA 4Q9AA 2D5CA 2F7SA 3NONA 4Q4DA 3VVLA 4J0QA 3Q40A 3AEKB 3K15A 5HFNA 2BGKA 3FLEA 3EXIB 4FQ5A 3NHAA 5JNSA 1O94D 2XXJA 3OX2A 1ZN9A 2AX3A 5FR1A 5IDWA 3MT7A 1X92A 5KNBA 2Q6TA 3U4MA 1ECFA 4BO8A 3DDCA 4LDZA 1QO7A 1ZVVA 3AY3A 5KYGA 3HNOA 2G9RA 1HFJA 1Y6JA 4ND7A 2HSDA 2CLEB 2RK3A 3H4VA 3VU3A 3RUPA 4LZLA 3V1KA 3B82A 5JSKA 2OBLA 4PX2A 9ABPA 2J4DA 3OJWA 1B4DA 1CUDA 1RQGA 1USUA 3EIUA 4INJA 4X8LA 2O2YA 3WLMA 3GBSA 3AETA 3RB8A 4MMXB 4J7UA 3IS3A 4IV5A 4IGFA 2EIHA 5GP1A 5BQ3A 3FRIA 2Q9UA 5BT8A 4YJFA 3HKBB 2OA0A 3BWEA 1ZHOA 2LRHA 4S1PA 5G0SA 4LVUA 5G02A 1E0JA 3LQYA 2OHOA 1J99A 4BZXA 4ZV4A 4UKDA 5L3QA 5ALDA 2V6BA 3HKEB 1ONBA 5KC9A 1YZNA 4QPPA 3JAWA 4LDAA 1WCYA 4URVR 5HF8A 4XDGA 2FZ4A 3T7DA 1DELA 1E8NA 4FOLA 5K3CA 3NR2A 4CYMA 4G36A 3FMIA 1KVTA 2VKQA 1E7MA 4Y2VA 3I5AA 2BMFA 2IYAA 4R2KA 4RGBA 3AR8A 3UAXA 4EPVA 4RM3A 4EG6A 2Q99A 3ISJA 2QJFA 3STHA 1N5DA 2O8CB 2QTTA 2WSBA 4PGMA 1O89A 3G88A 1AKQA 3GBVA 1P5HA 1HNXB 1HZZA 1W4ZA 2HLNA 2W37A 4RF2A 1NYRA 1GOTA 4G9BA 4PLCA 4L2IA 1W4RA 3B7PA 2VP3A 3AJAA 3HDYA 3TIIA 1VMDA 1CJUC 5LZ4A 4TLDA 1PJQA 2QTMA 1DL5A 2BPOA 1WUTA 2ACWA 2JCGA 2PBLA 3JASB 4MB0A 5ILOA 1EUYA 3TS1A 2O2JA 3R23A 2AUTA 2A4MA 2Y1FA 4WFIA 3U80A 4QRDA 3IDFA 4TN1A 1FPMA 1MC5A 2VK1A 3RSSA 4BMNA 1TD1A 5JBNA 4ZEWA 5PNTA 3HY6A 1QZTA 3NTRA 4MSUA 4IPTA 3V2HA 1DKOA 2JGJA 3KEGA 4G4SP 4Z9YA 4JUAA 4ZI5A 3L7NA 1J22A 1RWXA 4RZHA 1P61B 3SR3A 3ZUPA 1T3ZA 2VWPA 3C8HA 4L7VA 2PPVA 3P9SA 3I92A 1DEXA 3T3MB 1UXIA 4J29A 3T9EA 2XZPA 2AH5A 4WGGA 2X1MA 4LBZA 1GAWA 2EL7A 2X76A 5BQPA 2GASA 4JUBA 4N3NA 3RTCA 3K8ZA 4LKRA 2X9NA 4DQLA 2ZM6B 2PSHA 2Q5EA 4IWXA 5FORA 3RNLA 4CQMB 4Q4CA 1YQUA 3IE0A 1GG2A 3AVVA 2QYTA 2JLCA 3ABIA 8OHMA 1X1RA 4EA9A 5DCWA 3WO1A 2ZVDA 2OG2A 4A0FA 2UUCB 1WZIA 4P7FA 1KYXA 4L6CA 1DKUA 1G20B 2QR2A 3DLPX 3GOQA 3ZX5A 1NZFA 4K1XA 5F7XA 2BSXA 2FPXA 4F4JA 5A7FA 4M0KA 5I7WA 3R5HA 4MEBA 1QTRA 4PLYA 3HZRA 3IDZA 5MDHA 1EGHA 1Q84A 4ESEA 3B3FA 3QWIA 4IZHA 2QBYA 1YQDA 2NTJA 2WNHA 1H4VB 4L15A 5MF6A 4H4CA 2ZOSA 4WDQA 2UV8A 4U7TB 3TLZA 3DHYA 3K6SA 1FL9A 4P80A 1DAPA 1YDGA 3EIOA 4C0LA 5BV0A 2FUKA 1SVWA 2C5LA 4ON9A 4P4TA 3DZIA 1OWNA 1R5OA 1ZN8A 2GQ0A 4YRQA 2PPLA 4LHXA 4OQYA 2O2SA 1C0LA 1FFEA 2MR5A 2PT7A 1MVLA 3BSWA 1RDFA 3C1OA 2JD0A 3GR6A 3HLYA 3QVOA 4I0WB 1QZ3A 4G5FA 5HR5A 1TMYA 3EXAA 3UHOA 4ZU6X 3UC9A 3S2IA 5DP1A 3GFSA 3NDIA 4NK5A 5F1YA 1TUBB 3G79A 3IOBA 1S3SA 4IO0A 2DM6A 2XI4A 5CYFA 4C4ZA 3BHNA 1K6MA 1KARA 1WSAA 3ENVA 3IKLA 3T5PA 2Q0XA 1X9HA 4UEQA 4Y2HA 2G1JA 2NO9A 4JGGA 3TMYA 2XB6A 2A5YB 3ZS8A 5C1BA 3DHNA 3T7AA 3JZFA 2FG5A 2OVBA 3QHPA 1ZP6A 3GP8A 5JNRA 1XGKA 2YV5A 1Z6ZA 3GJRA 4UM9B 4NG5A 1JKJB 1YZQA 4G1EB 3FHTA 4YRRA 3TXYA 3PQDA 1N1EA 3ZG6A 2H31A 1E20A 2FSGA 3LBYA 5C5EA 1U04A 3N5KA 2AQIA 4TGLA 3HO8A 5TQ0B 4BFSA 1EWTA 1A9XA 1FLVA 4UDXX 4LZAA 4PF1A 3PR3A 2VHCA 2E4ZA 3QVVA 1JQDA 4BWVA 3U7GA 1PS8A 2ODBA 3E2PA 4N01A 4X84A 1ECBA 5F33A 4CLOB 4CM4A 4Y6GB 1X1BA 5ARCA 5A5FA 5JJIA 2CGEA 2WSLA 4DZZA 4RNDB 3RSOA 3GOHA 1V26A 4RY2A 3EGDA 4DLSA 2JAWA 4MW6A 3D7RA 4F5EA 4NESA 3VPBA 1JECA 2QXTA 1HDEA 4JJKA 1EVYA 5KWJA 3DDZX 1IY8A 3EUEA 1XDBA 1K68A 3NIWA 1RHRA 3RC2A 1Y1TA 3RS5A 4CXMA 2RI0A 4YEDA 4DXDA 4CEIA 3WBJA 3DE1X 3IALA 5CPBA 8GPBA 4MTCA 2VYVD 4M8KA 3WDSA 5EYPA 3WWPA 5KNCD 2O8FA 3LCRA 3TG2A 3IUYA 3P9NA 4W99A 3ZWYA 1T2FA 3P96A 3UQYS 2MWMA 4AF6A 4M0DA 4NCXA 4P36A 1FJXA 1M6NA 4LZWA 4NBNA 4B2LA 2X9VA 4NAUA 2A0YA 3U7QA 5BOVA 5IBQA 3IIKA 2XYHA 2VP5A 4P0QB 3HJBA 3CFYA 2QD2A 4TKUB 5KWSA 2WQ7A 4FCWA 3I0MA 1O5OA 4TYPA 3UEOA 1XK7A 3HACA 2FPSA 3LGAA 1TA9A 4OQDA 5LMZA 4YAOA 2VNHA 3D6HA 5L3SA 2VPIA 2IS2A 5BW8A 3ROZA 2HRZA 4GPZA 3PFHA 3ZDYB 2NV6A 2D4HA 4EBFA 4Z4HA 2NLOA 2IV3A 4MEJA 5CIQA 2PAAA 2VA8A 4QUDA 3PJDA 3WADA 1CY8A 2H1IA 3RVBA 4URHA 3FSGA 1ZSVA 2VYVA 5AJHA 1KMHA 2OCDA 2YL2A 2PD4A 4HZUA 1I5OA 3HR8A 1Z74A 3DM5A 4OP3A 1U9ZA 5K0EA 5LNK1 5ER6A 1VB3A 1LLCA 1YF3A 1ZNQO 1H8ED 3CNHA 5EFZA 4HHEA 1C7IA 3UCEA 1KQNA 1NULA 4FKMA 4BNFA 4CU5A 1C2YA 1X1DA 3RQIA 2QM7A 3CGWA 3ESDA 3GRAA 3O95A 4KQIA 3ZS9A 5LOVB 3EVNA 4QUGA 4H1WA 2XXBA 4WCFB 2GM5A 1M7BA 1KI6B 1TCUA 5AQ1A 1MC1A 3TSYA 1Q0HA 3UXYA 5D3MB 3LC7O 4MGYR 3CMMA 1EIZA 1NQ5A 3JSXA 3H2KA 4DUGD 3NM4A 2ZTVA 1BKDR 2VK2A 2VSYA 1NN3A 3B1XA 3FPKA 1FJ2A 3CW8X 2GRAA 3AEUB 3JWJA 4L5AA 4FYPA 5CLLA 1IN5A 3RE1A 1J0BA 3K0EA 4B71A 5JYEA 1REQB 2XRZA 1NVBA 4GO1A 4MR9B 3AUAA 2CHFA 3OPMA 2YFKA 4MV5A 1OMOA 4OJNA 1EU1A 2GD2A 1ZRMA 1NBMD 3GAFA 3AR4A 3LU1A 4JC5A 4OX9B 1D6JA 2XBLA 1S3IA 4RA6B 5AUQA 4H3SA 1A72A 2JLVA 4GECA 2IVFA 5LVAA 2BZGA 2XGOA 2XIJA 4ENVA 2EHJA 5HHTA 1B6TA 2P77A 2R7NA 3BJMA 4GYKA 4RMNA 4J49A 4JEHA 1R5JA 3PBKA 2H52A 5LA6A 3KELA 4IIYA 3UBTA 1PJLA 3EIXA 3MTBA 5T57A 1RHKA 1W93A 2FF7A 4IMPA 1AUVA 2ODTX 1EXMA 4LK2A 4HTFA 4UVHA 3U16A 4MQEB 4B40A 4PO1A 3AF2A 3FNEA 3OQNA 2HQ1A 4QXQA 3A9TA 2GHTA 1NNLA 1AKWA 3LQ2A 3F7OA 4Q18A 5FO0A 1P2VA 2W2OA 2XOXA 1OI4A 3HYNA 1ZGHA 3KZKA 4AF8A 3T38A 1G3MA 3CSDA 6AT1A 5CA1F 5ALVA 3F8WA 1XLVA 3C85A 3ZTWA 3KKMA 2O4UX 4ZC1A 4DR5B 3I53A 4DCUA 3F71A 2C95A 1QH8A 1CR1A 3GEBA 4W9RA 2R8BA 5CVEA 3UQZA 4AN0A 3Q98A 3SYNA 3L18A 3WMFA 1ZM9A 3ZNOA 1UDBA 1PGQA 2X14A 1Q57A 3U31A 5LUAA 1UPXA 1X9GA 1FVFA 2P7HA 1CU1A 3KL4A 5BR1A 3ADCA 1FMFA 3B20A 1NP7A 3ML1A 1ODLA 2JKVA 3LDFA 4OQLA 4F3KA 1VPLA 3KQHA 1XCBA 6CHYA 2PM8A 2GZHA 3RC1A 2PSSA 4ARUA 2Z5VA 1ZEMA 4H2DA 3SQOA 1SKMA 4JGBA 3L5OA 3LLVA 4MKIA 5EQDA 4EEZA 1Y34E 1PAUA 1RAHA 2VCHA 3MCAA 4N0QA 2UUBB 3BB1A 3BCUA 3ANNA 3QBVA 4DSTA 5IKXA 2FETA 1UK9A 2J08A 3EASA 4CT0A 3BD8A 4OKIA 1CR4A 4URXR 1PWEA 3F3MA 2FXVA 3OF5A 2V9PA 2GXAA 1RJDA 3K9LA 4QSHA 1RM4A 1XCMA 4GT1A 4RXMA 3IYLW 4REQA 2LR0A 1MR3F 3U3JA 4OJMX 1QC5B 1W25A 2OHIA 3NT4A 3FTDA 3OEED 5E9JA 2BUBA 2NZVG 3SVZA 3HDJA 4ZQEA 3VISA 3B52X 3PENA 1KSJA 3V32A 1P7CA 5GZ3A 3B3QA 1WXQA 1DARA 5G1OA 4R9VA 5TT0A 2HN9A 1MPTA 4EY4A 5C5DA 4YVFA 4ZFNA 1J2YA 2ONYA 4XGQA 1P2BA 3M33A 3OQVA 5LXTF 3CLRC 4B80A 1L4UA 1YJXA 1XRJA 3DKPA 1SCAA 1OYVA 1AC5A 4MW9A 4AW9A 3PQ8A 3IP1A 4HYQA 3ZE0B 3BS4A 1Y98A 4FI3F 1RWPA 4R2JA 3CONA 2CNOA 1RJWA 4ZVRA 4PAWA 1T2CA 2P68A 2P11A 1VGRA 2PL5A 3L7IA 4UHJA 1TNDA 4FSXA 1JIXA 2OUKA 1NUQA 1JG3A 1R8XA 2ZSIA 3NEYA 5MN4A 3J80A 5DYIA 3GZTB 1R88A 1T5OA 1JZSA 1HY3A 2JA1A 2XYQA 3FFTA 4Y6PA 3NGMA 4JI8B 2DFVA 4JASB 2YYYA 2PDAA 3AR7A 4RA9A 2QL5A 1PEDA 2HMUA 1IQRA 3E0QA 3FAKA 2IW1A 4RA9B 2R96A 1MTOA 2OG1A 2OHFA 5HX7A 5D5HA 4C20A 4JOCA 1MXHA 4EPXA 1CKEA 1QAOA 1ZD5A 4MV1A 3HA2A 4COKA 2JZCA 4J0KA 2YXBA 4MROA 2QVXX 4RV9A 3GLGE 1PDOA 1WDTA 2GR9A 1BHQ1 3LW8A 3LUKA 2BFDA 2FX2A 3FYTA 1SXJD 2WIAA 4Q9KA 4K9DA 4NH0A 3BCHA 2Q3JA 3PUHA 4MWEA 4EK9A 4K0KB 3DOEA 2WF9A 2HF9A 2O8CA 3NHRA 4N3GA 3OFKA 3UKOA 1I9CA 2B82A 4P2GA 3GLFA 1VGQA 2HH9A 2ZYAA 3OZWA 4R1NA 3DEKA 4XSGA 3HXMA 1UMCA 4YUVA 4DRYA 3HBJA 1MRZA 2BKEA 5KAMA 1JTFA 2YJZA 4A23A 1E2PA 5EIBC 5HJEA 3ZCQA 2ZYWX 2PZFA 2DUMA 1DWQA 5HF5A 1I9GA 1IDN1 3AYXB 3TUIC 3FHOA 2BHLA 3OFSA 2IEIA 3R7LA 2B1IA 3LWZA 1I3LA 2FSIA 3EZ6A 3A6GA 1GAXA 2HMWA 2B25A 4NP6A 4C1BA 2IDKA 3LT0A 1D6SA 2YIJA 2J5KA 3EPRA 2Q9BA 4Z9XA 3IDSA 3ZXSA 1JG1A 4MUNA 3LTNC 4FZRA 4Q3CA 3MOGA 3GLIE 1D7AA 3OQPA 1QGED 4Y2XA 3I2IA 2JIPA 3GEEA 3LK7A 3IAFA 2OSBA 1WBJB 1NC3A 1KVSA 1II0A 4MGEA 1PG5A 3LL7A 2OPHA 5CFQA 4FBLA 2ACKA 4DKXA 2WDPA 3KQMA 3MMNA 4JJ6A 3VZRA 5J1SB 3GLIA 2XA1A 2O9JA 1XA3A 2PE5A 3IUBA 4QOIA 2Z1MA 4ZV7A 3JX9A 2X0JA 4Y2GA 1SN7A 4CTKA 2EOAA 3L0DA 4J3NA 2WFLA 5F2EA 2XB4A 3LVFO 1AA6A 1DBWA 1RRKA 1QLHA 3PJFA 3FTFA 3BHMA 4MV7A 4BFZA 1VSTA 2FMFA 4ZVKA 3NYQA 2CCGA 1G21B 3H9QA 4PXYA 2VQFB 1YCHA 5ALEA 2IXDA 1G41A 2B8NA 2DTXA 3HA5A 1L4HA 1P2FA 4ZHQF 1K0FA 3ME5A 2AD5A 3LY5A 2IPAB 3QKWA 4QUKA 2ZWOA 4PQEA 3MG9A 1U7OA 2RJ3A 4IIVA 5TPZD 2CK3A 1HUQA 3KPWA 2B6HA 2GFIA 3L79A 2V8BA 2DQZA 3NGLA 4WEOA 1HOXA 1LI5A 2EERA 3RO7A 3UAYA 4YP6A 1TJ3A 3H8JA 4YTEA 2E55A 2J3LA 3AHHA 1MN6A 2DJIA 5EAIA 1U7XA 1R0RE 3AJDA 2B2CA 2XZDA 5A4DA 1U7DA 3SXUB 2LBPA 4BO7A 3N6VA 1EQAA 2XWSA 3GRPA 2WKWA 4HATA 2C78A 3SXPA 4LF7B 1WM1A 1Y1PA 1ZESA 2YFQA 3JATB 3N6RA 4UE3S 4W82A 3ZD6A 3O4GA 2PIAA 4E07A 2FXIA 2A0UA 3E3AA 5AH0A 3AUUA 5JJLA 2JFUA 1NX9A 3T52A 3KYCA 1J7JA 1YIDA 1YZLA 2IOFK 2NSDA 2C7PA 3PGXA 4X6YA 1HQKA 1W4CA 4TRRA 2ZRDA 3GP5A 3DMHA 4ND4A 1SQGA 2Z8YM 4YJDA 3Q6NA 2P67A 4BNUA 4FYMA 4O4HB 3R4CA 4WPGA 2IXFA 4R1LA 3H11A 4LE1A 5SV2A 3I1YA 1WB4A 4UW9A 2YN4A 3UK6A 4D8VA 1ZUWA 3S8MA 1J8MF 3RS7A 4F04A 3HABA 1IOLA 2OHXA 4MR9A 4O3MA 2LD4A 3ER9A 4WLNA 4ZI2A 5K7SA 1S8NA 1G7SA 3CTPA 4LC0A 1ACJA 4LY0A 4RSMA 4GIBA 4Q15A 3X2EA 4E3ZA 4PCAA 5ADUS 4J9UE 1QMPA 1KP2A 2XVMA 4MKFA 2H85A 6GPBA 3AWDA 3WIDA 3T5AA 1K06A 1ML4A 1VA5A 1AMUA 5LD2C 3HKCA 4MUEA 3BE5A 1AS0A 2YJTD 1SH7A 3IDOA 2VHWA 5F7JA 4UVGA 4M0FA 4DB2A 4WZBA 4GZ6A 1IATA 1NNEA 2YMMA 3N2GB 2X4LA 4IINA 4RWZA 3F6EX 3QOWA 1X42A 3HCBA 3C98A 1QO9A 5FWXB 3QKRB 5HJ5A 3JZAA 4X5OA 3U3XA 3RVLA 1YDEA 3VX4A 2WFMA 2ZBGA 3A06A 4ZCTA 5LP6A 3N2EA 1ZVKA 4KV7A 5T3YA 4Q9HA 4BLPA 5IK2A 1OB2A 3PQCA 3ZWPA 4PLTA 4ZTZB 1DBVO 3VO8A 4MVWA 1TJNA 2IY7A 4ALMA 3WSTA 1WW2A 5SY6A 2GEVA 3GCWA 5CK4A 3RUEA 5K2OA 2J0UA 4X1KA 2IPLA 5IVPA 5JRJA 4IKEA 1KP9A 1U3CA 4XLLA 1QS0A 2UUOA 3QEKA 4BVLA 2FN4A 5FBWB 3WWZA 3H5VA 5JC1A 3RARA 4JFAA 4YV7A 4OUKX 2NVUB 3AVWA 2DUJA 2I34A 5K3AA 4Q1AA 2RGCA 4LHWA 3NBYC 1X7XA 2OCLA 2EV9A 3BTUA 3KUCA 5KNDD 4C30A 2Q3DA 1DBPA 3Q15C 4G85A 5BR4A 4TV9B 4R0MA 4JK3A 2GZDA 3UFBA 2GZ2A 3C70A 3QVMA 3DZHA 1JAHA 3TDNA 1SXJC 2QM0A 4V38A 4B73A 3FX2A 3ZCVA 3RH0A 1PR1A 3BD9A 3O26A 5ALYA 1DJPA 1MG0A 1QXSA 2Q6KA 1SUIA 2GPWA 4NEQA 4O4LB 4JBGA 3C7CB 4IMIB 3ZV4A 3G0IA 2VBIA 3AM5A 4IG4A 3S68A 5A6SB 4CUKA 3U17A 3KD2A 4RMJA 3ZNNA 2FPLA 2NADA 2O8EA 4IVPA 3EUWA 3KFLA 3DLIA 2EKQA 4P98A 3UMFA 2XEDA 4GEGA 5KJEA 4YPVA 3ZWNA 4O29A 1IN7A 3LWDA 2XWJI 5J4YA 4A5OA 1FYXA 1G2PA 2ZU6A 5AR1A 4PFSA 4GSKA 3U7FB 2O20A 1SBTA 5INTA 1TK9A 1ILWA 2E87A 3IHKA 3WYCA 1Y6GA 3P2KA 1YDHA 1NG1A 2IF0A 2KBEA 1Q0SA 1ZMBA 3R75A 4NU5A 3W4KA 1WZUA 1SELA 1DQZA 2B4TO 4PSAA 5K8IA 3UUGA 5LM3A 2GKOA 4OG2A 3SLRA 4AJ9A 2YVAA 4HI0E 4C4SA 1U80A 5BVHA 2H51A 4F5ZA 3ZY4A 2PY6A 1XCJA 5HIKA 2WRZA 5EOVA 3EB9A 3TJZA 5JH7A 3A36A 1G3IA 3HO1A 1RE0A 4IIGA 2OHGA 3ROFA 4DJDC 2I71A 4ADSG 4MVJP 1BC5A 1Z4JA 4NECA 5B57C 3MCUA 1PZXA 1K92A 2I66A 1RQ2A 3K2IA 5I7VA 1CF9A 5IEBA 4DLXA 5GJCA 4AF7A 3R3JA 3EEQA 4J6FA 2Q5QA 4U2GA 1GKUB 1CG6A 4JODA 4KQ1A 2PNFA 1JEQB 1VC2A 3WQRA 4LQLA 5I5EA 2OXRA 1KQPA 2IYVA 2RHOA 4KMOA 1ADJA 4H1HA 4W7HA 1M8FA 2I3BA 4WY2A 2XITA 1U81A 2I1WA 4LJ7A 3CVWA 1UOQA 3I2FA 3OZSA 1W4BA 3MT0A 4I55A 9GPBA 2OYSA 1MTZA 4Z9BA 1QK3A 3O73A 3R3SA 4HOYA 3KL2A 1V71A 2J48A 5FTMA 1PK7A 2YZ7A 3WMWA 1T5SA 2CLMB 1HTTA 2JHPA 1S2IA 3K6SB 4M9CA 3OCVA 4K9SA 4U6NA 5DYYA 4V0MA 3THOA 5BRJA 2E0IA 1F6BA 4LXHA 2BL4A 2HBRA 3HP7A 3OKCA 5A3VA 3T9FA 1G4UR 3KB2A 3IEPA 3H86A 2BH9A 3DXFA 3U3OA 4CMJA 3ZE6A 1K5GA 1H66A 2A58A 1KJYA 3N1UA 4H1TA 4HNVA 1D2RA 2Z6VA 1N6RA 2D5AA 2X1HA 2JVIA 3QNUA 3REQA 1KRWA 4MCAA 3ZZTA 2QW8A 5C4GB 4B6FA 1EUDA 4D4JA 1SUPA 3RADC 1N6KA 3LZDA 3IVGA 3MBKA 4YN3A 5ILQA 4CKBB 4JWKA 4MUKA 1NXOA 2AWNA 1FVXA 1XTIA 2UKDA 1VE9A 4OOEA 2P9YA 2QY6A 4DN6A 4E5DA 4M55A 1VJ0A 3W6UA 4EFKA 1UFRA 3O1LA 4EHJA 3COJA 1XQXA 2YWEA 3C4JA 3MEQA 3QOYA 4X7RA 4DCOA 4EBBA 1NE2A 1T15A 3H1AA 4IYRA 1NUPA 4BWFB 4TV8F 2BR5A 3V7UA 3TD9A 5JNUA 2PYDA 3DOJA 4LHZA 4K8OA 4D4KA 5FV7A 1A97A 2GXSA 1VPVA 5EHGA 5B37A 3P0FA 1QLJA 1NDQA 3GVXA 3IFSA 5CDFA 4YGXB 2QDKA 5CR9A 5TVKA 4I6GA 4EGCB 2ATVA 2Q5OA 1F8UA 2EQAA 1LBSA 2PV7A 4H3HB 4HS9A 2Q2NA 2X8BA 3I9NA 2AVNA 3R5KA 3QP9A 5BUSA 3P97A 4X64B 2FPGB 1V7ZA 4CLDA 4GG1A 5CDFE 5AW1A 1Z16A 4MOWA 1IRIA 1TM2A 4EELA 4ZYZA 3X1JA 3S2UA 2CD9A 1MJHA 3O1IC 3C1UA 2O2ZA 4Z0TA 3WP0A 3QPWA 1VZ2A 4DGSA 4DIFA 2VHZA 1L9XA 2X3YA 4QEZA 1JU9A 4JQOA 2JFFA 3BRQA 4QLAA 3PE6A 2B2NA 3G8DA 3E58A 4FMCB 5HYVA 3K92A 3LL4A 2C2WA 3EC7A 3M6AA 4YJ3B 1T9GS 2X1VA 2OAGA 4LHVA 2B4AA 1JA0A 2YY5A 4U4AA 2JF0A 4Q7LA 3U3DA 1E2LA 3ET4A 1AK1A 1QE3A 1DG1G 4HFRA 1O95D 3GJ4A 4RFLA 3EIWA 5JCPA 2VYNA 3JQAD 4GUDA 4O0MA 2IHZA 4A2WA 2P91A 2ZXEA 1WB6A 2C1XA 2WYUA 2Y66A 1TJ5A 1WRBA 2HOQA 4OMCA 1UPTA 3T5DA 2SICE 2EARA 5T67A 1DTWB 1C0IA 2G77B 2PGXA 3NAQA 1RXIA 4ZD6A 2AI1A 2Y2UA 1EX6A 3BTVA 2G5PA 1MH1A 2D1TA 1S8FA 3LVQE 4JITA 3ZU6A 2B35A 1J97A 5BSWA 4EB0A 3QF7A 2ZKLA 2WSMA 3KHKA 5IBPA 4OX9Y 2RB4A 3OA2A 3HWX1 1RABA 2O0HA 3M6LA 1DIOB 4ZARA 5FAKA 4AMZA 2ZUDA 2AE2A 2P9ZA 2XE6A 3N9IA 4A0QA 2BFWA 3PR2B 5ALXA 1L8QA 2PZJA 4BVBA 4DBVO 3B6ZA 1QIMA 3HGQA 4EA7A 1KJZA 1RBZA 3D3EA 1KDTA 5SICE 1UXKA 4DQ0A 4BO3A 3M4ZA 1R15A 4NY1A 4OD0A 5G1NA 4HG2A 5FEUA 4WECA 1T8RA 4DA8A 1EVLA 3DG9A 3L9WA 4I55B 2ZBUA 3FCAA 1ELOA 2I7TA 2JAXA 4UZFA 5BN4B 4IDGA 4MYCA 5M29A 1NOIA 1KYQA 4EB6A 2HIHA 3KRTA 3QVKA 4H59A 4I3GA 1H65A 3SDBA 3WZLA 4XJSA 4Z8XA 4F8JA 4Q7EA 1DFIA 5A71A 1SXQA 2R84A 3FKQA 4KWCA 1Z15A 4JVMA 4U0JA 3R8FA 1K3FA 4CM3A 4AMYA 4EFDA 4J1NA 1KNXA 1MX5A 1Q7CA 4G25A 5DNAA 3V8NA 3Q7IA 1EK0A 3ICWA 4E11A 5KYWA 4FW8A 4UZEA 1GUYA 1IHDA 2OXEA 4LZNA 2G80A 1XVUA 4KPFC 5AKJA 3F5QA 1GTL1 2GESA 1MJ5A 3LZCA 2CZGA 4FN4A 4GSYA 2VZ9A 3I9JA 4MB2A 4U2DA 5K0JA 1ORHA 1W34A 3KWJA 5EEGA 2G40A 3IELA 1WEKA 4B47A 5AI8A 4D97A 4GGPA 4PQGA 1P0PA 4I8DA 3HCNA 1IHXA 3CX7A 5GVRA 5IARA 2R2AA 1C4KA 2WM2A 1TCCA 1VCNA 1DKQA 3ZOKA 3F73A 4RJJA 1RMYA 4D9IA 3K70D 4LBYA 3VKFA 4RTJA 3TM4A 1T5BA 5JCOA 3QW4B 3ZCRA 4COOA 1JG4A 3UW3A 1D2MA 3RRNA 2ZR8A 3CX3A 1E5TA 4NU0A 3T5TA 4KYUA 3QEBZ 4JI4B 3AY6A 1UOEA 1C3XA 4DLAA 2BFCA 1E5DA 4EF6A 3IJEB 4AICA 1P5JA 4OHWA 3AHCA 3ZTYA 3ZZUA 2WP0A 4D98A 1YH3A 4GMKA 4BV8A 5KHAA 2RK4A 2HNAA 2P2ZA 1OFTA 4YQEA 3JYLA 4A6XA 1H22A 2FFRA 4UCWA 1AH2A 1M6VA 4O4IB 1DEHA 1J21A 4R9NA 5E9WA 4E4YA 4QOJA 5C8YF 1NG9A 2AKEA 4GKJB 2QTVB 3K1AB 4XB2A 4E33A 1YRLA 5EZ5A 1GL6A 3VSCA 2CXPA 3VC1A 1GN9A 5BN3B 1X8XA 1XDUA 4V02A 3SYLA 3VZDA 2VF8A 3GD7A 1NUTA 2RHTA 3VPFA 5JNLA 3HXQA 3UK2A 3KAPA 3ZLTA 4EGFA 3GDHA 5K0NA 3TD2A 3C4VA 5AI6A 2WWVD 1A8QA 1ZGGA 4KH0A 3B51X 5ADVA 4DT1A 2FW6A 4JLUA 2BCEA 4TMTA 2Z83A 1UL1X 2K7ZA 4RAOA 4TLBA 4E46A 1CUZA 1CZNA 1TVKB 2VAMA 1H4TA 1Z0KA 3WLOA 4GU5A 2QQ5A 4MIYA 3PPXA 4PGGA 1IJBA 1KE2A 1L4YA 1O97D 1HEUA 2HHLA 2HI0A 1CY1A 2BUCA 2B7CA 5B1YA 4TVSA 5IDQA 4XARA 3ZCXA 3R3VA 2P40A 1XZ8A 3B53X 4Y9RA 1B93A 3HJAA 1MB4A 1Y5NA 2JJ8A 1KORA 3HUTA 3V8EA 3WX0A 5CFNA 5JYBA 3EPKA 5IYZA 1Z2EA 5JCZA 1UFVA 2VH2A 3RHTA 1BKYA 1HLGA 4L73A 2XQFA 2YVUA 3L7BA 3MK31 3W7VA 4UUAA 3WGYA 1RBYA 2IU4A 1EBUA 3AZOA 4RO0A 3PG5A 3G0GA 3HCPA 4BE9A 4EB3A 2W6IA 1T36B 1KYZA 2XTAA 2QMZA 1OYWA 1TI7A 4F9FA 3E70C 4EYOA 1SUEA 1DDIA 1H93A 2W5UA 3AL2A 1AQIA 3KLMX 4PN3A 1OGJA 4WMLA 3EFOA 3V00A 1QORA 1T24A 4LY9A 3VTAA 1YBVA 3SHWA 5A4JA 1BQEA 5HRUA 2A5GA 1UAYA 4IFIA 4CPDA 4CMAA 5JC8A 4A03A 4JDPA 1V5GA 1C9KA 4F2GA 4C4YA 3LQKA 1GRVA 4G0NA 1XD9A 4UDNA 5AT1A 4S2EA 2V6IA 5KJCA 4L0MA 2YWGA 3EDMA 2FWIA 2IZ7A 3OIDA 3WFJA 4E32A 5DNUA 1NV9A 3M1AA 1AGPA 1GGEA 5FKJA 4BFCA 1FSFA 3S5JA 1U2GC 3CNNA 1QIEA 2FRVA 3TLGA 1WIWA 3THWA 4RV5A 1XPRA 3A1EA 1TM7E 3L40A 3R6TA 2JI7A 2ZCVA 3EEBA 3MGAA 4QGBA 3DBHA 1IOZA 2P5UA 1E3DA 3AEZA 3OIUA 4PV7A 4RPKA 3ILHA 1P4SA 2FQQA 2HU8A 1JHDA 1MORA 5IVKA 5AJZA 3OP1A 2QNBA 3KS9A 4BCDA 3JY6A 3AW8A 2XDYA 3KQQA 1HO3A 3DAYA 4KPUB 4X60A 3VHRA 2QVLA 4L22A 3AI2A 3VR0A 1FCJA 4CT4B 4CTNA 4ZMBA 3VVBA 4M8IA 3V8VA 1DPFA 4MW5A 4YP9A 4L75A 2PKRA 2IL1A 1V6CA 2YW2A 1H2AS 4NJEA 4YCDA 3ZJVA 3N07A 3MILA 1V96A 3VPXA 1JH9A 3TM5A 5BP7A 3CEJA 1YR7A 3O2JA 1ZWKA 3CKMA 3V7YA 1YB5A 5E8JA 4AECA 3FTPA 5AVTA 4I46A 1R6XA 1G3UA 1AX9A 2N47A 2WU1A 3KETA 1MT0A 1VHLA 1W96A 2VJYA 4QZVA 6PFKA 4EATA 2WT9A 3SFVA 3VC7A 5A9TA 4YRGA 4HTAA 1YHZA 1FS5A 3W06A 3K6JA 5EIFA 4YP0A 1WBDA 5JPIA 4Z4EA 2GBIA 1FUEA 4HO1X 2N75A 2GTHA 4DIBA 3KG2A 2AFRA 3B48A 4RHFA 4AUEA 4AJNA 4HNAB 4BKPA 3MJDA 5C1PA 5JEEA 1PFVA 5HTOA 1I0LA 5NULA 3JWGA 4NE9A 2W8BA 3A6PC 1RRVA 1XVLA 2QYHA 3GP3A 4RVGA 3BF7A 4H60A 3V80A 5HS6A 3VU1A 4UE2A 2ECPA 2EBHX 4RPGA 4WTOA 4XYMA 3F2IA 4B32A 4MQLA 1OBHA 3PUJA 3U13A 3CIOA 3T4XA 3U4CA 2I4TA 4K3VA 4Q1EA 3F1KA 3KKOA 4UARA 4FFVA 4N8DA 1JJIA 4Y1EA 3JRNA 5KPJA 2X5NA 4KGXA 3IPXA 4UTZA 3T7IA 4XGNA 3TZKA 1FP1D 2F17A 1TZKA 4FLFA 3WIBA 4K05A 1PSZA 4Z3KA 3LZ6A 1Z34A 2B9VA 5AJVB 5IVIA 1P3Y1 3R0IA 2QSZA 5IZCC 5KOJB 3DGEC 3SIWA 1XRMA 1I0IA 1U3VA 2XDQA 3I32A 1L7DA 2TECE 2G36A 2V97A 1LDBA 2J0QA 3OAAA 1H5NA 4WIAA 5AK3A 4I9HA 4EB6B 1LTQA 3MJVA 1EGMB 3GJ8A 2CFOA 3DT8A 3GRKA 4GICA 1LLDA 2GN2A 1UC8A 1K0UA 1TQHA 1J42A 3PDJA 3G0OA 1O6FA 3K73O 4M0CA 4TT3D 3T0IA 1M8GA 1ZXXA 3QWFA 4MICA 2QENA 4M86A 4KR2A 3A28A 4PW0A 5LQSA 3FWPA 4K81B 4PG4A 4DMGA 4JHLA 3GFTA 3VKGA 3GRZA 4QNMA 5DHQA 3LTEA 4MS3A 3CF4G 3THRA 3ADKA 3HKDB 4IHJA 4ZA2A 5FTLA 2VJLA 3PFBA 3LKDA 2H5JA 1U2PA 4LA4A 3LC2O 2Z8ZA 4OHMA 3RRZA 3FB1A 2AOUB 3ZIAD 4BTLA 4HQ6A 4CG3A 4D74A 4EH1A 4BCBA 5J2UA 4TUYA 2XXAA 3LKVA 5TMBA 5CT9A 3OOWA 1G64A 3H04A 3BL6A 1NR7A 4E2XA 4D42A 4JJAA 3QI7A 3L0YA 1KY3A 3ICPA 4I1SA 3EUFA 4Z4IA 3WZ2A 3L0OA 3BB3A 1HNZB 4D4MA 3F96A 5FOWA 2PUHA 3MIZA 4I1RA 1ESZA 3ENKA 5D7NA 4Q16A 5FT9A 5BT9A 1ZR4A 1OUMA 1WW8A 2QN3A 4NENB 5IXJA 2N9UA 1I4DD 1N2CA 4X41A 2EW2A 2W70A 4HNQA 4Z3DA 1V3QE 3SS8A 3RK4A 1RZ3A 4D9KA 1G3QA 2LGJA 5HIAA 3ISVA 1DRKA 3OTOB 3NAZA 4TROA 5DGDA 2QIPA 1RPAA 3T61A 1KZ9A 3L1UA 5EP1A 2HWYA 3QK7A 1H42A 3ROQA 1FUYB 1ODKA 5JXHA 1RKVA 1ND5A 2AQ8A 4WZ6A 1YJ8A 2D4AA 3IMFA 3OH8A 4QVKA 1H0HA 1XYVA 3K20A 1W36D 4E15A 1S3FA 3O4IA 4MRSA 5B7PA 1RR6A 5JAMA 3JD4A 2IEAA 1YBFA 5LQJA 4G0ZA 3RRMA 4WI1A 2CYCA 3CJRA 2XUAA 1T25A 2NNWB 4K9OA 1GPDG 1IEXA 1C81A 1YKFA 2WUGA 4PY2A 4BATA 2EX0A 4MQFA 1ZCZA 2WWYA 4H1UA 4XYEA 2BUAA 2ZAMA 3D0KA 2NMVA 4E6EA 2OHHA 4IV8A 4TM8A 3TL3A 4EQZA 1TZBA 1LZLA 3ZWOA 2IU6A 3M6IA 5DXAA 3T95A 5KYUB 1CV2A 1RLIA 2IC5A 4G0MA 3E9MA 3R9WA 4L4SA 2IEGA 3OLZA 3KDSE 3HVIA 4KAAA 1QDLB 2ZE8A 3V4ZA 3GJ5A 6NULA 3U4DA 2C04A 2FR0A 1JDSA 2IBMA 2WWFA 3JQFC 1AUOA 5FNVF 3BIWA 2ZYUX 1N3YA 2R6ZA 2PYIA 4ZHQB 1Q77A 4U00A 1ZDMA 2YZMA 2ERXA 4CM5A 4HNHA 4B43A 1LBQA 1OWOA 3H7IA 2VP6A 2G6TA 2HWUA 4YK7A 3TR0A 1V48A 4YA6A 3L6DA 3QWBA 1GPYA 4P86A 6ADHA 3GT4A 3MWDA 5CFZA 5SY4A 4F9GA 4MULA 2G1UA 4KACA 3KB1A 4UC0A 2QROA 3DH0A 3DF7A 1A1SA 4EUSA 3E84A 1FP6A 4FQ8A 4J0CA 3TFOA 3NTQA 2XZTA 1N25A 1UBOS 1MW9X 1J0CA 1N2EA 4LYGA 1Y33E 3ZWQA 3E35A 3OCZA 3RSZA 3IVCA 1UDWA 3IQHX 5C8DA 1J8QA 1Z5WA 4XJXA 5FD8A 2LE0A 4FJ0A 4GYJA 3U7HB 1H3NA 2PCLA 4AUNA 5KWEA 1X7ZB 1Z4QA 5JUWA 4JBIA 1SVUA 1GPH1 3OLWA 3QA9A 5A04A 2HT1A 3DZKA 2V7GA 4Y0NA 1RLTA 1ITZA 1IBMB 1FU8A 4TWAA 1EQUA 4BNMA 4QTUB 3K2QA 4EYQA 4CIWA 1MRNA 3B7GA 5CRIA 3J81k 1W85A 2FW8A 1Q3TA 2DPHA 4NU8X 2BFNA 4BP1A 3O8LA 4JA2A 2PLNA 1IE3A 3GLFE 4KXFB 2F8LA 2C4TA 5CFRA 1Z2DA 3C3WA 3UKDA 3KT8A 1RTKA 3UWPA 4PPGA 4TM7A 4ZP1A 1I94B 1GZSA 2ZBRA 1EEXB 1VFPA 3GMTA 3IC5A 2HMAA 2O7VA 3LUBA 2XUKA 3TPFA 1VOTA 2V6GA 3EEOA 3NVKI 5J59A 3DCNA 3L7CA 5HQ3B 3QW2A 5KSOA 5MFPA 2F64A 1E61A 3RC9A 3SFTA 3I9LA 5GAJA 4WXEA 3V4SA 1ZNYA 3LVBA 1N6PA 1L7VC 5LBIA 3T3EA 3WDKA 2C7VA 1WVGA 4OSEA 3L05A 2WI8A 4ETNA 4KBYA 1Q7GA 2QVYX 4C78A 2QT0A 1T4CB 2CXSA 3PQ3A 2M6KA 4YLYA 4U2KA 4BFWA 4PX9A 1EK5A 3E7PA 1YAHA 1D8AA 2VDNB 2ORYA 2ZJ0A 1NP3A 3CLUC 1JLLA 1KMCA 1HQYE 1KL7A 3IIJA 1BGWA 2XRMA 3NCHA 4QU0A 5BN3A 5JSQA 4OBBA 2YHIA 3UK1A 4YR7A 1JI0A 4KITB 2GAJA 3HNPA 2FZ5A 3E61A 3K0FA 2AYZA 5JQWA 4G01B 1ZZGA 1R4MA 3QMPA 4RWEA 2AC2A 1NBAA 3GLQA 1JA9A 1U2EA 3AW9A 5DOZA 4IZ6A 2PGLA 1E63A 1AGXA 2AN9A 3OCJA 5IJXA 3T34A 2H59A 5HRAA 4JELA 3NORA 2NU9A 4OHRA 3BGWA 3CZCA 3PXCX 4UBIA 1JGTA 5BUZA 1PJ4A 3IXMA 4OQZA 3WQSB 4UPEA 2VSNA 2V1UA 4QGHA 3T7TA 3ZHBA 1OROA 4FYIA 1CS4C 3D8SA 1M67A 3IH5A 5BPFA 3A0UA 3F5DA 3D4IA 2WE7A 5FF9A 1X38A 3GDFA 4KIFA 1TADA 4DZTA 3CW9A 2C5HA 3OPXA 4MO9A 1JLMA 3GJYA 1GL9B 5JBIA 4GXNA 2BR3A 2BEUB 2QD5A 1TKBA 2VC2B 2QR5A 5TV2A 4UBOA 4YNBA 1P5ZB 2GM9A 2XH8A 4RD4A 4DY4A 2N42A 1Z75A 4WLUA 3FNIA 3DZGA 4ISBA 3E18A 5CVUA 2WYWA 3FWZA 2XOKD 4LS3A 3IPAA 4M99A 5KYUA 4HYTA 2ADOA 4WLOA 3DVLA 3QMWA 3SS7X 5CVTA 3D7NA 5ICGA 2LZ0A 2RGYA 2VHXA 1N7JA 3KJQA 10MHA 4Y2RA 3OU6A 5A9SB 3EY4A 5FLYA 3SDZA 2V7XA 1M1NB 3P0JA 4RX1A 3OE1A 1LDEA 2B5VA 4LX0A 4YCBA 1P75A 4BKRA 4RY8A 5AW2A 2PIDA 2IUEA 4ER7A 4R98A 5B1IA 4AMVA 4R8LA 3K9GA 3FUWA 4FX2A 1TAQA 3A2KA 3CY6A 2YNMD 5ECWA 1P4AA 1I8TA 1ZGAA 4QG3A 3BEDA 4N40A 1KMMA 3C6YA 5LKAA 4X3CA 3CVVA 2ZZMA 2YWXA 2X5JO 2JK1A 4LY3A 5TXGA 2FG6C 3CKKA 1D1SA 1ZCFA 4KQHA 1SHTX 3ZK7A 4WASA 3OUUA 4B83A 3GYGA 4B75A 2O52A 4BV2A 1T9KA 2AG8A 1HKUA 1ADCA 3EIFA 4GOND 4YJKA 4A26A 1CZOA 2PFGA 4O4LA 5HF9A 4KV9A 5LWHA 1ODCA 1IDOA 1QCDA 1VFNA 4MAAA 2UU9B 4HWPA 1GFSA 2C9MA 4M7PA 1BX0A 2GDJA 3IR7A 2FJ0A 3LFHA 4Z1MD 4G41A 8ADHA 2G17A 1E4OA 1F8GA 1DQRA 1UJBA 1H6DA 5K4HA 1AF7A 1X7YB 1NZJA 3E1KA 1Z5ZA 1RBMA 2PD6A 1P81A 3OX3A 2ZT5A 2I87A 1JHYA 1VTKA 3UTCA 1I7SB 3MWJA 1U5BA 1LKZA 3OIFA 1Z7BA 3TQTA 3R5FA 3IKTA 4IJWA 1BMFA 2WNIA 1EVZA 3SK0A 2I1LA 5L45A 3KXKA 1VJTA 2J9YB 3B1KA 1F4VA 3CBQA 2KS6A 3L8HA 2BW0A 1Y1QA 1FQOA 2OK7A 2Y0DA 4PYQA 2R8YA 5HFAA 4S35A 1TK3A 4X1IB 3I5YA 1XN1A 1XR3A 1F1BA 2O2HA 4AQYB 1ACMA 4ZAVA 5DXJA 4EKDA 2WJJA 1Z47A 1P4JA 3JQFA 4LRSB 1GPMA 2QPTA 4NBVA 4M83A 3NUQA 4HNAA 3LT4A 1ENPA 2O3UA 4U7PB 1D2HA 2IYTA 4N39A 4CF3A 2IRWA 4GOMD 5SZHB 1Z6GA 4QOEA 4QTZA 1KJWA 1E3JA 2B0CA 5LYYA 3L82B 3L7DA 4MYSA 2G04A 1FRFS 1FRVA 2Y1DA 3FVQA 1IVSA 4R83A 4LN1A 4RH0A 1J1ZA 1K7YA 1MU0A 3ESRA 4XA8A 5JYCA 4N41A 2IZ6A 1XAGA 2VBGA 2ZITA 4CM6A 3AIKA 3HS3A 3K5PA 1Z0IA 4AUMA 2C7GA 5LMNB 3FOWA 3JQPA 2YQ5A 4X7PA 4B85A 3AUFA 5EQTA 4E14A 2E4WA 5LN1A 2G1PA 4AM8A 1EH5A 2W6JA 1UWKA 3D1JA 4H35A 3PUXA 4E94A 1XQ9A 4Z54A 2CHVA 2AZXA 2DTDA 4EW3A 3G2KA 4OQ4A 1R0XA 5FCDA 5JD4A 1H6CA 3GZ4A 5IAGA 1SUSA 2Z5GA 1DO2A 3AZQA 4RHTA 2RHJA 3THWB 4TL7A 5TARA 1AU9A 3SJCA 2PX8A 3TLKA 4WLVA 1AKVA 1Z6XA 2K5UA 4OL9A 4ZI7A 4IG9A 4ZMSA 2NTYC 2H00A 3RT7A 3HDTA 2PMDA 3DEZA 1XDSA 3U1TA 2WF8A 5GV7A 4KQXA 2GI4A 4RLQA 1DPGA 1EJ6A 4BFXA 1W1IA 2XAUA 1XU4A 2Z1DA 5HE9A 1GL3A 5DOVA 5H02A 5KKAA 5LNK6 3T41A 3LUAA 4QKQA 4KPGA 1ZM2A 2JC3A 4WADA 3T5GA 2O6LA 4AMGA 1DX4A 2GN4A 3KR1A 2GM4A 2QTAA 3A1WA 1UBHS 1M74A 5JTTA 3V4FA 2EHDA 1KPHA 2XW6A 5KOJA 4NCHA 4DC0A 1SQ6A 1VG9B 3QUAA 4OO3A 2I0FA 4AZTA 1U0FA 3GC6A 1H2WA 2BP7B 5REQA 1JR3D 1KZ4A 3PUKA 1IY0A 4Q1CA 4A0RA 3D3KA 4PHGA 5BR8B 2AI2A 3DF9A 4XAQA 1QQ7A 4LPKA 2AK2A 2ECKA 4AC9A 5HK8A 5LL6P 3CZPA 4XLTA 1V7PC 2Q4EA 1IN6A 2XDAA 3QWHA 4JNKA 4REOA 1T2UA 2RH5A 2FPPB 3QKUA 2AOWA 4DCVA 3D6AA 1PHRA 1ZJ4A 5A5DA 2I2XB 4RZQA 2ZKIA 2JAHA 4L9SA 2Y4NA 2OCAA 1CQWA 3ENQA 3LSTA 3TTSA 5G4LA 4L4YA 5HOEA 2OGWA 3NLLA 1M6YA 3A6HA 5FOSA 1MGOA 2Y99A 2IS4A 4FW9A 2IHUA 4W63A 1EGVB 1MOZA 3RUFA 4UHFA 1LI4A 3F6BX 2ZUVA 5B6IA 1C3LA 4ZVLA 4UMVA 3JAWB 4RLFA 2CW5A 2WEKA 3BH0A 5AUNB 1MQAA 3SFZA 4RETA 3WKEA 2PUCA 1VBKA 1T9CA 1PQUA 2NVOA 1KXZA 3HZHA 4QU5A 1R12A 3V97A 3W05A 4CFYA 3U5ZB 1X7YA 2DWUA 1CUCA 1Y0BA 2ISSD 2G72A 3B2EA 3I58A 3JYHA 5B3AA 3VNSA 1NT4A 4RD6A 4XD2A 3M9XA 1T4MA 5EEHA 3H84A 1NU8A 2VZ0A 3O8OB 5GQSA 1P0IA 2G06A 4OI0A 4PSUA 3L7OA 1JBKA 4MQ5A 4HGNA 4HQFA 3UZUA 1NURA 1O8CA 1GRQA 1Z4MA 4IM7A 4BNVA 3EZ2A 1ZAYA 4QJ4A 4B3FX 3K4PA 1K6EA 2QRUA 1DXYA 2TS1A 5BVGA 5SZKB 2Q45A 4AROA 4I4LA 3SF8B 5LSAA 1YT5A 3HJRA 1A8SA 1WMSA 2YHAA 1UK7A 1GSHA 2IWHA 3X1DA 2Z2YA 3DBLB 3KAQA 3O0DA 5AKYA 3SCZA 4OHYA 2QM8A 4JLDA 5EIBD 1JR3E 1UKCA 5AUOB 2R7AA 2A9QA 1N8KA 3VZCA 3G49A 4M6WA 4NSNA 1PLLA 2HF2A 4ECAA 1C9JA 1WCV1 3WWEA 4OP2A 1IZ8A 1Q0ZA 4IKOA 5EWJA 2I8AA 5JATA 1CUUA 3OZUA 2ECOA 5BRNA 3V4PB 5ALKA 2VTBB 5IJZA 3WK7A 1EFLA 3C8DA 3HGMA 3FUCA 1Z35A 1KJJA 2IP1A 1DLJA 2O8NA 4N0PA 4PQFA 4IRUB 4QYSA 3EFHA 3OQHA 1F14A 2JBAA 2Z30A 3ES9A 2JFWA 1TRKA 5IP5A 4PYNA 1Y4AE 3OETA 2AJBA 2VOJA 4EX6A 1AZTA 1E79D 3N28A 2WUEA 4KQGA 1NASA 2XD4A 4JU8A 1J8YF 3H42B 4Z6KA 4RK0A 2BI4A 1SUCA 2FWAA 2PQMA 5G3ZA 5F35A 2GAIA 4KUEA 1A04A 1Z6PA 3IT2A 1JHOA 3HNRA 3NTOA 1NN1A 1QANA 3CH5A 4FKZA 3AKDA 3HUDA 3WLTA 2AXPA 2NWQA 4TXJA 3RS0A 5MHTA 1ZLXA 4S04A 4XI9A 5GM2A 1X8LA 1M6HA 1QTNA 3RIMA 3T99A 4EI9A 2H0RA 1QHIA 2IYEA 3CT4A 4X44A 1PTJA 1YL7A 3K1TA 1XCLA 1RRPA 1I1OA 4PLPA 3V4VB 1SD2A 2GZSA 4OM7A 3MMXA 4DRXB 2FPIA 5LWQA 1TIKA 3WS7A 4C21A 1L7XA 3ENNA 1ORIA 4H08A 5AW3A 4Q3EA 2W48A 4XASA 3WOHA 5L95A 3LY8A 4Y1FA 1MRSA 3S2SA 3MWKA 1UPFA 2V0NA 4LJYA 4BB5A 4HX5A 4R7GA 2JNWA 1YA4A 1JBEA 2C4UA 3HU1A 4WBNB 4DR4B 2O8DB 1PSWA 4XYLA 5JAHA 3FD8A 4I6EA 1OJ7A 4NABA 4BKQA 1K2VN 3KWLA 3RUHA 3PSAA 3KKZA 3QXXA 4MP6A 1XQ1A 4JH0A 5DTIA 3FETA 3V55A 1ZH2A 3OM8A 1SCUB 3A14A 3GDOA 5FADA 1XDWA 3TW6A 3ZZNA 1E7YA 3WRYA 1YHYA 4BO5A 3N8IA 2CLLB 4IH4A 1MG5A 3AY7A 1HF3A 5ENVA 1W49A 3DC7A 1SKQA 3UW1A 2QUJA 2BGWA 4PAQA 3U3ZA 5G0VA 2ZI3A 4CMEC 4WOJA 3QLEA 3RHZA 5BQOA 4W4TA 3O8QB 3PITA 3IV6A 2HU2A 2VWHA 1GCUA 1CLEA 1CUXA 2CYBA 3HY3A 5FBLB 1B8NA 2BSQA 4GMFA 1E0DA 5JWRA 3AHDA 4GX0A 5THKA 5E3JA 2YVKA 3BG5A 3R76A 3TRDA 1ZOLA 1OLSB 1ZD3A 1RIFA 3KPJA 3ADBA 3WL5A 3TRIA 2ALJA 4F5WA 5DV9A 4ZDWA 5HM8A 3LYHA 3A1SA 3CJTA 4RCZA 2PO7A 1XRPA 5JY1A 1Z8HA 1N5LA 3D64A 3U4IA 1V8OA 4N3CA 4X1IA 4NC9A 1AB6A 2P4SA 3SSOA 3JQAB 2IHNA 5C53B 4ERNA 4IGKA 3ZU5A 3BXGA 4E12A 5M04A 2P3OA 2EKDA 3K94A 3BXEA 3O8OA 1HSOA 3K7EA 3RS4A 1UDRA 4UFPA 4GWGA 5H80A 1KSGA 3IQWA 1TTQB 1HTWA 4AULA 5KSYA 2RAFA 4Y9UA 1VSBA 3VNBA 1YZHA 4PRZA 4QHYA 1LRJA 1U2RA 3RHSA 1X1TA 4TRNA 4BNNA 4NCBA 3QF4B 5C5IA 5EGSA 3C41J 3ZY6A 5JZOA 1QQ5A 2OBNA 1PWHA 3EW9A 1EWQA 1VE6A 4MJXA 2C9DA 5C1DA 4KI7A 5EMLA 4A8HA 5KNDA 2K2WA 5DASA 3JW8A 5I51A 2WTMA 1E69A 3ZHXA 1GNTA 2XNDD 3H1PA 4XWOA 4IIEA 5B12A 5A4KA 1J0EA 3D43A 4W7IA 5LBTA 1MP0A 2CHQA 1GUDA 4CF4A 3ROMA 3UJNA 1CJBA 3RYTC 1G8KA 4DG8A 4OAQA 5IASA 3V8QA 3OA0A 5KTYA 5JSFA 4HZIA 2D06A 2VSQA 2RHHA 1FUIA 4BRWA 4DLNA 5I45A 5I7SA 3EVZA 1NI3A 2OMKA 1E62A 5GJBA 3A9UA 2OD9A 4RHXA 4JV5B 1E59A 1XZJA 1W1WA 2H7CA 3FBWA 3JTMA 5JMTA 2NVBA 4KE7A 4BQFA 4NE7A 1F7UA 3LA8A 3QVJA 1D4FA 1EX7A 3IKVA 5CB4A 3ANSA 5G4KA 2OZLB 2DAPA 4LTDA 4CQJA 1Q1EA 1VYTA 1C1XA 2HZ7A 1BN7A 1KPGA 1MF7A 2VA9A 4KN8A 3OD5A 4MCIA 2NUPB 2PX6A 4JJZA 4DMUB 2R79A 1ICEA 3UMJA 4HX2A 5TC4A 3RBXA 1CY0A 3PS9A 1WVIA 1Y7HA 5BYBA 3C48A 1RXSA 2OV1A 3VKUA 4UXIA 3AVPA 4JUFA 2R8PA 4RANA 4CLRA 2FP3A 2FEXA 2IP2A 4PICA 3FLAA 1YU6A 2ACEA 2VNIA 4KDRA 1KI4A 3H0EA 1WZNA 3OQ1A 1UR5A 1JH8A 2CXUA 2H7YA 2ZYHA 5LFAA 7MHTA 2ZJ7A 3COPA 1C7RA 1P33A 2GF0A 4RCVA 2XUOA 3PJEA 2H1HA 2XT0A 2XLBA 2EDCA 2AOVA 3P0IA 2R6FA 1NW5A 3RPEA 2ILVA 3VR4D 3OQMA 3G9QA 3PD0A 4L74A 3K9QO 3O38A 4XOIA 5HKBA 1WNFA 1W8DA 1GTSA 3AHIA 3A1DA 4OI2A 4Q7JB 5HILA 3TQQA 5LOVF 1SXHA 1ZINA 3KYDA 1U98A 3NKFA 3VPHA 4UQOA 4BOYA 5ITZA 2UVQA 2VATA 5BNTA 3LBIA 8LDHA 2EYQA 2H1VA 2QLNA 4M4SA 2QL7A 5EY5B 3R9XB 1T5TA 4QUEA 1XEAA 3ZTTA 3PHJA 1X3LA 4RIEA 2PRYA 4WERA 2NPOA 4Y0VA 5LD2B 3ETEA 3P20A 5D3KA 1EP1B 4D7AA 4QDOA 2HA7A 4IV0A 4DDUA 1CQJA 3N7TA 3AUXA 1BFDA 1V37A 1QB8A 1IQPA 1JALA 2OV3A 4DVJA 3AB3A 2FOXA 4MVCA 1XZBA 1L5LA 1AN9A 1QE5A 4FFLA 2PUGA 3GPLA 3RYHA 2H4ZA 1D9XA