2R93K

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2r93K00
3RZOK 2E2HK 2B63K 4Q5SA 3K7AK 1ZYRA 1Y1VK 2A69A 5FJ8K 4A3KK 3S1MC 3CQZC 3WODA 1TWHK 5M5WK 4Y52K 3GTJC 5IYCC 5FLMC 2JA7C 4YG2A 5IYDC 3PO3K 1I6HK 4MQ9A 3S15C 3S16K 2O5JA 5M3MK 3FKIC 4A3CC 4ZH4A 4MEXA 1Y1WC 1TWGK 4A3EC 2VUMC 3S1MK 4A3LC 3HOXC 4LK1A 1I6VA 3CQZK 4NOIA 2YU9C 2WB1D 2PMZL 1SMYA 4C3IK 5IYCK 5FLMK 3GTJK 4A3IC 2JA7K 2NVQC 5IYDK 1SFOC 4XSZA 3S15K 4G7HA 3GTMC 3GTQC 3FKIK 4A3CK 1R9TC 4KN4A 2PA8L 1Y1WK 4BY1K 1BDFA 4A3EK 3S1NC 3H3VD 2VUMK 4A3FC 4A3LK 3H0GC 3HOXK 5C3EC 2YU9K 3S14C 4BXXC 5IYBC 4A3IK 4A3MC 4BY7K 2NVQK 4A3BC 2Y0SD 4OIOA 3DXJA 4G7OA 1SFOK 4QIWD 3I4NC 4XLNA 4AYBD 4KMUA 2E2IC 3GTQK 1R9TK 4LK0A 5C4JC 4C3JK 2PPBA 3S1NK 2JA5C 4QJVA 1I3QC 4G7ZA 3S17K 4A3FK 4C3HK 3H0GK 5C3EK 3S14K 4BXXK 5IYBK 4A3MK 2CW0A 4A3BK 4A3DC 5M5YK 2NVYC 2E2IK 5C44C 3S2HC 5IP7C 2R7ZC 5C4JK 4YFKA 3GTLC 1XPPA 2JA5K 3HOZC 1I3QK 4LJZA 3HOUC 5C4XC 4A93C 4X6AC 1I50C 3HOYC 3EQLA 1HQMA 2JA6C 2WAQD 2O5IA 4A3DK 4JK1A 2WB1L 2A6HA 1TWAC 3S1RC 2NVYK 5M5XK 4BBRC 5M3FK 3GTPC 5C44K 1YNNA 3HKZD 4Y7NC 3HOVC 5D4DA 2R92C 5IP7K 3GTMK 3I4MC 3S2HK 3S1QK 3GTLK 2R93C 4KN7A 1YNJA 3HOZK 4XLPA 3S1QC 4Q4ZA 4A3JC 3GTKC 3H3VL 4A93K 5IP9C 4A3KC 2E2JC 1I50K 3S2DC 4X6AK 4C2MK 4A3GC 2JA6K 3PO2C 1TWAK 3S1RK 2Y0SL 1WCMC 4BBRK 3GTPK 4QIWL 3HOVK 4Y7NK 4AYBL 1K83C 2R92K 3GTGC 3HOWC 3I4MK 2R93K 1TWFC 4LLGA 4OIPA 1TWGC 4XSXA 4A3JK 5TMFA 5TMCA 1TWCC 5IP9K 2E2JK 3GTKK 3M3YC 3S2DK 2JA8C 4A3GK 4GZYA 4MEYA 3PO2K 4QJVB 3GTOC 2NVXC 2A68A 2PMZD 1WCMK 2BE5A 3M4OC 1K83K 3GTGK 3HOWK 4BBSC 1TWFK 4BY1C 2R7ZK 2PA8D 4YFNA 2NVTC 3RZDC 1TWCK 4OIRA 3M3YK 4YFXA 3RZOC 3S17C 2JA8K 2E2HC 2B63C 3HOUK 3I4NK 3K7AC 1Y1VC 4OIQA 3GTOK 3HOYK 2NVXK 2WAQL 4BY7C 1TWHC 4Y52C 1IW7A 3M4OK 3PO3C 2A6EA 4BBSK 1I6HC 3HKZL 4OINA 3S16C 5C4XK 2NVTK 3RZDK
chains in the Genus database with same CATH superfamily
4KDDA 5JVOA 3S1MC 1PJ7A 1WOSA 2CFAA 3WODA 3GIRA 1TWHK 1O2FB 5IORA 5IYDC 1YX2A 1C0AA 4KM8A 4BLBA 3S15C 3S16K 4P9SA 4ZH4A 3NUHA 4A3EC 1AB4A 1O28A 4LK1A 1JOEA 2YU9C 4C3IK 3N0BA 2JA7K 1BS2A 4G7HA 2YU9A 3GTQC 1Y1WK 1BDFA 3H3VD 3AH5A 1WQHA 2VUMK 4GTAA 3HOXK 3ADAC 5IYBC 4A3IK 2V6UA 4A3BC 4G7OA 1X31C 1SFOK 4PABA 4QIWD 5C4JC 3T01A 3GTJA 2JA5C 4G7ZA 3G4CA 1GE9A 3H0GK 1XZQB 4A3MK 1VRQC 2CW0A 4KM9A 2JA5A 5IOSA 1DD5A 3HXAA 2PHCB 1B4BA 4YFKA 1XPPA 3A8IA 4X6AC 4GTLA 1DCOA 1XXAA 3LAJA 4JK1A 4A3DK 2NVYK 1B4AA 3HKZD 2R92C 4GT9A 1EK8A 3S1QC 4Q4ZA 4A3JC 3GTKC 5IP9C 1UV7A 1L0WA 5EGEA 2JA6K 2ZUFA 1WCMC 1O25A 1K83C 3I4MK 4LLGA 1TWGC 3T02A 1K83A 4A3GK 4GZYA 3PO2K 5JFEA 2R7ZA 2A68A 2PMZD 3GTLA 2KWAA 2BE5A 1WSVA 3M4OC 4AH6A 3GTGK 2PA8D 5C4XC 1TWCK 4YFXA 2JA8K 3A8KA 3TTGA 5IOTA 4FZBA 2WAQL 1VH2A 3LAPA 2P8TA 1TWHC 3JSTA 1IW7A 2A6EA 3AQOA 1WQGA 4KB2A 1INNA 4OINA 4WJ4A 3S16C 3OEPA 1TWHA 3S17K 1XZQA 4Q5SA 3K7AK 5FJ8K 3FOFA 4Y52K 2JA7C 3PO3K 1WIHA 4KB4A 4MQ9A 5M3MK 2NVXA 1F7UA 2JA7A 1IQ0A 1PJ5A 1Y1WC 1TWGK 1J98A 2VUMC 3BP8C 1F93A 3HOXC 1WOOA 3CQZK 2WB1D 1Y1WA 4A3IC 5FLMK 2VUMA 1SFOC 2E2HA 2B63A 4XSZA 1Y1VA 3GTMC 3FKIK 4GFQA 2XCOA 4KN4A 2Y3PA 4A3LK 3H0GC 4A3MC 2JH3A 2NVQK 2Y0SD 4OIOA 3H0GA 2GAHC 2GSOA 3S1NK 5HL8A 5C3EK 1IL2A 3S14K 4A3DC 5M5YK 2P5MA 4DDQA 2NVYC 2E2IK 4P5BA 2NVYA 1I3QK 2FQOA 4BKWA 3GTQA 2JA6C 1F7VA 1VGXA 5M5XK 5M3FK 3AQPA 5C44K 2JA6A 5IP7K 3GTMK 3I4MC 1IBAA 1YNJA 4A93K 4A3KC 4A3GC 3PO2C 1TWAK 3S1RK 4BBRK 4KMDA 4Y7NK 4AYBL 3GTGC 2R93K 4KMHA 3BUEA 4OIPA 4XSXA 5TMFA 1TWCC 3S2DK 1EQRA 1IS1A 2JA8C 3GTGA 1TWCA 3QX3A 1IE0A 4ILDA 3HOWK 4BY1C 4YFNA 1O29A 3S17C 4OIRA 2ZFZA 5EGHA 2D6FC 1O2BA 3K7AC 4M1XA 4J3NA 4OIQA 3GTOK 5L46A 2R92A 4BY7C 1ZQ1C 4LOWA 4Y52C 3GTKA 3BP3A 3PO3C 4BBSK 4GTBA 3CAGA 3Q3QA 3A8JA 2NVTK 3RZDK 4GTCA 3I4NK 1WCMA 2A69A 4A3KK 1ZBSA 3CQZC 5M5WK 1TWGA 5FLMC 4YG2A 1XZPB 4KMAA 1BGWA 1V5VA 3CQZA 2O5JA 3FKIC 1EH1A 4A3LC 3FKIA 1I6VA 1SMYA 3GTJK 5IYCK 2NVQC 1O2AA 3GDZA 4A3CK 4BY1K 3S1NC 3L4KA 1HI9A 1WORA 5C3EC 3S14C 1O27A 3AD9C 3TFIA 1F9NA 2GSNA 4BY7K 1G51A 1O26A 4GTFA 4XLNA 4KMUA 2E2IC 1J6WA 2V6TA 1R9TK 5CHPA 4LK0A 3V4GA 4C3JK 2PPBA 1I3QC 4KASA 4KATA 4C3HK 2XCRB 4A3FK 1VJEA 1DCHA 4BXXK 4P5AA 2RGRA 5C44C 2V6SA 5IP7C 1USMA 4LJZA 1J6VA 1SFOA 4A93C 3GTMA 2WAQD 2A6HA 1TWAC 3S1RC 1WQFA 2GSUA 4BBRC 1BJTA 1YNNA 3GEHA 4Y7NC 3S2HK 5D4DA 4GTEA 3GTLK 2R93C 3HOZK 4XLPA 2RH6A 3H3VL 3S2DC 1I50K 4C2MK 3GTPK 4QIWL 3HOVK 3HOWC 5E68A 4PAAA 3N3YA 3GEIA 3SZYA 4C45A 2E2JK 3GSIA 4QJVB 3GTOC 4G0WA 1WOPA 3SZZA 3G4AA 3T00A 1ZXOA 2FQTA 3GTOA 4BBSC 1TWFK 3M3YK 2NVTC 3RZDC 3I4NC 1USOA 4LQYA 1PJ6A 1XXCA 3L4JA 2NVXK 2GAGC 3N0CA 3HKZL 4G0VA 3RZOK 3TFHA 2E2HK 2B63K 1ZYRA 1Y1VK 5CJ9A 3GTJC 4GTDA 5IYCC 1I6HK 3FHZA 1VLOA 5TJ3A 4A3CC 4MEXA 1ZVUA 4WILA 1O24A 3S1MK 4NOIA 3FOEA 2PMZL 3LPXA 5IYDK 3S15K 1R9TC 1XXBA 2PA8L 4C3JC 4A3EK 4A3FC 4C3HC 1R9TA 2YU9K 4BXXC 1EFWA 2ZUEA 5IOQA 3DXJA 4AYBD 1DCPA 3GTQK 3GEEA 4BLAA 4QJVA 3OPFA 3ERED 5IYBK 4A3BK 1JVIA 2CFAB 2EBBA 1JQWA 3S2HC 2R7ZC 5C4JK 3GTLC 3AD7C 2JA5K 3HOZC 4LR2A 4O2DA 3HOUC 4XCHA 1I50C 3HOYC 4C2MC 3EQLA 1HQMA 3VA7A 2O5IA 3OREA 2WB1L 1WSRA 1I50A 3GTPC 3HOVC 1EI6A 3IPJA 1ISEA 1RU0A 4KN7A 4G0UA 3GTPA 4X6AK 2E2JC 2E2IA 2XCQA 4FM9A 2Y0SL 1I3QA 4KC6A 2R92K 1TWFC 3MMLB 3S1QK 4A3JK 5TMCA 3GTKK 1KQ4A 5IP9K 3M3YC 1YCLA 4WJ3M 4MEYA 1TWFA 4C3IC 1J6XA 2NVXC 1WCMK 4KARA 1K83K 3AD8C 2R7ZK 1TWAA 3RZOC 3HOUK 2E2HC 2B63C 1Y1VC 3HOYK 2R93A 3TFJA 1XZPA 4KAWX 3M4OK 1I6HC 3S0XA 2W7VA 4RMFA 5C4XK
chains in the Genus database with same CATH topology
3RZOK 2E2HK 2B63K 4Q5SA 3K7AK 1ZYRA 1Y1VK 2A69A 5FJ8K 4A3KK 3S1MC 3CQZC 3WODA 1TWHK 5M5WK 4Y52K 3GTJC 5IYCC 5FLMC 2JA7C 4YG2A 5IYDC 3PO3K 1I6HK 4MQ9A 3S15C 3S16K 2O5JA 5M3MK 3FKIC 4A3CC 4ZH4A 4MEXA 1Y1WC 1TWGK 4A3EC 2VUMC 3S1MK 4A3LC 3HOXC 4LK1A 1I6VA 3CQZK 4NOIA 2YU9C 2WB1D 2PMZL 1SMYA 4C3IK 5IYCK 5FLMK 3GTJK 4A3IC 2JA7K 2NVQC 5IYDK 1SFOC 4XSZA 3S15K 4G7HA 3GTMC 3GTQC 3FKIK 4A3CK 1R9TC 4KN4A 2PA8L 1Y1WK 4BY1K 1BDFA 4A3EK 3S1NC 3H3VD 2VUMK 4A3FC 4A3LK 3H0GC 3HOXK 5C3EC 2YU9K 3S14C 4BXXC 5IYBC 4A3IK 4A3MC 4BY7K 2NVQK 4A3BC 2Y0SD 4OIOA 3DXJA 4G7OA 1SFOK 4QIWD 3I4NC 4XLNA 4AYBD 4KMUA 2E2IC 3GTQK 1R9TK 4LK0A 5C4JC 4C3JK 2PPBA 3S1NK 2JA5C 4QJVA 1I3QC 4G7ZA 3S17K 4A3FK 4C3HK 3H0GK 5C3EK 3S14K 4BXXK 5IYBK 4A3MK 2CW0A 4A3BK 4A3DC 5M5YK 2NVYC 2E2IK 5C44C 3S2HC 5IP7C 2R7ZC 5C4JK 4YFKA 3GTLC 1XPPA 2JA5K 3HOZC 1I3QK 4LJZA 3HOUC 5C4XC 4A93C 4X6AC 1I50C 3HOYC 3EQLA 1HQMA 2JA6C 2WAQD 2O5IA 4A3DK 4JK1A 2WB1L 2A6HA 1TWAC 3S1RC 2NVYK 5M5XK 4BBRC 5M3FK 3GTPC 5C44K 1YNNA 3HKZD 4Y7NC 3HOVC 5D4DA 2R92C 5IP7K 3GTMK 3I4MC 3S2HK 3S1QK 3GTLK 2R93C 4KN7A 1YNJA 3HOZK 4XLPA 3S1QC 4Q4ZA 4A3JC 3GTKC 3H3VL 4A93K 5IP9C 4A3KC 2E2JC 1I50K 3S2DC 4X6AK 4C2MK 4A3GC 2JA6K 3PO2C 1TWAK 3S1RK 2Y0SL 1WCMC 4BBRK 3GTPK 4QIWL 3HOVK 4Y7NK 4AYBL 1K83C 2R92K 3GTGC 3HOWC 3I4MK 2R93K 1TWFC 4LLGA 4OIPA 1TWGC 4XSXA 4A3JK 5TMFA 5TMCA 1TWCC 5IP9K 2E2JK 3GTKK 3M3YC 3S2DK 2JA8C 4A3GK 4GZYA 4MEYA 3PO2K 4QJVB 3GTOC 2NVXC 2A68A 2PMZD 1WCMK 2BE5A 3M4OC 1K83K 3GTGK 3HOWK 4BBSC 1TWFK 4BY1C 2R7ZK 2PA8D 4YFNA 2NVTC 3RZDC 1TWCK 4OIRA 3M3YK 4YFXA 3RZOC 3S17C 2JA8K 2E2HC 2B63C 3HOUK 3I4NK 3K7AC 1Y1VC 4OIQA 3GTOK 3HOYK 2NVXK 2WAQL 4BY7C 1TWHC 4Y52C 1IW7A 3M4OK 3PO3C 2A6EA 4BBSK 1I6HC 3HKZL 4OINA 3S16C 5C4XK 2NVTK 3RZDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZO K;  2E2H K;  2B63 K;  4Q5S A;  3K7A K;  1ZYR A;  1Y1V K;  2A69 A;  5FJ8 K;  4A3K K;  3S1M C;  3CQZ C;  3WOD A;  1TWH K;  5M5W K;  4Y52 K;  3GTJ C;  5IYC C;  5FLM C;  2JA7 C;  4YG2 A;  5IYD C;  3PO3 K;  1I6H K;  4MQ9 A;  3S15 C;  3S16 K;  2O5J A;  5M3M K;  3FKI C;  4A3C C;  4ZH4 A;  4MEX A;  1Y1W C;  1TWG K;  4A3E C;  2VUM C;  3S1M K;  4A3L C;  3HOX C;  4LK1 A;  1I6V A;  3CQZ K;  4NOI A;  2YU9 C;  2WB1 D;  2PMZ L;  1SMY A;  4C3I K;  5IYC K;  5FLM K;  3GTJ K;  4A3I C;  2JA7 K;  2NVQ C;  5IYD K;  1SFO C;  4XSZ A;  3S15 K;  4G7H A;  3GTM C;  3GTQ C;  3FKI K;  4A3C K;  1R9T C;  4KN4 A;  2PA8 L;  1Y1W K;  4BY1 K;  1BDF A;  4A3E K;  3S1N C;  3H3V D;  2VUM K;  4A3F C;  4A3L K;  3H0G C;  3HOX K;  5C3E C;  2YU9 K;  3S14 C;  4BXX C;  5IYB C;  4A3I K;  4A3M C;  4BY7 K;  2NVQ K;  4A3B C;  2Y0S D;  4OIO A;  3DXJ A;  4G7O A;  1SFO K;  4QIW D;  3I4N C;  4XLN A;  4AYB D;  4KMU A;  2E2I C;  3GTQ K;  1R9T K;  4LK0 A;  5C4J C;  4C3J K;  2PPB A;  3S1N K;  2JA5 C;  4QJV A;  1I3Q C;  4G7Z A;  3S17 K;  4A3F K;  4C3H K;  3H0G K;  5C3E K;  3S14 K;  4BXX K;  5IYB K;  4A3M K;  2CW0 A;  4A3B K;  4A3D C;  5M5Y K;  2NVY C;  2E2I K;  5C44 C;  3S2H C;  5IP7 C;  2R7Z C;  5C4J K;  4YFK A;  3GTL C;  1XPP A;  2JA5 K;  3HOZ C;  1I3Q K;  4LJZ A;  3HOU C;  5C4X C;  4A93 C;  4X6A C;  1I50 C;  3HOY C;  3EQL A;  1HQM A;  2JA6 C;  2WAQ D;  2O5I A;  4A3D K;  4JK1 A;  2WB1 L;  2A6H A;  1TWA C;  3S1R C;  2NVY K;  5M5X K;  4BBR C;  5M3F K;  3GTP C;  5C44 K;  1YNN A;  3HKZ D;  4Y7N C;  3HOV C;  5D4D A;  2R92 C;  5IP7 K;  3GTM K;  3I4M C;  3S2H K;  3S1Q K;  3GTL K;  2R93 C;  4KN7 A;  1YNJ A;  3HOZ K;  4XLP A;  3S1Q C;  4Q4Z A;  4A3J C;  3GTK C;  3H3V L;  4A93 K;  5IP9 C;  4A3K C;  2E2J C;  1I50 K;  3S2D C;  4X6A K;  4C2M K;  4A3G C;  2JA6 K;  3PO2 C;  1TWA K;  3S1R K;  2Y0S L;  1WCM C;  4BBR K;  3GTP K;  4QIW L;  3HOV K;  4Y7N K;  4AYB L;  1K83 C;  2R92 K;  3GTG C;  3HOW C;  3I4M K;  2R93 K;  1TWF C;  4LLG A;  4OIP A;  1TWG C;  4XSX A;  4A3J K;  5TMF A;  5TMC A;  1TWC C;  5IP9 K;  2E2J K;  3GTK K;  3M3Y C;  3S2D K;  2JA8 C;  4A3G K;  4GZY A;  4MEY A;  3PO2 K;  4QJV B;  3GTO C;  2NVX C;  2A68 A;  2PMZ D;  1WCM K;  2BE5 A;  3M4O C;  1K83 K;  3GTG K;  3HOW K;  4BBS C;  1TWF K;  4BY1 C;  2R7Z K;  2PA8 D;  4YFN A;  2NVT C;  3RZD C;  1TWC K;  4OIR A;  3M3Y K;  4YFX A;  3RZO C;  3S17 C;  2JA8 K;  2E2H C;  2B63 C;  3HOU K;  3I4N K;  3K7A C;  1Y1V C;  4OIQ A;  3GTO K;  3HOY K;  2NVX K;  2WAQ L;  4BY7 C;  1TWH C;  4Y52 C;  1IW7 A;  3M4O K;  3PO3 C;  2A6E A;  4BBS K;  1I6H C;  3HKZ L;  4OIN A;  3S16 C;  5C4X K;  2NVT K;  3RZD K; 
#chains in the Genus database with same CATH topology
 4KDD A;  5JVO A;  3S1M C;  1PJ7 A;  1WOS A;  2CFA A;  3WOD A;  3GIR A;  1TWH K;  1O2F B;  5IOR A;  5IYD C;  1YX2 A;  1C0A A;  4KM8 A;  4BLB A;  3S15 C;  3S16 K;  4P9S A;  4ZH4 A;  3NUH A;  4A3E C;  1AB4 A;  1O28 A;  4LK1 A;  1JOE A;  2YU9 C;  4C3I K;  3N0B A;  2JA7 K;  1BS2 A;  4G7H A;  2YU9 A;  3GTQ C;  1Y1W K;  1BDF A;  3H3V D;  3AH5 A;  1WQH A;  2VUM K;  4GTA A;  3HOX K;  3ADA C;  5IYB C;  4A3I K;  2V6U A;  4A3B C;  4G7O A;  1X31 C;  1SFO K;  4PAB A;  4QIW D;  5C4J C;  3T01 A;  3GTJ A;  2JA5 C;  4G7Z A;  3G4C A;  1GE9 A;  3H0G K;  1XZQ B;  4A3M K;  1VRQ C;  2CW0 A;  4KM9 A;  2JA5 A;  5IOS A;  1DD5 A;  3HXA A;  2PHC B;  1B4B A;  4YFK A;  1XPP A;  3A8I A;  4X6A C;  4GTL A;  1DCO A;  1XXA A;  3LAJ A;  4JK1 A;  4A3D K;  2NVY K;  1B4A A;  3HKZ D;  2R92 C;  4GT9 A;  1EK8 A;  3S1Q C;  4Q4Z A;  4A3J C;  3GTK C;  5IP9 C;  1UV7 A;  1L0W A;  5EGE A;  2JA6 K;  2ZUF A;  1WCM C;  1O25 A;  1K83 C;  3I4M K;  4LLG A;  1TWG C;  3T02 A;  1K83 A;  4A3G K;  4GZY A;  3PO2 K;  5JFE A;  2R7Z A;  2A68 A;  2PMZ D;  3GTL A;  2KWA A;  2BE5 A;  1WSV A;  3M4O C;  4AH6 A;  3GTG K;  2PA8 D;  5C4X C;  1TWC K;  4YFX A;  2JA8 K;  3A8K A;  3TTG A;  5IOT A;  4FZB A;  2WAQ L;  1VH2 A;  3LAP A;  2P8T A;  1TWH C;  3JST A;  1IW7 A;  2A6E A;  3AQO A;  1WQG A;  4KB2 A;  1INN A;  4OIN A;  4WJ4 A;  3S16 C;  3OEP A;  1TWH A;  3S17 K;  1XZQ A;  4Q5S A;  3K7A K;  5FJ8 K;  3FOF A;  4Y52 K;  2JA7 C;  3PO3 K;  1WIH A;  4KB4 A;  4MQ9 A;  5M3M K;  2NVX A;  1F7U A;  2JA7 A;  1IQ0 A;  1PJ5 A;  1Y1W C;  1TWG K;  1J98 A;  2VUM C;  3BP8 C;  1F93 A;  3HOX C;  1WOO A;  3CQZ K;  2WB1 D;  1Y1W A;  4A3I C;  5FLM K;  2VUM A;  1SFO C;  2E2H A;  2B63 A;  4XSZ A;  1Y1V A;  3GTM C;  3FKI K;  4GFQ A;  2XCO A;  4KN4 A;  2Y3P A;  4A3L K;  3H0G C;  4A3M C;  2JH3 A;  2NVQ K;  2Y0S D;  4OIO A;  3H0G A;  2GAH C;  2GSO A;  3S1N K;  5HL8 A;  5C3E K;  1IL2 A;  3S14 K;  4A3D C;  5M5Y K;  2P5M A;  4DDQ A;  2NVY C;  2E2I K;  4P5B A;  2NVY A;  1I3Q K;  2FQO A;  4BKW A;  3GTQ A;  2JA6 C;  1F7V A;  1VGX A;  5M5X K;  5M3F K;  3AQP A;  5C44 K;  2JA6 A;  5IP7 K;  3GTM K;  3I4M C;  1IBA A;  1YNJ A;  4A93 K;  4A3K C;  4A3G C;  3PO2 C;  1TWA K;  3S1R K;  4BBR K;  4KMD A;  4Y7N K;  4AYB L;  3GTG C;  2R93 K;  4KMH A;  3BUE A;  4OIP A;  4XSX A;  5TMF A;  1TWC C;  3S2D K;  1EQR A;  1IS1 A;  2JA8 C;  3GTG A;  1TWC A;  3QX3 A;  1IE0 A;  4ILD A;  3HOW K;  4BY1 C;  4YFN A;  1O29 A;  3S17 C;  4OIR A;  2ZFZ A;  5EGH A;  2D6F C;  1O2B A;  3K7A C;  4M1X A;  4J3N A;  4OIQ A;  3GTO K;  5L46 A;  2R92 A;  4BY7 C;  1ZQ1 C;  4LOW A;  4Y52 C;  3GTK A;  3BP3 A;  3PO3 C;  4BBS K;  4GTB A;  3CAG A;  3Q3Q A;  3A8J A;  2NVT K;  3RZD K;  4GTC A;  3I4N K;  1WCM A;  2A69 A;  4A3K K;  1ZBS A;  3CQZ C;  5M5W K;  1TWG A;  5FLM C;  4YG2 A;  1XZP B;  4KMA A;  1BGW A;  1V5V A;  3CQZ A;  2O5J A;  3FKI C;  1EH1 A;  4A3L C;  3FKI A;  1I6V A;  1SMY A;  3GTJ K;  5IYC K;  2NVQ C;  1O2A A;  3GDZ A;  4A3C K;  4BY1 K;  3S1N C;  3L4K A;  1HI9 A;  1WOR A;  5C3E C;  3S14 C;  1O27 A;  3AD9 C;  3TFI A;  1F9N A;  2GSN A;  4BY7 K;  1G51 A;  1O26 A;  4GTF A;  4XLN A;  4KMU A;  2E2I C;  1J6W A;  2V6T A;  1R9T K;  5CHP A;  4LK0 A;  3V4G A;  4C3J K;  2PPB A;  1I3Q C;  4KAS A;  4KAT A;  4C3H K;  2XCR B;  4A3F K;  1VJE A;  1DCH A;  4BXX K;  4P5A A;  2RGR A;  5C44 C;  2V6S A;  5IP7 C;  1USM A;  4LJZ A;  1J6V A;  1SFO A;  4A93 C;  3GTM A;  2WAQ D;  2A6H A;  1TWA C;  3S1R C;  1WQF A;  2GSU A;  4BBR C;  1BJT A;  1YNN A;  3GEH A;  4Y7N C;  3S2H K;  5D4D A;  4GTE A;  3GTL K;  2R93 C;  3HOZ K;  4XLP A;  2RH6 A;  3H3V L;  3S2D C;  1I50 K;  4C2M K;  3GTP K;  4QIW L;  3HOV K;  3HOW C;  5E68 A;  4PAA A;  3N3Y A;  3GEI A;  3SZY A;  4C45 A;  2E2J K;  3GSI A;  4QJV B;  3GTO C;  4G0W A;  1WOP A;  3SZZ A;  3G4A A;  3T00 A;  1ZXO A;  2FQT A;  3GTO A;  4BBS C;  1TWF K;  3M3Y K;  2NVT C;  3RZD C;  3I4N C;  1USO A;  4LQY A;  1PJ6 A;  1XXC A;  3L4J A;  2NVX K;  2GAG C;  3N0C A;  3HKZ L;  4G0V A;  3RZO K;  3TFH A;  2E2H K;  2B63 K;  1ZYR A;  1Y1V K;  5CJ9 A;  3GTJ C;  4GTD A;  5IYC C;  1I6H K;  3FHZ A;  1VLO A;  5TJ3 A;  4A3C C;  4MEX A;  1ZVU A;  4WIL A;  1O24 A;  3S1M K;  4NOI A;  3FOE A;  2PMZ L;  3LPX A;  5IYD K;  3S15 K;  1R9T C;  1XXB A;  2PA8 L;  4C3J C;  4A3E K;  4A3F C;  4C3H C;  1R9T A;  2YU9 K;  4BXX C;  1EFW A;  2ZUE A;  5IOQ A;  3DXJ A;  4AYB D;  1DCP A;  3GTQ K;  3GEE A;  4BLA A;  4QJV A;  3OPF A;  3ERE D;  5IYB K;  4A3B K;  1JVI A;  2CFA B;  2EBB A;  1JQW A;  3S2H C;  2R7Z C;  5C4J K;  3GTL C;  3AD7 C;  2JA5 K;  3HOZ C;  4LR2 A;  4O2D A;  3HOU C;  4XCH A;  1I50 C;  3HOY C;  4C2M C;  3EQL A;  1HQM A;  3VA7 A;  2O5I A;  3ORE A;  2WB1 L;  1WSR A;  1I50 A;  3GTP C;  3HOV C;  1EI6 A;  3IPJ A;  1ISE A;  1RU0 A;  4KN7 A;  4G0U A;  3GTP A;  4X6A K;  2E2J C;  2E2I A;  2XCQ A;  4FM9 A;  2Y0S L;  1I3Q A;  4KC6 A;  2R92 K;  1TWF C;  3MML B;  3S1Q K;  4A3J K;  5TMC A;  3GTK K;  1KQ4 A;  5IP9 K;  3M3Y C;  1YCL A;  4WJ3 M;  4MEY A;  1TWF A;  4C3I C;  1J6X A;  2NVX C;  1WCM K;  4KAR A;  1K83 K;  3AD8 C;  2R7Z K;  1TWA A;  3RZO C;  3HOU K;  2E2H C;  2B63 C;  1Y1V C;  3HOY K;  2R93 A;  3TFJ A;  1XZP A;  4KAW X;  3M4O K;  1I6H C;  3S0X A;  2W7V A;  4RMF A;  5C4X K; 
#chains in the Genus database with same CATH homology
 3RZO K;  2E2H K;  2B63 K;  4Q5S A;  3K7A K;  1ZYR A;  1Y1V K;  2A69 A;  5FJ8 K;  4A3K K;  3S1M C;  3CQZ C;  3WOD A;  1TWH K;  5M5W K;  4Y52 K;  3GTJ C;  5IYC C;  5FLM C;  2JA7 C;  4YG2 A;  5IYD C;  3PO3 K;  1I6H K;  4MQ9 A;  3S15 C;  3S16 K;  2O5J A;  5M3M K;  3FKI C;  4A3C C;  4ZH4 A;  4MEX A;  1Y1W C;  1TWG K;  4A3E C;  2VUM C;  3S1M K;  4A3L C;  3HOX C;  4LK1 A;  1I6V A;  3CQZ K;  4NOI A;  2YU9 C;  2WB1 D;  2PMZ L;  1SMY A;  4C3I K;  5IYC K;  5FLM K;  3GTJ K;  4A3I C;  2JA7 K;  2NVQ C;  5IYD K;  1SFO C;  4XSZ A;  3S15 K;  4G7H A;  3GTM C;  3GTQ C;  3FKI K;  4A3C K;  1R9T C;  4KN4 A;  2PA8 L;  1Y1W K;  4BY1 K;  1BDF A;  4A3E K;  3S1N C;  3H3V D;  2VUM K;  4A3F C;  4A3L K;  3H0G C;  3HOX K;  5C3E C;  2YU9 K;  3S14 C;  4BXX C;  5IYB C;  4A3I K;  4A3M C;  4BY7 K;  2NVQ K;  4A3B C;  2Y0S D;  4OIO A;  3DXJ A;  4G7O A;  1SFO K;  4QIW D;  3I4N C;  4XLN A;  4AYB D;  4KMU A;  2E2I C;  3GTQ K;  1R9T K;  4LK0 A;  5C4J C;  4C3J K;  2PPB A;  3S1N K;  2JA5 C;  4QJV A;  1I3Q C;  4G7Z A;  3S17 K;  4A3F K;  4C3H K;  3H0G K;  5C3E K;  3S14 K;  4BXX K;  5IYB K;  4A3M K;  2CW0 A;  4A3B K;  4A3D C;  5M5Y K;  2NVY C;  2E2I K;  5C44 C;  3S2H C;  5IP7 C;  2R7Z C;  5C4J K;  4YFK A;  3GTL C;  1XPP A;  2JA5 K;  3HOZ C;  1I3Q K;  4LJZ A;  3HOU C;  5C4X C;  4A93 C;  4X6A C;  1I50 C;  3HOY C;  3EQL A;  1HQM A;  2JA6 C;  2WAQ D;  2O5I A;  4A3D K;  4JK1 A;  2WB1 L;  2A6H A;  1TWA C;  3S1R C;  2NVY K;  5M5X K;  4BBR C;  5M3F K;  3GTP C;  5C44 K;  1YNN A;  3HKZ D;  4Y7N C;  3HOV C;  5D4D A;  2R92 C;  5IP7 K;  3GTM K;  3I4M C;  3S2H K;  3S1Q K;  3GTL K;  2R93 C;  4KN7 A;  1YNJ A;  3HOZ K;  4XLP A;  3S1Q C;  4Q4Z A;  4A3J C;  3GTK C;  3H3V L;  4A93 K;  5IP9 C;  4A3K C;  2E2J C;  1I50 K;  3S2D C;  4X6A K;  4C2M K;  4A3G C;  2JA6 K;  3PO2 C;  1TWA K;  3S1R K;  2Y0S L;  1WCM C;  4BBR K;  3GTP K;  4QIW L;  3HOV K;  4Y7N K;  4AYB L;  1K83 C;  2R92 K;  3GTG C;  3HOW C;  3I4M K;  2R93 K;  1TWF C;  4LLG A;  4OIP A;  1TWG C;  4XSX A;  4A3J K;  5TMF A;  5TMC A;  1TWC C;  5IP9 K;  2E2J K;  3GTK K;  3M3Y C;  3S2D K;  2JA8 C;  4A3G K;  4GZY A;  4MEY A;  3PO2 K;  4QJV B;  3GTO C;  2NVX C;  2A68 A;  2PMZ D;  1WCM K;  2BE5 A;  3M4O C;  1K83 K;  3GTG K;  3HOW K;  4BBS C;  1TWF K;  4BY1 C;  2R7Z K;  2PA8 D;  4YFN A;  2NVT C;  3RZD C;  1TWC K;  4OIR A;  3M3Y K;  4YFX A;  3RZO C;  3S17 C;  2JA8 K;  2E2H C;  2B63 C;  3HOU K;  3I4N K;  3K7A C;  1Y1V C;  4OIQ A;  3GTO K;  3HOY K;  2NVX K;  2WAQ L;  4BY7 C;  1TWH C;  4Y52 C;  1IW7 A;  3M4O K;  3PO3 C;  2A6E A;  4BBS K;  1I6H C;  3HKZ L;  4OIN A;  3S16 C;  5C4X K;  2NVT K;  3RZD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...