2R93K

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
molecule tags Transferase/rna
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r93K00
2A6EA 3FKIC 1HQMA 3GTPK 4NOIA 5C4JC 1I6HK 3K7AK 5TMCA 3S1MK 3S16K 4QIWD 2A69A 4A3IC 3S2HC 4Q5SA 4A3JK 1TWCK 3WODA 2JA6K 5M3FK 1YNNA 4LLGA 3PO3C 4LK1A 5IYBK 3S1NC 2BE5A 3EQLA 3HOWC 2NVYK 3H3VD 3HOVK 5IYCK 3I4NK 4BBRC 3HOYC 3GTLC 4BY1K 4A3BK 1I50C 4BY7C 4JK1A 4YFXA 4G7HA 4A3EC 2JA7K 3GTGK 4BXXK 1ZYRA 4A3MK 2NVTC 2NVQK 3GTKC 4X6AK 1K83K 3HKZL 5C4XC 2CW0A 1TWFC 4A3CK 3S1QK 4OIRA 4A3EK 1Y1VK 4A3KK 4BBSK 1Y1WK 3GTMK 3K7AC 3GTKK 1I6HC 4YFKA 4G7ZA 3S1MC 3S16C 1WCMK 3HOZK 4A3JC 1TWCC 2JA6C 1I6VA 1XPPA 4C3JK 2R92K 3HOUK 3HKZD 5IYBC 4GZYA 3HOVC 3I4NC 2NVYC 5M3MK 4A3BC 5IYCC 5D4DA 4OINA 4BY1C 3S15K 3S2DK 2O5IA 4LK0A 2JA7C 1SMYA 2A68A 3GTGC 3I4MK 4BXXC 4X6AC 1I3QK 4A3MC 1YNJA 2NVQC 4C3HK 1K83C 5IP7K 3H0GK 4QJVB 2E2HK 3PO2K 3S1QC 4A3CC 4XLPA 1Y1VC 4AYBL 4A3KC 4XSZA 2R7ZK 4BBSC 1Y1WC 3GTMC 3M4OK 3DXJA 4KN4A 2E2IK 1WCMC 4Y7NK 3S14K 5TMFA 3HOZC 3GTJK 3RZOK 4C2MK 2R92C 4A3FK 3HOUC 2A6HA 5M5XK 5IYDK 4YFNA 2YU9K 4A3GK 4A3DC 4AYBD 3S15C 3S2DC 5C3EK 4A3LK 4OIPA 4A3DK 4ZH4A 2JA8K 3I4MC 1I3QC 2R93K 4MEYA 1TWHK 5IP7C 3H0GC 3HOXK 4MEXA 2E2HC 2VUMK 3GTQK 3PO2C 1SFOK 2R7ZC 1TWAC 3M4OC 5C44K 4Q4ZA 5M5YK 3S1RC 2E2IC 3GTOK 3RZDK 4Y7NC 3S14C 4LJZA 5FLMC 3GTJC 2B63C 4Y52K 4XSXA 1TWAK 2JA5K 3RZOC 3S1RK 4A3FC 5IYDC 3S17K 4A93K 2NVXK 2YU9C 2PA8L 5FLMK 5IP9K 4A3GC 3CQZK 2B63K 3M3YK 1R9TK 5FJ8K 4XLNA 1IW7A 2Y0SL 2PMZL 2WAQL 5C3EC 4A3LC 3FKIK 5C4JK 2E2JC 2JA8C 2R93C 2WB1L 1TWHC 3GTQC 3HOXC 4OIQA 4A3IK 2VUMC 3S2HK 4KN7A 1SFOC 2E2JK 2PA8D 4QJVA 5C44C 3GTOC 2O5JA 3PO3K 2Y0SD 4OIOA 3S1NK 3RZDC 2WAQD 2PMZD 3HOWK 4G7OA 3HOYK 4MQ9A 4BBRK 4Y52C 3GTLK 2JA5C 1I50K 4QIWL 4BY7K 2PPBA 3S17C 2WB1D 1TWGC 4YG2A 4C3IK 2NVXC 4A93C 4KMUA 5IP9C 3CQZC 3GTPC 3M3YC 5M5WK 1R9TC 2NVTK 5C4XK 1TWFK 3H3VL 1BDFA 1TWGK
chains in the Genus database with same CATH superfamily
2A6EA 3FKIC 1HQMA 5C4JC 1IBAA 1XXBA 3K7AK 4QIWD 2A69A 1O26A 4GTCA 2YU9A 1X31C 2JA6K 3IPJA 3GIRA 2BE5A 3HOVK 2NVYK 3ADAC 4A3BK 1YX2A 1I50C 1VRQC 1IQ0A 2JA7K 1EH1A 1SFOA 3GTGK 4A3MK 3GTKC 1EI6A 3HKZL 2CW0A 4A3KK 4KASA 1ZXOA 2JA5A 3AD9C 1WCMK 2RH6A 3GTPA 3T01A 3CQZA 1WSVA 1I6VA 3HOUK 1ISEA 3HKZD 1WIHA 5IYBC 5M3MK 5IYCC 1F93A 3GSIA 4BY1C 3TFJA 2O5IA 1WQFA 4X6AC 1I3QK 2NVQC 5IP7K 4QJVB 2E2HK 4A3CC 3TFIA 4XLPA 1O24A 1Y1VC 3L4KA 3GTLA 5TMFA 1B4BA 4PABA 3RZOK 3GTMA 4C2MK 2A6HA 5M5XK 3S15C 2GSUA 4A3LK 2GAGC 4ZH4A 2JA6A 4C3HC 4RMFA 3PO2C 3H0GC 2KWAA 3HOXK 4MEXA 2VUMK 2NVYA 1XZPA 3LAJA 3GTOK 5M5YK 2E2IC 1J6XA 4BKWA 2JA7A 4LJZA 3GTJC 1F9NA 2B63C 4Y52K 5L46A 3V4GA 4A3FC 4KM9A 4A3GC 3M3YK 4WJ3M 1DCOA 5C3EC 1WCMA 1DD5A 4KB4A 2E2JC 1IE0A 2R93C 2WB1L 1TWHC 4OIQA 2FQTA 1IS1A 4KN7A 3LPXA 5C44C 3S1NK 3HOYK 1WQGA 4BBRK 1WSRA 2CFAB 1I3QA 1XZPB 5IORA 2E2HA 2WB1D 1TWGC 2NVXC 4KMUA 4FZBA 3GTPK 1J6WA 4NOIA 4AH6A 1JVIA 5IOQA 4A3IC 4A3JK 3PO3C 3AQOA 3HOWC 3AQPA 1O2FB 2VUMA 4G7HA 1L0WA 1YCLA 4BXXK 3QX3A 1K83K 3GTOA 3VA7A 5C4XC 1WOOA 1TWFC 4A3EK 3BP3A 1Y1WK 3GTMK 1I6HC 3S1MC 3S16C 1J98A 1VLOA 4KMHA 4FM9A 1EFWA 1V5VA 1TWCC 4C3JK 4GZYA 3I4NC 3LAPA 1UV7A 1B4AA 4ILDA 3GEIA 4LK0A 1SMYA 3I4MK 3Q3QA 2GAHC 3S1QC 4AYBL 2R7ZK 4BBSC 4C2MC 5JVOA 1EK8A 4Y7NK 3HOZC 3OPFA 3MMLB 3OREA 2R92C 4DDQA 4AYBD 4GTLA 3S2DC 4OIPA 4A3DK 1O2AA 3GTQK 1JOEA 4WILA 3M4OC 5EGEA 3G4CA 4KARA 3S14C 4XSXA 3S1RK 3N0CA 1K83A 5IYDC 3FOEA 2YU9C 1J6VA 5FLMK 3GTJA 1R9TK 1Y1WA 1IW7A 2Y0SL 4O2DA 2PMZL 2WAQL 3FKIK 5C4JK 2JA8C 4WJ4A 4G0UA 1XXCA 1SFOC 2R93A 3G4AA 2JH3A 3GEEA 4G0VA 2Y0SD 4GTAA 3RZDC 2WAQD 2Y3PA 2PMZD 2ZUEA 1O2BA 4MQ9A 2P8TA 4KC6A 1I50K 2JA5C 1GE9A 3S17C 3TTGA 4YG2A 4A93C 3T00A 5IP9C 1VH2A 3CQZC 3GTPC 2R7ZA 5M5WK 1TWAA 5HL8A 1EQRA 3A8JA 1JQWA 1O25A 3BP8C 3S2HC 4Q5SA 3WODA 5IYBK 4LR2A 3EQLA 3T02A 3A8IA 5IYCK 3GEHA 3GTLC 4BY1K 4BY7C 1WQHA 4J3NA 4JK1A 3GTQA 1O27A 4A3EC 4C3IC 1BJTA 3N3YA 4X6AK 2NVTC 2NVQK 4A3CK 1F7UA 1Y1VK 1USOA 3K7AC 3FOFA 1TWFA 3JSTA 2GSNA 3FHZA 3AH5A 1R9TA 2JA6C 4P5BA 1INNA 1XPPA 2V6TA 5IOTA 3HOVC 2NVYC 4GTBA 3FKIA 4A3BC 5D4DA 4OINA 3S15K 2JA7C 3GTGC 4A3MC 4C3HK 3PO2K 3H0GK 3SZZA 1VGXA 4A3KC 4XSZA 2W7VA 1WORA 1I50A 4KN4A 4GTEA 2E2IK 1WCMC 2V6SA 3GTJK 1C0AA 3GTKA 3HOUC 4A3FK 4YFNA 3ERED 4A3GK 4A3DC 5C3EK 1I3QC 2R93K 4MEYA 1TWHK 5IP7C 2E2HC 4PAAA 5C44K 4Q4ZA 3S1RC 1BS2A 5FLMC 3A8KA 4C45A 1TWAK 3RZOC 1KQ4A 2NVXK 2PA8L 1Y1VA 1ZVUA 1ZBSA 1O28A 5EGHA 4XLNA 1G51A 4G0WA 2EBBA 4A3LC 1DCHA 5E68A 3BUEA 3HOXC 4A3IK 2VUMC 2ZFZA 4M1XA 2PA8D 4QJVA 3GTOC 3PO3K 2XCOA 3HOWK 4KATA 4Y52C 3N0BA 1XXAA 3H0GA 3TFHA 2PPBA 4LOWA 1AB4A 3M3YC 2P5MA 5C4XK 1PJ5A 1TWFK 3H3VL 1BDFA 2E2IA 2B63A 1I6HK 5JFEA 5TMCA 3S1MK 3S16K 1TWCK 1YNNA 4LLGA 1USMA 4LK1A 3S1NC 1O29A 3I4NK 2O5JA 3H3VD 3HOYC 4BBRC 4GFQA 1TWHA 4YFXA 3OEPA 4KAWX 5CJ9A 1ZYRA 4XCHA 3S1QK 4BLBA 3CAGA 4OIRA 1F7VA 4BBSK 3GTKK 1PJ6A 4YFKA 4G7ZA 1TWGA 3SZYA 2NVXA 3HOZK 4KB2A 4A3JC 1WOSA 2R92K 4GTFA 1VJEA 2PHCB 2D6FC 4GT9A 3S2DK 4P9SA 4BLAA 2A68A 2CFAA 4BXXC 1YNJA 1K83C 5IOSA 3GTGA 1Y1WC 3GTMC 3M4OK 3DXJA 4KDDA 3HXAA 3S14K 3S0XA 1DCPA 1WOPA 4C3JC 5IYDK 5TJ3A 1IL2A 2YU9K 5CHPA 3I4MC 2JA8K 4KMDA 1TWCA 1BGWA 2GSOA 1HI9A 3GDZA 4LQYA 1SFOK 4P5AA 2R7ZC 1TWAC 4GTDA 3RZDK 4Y7NC 4KMAA 2JA5K 1XZQA 2XCRB 3S17K 4A93K 5IP9K 3CQZK 3L4JA 2B63K 5FJ8K 2XCQA 2ZUFA 2RGRA 3AD7C 3GTQC 2R92A 3S2HK 2E2JK 3NUHA 2FQOA 4OIOA 4G7OA 1ZQ1C 3GTLK 4BY7K 1RU0A 4QIWL 1PJ7A 4C3IK 2V6UA 1R9TC 2NVTK 1XZQB 3AD8C 5M3FK 4KM8A 1TWGK
chains in the Genus database with same CATH topology
2A6EA 3FKIC 1HQMA 3GTPK 4NOIA 5C4JC 1I6HK 3K7AK 5TMCA 3S1MK 3S16K 4QIWD 2A69A 4A3IC 3S2HC 4Q5SA 4A3JK 1TWCK 3WODA 2JA6K 5M3FK 1YNNA 4LLGA 3PO3C 4LK1A 5IYBK 3S1NC 2BE5A 3EQLA 3HOWC 2NVYK 3H3VD 3HOVK 5IYCK 3I4NK 4BBRC 3HOYC 3GTLC 4BY1K 4A3BK 1I50C 4BY7C 4JK1A 4YFXA 4G7HA 4A3EC 2JA7K 3GTGK 4BXXK 1ZYRA 4A3MK 2NVTC 2NVQK 3GTKC 4X6AK 1K83K 3HKZL 5C4XC 2CW0A 1TWFC 4A3CK 3S1QK 4OIRA 4A3EK 1Y1VK 4A3KK 4BBSK 1Y1WK 3GTMK 3K7AC 3GTKK 1I6HC 4YFKA 4G7ZA 3S1MC 3S16C 1WCMK 3HOZK 4A3JC 1TWCC 2JA6C 1I6VA 1XPPA 4C3JK 2R92K 3HOUK 3HKZD 5IYBC 4GZYA 3HOVC 3I4NC 2NVYC 5M3MK 4A3BC 5IYCC 5D4DA 4OINA 4BY1C 3S15K 3S2DK 2O5IA 4LK0A 2JA7C 1SMYA 2A68A 3GTGC 3I4MK 4BXXC 4X6AC 1I3QK 4A3MC 1YNJA 2NVQC 4C3HK 1K83C 5IP7K 3H0GK 4QJVB 2E2HK 3PO2K 3S1QC 4A3CC 4XLPA 1Y1VC 4AYBL 4A3KC 4XSZA 2R7ZK 4BBSC 1Y1WC 3GTMC 3M4OK 3DXJA 4KN4A 2E2IK 1WCMC 4Y7NK 3S14K 5TMFA 3HOZC 3GTJK 3RZOK 4C2MK 2R92C 4A3FK 3HOUC 2A6HA 5M5XK 5IYDK 4YFNA 2YU9K 4A3GK 4A3DC 4AYBD 3S15C 3S2DC 5C3EK 4A3LK 4OIPA 4A3DK 4ZH4A 2JA8K 3I4MC 1I3QC 2R93K 4MEYA 1TWHK 5IP7C 3H0GC 3HOXK 4MEXA 2E2HC 2VUMK 3GTQK 3PO2C 1SFOK 2R7ZC 1TWAC 3M4OC 5C44K 4Q4ZA 5M5YK 3S1RC 2E2IC 3GTOK 3RZDK 4Y7NC 3S14C 4LJZA 5FLMC 3GTJC 2B63C 4Y52K 4XSXA 1TWAK 2JA5K 3RZOC 3S1RK 4A3FC 5IYDC 3S17K 4A93K 2NVXK 2YU9C 2PA8L 5FLMK 5IP9K 4A3GC 3CQZK 2B63K 3M3YK 1R9TK 5FJ8K 4XLNA 1IW7A 2Y0SL 2PMZL 2WAQL 5C3EC 4A3LC 3FKIK 5C4JK 2E2JC 2JA8C 2R93C 2WB1L 1TWHC 3GTQC 3HOXC 4OIQA 4A3IK 2VUMC 3S2HK 4KN7A 1SFOC 2E2JK 2PA8D 4QJVA 5C44C 3GTOC 2O5JA 3PO3K 2Y0SD 4OIOA 3S1NK 3RZDC 2WAQD 2PMZD 3HOWK 4G7OA 3HOYK 4MQ9A 4BBRK 4Y52C 3GTLK 2JA5C 1I50K 4QIWL 4BY7K 2PPBA 3S17C 2WB1D 1TWGC 4YG2A 4C3IK 2NVXC 4A93C 4KMUA 5IP9C 3CQZC 3GTPC 3M3YC 5M5WK 1R9TC 2NVTK 5C4XK 1TWFK 3H3VL 1BDFA 1TWGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6E A;  3FKI C;  1HQM A;  3GTP K;  4NOI A;  5C4J C;  1I6H K;  3K7A K;  5TMC A;  3S1M K;  3S16 K;  4QIW D;  2A69 A;  4A3I C;  3S2H C;  4Q5S A;  4A3J K;  1TWC K;  3WOD A;  2JA6 K;  5M3F K;  1YNN A;  4LLG A;  3PO3 C;  4LK1 A;  5IYB K;  3S1N C;  2BE5 A;  3EQL A;  3HOW C;  2NVY K;  3H3V D;  3HOV K;  5IYC K;  3I4N K;  4BBR C;  3HOY C;  3GTL C;  4BY1 K;  4A3B K;  1I50 C;  4BY7 C;  4JK1 A;  4YFX A;  4G7H A;  4A3E C;  2JA7 K;  3GTG K;  4BXX K;  1ZYR A;  4A3M K;  2NVT C;  2NVQ K;  3GTK C;  4X6A K;  1K83 K;  3HKZ L;  5C4X C;  2CW0 A;  1TWF C;  4A3C K;  3S1Q K;  4OIR A;  4A3E K;  1Y1V K;  4A3K K;  4BBS K;  1Y1W K;  3GTM K;  3K7A C;  3GTK K;  1I6H C;  4YFK A;  4G7Z A;  3S1M C;  3S16 C;  1WCM K;  3HOZ K;  4A3J C;  1TWC C;  2JA6 C;  1I6V A;  1XPP A;  4C3J K;  2R92 K;  3HOU K;  3HKZ D;  5IYB C;  4GZY A;  3HOV C;  3I4N C;  2NVY C;  5M3M K;  4A3B C;  5IYC C;  5D4D A;  4OIN A;  4BY1 C;  3S15 K;  3S2D K;  2O5I A;  4LK0 A;  2JA7 C;  1SMY A;  2A68 A;  3GTG C;  3I4M K;  4BXX C;  4X6A C;  1I3Q K;  4A3M C;  1YNJ A;  2NVQ C;  4C3H K;  1K83 C;  5IP7 K;  3H0G K;  4QJV B;  2E2H K;  3PO2 K;  3S1Q C;  4A3C C;  4XLP A;  1Y1V C;  4AYB L;  4A3K C;  4XSZ A;  2R7Z K;  4BBS C;  1Y1W C;  3GTM C;  3M4O K;  3DXJ A;  4KN4 A;  2E2I K;  1WCM C;  4Y7N K;  3S14 K;  5TMF A;  3HOZ C;  3GTJ K;  3RZO K;  4C2M K;  2R92 C;  4A3F K;  3HOU C;  2A6H A;  5M5X K;  5IYD K;  4YFN A;  2YU9 K;  4A3G K;  4A3D C;  4AYB D;  3S15 C;  3S2D C;  5C3E K;  4A3L K;  4OIP A;  4A3D K;  4ZH4 A;  2JA8 K;  3I4M C;  1I3Q C;  2R93 K;  4MEY A;  1TWH K;  5IP7 C;  3H0G C;  3HOX K;  4MEX A;  2E2H C;  2VUM K;  3GTQ K;  3PO2 C;  1SFO K;  2R7Z C;  1TWA C;  3M4O C;  5C44 K;  4Q4Z A;  5M5Y K;  3S1R C;  2E2I C;  3GTO K;  3RZD K;  4Y7N C;  3S14 C;  4LJZ A;  5FLM C;  3GTJ C;  2B63 C;  4Y52 K;  4XSX A;  1TWA K;  2JA5 K;  3RZO C;  3S1R K;  4A3F C;  5IYD C;  3S17 K;  4A93 K;  2NVX K;  2YU9 C;  2PA8 L;  5FLM K;  5IP9 K;  4A3G C;  3CQZ K;  2B63 K;  3M3Y K;  1R9T K;  5FJ8 K;  4XLN A;  1IW7 A;  2Y0S L;  2PMZ L;  2WAQ L;  5C3E C;  4A3L C;  3FKI K;  5C4J K;  2E2J C;  2JA8 C;  2R93 C;  2WB1 L;  1TWH C;  3GTQ C;  3HOX C;  4OIQ A;  4A3I K;  2VUM C;  3S2H K;  4KN7 A;  1SFO C;  2E2J K;  2PA8 D;  4QJV A;  5C44 C;  3GTO C;  2O5J A;  3PO3 K;  2Y0S D;  4OIO A;  3S1N K;  3RZD C;  2WAQ D;  2PMZ D;  3HOW K;  4G7O A;  3HOY K;  4MQ9 A;  4BBR K;  4Y52 C;  3GTL K;  2JA5 C;  1I50 K;  4QIW L;  4BY7 K;  2PPB A;  3S17 C;  2WB1 D;  1TWG C;  4YG2 A;  4C3I K;  2NVX C;  4A93 C;  4KMU A;  5IP9 C;  3CQZ C;  3GTP C;  3M3Y C;  5M5W K;  1R9T C;  2NVT K;  5C4X K;  1TWF K;  3H3V L;  1BDF A;  1TWG K; 
#chains in the Genus database with same CATH topology
 2A6E A;  3FKI C;  1HQM A;  5C4J C;  1IBA A;  1XXB A;  3K7A K;  4QIW D;  2A69 A;  1O26 A;  4GTC A;  2YU9 A;  1X31 C;  2JA6 K;  3IPJ A;  3GIR A;  2BE5 A;  3HOV K;  2NVY K;  3ADA C;  4A3B K;  1YX2 A;  1I50 C;  1VRQ C;  1IQ0 A;  2JA7 K;  1EH1 A;  1SFO A;  3GTG K;  4A3M K;  3GTK C;  1EI6 A;  3HKZ L;  2CW0 A;  4A3K K;  4KAS A;  1ZXO A;  2JA5 A;  3AD9 C;  1WCM K;  2RH6 A;  3GTP A;  3T01 A;  3CQZ A;  1WSV A;  1I6V A;  3HOU K;  1ISE A;  3HKZ D;  1WIH A;  5IYB C;  5M3M K;  5IYC C;  1F93 A;  3GSI A;  4BY1 C;  3TFJ A;  2O5I A;  1WQF A;  4X6A C;  1I3Q K;  2NVQ C;  5IP7 K;  4QJV B;  2E2H K;  4A3C C;  3TFI A;  4XLP A;  1O24 A;  1Y1V C;  3L4K A;  3GTL A;  5TMF A;  1B4B A;  4PAB A;  3RZO K;  3GTM A;  4C2M K;  2A6H A;  5M5X K;  3S15 C;  2GSU A;  4A3L K;  2GAG C;  4ZH4 A;  2JA6 A;  4C3H C;  4RMF A;  3PO2 C;  3H0G C;  2KWA A;  3HOX K;  4MEX A;  2VUM K;  2NVY A;  1XZP A;  3LAJ A;  3GTO K;  5M5Y K;  2E2I C;  1J6X A;  4BKW A;  2JA7 A;  4LJZ A;  3GTJ C;  1F9N A;  2B63 C;  4Y52 K;  5L46 A;  3V4G A;  4A3F C;  4KM9 A;  4A3G C;  3M3Y K;  4WJ3 M;  1DCO A;  5C3E C;  1WCM A;  1DD5 A;  4KB4 A;  2E2J C;  1IE0 A;  2R93 C;  2WB1 L;  1TWH C;  4OIQ A;  2FQT A;  1IS1 A;  4KN7 A;  3LPX A;  5C44 C;  3S1N K;  3HOY K;  1WQG A;  4BBR K;  1WSR A;  2CFA B;  1I3Q A;  1XZP B;  5IOR A;  2E2H A;  2WB1 D;  1TWG C;  2NVX C;  4KMU A;  4FZB A;  3GTP K;  1J6W A;  4NOI A;  4AH6 A;  1JVI A;  5IOQ A;  4A3I C;  4A3J K;  3PO3 C;  3AQO A;  3HOW C;  3AQP A;  1O2F B;  2VUM A;  4G7H A;  1L0W A;  1YCL A;  4BXX K;  3QX3 A;  1K83 K;  3GTO A;  3VA7 A;  5C4X C;  1WOO A;  1TWF C;  4A3E K;  3BP3 A;  1Y1W K;  3GTM K;  1I6H C;  3S1M C;  3S16 C;  1J98 A;  1VLO A;  4KMH A;  4FM9 A;  1EFW A;  1V5V A;  1TWC C;  4C3J K;  4GZY A;  3I4N C;  3LAP A;  1UV7 A;  1B4A A;  4ILD A;  3GEI A;  4LK0 A;  1SMY A;  3I4M K;  3Q3Q A;  2GAH C;  3S1Q C;  4AYB L;  2R7Z K;  4BBS C;  4C2M C;  5JVO A;  1EK8 A;  4Y7N K;  3HOZ C;  3OPF A;  3MML B;  3ORE A;  2R92 C;  4DDQ A;  4AYB D;  4GTL A;  3S2D C;  4OIP A;  4A3D K;  1O2A A;  3GTQ K;  1JOE A;  4WIL A;  3M4O C;  5EGE A;  3G4C A;  4KAR A;  3S14 C;  4XSX A;  3S1R K;  3N0C A;  1K83 A;  5IYD C;  3FOE A;  2YU9 C;  1J6V A;  5FLM K;  3GTJ A;  1R9T K;  1Y1W A;  1IW7 A;  2Y0S L;  4O2D A;  2PMZ L;  2WAQ L;  3FKI K;  5C4J K;  2JA8 C;  4WJ4 A;  4G0U A;  1XXC A;  1SFO C;  2R93 A;  3G4A A;  2JH3 A;  3GEE A;  4G0V A;  2Y0S D;  4GTA A;  3RZD C;  2WAQ D;  2Y3P A;  2PMZ D;  2ZUE A;  1O2B A;  4MQ9 A;  2P8T A;  4KC6 A;  1I50 K;  2JA5 C;  1GE9 A;  3S17 C;  3TTG A;  4YG2 A;  4A93 C;  3T00 A;  5IP9 C;  1VH2 A;  3CQZ C;  3GTP C;  2R7Z A;  5M5W K;  1TWA A;  5HL8 A;  1EQR A;  3A8J A;  1JQW A;  1O25 A;  3BP8 C;  3S2H C;  4Q5S A;  3WOD A;  5IYB K;  4LR2 A;  3EQL A;  3T02 A;  3A8I A;  5IYC K;  3GEH A;  3GTL C;  4BY1 K;  4BY7 C;  1WQH A;  4J3N A;  4JK1 A;  3GTQ A;  1O27 A;  4A3E C;  4C3I C;  1BJT A;  3N3Y A;  4X6A K;  2NVT C;  2NVQ K;  4A3C K;  1F7U A;  1Y1V K;  1USO A;  3K7A C;  3FOF A;  1TWF A;  3JST A;  2GSN A;  3FHZ A;  3AH5 A;  1R9T A;  2JA6 C;  4P5B A;  1INN A;  1XPP A;  2V6T A;  5IOT A;  3HOV C;  2NVY C;  4GTB A;  3FKI A;  4A3B C;  5D4D A;  4OIN A;  3S15 K;  2JA7 C;  3GTG C;  4A3M C;  4C3H K;  3PO2 K;  3H0G K;  3SZZ A;  1VGX A;  4A3K C;  4XSZ A;  2W7V A;  1WOR A;  1I50 A;  4KN4 A;  4GTE A;  2E2I K;  1WCM C;  2V6S A;  3GTJ K;  1C0A A;  3GTK A;  3HOU C;  4A3F K;  4YFN A;  3ERE D;  4A3G K;  4A3D C;  5C3E K;  1I3Q C;  2R93 K;  4MEY A;  1TWH K;  5IP7 C;  2E2H C;  4PAA A;  5C44 K;  4Q4Z A;  3S1R C;  1BS2 A;  5FLM C;  3A8K A;  4C45 A;  1TWA K;  3RZO C;  1KQ4 A;  2NVX K;  2PA8 L;  1Y1V A;  1ZVU A;  1ZBS A;  1O28 A;  5EGH A;  4XLN A;  1G51 A;  4G0W A;  2EBB A;  4A3L C;  1DCH A;  5E68 A;  3BUE A;  3HOX C;  4A3I K;  2VUM C;  2ZFZ A;  4M1X A;  2PA8 D;  4QJV A;  3GTO C;  3PO3 K;  2XCO A;  3HOW K;  4KAT A;  4Y52 C;  3N0B A;  1XXA A;  3H0G A;  3TFH A;  2PPB A;  4LOW A;  1AB4 A;  3M3Y C;  2P5M A;  5C4X K;  1PJ5 A;  1TWF K;  3H3V L;  1BDF A;  2E2I A;  2B63 A;  1I6H K;  5JFE A;  5TMC A;  3S1M K;  3S16 K;  1TWC K;  1YNN A;  4LLG A;  1USM A;  4LK1 A;  3S1N C;  1O29 A;  3I4N K;  2O5J A;  3H3V D;  3HOY C;  4BBR C;  4GFQ A;  1TWH A;  4YFX A;  3OEP A;  4KAW X;  5CJ9 A;  1ZYR A;  4XCH A;  3S1Q K;  4BLB A;  3CAG A;  4OIR A;  1F7V A;  4BBS K;  3GTK K;  1PJ6 A;  4YFK A;  4G7Z A;  1TWG A;  3SZY A;  2NVX A;  3HOZ K;  4KB2 A;  4A3J C;  1WOS A;  2R92 K;  4GTF A;  1VJE A;  2PHC B;  2D6F C;  4GT9 A;  3S2D K;  4P9S A;  4BLA A;  2A68 A;  2CFA A;  4BXX C;  1YNJ A;  1K83 C;  5IOS A;  3GTG A;  1Y1W C;  3GTM C;  3M4O K;  3DXJ A;  4KDD A;  3HXA A;  3S14 K;  3S0X A;  1DCP A;  1WOP A;  4C3J C;  5IYD K;  5TJ3 A;  1IL2 A;  2YU9 K;  5CHP A;  3I4M C;  2JA8 K;  4KMD A;  1TWC A;  1BGW A;  2GSO A;  1HI9 A;  3GDZ A;  4LQY A;  1SFO K;  4P5A A;  2R7Z C;  1TWA C;  4GTD A;  3RZD K;  4Y7N C;  4KMA A;  2JA5 K;  1XZQ A;  2XCR B;  3S17 K;  4A93 K;  5IP9 K;  3CQZ K;  3L4J A;  2B63 K;  5FJ8 K;  2XCQ A;  2ZUF A;  2RGR A;  3AD7 C;  3GTQ C;  2R92 A;  3S2H K;  2E2J K;  3NUH A;  2FQO A;  4OIO A;  4G7O A;  1ZQ1 C;  3GTL K;  4BY7 K;  1RU0 A;  4QIW L;  1PJ7 A;  4C3I K;  2V6U A;  1R9T C;  2NVT K;  1XZQ B;  3AD8 C;  5M3F K;  4KM8 A;  1TWG K; 
#chains in the Genus database with same CATH homology
 2A6E A;  3FKI C;  1HQM A;  3GTP K;  4NOI A;  5C4J C;  1I6H K;  3K7A K;  5TMC A;  3S1M K;  3S16 K;  4QIW D;  2A69 A;  4A3I C;  3S2H C;  4Q5S A;  4A3J K;  1TWC K;  3WOD A;  2JA6 K;  5M3F K;  1YNN A;  4LLG A;  3PO3 C;  4LK1 A;  5IYB K;  3S1N C;  2BE5 A;  3EQL A;  3HOW C;  2NVY K;  3H3V D;  3HOV K;  5IYC K;  3I4N K;  4BBR C;  3HOY C;  3GTL C;  4BY1 K;  4A3B K;  1I50 C;  4BY7 C;  4JK1 A;  4YFX A;  4G7H A;  4A3E C;  2JA7 K;  3GTG K;  4BXX K;  1ZYR A;  4A3M K;  2NVT C;  2NVQ K;  3GTK C;  4X6A K;  1K83 K;  3HKZ L;  5C4X C;  2CW0 A;  1TWF C;  4A3C K;  3S1Q K;  4OIR A;  4A3E K;  1Y1V K;  4A3K K;  4BBS K;  1Y1W K;  3GTM K;  3K7A C;  3GTK K;  1I6H C;  4YFK A;  4G7Z A;  3S1M C;  3S16 C;  1WCM K;  3HOZ K;  4A3J C;  1TWC C;  2JA6 C;  1I6V A;  1XPP A;  4C3J K;  2R92 K;  3HOU K;  3HKZ D;  5IYB C;  4GZY A;  3HOV C;  3I4N C;  2NVY C;  5M3M K;  4A3B C;  5IYC C;  5D4D A;  4OIN A;  4BY1 C;  3S15 K;  3S2D K;  2O5I A;  4LK0 A;  2JA7 C;  1SMY A;  2A68 A;  3GTG C;  3I4M K;  4BXX C;  4X6A C;  1I3Q K;  4A3M C;  1YNJ A;  2NVQ C;  4C3H K;  1K83 C;  5IP7 K;  3H0G K;  4QJV B;  2E2H K;  3PO2 K;  3S1Q C;  4A3C C;  4XLP A;  1Y1V C;  4AYB L;  4A3K C;  4XSZ A;  2R7Z K;  4BBS C;  1Y1W C;  3GTM C;  3M4O K;  3DXJ A;  4KN4 A;  2E2I K;  1WCM C;  4Y7N K;  3S14 K;  5TMF A;  3HOZ C;  3GTJ K;  3RZO K;  4C2M K;  2R92 C;  4A3F K;  3HOU C;  2A6H A;  5M5X K;  5IYD K;  4YFN A;  2YU9 K;  4A3G K;  4A3D C;  4AYB D;  3S15 C;  3S2D C;  5C3E K;  4A3L K;  4OIP A;  4A3D K;  4ZH4 A;  2JA8 K;  3I4M C;  1I3Q C;  2R93 K;  4MEY A;  1TWH K;  5IP7 C;  3H0G C;  3HOX K;  4MEX A;  2E2H C;  2VUM K;  3GTQ K;  3PO2 C;  1SFO K;  2R7Z C;  1TWA C;  3M4O C;  5C44 K;  4Q4Z A;  5M5Y K;  3S1R C;  2E2I C;  3GTO K;  3RZD K;  4Y7N C;  3S14 C;  4LJZ A;  5FLM C;  3GTJ C;  2B63 C;  4Y52 K;  4XSX A;  1TWA K;  2JA5 K;  3RZO C;  3S1R K;  4A3F C;  5IYD C;  3S17 K;  4A93 K;  2NVX K;  2YU9 C;  2PA8 L;  5FLM K;  5IP9 K;  4A3G C;  3CQZ K;  2B63 K;  3M3Y K;  1R9T K;  5FJ8 K;  4XLN A;  1IW7 A;  2Y0S L;  2PMZ L;  2WAQ L;  5C3E C;  4A3L C;  3FKI K;  5C4J K;  2E2J C;  2JA8 C;  2R93 C;  2WB1 L;  1TWH C;  3GTQ C;  3HOX C;  4OIQ A;  4A3I K;  2VUM C;  3S2H K;  4KN7 A;  1SFO C;  2E2J K;  2PA8 D;  4QJV A;  5C44 C;  3GTO C;  2O5J A;  3PO3 K;  2Y0S D;  4OIO A;  3S1N K;  3RZD C;  2WAQ D;  2PMZ D;  3HOW K;  4G7O A;  3HOY K;  4MQ9 A;  4BBR K;  4Y52 C;  3GTL K;  2JA5 C;  1I50 K;  4QIW L;  4BY7 K;  2PPB A;  3S17 C;  2WB1 D;  1TWG C;  4YG2 A;  4C3I K;  2NVX C;  4A93 C;  4KMU A;  5IP9 C;  3CQZ C;  3GTP C;  3M3Y C;  5M5W K;  1R9T C;  2NVT K;  5C4X K;  1TWF K;  3H3V L;  1BDF A;  1TWG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...