2R9IA

Crystal structure of putative phage capsid protein domain from corynebacterium diphtheriae
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
MNLKDLLAHRENLMDSAKRARSAITDDMDPADAAQAVENVKSIISEIESTDEAIAARRGVSDVTQKLKGLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of putative phage capsid protein domain from Corynebacterium diphtheriae.
rcsb
source organism Corynebacterium diphtheriae nctc 13129
molecule tags Structural genomics, unknown function
molecule keywords Putative phage capsid protein
total genus 29
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2r9iA00
2Z3YA 4Z1MG 1MABG 2W6IG 5H6RA 2XAJA 1COWG 2JIZG 3ZMUA 2V1DA 2WSSG 5L3BA 2XAQA 1FS0G 3OEHG 5L3FA 2XAHA 3ZMSA 2CK3G 2XASA 5L3GA 2XAFA 4TSFG 1E79G 1EFRG 2XOKG 2IW5A 4UXNA 2JDIG 1H8EG 2QE7G 3OFNG 5L3EA 5LHIA 5LGNA 5L3CA 4UVAA 5LBQA 2Z5UA 4CZZA 5LHHA 4ASUG 5H6QA 2Y48A 4KUMA 1BMFG 3ABTA 2UXXA 3ZMZA 1OHHG 2XAGA 3ZIAG 4UV8A 2W6JG 3ABUA 2V7QG 4UVBA 2H94A 5LHGA 2JJ2G 2UXNA 2WPDG 4YXWG 3ZMVA 3ZN1A 3OEEG 2HLDG 2EJRA 5FL7G 1NBMG 4UVCA 4BAYA 2DW4A 2XNDG 1E1QG 5LGTA 1E1RG 3OE7G 2F43G 5DN6G 2HKOA 1H8HG 1W0KG 4TT3G 3FKSG 4UV9A 1W0JG 3OAAG 2R9IA 2X0LA 2JJ1G 4XBFA 5LGUA 3ZMTA 5L3DA 3ZN0A
chains in the Genus database with same CATH superfamily
1BQ0A 1QQCA 5J9PC 1WLEA 3ETGA 2W6IG 2YXYA 1BHBA 1YI2V 1M56B 4DV5B 5BR8O 3TETA 2ZM6B 1GRJA 3A2FA 2G38A 2DMXA 3X2QB 2E3CA 2XAHA 3ZMSA 1VQMV 2YI9A 2L6LA 3OD4A 2QWQB 1O9HA 4XDKA 4JI7O 5CBGA 1RSOA 5BZBA 1K7DA 1JFFA 4JI3O 4ZI7A 4G28B 2Z5UA 1K9MW 3L72H 4OPHA 1AI5A 3I55V 2IU0A 1US6A 4LR3A 3JAWA 1Y6XA 4TV8B 1IXBA 4WFGA 3ZMZA 3VBBA 2CGOA 1TA8A 3OT7A 2BSKB 1WB7A 2WLNA 2UUCO 1VQOV 1S5LZ 2BOBC 3A0HZ 4QPJA 1FFXA 4FM2A 4GX5A 1XMQB 4DO2A 4X9QA 2QKSA 4MTGA 3ZCCA 4I50A 2ZT9B 3OEEG 4MS2A 1SQFA 4D6TH 1IBLB 3WB0A 3JASA 3AG3C 5JWPA 1G1XB 1PKXA 1ZTEA 3CC2V 1N36O 3UT5B 1M90W 4LF9B 1YVWA 2VQEB 1P4RA 4ZHQA 3JAKB 1HNZO 4RUEA 3VOUA 4BWAA 5BXZA 4I4TA 4X89A 3R65A 4OX9O 2GDSA 4I9QA 4DV3B 3L70H 4P30A 4I0XA 5LYJB 5GONA 4FM0A 5JJNB 4YJ2A 3W7SA 2VQFB 1Q5OA 5IWAB 2BE3A 4JASA 4NXNO 2B1GA 4U7OA 3R66A 4B7KA 1VF7A 4TUYB 1PNMA 1N36B 3RN4A 4LF6B 2AZ2A 2CTQA 4TV9B 1N0NA 4LF7O 3UO2A 3CD6V 1Q90D 1VQ8V 3JD2A 5L3CA 1ZX3A 4DV6O 1DLBA 3DC5A 3H1LH 2Q9LA 1SRYA 2D2CB 1BCCH 4TV8A 4O4HB 2WLLB 1AJPA 3DC6A 1V54B 1P7GA 4X62O 5LMUB 4PA6A 3E8GA 3AK3A 3E22A 4WCEV 4O2AA 4LF5O 2ZDIA 4B3TO 3B40A 1VQKV 2JJ2G 4GZRB 1XDCA 3T1YO 3ZMVA 4QE9A 1VMGA 3T1YB 4X20B 3SJCC 1GN6A 2R72A 1PNKA 4IGGA 4R6ZA 2BTQB 1ZL8B 4PHZA 4B08A 5ITZA 1XNRB 1VEWA 1YJWV 1BL8A 2A7WA 1Y76B 2M6YA 4X1YA 4CH3A 1AR5A 5B1BC 1R3JC 4ZOLA 5KUKA 1AJNA 3MHHC 3ZRWB 4J7ZA 3ETEA 2GUZA 1JOYA 4G2KA 2IJJA 2Z3YA 1XL6A 1M9NA 4L87A 4ABMA 1Z2GA 3JSLA 3TXSA 1QU7A 2Q7GA 3SDLA 3ABKB 4PA9A 5HFMA 3OMIB 4I9WA 4DR2O 4LF6O 1EN4A 2P4VA 3GVMA 2YI8A 4X66B 3AEIA 1FJGO 2DWDC 3SJQC 4O4IB 3RYHA 1RM1C 3X2QC 3E83A 5LXTA 1OCZB 2QM4A 1SC5B 2LFSA 1OCCC 3I56V 4PDLA 4ASUG 3F7VC 1V9PA 2B5UA 3LNNA 3WG7C 3D36C 1FYJA 4U3FH 3JYCA 4YIOA 2DQ0A 4OX9B 3BVOA 4GUNA 2RJZA 2XTAA 4X1IA 1GK9A 1Q3EA 4K0KO 4D7SA 2YXLA 3K3WA 5IYZB 1OCCB 3QNEA 3ETQA 1TUEB 2QDOA 4LP8A 5B1AB 5KHHA 4U7NA 3CMAV 3G6BA 1SQVH 3CRAA 5JQGB 5H5NA 3WG7B 4LFAB 4NXMO 4DR7O 5J2TB 2QJ1A 4X20A 1NBMG 2W0FC 2ZINA 4UCSA 1IVSA 4P9PA 3D8CA 1K8AW 3A0RA 4PD4F 4JAUA 2UUCB 3GB7C 2PI4A 4P9OA 2FTKA 4NXMB 4DR7B 4LFAO 4JAAA 4NB5A 4IIJA 3FFQA 1KECA 2M7WA 3ZRWA 3DSQA 4IHJB 1BT8A 3H1JH 5C8YA 3K04A 5LGUA 1S76D 1PD3A 3KZIZ 5KA6A 2LW1A 3VQXA 1K4DC 3RT3C 1SQGA 1TVKB 2JIZG 4K35A 2H3OA 2ZE8A 3T1HO 2VS0A 1XUQA 3NXSA 1WN7A 3ML0A 2KKWA 4R7CA 1NH2D 1AILA 4DUYO 3K03A 1KKCA 5KX5B 1M4UA 1SERA 5EZYA 4LH7A 4DR5O 2LQTA 3RWRD 1JFFB 5KA5A 1URFA 1XOUA 5E1AC 5EBLC 2P5OA 3KCXA 2N04A 1FPOA 4J7KA 2PF4E 2QWRB 4C7UA 4EFEA 4K0KB 1ZAUA 3SPHA 1QVFU 4DV4O 4LF4B 5LMNB 3JARA 1EZVH 3ZS8C 2UXXA 1FAFA 2UUAO 1R6TA 3Q4HB 5BY1A 2F4VO 4CC6A 5IYZA 2EBOA 2LGQA 1NR1A 5AG2A 1KBHA 3G6EV 4FPPA 4RUFA 1N32B 3K0GA 3BCCH 5CN0A 4Z1VA 1TAEA 3K9SA 4X65O 2DYSC 1G4YB 2EJRA 1M5IA 3E35A 1B3QA 3CHXA 1XBLA 3CJHA 3VQVA 4JZ2A 3CEIA 5KHJA 1NTKH 4NKGB 1DF4A 1JJOA 5JVDA 1WA8B 2DN9A 5DN6G 3W7TA 4I4TB 2GTAA 2QR4A 1XMOO 4QE7A 4JI5O 4YY3O 2OT5A 2WLMA 3HPLC 3A8TA 3H9VA 1KP3A 2PI5A 3AG4C 2ZE6A 2GV9A 2DYRC 1COWG 3GWOA 1SQPH 2ZQMA 5CBFA 3O9OA 1XNQB 4B3MB 1IDSA 1QHTA 4CS2A 3ZRVA 4FJCC 4JYAB 1FS0G 1H38A 4MTFA 3ZHVA 3JSNA 4TV9A 1VQNV 1D2DA 4I5SA 5H9CA 3AG2B 1ZUQA 2NLJC 4DV7B 3AG4B 2OYQA 4RAIA 2IW5A 1VARA 5CMUA 2DE0X 4QPKA 1GN4A 4PDRA 1DF5A 1LNQA 1BGYH 4DRXB 3OR7C 2YSUB 4GT1A 5H6QA 1H2MA 5EBMC 2WLHA 1H2LA 1OCZC 3H01A 4WFEA 4EB6A 4O4HA 5LOVA 3SPGA 3HKEB 3T2MA 2VQFO 3EHBB 5FLXN 1QR8A 2ZD9A 3BEHA 4DV0B 4DV3O 2OTLV 2Y4UA 5KLVH 4JI2B 1MG1A 4ZBMA 2F23A 3OM3B 5IYBO 3APOA 4JPRA 3CCRV 2Q7HA 3H1HH 2EIJB 4BAYA 1I5XA 3JD3A 4LF9O 2KSDA 3MHSC 2NNUA 3QO7A 2YIBA 4NXNB 3STLC 2Q69A 4X1YB 2EZOA 5JVDB 2QKCA 2E5LO 3ABKC 2DYRB 3B77A 1N8RW 1XREA 1YITV 3ABMB 3ZN0A 4B3SO 5DECA 2L35A 1NI8A 3CXCU 4NYKA 5BMVA 3ZHTA 2V1DA 4JZGA 5L3BA 3D3QA 4DYLA 2HEPA 1VQ9V 2WAMA 1M57B 1JMKC 3AG1C 3HR0A 3WB2A 1U96A 3QO8A 4JAVA 4DV2B 4PJ0Z 1RPOA 4X88A 1HP8A 2FMLA 1TGOA 4NR1A 3JATA 1JVMA 1JA8A 3U11A 3WFVA 4R50A 1K3EA 2IH3C 4JV5B 4I55A 4DRXA 3K5LA 4J10A 4O4JB 1XHZA 3IC9A 2XUMA 2Y48A 1N33O 4F6EA 2HHHO 3HKEA 4K8XA 5JH7B 3ZIAG 5IYDO 3MDSA 3N2GB 4LH6A 2E76B 3CCMV 4DR3B 1HW7A 1NH2B 1HDJA 2VWJA 4PI2A 4YXWG 2P4KA 3ZN1A 4JI7B 2ZE5A 3ZRXA 5J2TA 4X64O 1QR9A 3AK2A 4MVQA 3ZJZA 4J42A 3E2EA 5EYPB 3E8FA 2ZE7A 4CBCA 2UU9B 2ZM6O 3UM7A 4HYOA 3PJSK 2ZDIC 3AG3B 3D3IA 4IIJB 4QJFB 3SPJA 4DV5O 4WFFA 4E2LA 3F7YC 4X65B 5KHKA 3CX5F 1W0JG 4IHJA 3A0BZ 2HR3A 4JI0B 2R9IA 2UU9O 1SZTA 3J7AU 3JD0A 2MW2B 2RDCA 4JI8B 3ZRSA 1M57C 5GONB 4JGSA 2AXTZ 2PY5A 1MNGA 2PYJA 5JCOA 3FAVB 1JCHA 1ZLZA 2ATKC 3B2EE 4EFBA 1X4TA 1OCOC 4IYHA 1MMMA 2MK3A 2D3OW 4H37A 2EX3A 2CK3G 1SESA 2UXDO 4TSFG 5KX5A 1AVMA 4J9YB 3RBZA 4OXSA 4MVSA 1EZJA 1HWYA 4MTXA 3B4SA 2UUBB 1HR0O 4DR4B 1GM8A 3JATB 4LF8B 2ITCC 1AROP 4DUYB 3SGIA 1O9GA 1YEWA 4GKKO 1FKAO 3QG5A 1SQQH 2HVKC 5B1AC 4O2BB 2WLLA 1Q7YW 4JTCB 1KUQA 5JH7A 2CTWA 2KQXA 1CEZA 4HNAB 3ICXA 3STZC 3E22B 3N2GA 4TQFA 3FYEB 1MSWD 3CPWU 1YTFB 4YHHB 4NTXA 5GTIZ 4J7JA 3CCQV 1Q6UA 2GHYA 1KB9F 2E75B 3K9AA 2EIMB 2YDEA 1SA0B 2RMKB 2JRIA 2Q0OC 2EULA 1PL4A 4J41A 2XNDG 3OGCC 3JALB 1MOFA 1GH6A 1Y74A 2WLIB 3TK1A 3S3XA 2B1IA 2YUAA 1K34A 2ZCEA 1K5QA 1OCOB 2R9RB 4N23A 5L3DA 2YICA 3BAAA 4BIOA 2XAJA 4AILC 1XI1A 1N34B 2Q0AA 2F93B 2QWPB 1K97A 4CS4A 1S0VA 4D7TA 5JCOC 4JI6B 4WFHA 5F2VO 4YJ3B 2Q73A 2QTSA 1YZBA 1P7BA 2IJHA 3RYHB 1M56C 4U3JA 5LHIA 4ZI7B 3SPIA 4CZZA 2VRZA 3RYIB 2QWOB 3OGIB 4BW5A 3ABLC 2ZXWB 3OUFA 1K5SA 3JAWB 1KKDA 1WJZA 4KUMA 2FKXA 3NR7A 1GN3A 2A9HA 2OWOA 1RPRA 3RW0A 2IU3A 5DEDA 2QA4V 4DV7O 4DR6O 2CDYA 2EIJC 1V55C 2BOCC 4MW3A 3CYOA 1YCIA 2O57A 2EILB 2Q7EA 5TISZ 1R6NA 4GLXA 3ABLB 2V4DA 5B1BB 2JGDB 1FFTB 4I50B 4DK0A 2IH1C 1GTOA 4NTYA 5CA1A 1NU1H 2BTOA 1IZ3A 1TUBA 1I08A 2DW4A 4MVOA 4BIUA 3M7MX 5D5QA 4DW0A 4FFBB 4MVRA 2DWEC 5KAIZ 1L0NH 5EC2C 1OV9A 3FKSG 2ADQB 1BS3A 3F5WC 2LJ2A 4LWSA 3AK1A 1IX9A 2JJ1G 5C8YB 4RQFA 4B3TB 2KG7A 4LFCO 4XDJA 5KUMA 5K1PA 2ILMA 4WFBV 2ZR2A 5LYJA 4KFMA 4HAMA 4ZIBA 1H2GA 4PA7A 2RCVA 4NTWA 1K33A 3P3NA 4IL6Z 1U97A 1SQBH 1VQ7V 3OEHG 1BE3H 4YJ3A 4HBNA 5CB4A 5JJJB 3JD1A 2UUAB 1I94B 1P49A 4FZ1A 4KHPB 4B3RO 4W4LA 4P2ZA 3OFNG 3S3WA 5L3EA 4LF7B 2XT9A 5EBWC 2CE4A 1OJHA 5A2QN 4H44B 4I55B 3RYCA 3L9DA 3N27A 1F51A 3AG7A 4F6RB 5IWAO 4DR5B 3Q4HA 2QTOA 4G27B 4UV8A 3LSSA 4UVBA 1WPBA 2R9AA 2JGDA 2EINB 1Q43A 3DXRA 4MVZA 4JI1O 1S72V 2HLDG 5CA1B 4CS3A 1YDXA 2LFRA 1TUBB 5KMGA 3CJHB 3HKBA 5EYPA 1PNLA 5ITZB 1L8DA 3G67A 2A3QA 2YEVB 1RP3B 2W0XA 1Y76A 4FFBA 1IBLO 2F43G 3G71V 3CRCA 3OMAB 3T4DA 4ZOLB 4J9ZB 4DV1O 3H1KH 1R3LC 3OAAG 2LO1A 3LSQA 5IT9N 3VQYA 1K4CC 1KU9A 4PA3A 2KG7B 3G80A 1FXHA 1WPXA 1S5JA 1YJNV 4W4KA 2QM8A 2OIGA 4Z1MG 5H6RA 4DV1B 3AG1B 1J5EO 3FAVA 5A9GA 3OW2U 1HR0B 4DR4O 2QSAA 5LP6A 3SYOA 3SYPA 1CPYA 2P7TC 3B09A 2P90A 2UXDB 3BRCA 5D5PA 3SJAC 5FNVB 2XAFA 1Q81W 3K08A 1WNSA 2XOKG 5IY5C 3OMNB 2QWNB 5C93A 1XHXA 2ZNJA 3D36A 3ZBHA 5LXTB 4MT8A 1NS1A 3APQA 5LBQA 1NVPD 2WA3A 4FK5C 1YTFD 1NR7A 2UUBO 3ZHUA 4EB6B 5IY5B 2Q8VA 5EC1C 4MVMA 1BQZA 3HB3B 4DR2B 3RYFA 2FL4A 5LHGA 3CS5A 4WF9V 1FXKC 3ZEDA 2UXNA 1R6KA 3CRQA 4DUZB 3U10A 4Z2WA 4LFBO 1K92A 5KMGB 1D5NA 4QNHB 2P67A 1JPXA 2RNBA 2JEXA 2WLJA 3JAKA 2YEVA 4E4EA 5LP6C 3U0ZA 3ZHSA 1DGSA 4QIWF 4FM1A 1PL0A 1XNRO 1N33B 1F7YA 3TGUH 2GSMB 4K3AA 5KHIA 5LL6Y 4UCVA 3K79A 5IJ9B 1WP8A 4I0XB 4JV5O 4H33A 2JVDA 5BMVB 2F66C 2YIAA 4GYCB 1KYOF 5LP6B 5EK0A 4TQDA 2Q5ZA 3ABMC 2FYUH 4PDMA 4N21A 3ASOB 4CH6A 5FPRA 3KKYA 5FPOA 3IC7A 3DTUB 2UXBB 5L3FA 2ZXWC 5CA0B 1AP6A 3P30A 3L71H 5EZYB 2KB1A 2X6BA 2HHHB 2EIKB 3OTFA 3G4SV 1V55B 1WAZA 2QE7G 1J5EB 3W7XA 3E8BA 4UVAA 5LHHA 1BHAA 5B5EZ 2HG5C 1QNMA 4A5UB 3FX7A 3JARB 4FLWA 1AI6A 1H2NA 1BMFG 3ABTA 1AI7A 2RQ6A 1FXKB 5B1OA 1JQ0A 2E5LB 4ICGA 2FB5A 1GAXA 1M93A 2IM9A 1L0LH 4FLZA 2JS3A 3K58A 1NJIW 3RYFB 2H94A 4KP4A 4FIPC 4FFKA 4PA4A 4JYBA 4DR1O 5GTHZ 2CH7A 2YIBD 1AI4A 3RVZA 3JD4A 3JAMN 1VF6A 3OTOB 3CMEV 1YXBA 3BA8A 4AQYO 1KQSU 1IXMA 2E74B 1ENVA 1G8MA 1WB8A 1ZL8A 4AQYB 1B06A 2ADPA 4OPAA 3N2KA 3OE7G 1NT2B 1WA8A 3THOA 1MZEA 2GTSA 3BHPA 4JYCA 4TT3G 3M8AA 2X0LA 1R3KC 1IBKO 4K8ZA 5IJ9A 2IJIA 4X8AA 1VQLV 2WLKA 1L1FA 1RM1B 4LNUB 4B3RB 4KHPO 3P32A 2X6CA 2WSSG 3KG2A 4X1KA 3CCVV 1XMQO 2JS5A 4JI4O 2Q68A 2ZKOA 4J11A 2A0LA 1SZXA 1B6QA 4JYAO 2F95B 3VQWA 5CB4B 3OTOO 4LBEC 3LDDA 1XNQO 3H1IH 4O4IA 4DR1B 3CWBH 1XEQA 3SJBC 2C2AA 2WWWA 2DJVA 3K0DA 1IBMO 3I5DA 3J80N 3CE2A 3GWKC 4LFCB 5CA3A 4JI5B 1R73A 2IBZH 1P84F 2ZNIA 2PGGA 2X7RB 4KL1A 2EILC 2XHBA 4IYIA 2BSKA 4HNAA 3E89A 4EEQA 3HKDA 3ABUA 3LDCA 4FLTA 2HP8A 5H2FZ 4JTAB 4FLVA 2OIEA 5JQGA 2N05A 3UO3A 5B3SC 1AP5A 2X6AA 1B04A 2HJDA 1HNXB 3T1CA 4WBNA 3EFFK 4KXRA 4DW1A 1N32O 1FXVA 1QBZA 4H0LB 3UT5A 3L73H 2CGNA 4GX0A 3ETDA 4MTOA 1XMOB 3JALA 3MD0A 1ZWIC 2OTJV 4AHCA 2Q6AA 2EIMC 2BCCH 4DR6B 2HVJC 3C3SA 1QVGU 4DUZO 1K73W 4CH4A 3UQ8A 2RN9A 5LMNO 3O65A 4JI8O 1Q8IA 3CRRA 2CAZC 4GKJO 2PUSA 4JI0O 4ZKIA 2R70A 1TVKA 2ZIOA 4XDLA 1Q82W 4X1KB 2ETNA 1WP7A 3SPCA 3TXQA 1UJWB 2QEXV 4LFBB 4RWUA 3CCSV 1EFRG 3ZHQA 3ASNB 1XQ8A 1AR1B 3CC4V 5IJ0A 3T1HB 1YHQV 4UXNA 2AZ0A 1N34O 2Y69B 4DV4B 4LF4O 4U3JB 5LGNA 3K06A 3P3PA 4UCRA 1D5AA 2AHYA 1PV0A 3RYIA 4DXWA 4O4JA 1KD1W 2UXCO 2CTPA 4Q20A 3WB1A 3K57A 1HNWB 4DK1A 1GO3F 3ASNC 4CC5A 1A32A 5GW7A 1I5YA 3EXAA 4BR6A 2GBOA 3HKDB 2PTMA 3IGAC 4O2AB 4LC1A 1VQ4V 1NZ6A 1VQPV 1H2KA 1UFIA 2YS8A 2YC0A 4BIZA 2ODMA 4MSWC 2QM7A 1GM7A 3K5OA 5KAFZ 3K59A 2P06A 2HFEC 1EBOA 4UVCA 5IE9A 2JGUA 3ZX6A 1YF2A 4UCTA 1Z5WA 3F5TA 1Q6IA 1E1RG 1R1BA 3JCZA 4JI1B 3CC7V 5J2UB 1W0KG 3SYQA 1DK1A 4HZ3A 1BZKA 3ASOC 2NN4A 4B3SB 3TJTA 2GUZB 3AG2C 2ZIMA 4GCZA 2A06H 1CP9A 1Y4MA 3FB6C 4TOIA 4F4LA 1S5HC 4BW9A 1FJGB 4X66O 1J95A 1SKVA 1VQ6V 2UXCB 5L3GA 1EN6A 5CA0A 1MA1A 1N4CA 4FLUA 1E79G 2A79B 2Q4PA 1YSCA 2JDIG 1H8EG 3FD9A 3UCSC 3CB2A 3RYCB 3MAQA 1YJ9V 1SS3A 2Y0PA 5LA6B 3BABA 4FMTA 4O2BA 2YIDA 3FB7C 1FXKA 5CBHA 1OHHG 1X59A 2PYLA 1AJQA 3QF7A 1Y67A 4GKJB 2LW7A 4JYYA 4UB8Z 2P22C 3CRMA 4X64B 2IJKA 2WPDG 2CH7B 4PDVA 4O4LA 1I94O 1LUWA 4RQEA 3LSUA 1AB3A 3FB8C 3W7WA 5FL7G 2JK5C 2B9ZA 1NVPB 4DR3O 3BA9A 2N74A 4LF5B 2DOSA 4B3MO 3B8NA 3TCUA 2Q67A 1T5EA 4EKWA 4RO2A 1W2BU 5LMUO 3N2KB 3PN1A 1Y74B 5LGTA 4X62B 2OCHA 1KMIZ 1XILA 3CSXA 1H8HG 1HNXO 2H8PC 4UV9A 4GX2A 4L8JA 2F1MA 3QVNA 5B66Z 2ARHA 1EM1A 2Z0AA 4XBFA 4YY3B 5K1XA 2PZSA 5HFLA 4DV6B 1MABG 4YJ2B 3T4ZA 4UCOA 4LNUA 3RGBA 3ZMUA 1DTOA 1QLEB 1VF5B 2XAQA 4DV2O 4MVUA 4H13B 3M99B 3BFRA 5IDJA 2ZR3A 4TUYA 1M1KW 1F23A 1IBMB 3EVKA 4FVMA 2XASA 5FNVA 4CH5A 3HKCA 2AHZA 4WFAV 1SETA 1VP7A 3E86A 1SQXH 3BPZA 3OR6C 3C90A 5JJEB 3QO5A 1OCRB 2K9PA 4NVPA 2WA4A 2QKAA 4UB6Z 2F4VB 4B7EA 4JI4B 5B3SB 2EINC 3CCUV 5LA6A 2Y69C 2CTRA 1R3IC 2XAGA 2EJ7A 1MZFA 1NKDA 2DQ3A 3LNMB 3SR2C 3CXHF 2NR5A 3J81N 3SYCA 3CCJV 1VF6C 2W6JG 2V7QG 1IBKB 3K5NA 1W59A 1EN5A 1F4MA 4TWKA 4O4LB 1KP2A 4WBNB 1ORQC 4JI2O 1F4NA 4FZ0A 3LDEA 1V54C 4JI6O 3FB5C 2BTQA 4PV1B 4J80A 3CP1A 4AI8A 4DV0O 1QLNA 2AGAA 2ITDC 2EZPA 3IJ4A 4YIPA 2JEUA 2CUGA 3E8HA 1CXZB 4JTDB 2P6JA 3FYIB 1FD9A 1Q86W 4R8CA 1HNZB 1VQ5V 3IAYA 4LWSB 1GMGA 1Q6HA 1QLEC 2VQEO 1IURA 1MSDA 3ZMTA 2HJFC 1QCEA 2QGNA 1VIBA 3RVYA 4JF3A 4JI3B 1NTZH 4FLYA 2VWKA 2OCCB 5EIBD 5EIBC 3C3TA 3ZHRA 1PM9A 1PP9H 5IYCO 3IFXA 1BSMA 5KHGA 1OCRC 1G6UA 3HKCB 3OUSA 4YHHO 3B8MA 4I7ZB 1RSOB 1GM9A 5IJ0B 4FLXA 1GKFA 1KC8W 3CCEV 3CCLV 1HNWO 2LGWA 1I0HA 2OCCC 3RFRA 1NQTA 1ROPA 4PI0A 2LP7A 1UPGA 4UCUA 2UXBO 4UUJC 1OZ0A 1N0JA 1S3JA 2EIKC 3L74H 4IT5A 3SYAA 4F6RA 1ZSPA 2AW9A 3WU2Z 1I7FA 1LUVA 5LOVB 1S77D 1NTMH 1PPJH 4X1IB 4GKKB 5E79Z 2YXHA 3DGEA 3JCUZ 3K5MA 3L75H 4PELA 1FFXB 1XL4A 2Y4TA 4LF8O 3LUTB 1AR4A 1JX9A 2K1EA 5BR8B 3KCYA 1SF9A 3DXRB 4MW8A 1LR1A 3JASB 1SA0A 4Q6GA 2Y0IA 5DM6V 3HKBB 1Y66A 4UFZA 4ZHQB 1H2SB 5B1NA 1E1QG 2DYSB 4LCUC 4GX1A 2WLIA 3W7UA 1Z5VA 2HKOA 3QTCA 1THZA 5J2UA 3BY6A 1JR9A 1RFYA 4OGQB 4QGPA 3UKMA 1YIJV 1GN2A 1JJ2U
chains in the Genus database with same CATH topology
5KUMA 4ZKIA 5J9PC 1KP3A 4WFBV 2ZR2A 2PI5A 1WLEA 3ETGA 3AG4C 4KFMA 4HAMA 1H2GA 2W6IG 4PA7A 2DYRC 1BHBA 1COWG 1YI2V 1M56B 3GWOA 4XDLA 1Q82W 2ZQMA 5CBFA 1K33A 3TETA 3SPCA 1VQ7V 3ZRVA 4FJCC 3X2QB 1FS0G 3OEHG 1H38A 2XAHA 4MTFA 3ZMSA 1VQMV 1UJWB 1VQNV 2QEXV 4I5SA 5H9CA 3AG2B 3CCSV 2NLJC 1EFRG 3JD1A 4XDKA 3ASNB 3AG4B 5CBGA 4RAIA 1AR1B 2IW5A 3CC4V 1YHQV 4UXNA 5CMUA 5BZBA 1K7DA 2Y69B 4P2ZA 3OFNG 4QPKA 5L3EA 5LGNA 3K06A 4G28B 5EBWC 4PDRA 2Z5UA 2AHYA 1DF5A 1LNQA 1K9MW 4DXWA 1KD1W 3OR7C 2YSUB 1AI5A 4GT1A 1F51A 4Q20A 5H6QA 5EBMC 2IU0A 3I55V 2WLHA 1OCZC 3H01A 4WFEA 4WFGA 1GO3F 3ASNC 3ZMZA 3SPGA 3VBBA 3T2MA 2QTOA 3EHBB 5GW7A 1I5YA 2WLNA 4G27B 4UV8A 1QR8A 2ZD9A 1VQOV 2BOBC 3BEHA 4QPJA 3IGAC 3LSSA 4UVBA 2OTLV 4LC1A 1VQ4V 4GX5A 1VQPV 4DO2A 2QKSA 4MTGA 1MG1A 4BIZA 2EINB 4ZBMA 3OM3B 3ZCCA 4MSWC 5IYBO 4MVZA 2QM7A 4MS2A 1GM7A 3OEEG 1S72V 2HLDG 3AG3C 4JPRA 3CCRV 2LFRA 2HFEC 1EBOA 1PKXA 2EIJB 4UVCA 4BAYA 3CC2V 1I5XA 1M90W 3JD3A 1P4RA 3MHSC 1PNLA 2NNUA 3QO7A 4RUEA 2YEVB 3STLC 2Q69A 1E1RG 3VOUA 2EZOA 2F43G 3JCZA 3G71V 3CC7V 3SYQA 1W0KG 3OMAB 3T4DA 3ABKC 4J9ZB 2DYRB 4HZ3A 3ASOC 3B77A 1R3LC 4X89A 1N8RW 3OAAG 3R65A 3LSQA 1K4CC 4PA3A 1YITV 3ABMB 3AG2C 3ZN0A 1FXHA 4P30A 1WPXA 4GCZA 1YJNV 1CP9A 2QM8A 4Z1MG 5H6RA 3CXCU 3AG1B 3W7SA 1Y4MA 3FB6C 4F4LA 3OW2U 2V1DA 4JASA 5L3BA 1S5HC 3SYOA 3SYPA 1CPYA 1J95A 2P7TC 2B1GA 1VQ9V 1VQ6V 4U7OA 2WAMA 1M57B 1PNMA 2P90A 3AG1C 5L3GA 2XAFA 1Q81W 1E79G 3K08A 2XOKG 3QO8A 4JAVA 3CD6V 5IY5C 3OMNB 1RPOA 5C93A 4X88A 2A79B 3D36A 1YSCA 2JDIG 1H8EG 1VQ8V 4MT8A 3JD2A 1JVMA 3WFVA 5L3CA 5LBQA 4R50A 1K3EA 2IH3C 1DLBA 1NVPD 4FK5C 1YTFD 1YJ9V 2Y48A 1NR7A 1SRYA 4FMTA 3FB7C 1FXKA 2WLLB 5CBHA 5IY5B 1OHHG 1AJPA 1V54B 5EC1C 1AJQA 4MVMA 3ZIAG 5IYDO 4PA6A 3E8GA 3HB3B 4WCEV 2ZDIA 5LHGA 3CCMV 1VQKV 4WF9V 1FXKC 2JJ2G 1NH2B 2UXNA 2IJKA 2WPDG 4PDVA 1R6KA 4YXWG 3ZMVA 4QE9A 3ZN1A 4RQEA 3ZRXA 3FB8C 3W7WA 5FL7G 2JK5C 1K92A 1NVPB 1QR9A 4MVQA 3ZJZA 1PNKA 4R6ZA 4QNHB 3E2EA 3E8FA 3B8NA 3TCUA 2P67A 2Q67A 4CBCA 1JPXA 4EKWA 2JEXA 2WLJA 4RO2A 4HYOA 3UM7A 1W2BU 3PJSK 2ZDIC 5LGTA 1YJWV 2YEVA 1BL8A 3AG3B 3D3IA 4QJFB 3SPJA 5B1BC 4QIWF 4WFFA 1H8HG 3F7YC 4E2LA 1R3JC 1PL0A 5KUKA 1AJNA 3MHHC 3ZRWB 2H8PC 1W0JG 4UV9A 4GX2A 2HR3A 2GSMB 2R9IA 3ETEA 1SZTA 3JD0A 4XBFA 1JOYA 3K79A 4G2KA 5HFLA 3ZRSA 2IJJA 2Z3YA 1M57C 1XL6A 4H33A 4JGSA 1MABG 1M9NA 3T4ZA 4L87A 1JCHA 2ATKC 3ZMUA 1DTOA 1OCOC 1QLEB 2XAQA 5EK0A 3ABMC 4MVUA 3ABKB 4PA9A 4PDMA 2MK3A 3M99B 3ASOB 4N21A 5IDJA 2D3OW 4H37A 2ZR3A 5HFMA 1M1KW 3OMIB 3IC7A 3DTUB 1F23A 4I9WA 5L3FA 2ZXWC 2CK3G 2XASA 1SESA 4TSFG 3P30A 4J9YB 2AHZA 3RBZA 4OXSA 4MVSA 4WFAV 1SETA 2KB1A 2X6BA 3AEIA 2EIKB 3E86A 1EZJA 2DWDC 1HWYA 4MTXA 3SJQC 3G4SV 1RM1C 1V55B 3OR6C 3X2QC 1GM8A 2QE7G 1OCZB 3E83A 3QO5A 3W7XA 2LFSA 1OCCC 2ITCC 1AROP 1OCRB 3I56V 3E8BA 4UVAA 4PDLA 5LHHA 4ASUG 1BHAA 3F7VC 2HG5C 2B5UA 3WG7C 5B3SB 2EINC 3CCUV 3JYCA 2DQ0A 2Y69C 2HVKC 1AI6A 5B1AC 1BMFG 3ABTA 1AI7A 2WLLA 1FXKB 5B1OA 1JQ0A 1Q7YW 1R3IC 2XAGA 4JTCB 1NKDA 2DQ3A 1GK9A 1CEZA 3LNMB 3CCJV 3SYCA 3K3WA 2W6JG 1OCCB 3QNEA 3STZC 1TUEB 1NJIW 2V7QG 2H94A 4LP8A 5B1AB 4KP4A 4FIPC 4U7NA 3CMAV 4PA4A 4JYBA 3FYEB 3WG7B 1MSWD 3CPWU 1F4MA 1YTFB 1AI4A 4TWKA 3JD4A 3RVZA 1KP2A 3CCQV 2GHYA 3K9AA 2EIMB 3CMEV 1ORQC 1NBMG 1F4NA 3LDEA 2W0FC 1V54C 1KQSU 1IXMA 3FB5C 1ENVA 1G8MA 3CP1A 2XNDG 4P9PA 1QLNA 1K8AW 3A0RA 4JAUA 3OGCC 3GB7C 2PI4A 2ITDC 1MOFA 2EZPA 4P9OA 2WLIB 2FTKA 3TK1A 2JEUA 3OE7G 3E8HA 4JTDB 1KECA 2B1IA 2P6JA 3FYIB 4JYCA 2M7WA 4TT3G 1K34A 1Q86W 4R8CA 3ZRWA 1VQ5V 2X0LA 1GMGA 1K5QA 1OCOB 1QLEC 1R3KC 2R9RB 3K04A 5LGUA 1S76D 4N23A 2HJFC 5L3DA 3ZMTA 1PD3A 2IJIA 5KA6A 4X8AA 1QCEA 1VQLV 1K4DC 3RVYA 4JF3A 2WLKA 1L1FA 2XAJA 2JIZG 1RM1B 2OCCB 3P32A 2X6CA 2WSSG 3KG2A 3CCVV 3NXSA 1K97A 1S0VA 3ML0A 2Q68A 3IFXA 5IYCO 4R7CA 2A0LA 4WFHA 1NH2D 1B6QA 1OCRC 3K03A 3OUSA 4LBEC 3LDDA 1SERA 1P7BA 3B8MA 1GM9A 1GKFA 2IJHA 1KC8W 1M56C 3CCEV 3CCLV 2OCCC 2C2AA 2WWWA 5KA5A 5LHIA 5E1AC 5EBLC 1NQTA 3SPIA 1ROPA 2LP7A 4CZZA 3K0DA 4UUJC 1OZ0A 4BW5A 1S3JA 2EIKC 3ABLC 3SPHA 5CA3A 2ZXWB 3OUFA 3SYAA 1QVFU 1K5SA 1R73A 1KKDA 4KUMA 2X7RB 2UXXA 2A9HA 2EILC 1RPRA 3RW0A 2IU3A 2QA4V 1S77D 2EIJC 1V55C 2BOCC 3DGEA 3E89A 4MW3A 2EBOA 4PELA 3ABUA 3CYOA 3LDCA 1NR1A 1XL4A 2EILB 3LUTB 4JTAB 3G6EV 4FPPA 4RUFA 1R6NA 3K0GA 3ABLB 5B1BB 5CN0A 1JX9A 5B3SC 2K1EA 2X6AA 1FFTB 4MW8A 2DYSC 2IH1C 1GTOA 3T1CA 1G4YB 2EJRA 3EFFK 3E35A 1FXVA 1QBZA 5DM6V 1Y66A 2DW4A 4GX0A 4MVOA 3ETDA 4MTOA 4BIUA 5B1NA 1E1QG 1DF4A 2DYSB 1ZWIC 3MD0A 4GX1A 4LCUC 2OTJV 2WLIA 2Q6AA 2EIMC 4MVRA 3W7UA 2DWEC 5DN6G 2HVJC 2HKOA 1THZA 3W7TA 1QVGU 1K73W 3BY6A 5EC2C 3FKSG 3F5WC 4QE7A 3UKMA 2JJ1G 1YIJV 4RQFA 2OT5A 2WLMA 3HPLC 1JJ2U 4XDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z3Y A;  4Z1M G;  1MAB G;  2W6I G;  5H6R A;  2XAJ A;  1COW G;  2JIZ G;  3ZMU A;  2V1D A;  2WSS G;  5L3B A;  2XAQ A;  1FS0 G;  3OEH G;  5L3F A;  2XAH A;  3ZMS A;  2CK3 G;  2XAS A;  5L3G A;  2XAF A;  4TSF G;  1E79 G;  1EFR G;  2XOK G;  2IW5 A;  4UXN A;  2JDI G;  1H8E G;  2QE7 G;  3OFN G;  5L3E A;  5LHI A;  5LGN A;  5L3C A;  4UVA A;  5LBQ A;  2Z5U A;  4CZZ A;  5LHH A;  4ASU G;  5H6Q A;  2Y48 A;  4KUM A;  1BMF G;  3ABT A;  2UXX A;  3ZMZ A;  1OHH G;  2XAG A;  3ZIA G;  4UV8 A;  2W6J G;  3ABU A;  2V7Q G;  4UVB A;  2H94 A;  5LHG A;  2JJ2 G;  2UXN A;  2WPD G;  4YXW G;  3ZMV A;  3ZN1 A;  3OEE G;  2HLD G;  2EJR A;  5FL7 G;  1NBM G;  4UVC A;  4BAY A;  2DW4 A;  2XND G;  1E1Q G;  5LGT A;  1E1R G;  3OE7 G;  2F43 G;  5DN6 G;  2HKO A;  1H8H G;  1W0K G;  4TT3 G;  3FKS G;  4UV9 A;  1W0J G;  3OAA G;  2R9I A;  2X0L A;  2JJ1 G;  4XBF A;  5LGU A;  3ZMT A;  5L3D A;  3ZN0 A; 
#chains in the Genus database with same CATH topology
 1BQ0 A;  1QQC A;  5J9P C;  1WLE A;  3ETG A;  2W6I G;  2YXY A;  1BHB A;  1YI2 V;  1M56 B;  4DV5 B;  5BR8 O;  3TET A;  2ZM6 B;  1GRJ A;  3A2F A;  2G38 A;  2DMX A;  3X2Q B;  2E3C A;  2XAH A;  3ZMS A;  1VQM V;  2YI9 A;  2L6L A;  3OD4 A;  2QWQ B;  1O9H A;  4XDK A;  4JI7 O;  5CBG A;  1RSO A;  5BZB A;  1K7D A;  1JFF A;  4JI3 O;  4ZI7 A;  4G28 B;  2Z5U A;  1K9M W;  3L72 H;  4OPH A;  1AI5 A;  3I55 V;  2IU0 A;  1US6 A;  4LR3 A;  3JAW A;  1Y6X A;  4TV8 B;  1IXB A;  4WFG A;  3ZMZ A;  3VBB A;  2CGO A;  1TA8 A;  3OT7 A;  2BSK B;  1WB7 A;  2WLN A;  2UUC O;  1VQO V;  1S5L Z;  2BOB C;  3A0H Z;  4QPJ A;  1FFX A;  4FM2 A;  4GX5 A;  1XMQ B;  4DO2 A;  4X9Q A;  2QKS A;  4MTG A;  3ZCC A;  4I50 A;  2ZT9 B;  3OEE G;  4MS2 A;  1SQF A;  4D6T H;  1IBL B;  3WB0 A;  3JAS A;  3AG3 C;  5JWP A;  1G1X B;  1PKX A;  1ZTE A;  3CC2 V;  1N36 O;  3UT5 B;  1M90 W;  4LF9 B;  1YVW A;  2VQE B;  1P4R A;  4ZHQ A;  3JAK B;  1HNZ O;  4RUE A;  3VOU A;  4BWA A;  5BXZ A;  4I4T A;  4X89 A;  3R65 A;  4OX9 O;  2GDS A;  4I9Q A;  4DV3 B;  3L70 H;  4P30 A;  4I0X A;  5LYJ B;  5GON A;  4FM0 A;  5JJN B;  4YJ2 A;  3W7S A;  2VQF B;  1Q5O A;  5IWA B;  2BE3 A;  4JAS A;  4NXN O;  2B1G A;  4U7O A;  3R66 A;  4B7K A;  1VF7 A;  4TUY B;  1PNM A;  1N36 B;  3RN4 A;  4LF6 B;  2AZ2 A;  2CTQ A;  4TV9 B;  1N0N A;  4LF7 O;  3UO2 A;  3CD6 V;  1Q90 D;  1VQ8 V;  3JD2 A;  5L3C A;  1ZX3 A;  4DV6 O;  1DLB A;  3DC5 A;  3H1L H;  2Q9L A;  1SRY A;  2D2C B;  1BCC H;  4TV8 A;  4O4H B;  2WLL B;  1AJP A;  3DC6 A;  1V54 B;  1P7G A;  4X62 O;  5LMU B;  4PA6 A;  3E8G A;  3AK3 A;  3E22 A;  4WCE V;  4O2A A;  4LF5 O;  2ZDI A;  4B3T O;  3B40 A;  1VQK V;  2JJ2 G;  4GZR B;  1XDC A;  3T1Y O;  3ZMV A;  4QE9 A;  1VMG A;  3T1Y B;  4X20 B;  3SJC C;  1GN6 A;  2R72 A;  1PNK A;  4IGG A;  4R6Z A;  2BTQ B;  1ZL8 B;  4PHZ A;  4B08 A;  5ITZ A;  1XNR B;  1VEW A;  1YJW V;  1BL8 A;  2A7W A;  1Y76 B;  2M6Y A;  4X1Y A;  4CH3 A;  1AR5 A;  5B1B C;  1R3J C;  4ZOL A;  5KUK A;  1AJN A;  3MHH C;  3ZRW B;  4J7Z A;  3ETE A;  2GUZ A;  1JOY A;  4G2K A;  2IJJ A;  2Z3Y A;  1XL6 A;  1M9N A;  4L87 A;  4ABM A;  1Z2G A;  3JSL A;  3TXS A;  1QU7 A;  2Q7G A;  3SDL A;  3ABK B;  4PA9 A;  5HFM A;  3OMI B;  4I9W A;  4DR2 O;  4LF6 O;  1EN4 A;  2P4V A;  3GVM A;  2YI8 A;  4X66 B;  3AEI A;  1FJG O;  2DWD C;  3SJQ C;  4O4I B;  3RYH A;  1RM1 C;  3X2Q C;  3E83 A;  5LXT A;  1OCZ B;  2QM4 A;  1SC5 B;  2LFS A;  1OCC C;  3I56 V;  4PDL A;  4ASU G;  3F7V C;  1V9P A;  2B5U A;  3LNN A;  3WG7 C;  3D36 C;  1FYJ A;  4U3F H;  3JYC A;  4YIO A;  2DQ0 A;  4OX9 B;  3BVO A;  4GUN A;  2RJZ A;  2XTA A;  4X1I A;  1GK9 A;  1Q3E A;  4K0K O;  4D7S A;  2YXL A;  3K3W A;  5IYZ B;  1OCC B;  3QNE A;  3ETQ A;  1TUE B;  2QDO A;  4LP8 A;  5B1A B;  5KHH A;  4U7N A;  3CMA V;  3G6B A;  1SQV H;  3CRA A;  5JQG B;  5H5N A;  3WG7 B;  4LFA B;  4NXM O;  4DR7 O;  5J2T B;  2QJ1 A;  4X20 A;  1NBM G;  2W0F C;  2ZIN A;  4UCS A;  1IVS A;  4P9P A;  3D8C A;  1K8A W;  3A0R A;  4PD4 F;  4JAU A;  2UUC B;  3GB7 C;  2PI4 A;  4P9O A;  2FTK A;  4NXM B;  4DR7 B;  4LFA O;  4JAA A;  4NB5 A;  4IIJ A;  3FFQ A;  1KEC A;  2M7W A;  3ZRW A;  3DSQ A;  4IHJ B;  1BT8 A;  3H1J H;  5C8Y A;  3K04 A;  5LGU A;  1S76 D;  1PD3 A;  3KZI Z;  5KA6 A;  2LW1 A;  3VQX A;  1K4D C;  3RT3 C;  1SQG A;  1TVK B;  2JIZ G;  4K35 A;  2H3O A;  2ZE8 A;  3T1H O;  2VS0 A;  1XUQ A;  3NXS A;  1WN7 A;  3ML0 A;  2KKW A;  4R7C A;  1NH2 D;  1AIL A;  4DUY O;  3K03 A;  1KKC A;  5KX5 B;  1M4U A;  1SER A;  5EZY A;  4LH7 A;  4DR5 O;  2LQT A;  3RWR D;  1JFF B;  5KA5 A;  1URF A;  1XOU A;  5E1A C;  5EBL C;  2P5O A;  3KCX A;  2N04 A;  1FPO A;  4J7K A;  2PF4 E;  2QWR B;  4C7U A;  4EFE A;  4K0K B;  1ZAU A;  3SPH A;  1QVF U;  4DV4 O;  4LF4 B;  5LMN B;  3JAR A;  1EZV H;  3ZS8 C;  2UXX A;  1FAF A;  2UUA O;  1R6T A;  3Q4H B;  5BY1 A;  2F4V O;  4CC6 A;  5IYZ A;  2EBO A;  2LGQ A;  1NR1 A;  5AG2 A;  1KBH A;  3G6E V;  4FPP A;  4RUF A;  1N32 B;  3K0G A;  3BCC H;  5CN0 A;  4Z1V A;  1TAE A;  3K9S A;  4X65 O;  2DYS C;  1G4Y B;  2EJR A;  1M5I A;  3E35 A;  1B3Q A;  3CHX A;  1XBL A;  3CJH A;  3VQV A;  4JZ2 A;  3CEI A;  5KHJ A;  1NTK H;  4NKG B;  1DF4 A;  1JJO A;  5JVD A;  1WA8 B;  2DN9 A;  5DN6 G;  3W7T A;  4I4T B;  2GTA A;  2QR4 A;  1XMO O;  4QE7 A;  4JI5 O;  4YY3 O;  2OT5 A;  2WLM A;  3HPL C;  3A8T A;  3H9V A;  1KP3 A;  2PI5 A;  3AG4 C;  2ZE6 A;  2GV9 A;  2DYR C;  1COW G;  3GWO A;  1SQP H;  2ZQM A;  5CBF A;  3O9O A;  1XNQ B;  4B3M B;  1IDS A;  1QHT A;  4CS2 A;  3ZRV A;  4FJC C;  4JYA B;  1FS0 G;  1H38 A;  4MTF A;  3ZHV A;  3JSN A;  4TV9 A;  1VQN V;  1D2D A;  4I5S A;  5H9C A;  3AG2 B;  1ZUQ A;  2NLJ C;  4DV7 B;  3AG4 B;  2OYQ A;  4RAI A;  2IW5 A;  1VAR A;  5CMU A;  2DE0 X;  4QPK A;  1GN4 A;  4PDR A;  1DF5 A;  1LNQ A;  1BGY H;  4DRX B;  3OR7 C;  2YSU B;  4GT1 A;  5H6Q A;  1H2M A;  5EBM C;  2WLH A;  1H2L A;  1OCZ C;  3H01 A;  4WFE A;  4EB6 A;  4O4H A;  5LOV A;  3SPG A;  3HKE B;  3T2M A;  2VQF O;  3EHB B;  5FLX N;  1QR8 A;  2ZD9 A;  3BEH A;  4DV0 B;  4DV3 O;  2OTL V;  2Y4U A;  5KLV H;  4JI2 B;  1MG1 A;  4ZBM A;  2F23 A;  3OM3 B;  5IYB O;  3APO A;  4JPR A;  3CCR V;  2Q7H A;  3H1H H;  2EIJ B;  4BAY A;  1I5X A;  3JD3 A;  4LF9 O;  2KSD A;  3MHS C;  2NNU A;  3QO7 A;  2YIB A;  4NXN B;  3STL C;  2Q69 A;  4X1Y B;  2EZO A;  5JVD B;  2QKC A;  2E5L O;  3ABK C;  2DYR B;  3B77 A;  1N8R W;  1XRE A;  1YIT V;  3ABM B;  3ZN0 A;  4B3S O;  5DEC A;  2L35 A;  1NI8 A;  3CXC U;  4NYK A;  5BMV A;  3ZHT A;  2V1D A;  4JZG A;  5L3B A;  3D3Q A;  4DYL A;  2HEP A;  1VQ9 V;  2WAM A;  1M57 B;  1JMK C;  3AG1 C;  3HR0 A;  3WB2 A;  1U96 A;  3QO8 A;  4JAV A;  4DV2 B;  4PJ0 Z;  1RPO A;  4X88 A;  1HP8 A;  2FML A;  1TGO A;  4NR1 A;  3JAT A;  1JVM A;  1JA8 A;  3U11 A;  3WFV A;  4R50 A;  1K3E A;  2IH3 C;  4JV5 B;  4I55 A;  4DRX A;  3K5L A;  4J10 A;  4O4J B;  1XHZ A;  3IC9 A;  2XUM A;  2Y48 A;  1N33 O;  4F6E A;  2HHH O;  3HKE A;  4K8X A;  5JH7 B;  3ZIA G;  5IYD O;  3MDS A;  3N2G B;  4LH6 A;  2E76 B;  3CCM V;  4DR3 B;  1HW7 A;  1NH2 B;  1HDJ A;  2VWJ A;  4PI2 A;  4YXW G;  2P4K A;  3ZN1 A;  4JI7 B;  2ZE5 A;  3ZRX A;  5J2T A;  4X64 O;  1QR9 A;  3AK2 A;  4MVQ A;  3ZJZ A;  4J42 A;  3E2E A;  5EYP B;  3E8F A;  2ZE7 A;  4CBC A;  2UU9 B;  2ZM6 O;  3UM7 A;  4HYO A;  3PJS K;  2ZDI C;  3AG3 B;  3D3I A;  4IIJ B;  4QJF B;  3SPJ A;  4DV5 O;  4WFF A;  4E2L A;  3F7Y C;  4X65 B;  5KHK A;  3CX5 F;  1W0J G;  4IHJ A;  3A0B Z;  2HR3 A;  4JI0 B;  2R9I A;  2UU9 O;  1SZT A;  3J7A U;  3JD0 A;  2MW2 B;  2RDC A;  4JI8 B;  3ZRS A;  1M57 C;  5GON B;  4JGS A;  2AXT Z;  2PY5 A;  1MNG A;  2PYJ A;  5JCO A;  3FAV B;  1JCH A;  1ZLZ A;  2ATK C;  3B2E E;  4EFB A;  1X4T A;  1OCO C;  4IYH A;  1MMM A;  2MK3 A;  2D3O W;  4H37 A;  2EX3 A;  2CK3 G;  1SES A;  2UXD O;  4TSF G;  5KX5 A;  1AVM A;  4J9Y B;  3RBZ A;  4OXS A;  4MVS A;  1EZJ A;  1HWY A;  4MTX A;  3B4S A;  2UUB B;  1HR0 O;  4DR4 B;  1GM8 A;  3JAT B;  4LF8 B;  2ITC C;  1ARO P;  4DUY B;  3SGI A;  1O9G A;  1YEW A;  4GKK O;  1FKA O;  3QG5 A;  1SQQ H;  2HVK C;  5B1A C;  4O2B B;  2WLL A;  1Q7Y W;  4JTC B;  1KUQ A;  5JH7 A;  2CTW A;  2KQX A;  1CEZ A;  4HNA B;  3ICX A;  3STZ C;  3E22 B;  3N2G A;  4TQF A;  3FYE B;  1MSW D;  3CPW U;  1YTF B;  4YHH B;  4NTX A;  5GTI Z;  4J7J A;  3CCQ V;  1Q6U A;  2GHY A;  1KB9 F;  2E75 B;  3K9A A;  2EIM B;  2YDE A;  1SA0 B;  2RMK B;  2JRI A;  2Q0O C;  2EUL A;  1PL4 A;  4J41 A;  2XND G;  3OGC C;  3JAL B;  1MOF A;  1GH6 A;  1Y74 A;  2WLI B;  3TK1 A;  3S3X A;  2B1I A;  2YUA A;  1K34 A;  2ZCE A;  1K5Q A;  1OCO B;  2R9R B;  4N23 A;  5L3D A;  2YIC A;  3BAA A;  4BIO A;  2XAJ A;  4AIL C;  1XI1 A;  1N34 B;  2Q0A A;  2F93 B;  2QWP B;  1K97 A;  4CS4 A;  1S0V A;  4D7T A;  5JCO C;  4JI6 B;  4WFH A;  5F2V O;  4YJ3 B;  2Q73 A;  2QTS A;  1YZB A;  1P7B A;  2IJH A;  3RYH B;  1M56 C;  4U3J A;  5LHI A;  4ZI7 B;  3SPI A;  4CZZ A;  2VRZ A;  3RYI B;  2QWO B;  3OGI B;  4BW5 A;  3ABL C;  2ZXW B;  3OUF A;  1K5S A;  3JAW B;  1KKD A;  1WJZ A;  4KUM A;  2FKX A;  3NR7 A;  1GN3 A;  2A9H A;  2OWO A;  1RPR A;  3RW0 A;  2IU3 A;  5DED A;  2QA4 V;  4DV7 O;  4DR6 O;  2CDY A;  2EIJ C;  1V55 C;  2BOC C;  4MW3 A;  3CYO A;  1YCI A;  2O57 A;  2EIL B;  2Q7E A;  5TIS Z;  1R6N A;  4GLX A;  3ABL B;  2V4D A;  5B1B B;  2JGD B;  1FFT B;  4I50 B;  4DK0 A;  2IH1 C;  1GTO A;  4NTY A;  5CA1 A;  1NU1 H;  2BTO A;  1IZ3 A;  1TUB A;  1I08 A;  2DW4 A;  4MVO A;  4BIU A;  3M7M X;  5D5Q A;  4DW0 A;  4FFB B;  4MVR A;  2DWE C;  5KAI Z;  1L0N H;  5EC2 C;  1OV9 A;  3FKS G;  2ADQ B;  1BS3 A;  3F5W C;  2LJ2 A;  4LWS A;  3AK1 A;  1IX9 A;  2JJ1 G;  5C8Y B;  4RQF A;  4B3T B;  2KG7 A;  4LFC O;  4XDJ A;  5KUM A;  5K1P A;  2ILM A;  4WFB V;  2ZR2 A;  5LYJ A;  4KFM A;  4HAM A;  4ZIB A;  1H2G A;  4PA7 A;  2RCV A;  4NTW A;  1K33 A;  3P3N A;  4IL6 Z;  1U97 A;  1SQB H;  1VQ7 V;  3OEH G;  1BE3 H;  4YJ3 A;  4HBN A;  5CB4 A;  5JJJ B;  3JD1 A;  2UUA B;  1I94 B;  1P49 A;  4FZ1 A;  4KHP B;  4B3R O;  4W4L A;  4P2Z A;  3OFN G;  3S3W A;  5L3E A;  4LF7 B;  2XT9 A;  5EBW C;  2CE4 A;  1OJH A;  5A2Q N;  4H44 B;  4I55 B;  3RYC A;  3L9D A;  3N27 A;  1F51 A;  3AG7 A;  4F6R B;  5IWA O;  4DR5 B;  3Q4H A;  2QTO A;  4G27 B;  4UV8 A;  3LSS A;  4UVB A;  1WPB A;  2R9A A;  2JGD A;  2EIN B;  1Q43 A;  3DXR A;  4MVZ A;  4JI1 O;  1S72 V;  2HLD G;  5CA1 B;  4CS3 A;  1YDX A;  2LFR A;  1TUB B;  5KMG A;  3CJH B;  3HKB A;  5EYP A;  1PNL A;  5ITZ B;  1L8D A;  3G67 A;  2A3Q A;  2YEV B;  1RP3 B;  2W0X A;  1Y76 A;  4FFB A;  1IBL O;  2F43 G;  3G71 V;  3CRC A;  3OMA B;  3T4D A;  4ZOL B;  4J9Z B;  4DV1 O;  3H1K H;  1R3L C;  3OAA G;  2LO1 A;  3LSQ A;  5IT9 N;  3VQY A;  1K4C C;  1KU9 A;  4PA3 A;  2KG7 B;  3G80 A;  1FXH A;  1WPX A;  1S5J A;  1YJN V;  4W4K A;  2QM8 A;  2OIG A;  4Z1M G;  5H6R A;  4DV1 B;  3AG1 B;  1J5E O;  3FAV A;  5A9G A;  3OW2 U;  1HR0 B;  4DR4 O;  2QSA A;  5LP6 A;  3SYO A;  3SYP A;  1CPY A;  2P7T C;  3B09 A;  2P90 A;  2UXD B;  3BRC A;  5D5P A;  3SJA C;  5FNV B;  2XAF A;  1Q81 W;  3K08 A;  1WNS A;  2XOK G;  5IY5 C;  3OMN B;  2QWN B;  5C93 A;  1XHX A;  2ZNJ A;  3D36 A;  3ZBH A;  5LXT B;  4MT8 A;  1NS1 A;  3APQ A;  5LBQ A;  1NVP D;  2WA3 A;  4FK5 C;  1YTF D;  1NR7 A;  2UUB O;  3ZHU A;  4EB6 B;  5IY5 B;  2Q8V A;  5EC1 C;  4MVM A;  1BQZ A;  3HB3 B;  4DR2 B;  3RYF A;  2FL4 A;  5LHG A;  3CS5 A;  4WF9 V;  1FXK C;  3ZED A;  2UXN A;  1R6K A;  3CRQ A;  4DUZ B;  3U10 A;  4Z2W A;  4LFB O;  1K92 A;  5KMG B;  1D5N A;  4QNH B;  2P67 A;  1JPX A;  2RNB A;  2JEX A;  2WLJ A;  3JAK A;  2YEV A;  4E4E A;  5LP6 C;  3U0Z A;  3ZHS A;  1DGS A;  4QIW F;  4FM1 A;  1PL0 A;  1XNR O;  1N33 B;  1F7Y A;  3TGU H;  2GSM B;  4K3A A;  5KHI A;  5LL6 Y;  4UCV A;  3K79 A;  5IJ9 B;  1WP8 A;  4I0X B;  4JV5 O;  4H33 A;  2JVD A;  5BMV B;  2F66 C;  2YIA A;  4GYC B;  1KYO F;  5LP6 B;  5EK0 A;  4TQD A;  2Q5Z A;  3ABM C;  2FYU H;  4PDM A;  4N21 A;  3ASO B;  4CH6 A;  5FPR A;  3KKY A;  5FPO A;  3IC7 A;  3DTU B;  2UXB B;  5L3F A;  2ZXW C;  5CA0 B;  1AP6 A;  3P30 A;  3L71 H;  5EZY B;  2KB1 A;  2X6B A;  2HHH B;  2EIK B;  3OTF A;  3G4S V;  1V55 B;  1WAZ A;  2QE7 G;  1J5E B;  3W7X A;  3E8B A;  4UVA A;  5LHH A;  1BHA A;  5B5E Z;  2HG5 C;  1QNM A;  4A5U B;  3FX7 A;  3JAR B;  4FLW A;  1AI6 A;  1H2N A;  1BMF G;  3ABT A;  1AI7 A;  2RQ6 A;  1FXK B;  5B1O A;  1JQ0 A;  2E5L B;  4ICG A;  2FB5 A;  1GAX A;  1M93 A;  2IM9 A;  1L0L H;  4FLZ A;  2JS3 A;  3K58 A;  1NJI W;  3RYF B;  2H94 A;  4KP4 A;  4FIP C;  4FFK A;  4PA4 A;  4JYB A;  4DR1 O;  5GTH Z;  2CH7 A;  2YIB D;  1AI4 A;  3RVZ A;  3JD4 A;  3JAM N;  1VF6 A;  3OTO B;  3CME V;  1YXB A;  3BA8 A;  4AQY O;  1KQS U;  1IXM A;  2E74 B;  1ENV A;  1G8M A;  1WB8 A;  1ZL8 A;  4AQY B;  1B06 A;  2ADP A;  4OPA A;  3N2K A;  3OE7 G;  1NT2 B;  1WA8 A;  3THO A;  1MZE A;  2GTS A;  3BHP A;  4JYC A;  4TT3 G;  3M8A A;  2X0L A;  1R3K C;  1IBK O;  4K8Z A;  5IJ9 A;  2IJI A;  4X8A A;  1VQL V;  2WLK A;  1L1F A;  1RM1 B;  4LNU B;  4B3R B;  4KHP O;  3P32 A;  2X6C A;  2WSS G;  3KG2 A;  4X1K A;  3CCV V;  1XMQ O;  2JS5 A;  4JI4 O;  2Q68 A;  2ZKO A;  4J11 A;  2A0L A;  1SZX A;  1B6Q A;  4JYA O;  2F95 B;  3VQW A;  5CB4 B;  3OTO O;  4LBE C;  3LDD A;  1XNQ O;  3H1I H;  4O4I A;  4DR1 B;  3CWB H;  1XEQ A;  3SJB C;  2C2A A;  2WWW A;  2DJV A;  3K0D A;  1IBM O;  3I5D A;  3J80 N;  3CE2 A;  3GWK C;  4LFC B;  5CA3 A;  4JI5 B;  1R73 A;  2IBZ H;  1P84 F;  2ZNI A;  2PGG A;  2X7R B;  4KL1 A;  2EIL C;  2XHB A;  4IYI A;  2BSK A;  4HNA A;  3E89 A;  4EEQ A;  3HKD A;  3ABU A;  3LDC A;  4FLT A;  2HP8 A;  5H2F Z;  4JTA B;  4FLV A;  2OIE A;  5JQG A;  2N05 A;  3UO3 A;  5B3S C;  1AP5 A;  2X6A A;  1B04 A;  2HJD A;  1HNX B;  3T1C A;  4WBN A;  3EFF K;  4KXR A;  4DW1 A;  1N32 O;  1FXV A;  1QBZ A;  4H0L B;  3UT5 A;  3L73 H;  2CGN A;  4GX0 A;  3ETD A;  4MTO A;  1XMO B;  3JAL A;  3MD0 A;  1ZWI C;  2OTJ V;  4AHC A;  2Q6A A;  2EIM C;  2BCC H;  4DR6 B;  2HVJ C;  3C3S A;  1QVG U;  4DUZ O;  1K73 W;  4CH4 A;  3UQ8 A;  2RN9 A;  5LMN O;  3O65 A;  4JI8 O;  1Q8I A;  3CRR A;  2CAZ C;  4GKJ O;  2PUS A;  4JI0 O;  4ZKI A;  2R70 A;  1TVK A;  2ZIO A;  4XDL A;  1Q82 W;  4X1K B;  2ETN A;  1WP7 A;  3SPC A;  3TXQ A;  1UJW B;  2QEX V;  4LFB B;  4RWU A;  3CCS V;  1EFR G;  3ZHQ A;  3ASN B;  1XQ8 A;  1AR1 B;  3CC4 V;  5IJ0 A;  3T1H B;  1YHQ V;  4UXN A;  2AZ0 A;  1N34 O;  2Y69 B;  4DV4 B;  4LF4 O;  4U3J B;  5LGN A;  3K06 A;  3P3P A;  4UCR A;  1D5A A;  2AHY A;  1PV0 A;  3RYI A;  4DXW A;  4O4J A;  1KD1 W;  2UXC O;  2CTP A;  4Q20 A;  3WB1 A;  3K57 A;  1HNW B;  4DK1 A;  1GO3 F;  3ASN C;  4CC5 A;  1A32 A;  5GW7 A;  1I5Y A;  3EXA A;  4BR6 A;  2GBO A;  3HKD B;  2PTM A;  3IGA C;  4O2A B;  4LC1 A;  1VQ4 V;  1NZ6 A;  1VQP V;  1H2K A;  1UFI A;  2YS8 A;  2YC0 A;  4BIZ A;  2ODM A;  4MSW C;  2QM7 A;  1GM7 A;  3K5O A;  5KAF Z;  3K59 A;  2P06 A;  2HFE C;  1EBO A;  4UVC A;  5IE9 A;  2JGU A;  3ZX6 A;  1YF2 A;  4UCT A;  1Z5W A;  3F5T A;  1Q6I A;  1E1R G;  1R1B A;  3JCZ A;  4JI1 B;  3CC7 V;  5J2U B;  1W0K G;  3SYQ A;  1DK1 A;  4HZ3 A;  1BZK A;  3ASO C;  2NN4 A;  4B3S B;  3TJT A;  2GUZ B;  3AG2 C;  2ZIM A;  4GCZ A;  2A06 H;  1CP9 A;  1Y4M A;  3FB6 C;  4TOI A;  4F4L A;  1S5H C;  4BW9 A;  1FJG B;  4X66 O;  1J95 A;  1SKV A;  1VQ6 V;  2UXC B;  5L3G A;  1EN6 A;  5CA0 A;  1MA1 A;  1N4C A;  4FLU A;  1E79 G;  2A79 B;  2Q4P A;  1YSC A;  2JDI G;  1H8E G;  3FD9 A;  3UCS C;  3CB2 A;  3RYC B;  3MAQ A;  1YJ9 V;  1SS3 A;  2Y0P A;  5LA6 B;  3BAB A;  4FMT A;  4O2B A;  2YID A;  3FB7 C;  1FXK A;  5CBH A;  1OHH G;  1X59 A;  2PYL A;  1AJQ A;  3QF7 A;  1Y67 A;  4GKJ B;  2LW7 A;  4JYY A;  4UB8 Z;  2P22 C;  3CRM A;  4X64 B;  2IJK A;  2WPD G;  2CH7 B;  4PDV A;  4O4L A;  1I94 O;  1LUW A;  4RQE A;  3LSU A;  1AB3 A;  3FB8 C;  3W7W A;  5FL7 G;  2JK5 C;  2B9Z A;  1NVP B;  4DR3 O;  3BA9 A;  2N74 A;  4LF5 B;  2DOS A;  4B3M O;  3B8N A;  3TCU A;  2Q67 A;  1T5E A;  4EKW A;  4RO2 A;  1W2B U;  5LMU O;  3N2K B;  3PN1 A;  1Y74 B;  5LGT A;  4X62 B;  2OCH A;  1KMI Z;  1XIL A;  3CSX A;  1H8H G;  1HNX O;  2H8P C;  4UV9 A;  4GX2 A;  4L8J A;  2F1M A;  3QVN A;  5B66 Z;  2ARH A;  1EM1 A;  2Z0A A;  4XBF A;  4YY3 B;  5K1X A;  2PZS A;  5HFL A;  4DV6 B;  1MAB G;  4YJ2 B;  3T4Z A;  4UCO A;  4LNU A;  3RGB A;  3ZMU A;  1DTO A;  1QLE B;  1VF5 B;  2XAQ A;  4DV2 O;  4MVU A;  4H13 B;  3M99 B;  3BFR A;  5IDJ A;  2ZR3 A;  4TUY A;  1M1K W;  1F23 A;  1IBM B;  3EVK A;  4FVM A;  2XAS A;  5FNV A;  4CH5 A;  3HKC A;  2AHZ A;  4WFA V;  1SET A;  1VP7 A;  3E86 A;  1SQX H;  3BPZ A;  3OR6 C;  3C90 A;  5JJE B;  3QO5 A;  1OCR B;  2K9P A;  4NVP A;  2WA4 A;  2QKA A;  4UB6 Z;  2F4V B;  4B7E A;  4JI4 B;  5B3S B;  2EIN C;  3CCU V;  5LA6 A;  2Y69 C;  2CTR A;  1R3I C;  2XAG A;  2EJ7 A;  1MZF A;  1NKD A;  2DQ3 A;  3LNM B;  3SR2 C;  3CXH F;  2NR5 A;  3J81 N;  3SYC A;  3CCJ V;  1VF6 C;  2W6J G;  2V7Q G;  1IBK B;  3K5N A;  1W59 A;  1EN5 A;  1F4M A;  4TWK A;  4O4L B;  1KP2 A;  4WBN B;  1ORQ C;  4JI2 O;  1F4N A;  4FZ0 A;  3LDE A;  1V54 C;  4JI6 O;  3FB5 C;  2BTQ A;  4PV1 B;  4J80 A;  3CP1 A;  4AI8 A;  4DV0 O;  1QLN A;  2AGA A;  2ITD C;  2EZP A;  3IJ4 A;  4YIP A;  2JEU A;  2CUG A;  3E8H A;  1CXZ B;  4JTD B;  2P6J A;  3FYI B;  1FD9 A;  1Q86 W;  4R8C A;  1HNZ B;  1VQ5 V;  3IAY A;  4LWS B;  1GMG A;  1Q6H A;  1QLE C;  2VQE O;  1IUR A;  1MSD A;  3ZMT A;  2HJF C;  1QCE A;  2QGN A;  1VIB A;  3RVY A;  4JF3 A;  4JI3 B;  1NTZ H;  4FLY A;  2VWK A;  2OCC B;  5EIB D;  5EIB C;  3C3T A;  3ZHR A;  1PM9 A;  1PP9 H;  5IYC O;  3IFX A;  1BSM A;  5KHG A;  1OCR C;  1G6U A;  3HKC B;  3OUS A;  4YHH O;  3B8M A;  4I7Z B;  1RSO B;  1GM9 A;  5IJ0 B;  4FLX A;  1GKF A;  1KC8 W;  3CCE V;  3CCL V;  1HNW O;  2LGW A;  1I0H A;  2OCC C;  3RFR A;  1NQT A;  1ROP A;  4PI0 A;  2LP7 A;  1UPG A;  4UCU A;  2UXB O;  4UUJ C;  1OZ0 A;  1N0J A;  1S3J A;  2EIK C;  3L74 H;  4IT5 A;  3SYA A;  4F6R A;  1ZSP A;  2AW9 A;  3WU2 Z;  1I7F A;  1LUV A;  5LOV B;  1S77 D;  1NTM H;  1PPJ H;  4X1I B;  4GKK B;  5E79 Z;  2YXH A;  3DGE A;  3JCU Z;  3K5M A;  3L75 H;  4PEL A;  1FFX B;  1XL4 A;  2Y4T A;  4LF8 O;  3LUT B;  1AR4 A;  1JX9 A;  2K1E A;  5BR8 B;  3KCY A;  1SF9 A;  3DXR B;  4MW8 A;  1LR1 A;  3JAS B;  1SA0 A;  4Q6G A;  2Y0I A;  5DM6 V;  3HKB B;  1Y66 A;  4UFZ A;  4ZHQ B;  1H2S B;  5B1N A;  1E1Q G;  2DYS B;  4LCU C;  4GX1 A;  2WLI A;  3W7U A;  1Z5V A;  2HKO A;  3QTC A;  1THZ A;  5J2U A;  3BY6 A;  1JR9 A;  1RFY A;  4OGQ B;  4QGP A;  3UKM A;  1YIJ V;  1GN2 A;  1JJ2 U; 
#chains in the Genus database with same CATH homology
 5KUM A;  4ZKI A;  5J9P C;  1KP3 A;  4WFB V;  2ZR2 A;  2PI5 A;  1WLE A;  3ETG A;  3AG4 C;  4KFM A;  4HAM A;  1H2G A;  2W6I G;  4PA7 A;  2DYR C;  1BHB A;  1COW G;  1YI2 V;  1M56 B;  3GWO A;  4XDL A;  1Q82 W;  2ZQM A;  5CBF A;  1K33 A;  3TET A;  3SPC A;  1VQ7 V;  3ZRV A;  4FJC C;  3X2Q B;  1FS0 G;  3OEH G;  1H38 A;  2XAH A;  4MTF A;  3ZMS A;  1VQM V;  1UJW B;  1VQN V;  2QEX V;  4I5S A;  5H9C A;  3AG2 B;  3CCS V;  2NLJ C;  1EFR G;  3JD1 A;  4XDK A;  3ASN B;  3AG4 B;  5CBG A;  4RAI A;  1AR1 B;  2IW5 A;  3CC4 V;  1YHQ V;  4UXN A;  5CMU A;  5BZB A;  1K7D A;  2Y69 B;  4P2Z A;  3OFN G;  4QPK A;  5L3E A;  5LGN A;  3K06 A;  4G28 B;  5EBW C;  4PDR A;  2Z5U A;  2AHY A;  1DF5 A;  1LNQ A;  1K9M W;  4DXW A;  1KD1 W;  3OR7 C;  2YSU B;  1AI5 A;  4GT1 A;  1F51 A;  4Q20 A;  5H6Q A;  5EBM C;  2IU0 A;  3I55 V;  2WLH A;  1OCZ C;  3H01 A;  4WFE A;  4WFG A;  1GO3 F;  3ASN C;  3ZMZ A;  3SPG A;  3VBB A;  3T2M A;  2QTO A;  3EHB B;  5GW7 A;  1I5Y A;  2WLN A;  4G27 B;  4UV8 A;  1QR8 A;  2ZD9 A;  1VQO V;  2BOB C;  3BEH A;  4QPJ A;  3IGA C;  3LSS A;  4UVB A;  2OTL V;  4LC1 A;  1VQ4 V;  4GX5 A;  1VQP V;  4DO2 A;  2QKS A;  4MTG A;  1MG1 A;  4BIZ A;  2EIN B;  4ZBM A;  3OM3 B;  3ZCC A;  4MSW C;  5IYB O;  4MVZ A;  2QM7 A;  4MS2 A;  1GM7 A;  3OEE G;  1S72 V;  2HLD G;  3AG3 C;  4JPR A;  3CCR V;  2LFR A;  2HFE C;  1EBO A;  1PKX A;  2EIJ B;  4UVC A;  4BAY A;  3CC2 V;  1I5X A;  1M90 W;  3JD3 A;  1P4R A;  3MHS C;  1PNL A;  2NNU A;  3QO7 A;  4RUE A;  2YEV B;  3STL C;  2Q69 A;  1E1R G;  3VOU A;  2EZO A;  2F43 G;  3JCZ A;  3G71 V;  3CC7 V;  3SYQ A;  1W0K G;  3OMA B;  3T4D A;  3ABK C;  4J9Z B;  2DYR B;  4HZ3 A;  3ASO C;  3B77 A;  1R3L C;  4X89 A;  1N8R W;  3OAA G;  3R65 A;  3LSQ A;  1K4C C;  4PA3 A;  1YIT V;  3ABM B;  3AG2 C;  3ZN0 A;  1FXH A;  4P30 A;  1WPX A;  4GCZ A;  1YJN V;  1CP9 A;  2QM8 A;  4Z1M G;  5H6R A;  3CXC U;  3AG1 B;  3W7S A;  1Y4M A;  3FB6 C;  4F4L A;  3OW2 U;  2V1D A;  4JAS A;  5L3B A;  1S5H C;  3SYO A;  3SYP A;  1CPY A;  1J95 A;  2P7T C;  2B1G A;  1VQ9 V;  1VQ6 V;  4U7O A;  2WAM A;  1M57 B;  1PNM A;  2P90 A;  3AG1 C;  5L3G A;  2XAF A;  1Q81 W;  1E79 G;  3K08 A;  2XOK G;  3QO8 A;  4JAV A;  3CD6 V;  5IY5 C;  3OMN B;  1RPO A;  5C93 A;  4X88 A;  2A79 B;  3D36 A;  1YSC A;  2JDI G;  1H8E G;  1VQ8 V;  4MT8 A;  3JD2 A;  1JVM A;  3WFV A;  5L3C A;  5LBQ A;  4R50 A;  1K3E A;  2IH3 C;  1DLB A;  1NVP D;  4FK5 C;  1YTF D;  1YJ9 V;  2Y48 A;  1NR7 A;  1SRY A;  4FMT A;  3FB7 C;  1FXK A;  2WLL B;  5CBH A;  5IY5 B;  1OHH G;  1AJP A;  1V54 B;  5EC1 C;  1AJQ A;  4MVM A;  3ZIA G;  5IYD O;  4PA6 A;  3E8G A;  3HB3 B;  4WCE V;  2ZDI A;  5LHG A;  3CCM V;  1VQK V;  4WF9 V;  1FXK C;  2JJ2 G;  1NH2 B;  2UXN A;  2IJK A;  2WPD G;  4PDV A;  1R6K A;  4YXW G;  3ZMV A;  4QE9 A;  3ZN1 A;  4RQE A;  3ZRX A;  3FB8 C;  3W7W A;  5FL7 G;  2JK5 C;  1K92 A;  1NVP B;  1QR9 A;  4MVQ A;  3ZJZ A;  1PNK A;  4R6Z A;  4QNH B;  3E2E A;  3E8F A;  3B8N A;  3TCU A;  2P67 A;  2Q67 A;  4CBC A;  1JPX A;  4EKW A;  2JEX A;  2WLJ A;  4RO2 A;  4HYO A;  3UM7 A;  1W2B U;  3PJS K;  2ZDI C;  5LGT A;  1YJW V;  2YEV A;  1BL8 A;  3AG3 B;  3D3I A;  4QJF B;  3SPJ A;  5B1B C;  4QIW F;  4WFF A;  1H8H G;  3F7Y C;  4E2L A;  1R3J C;  1PL0 A;  5KUK A;  1AJN A;  3MHH C;  3ZRW B;  2H8P C;  1W0J G;  4UV9 A;  4GX2 A;  2HR3 A;  2GSM B;  2R9I A;  3ETE A;  1SZT A;  3JD0 A;  4XBF A;  1JOY A;  3K79 A;  4G2K A;  5HFL A;  3ZRS A;  2IJJ A;  2Z3Y A;  1M57 C;  1XL6 A;  4H33 A;  4JGS A;  1MAB G;  1M9N A;  3T4Z A;  4L87 A;  1JCH A;  2ATK C;  3ZMU A;  1DTO A;  1OCO C;  1QLE B;  2XAQ A;  5EK0 A;  3ABM C;  4MVU A;  3ABK B;  4PA9 A;  4PDM A;  2MK3 A;  3M99 B;  3ASO B;  4N21 A;  5IDJ A;  2D3O W;  4H37 A;  2ZR3 A;  5HFM A;  1M1K W;  3OMI B;  3IC7 A;  3DTU B;  1F23 A;  4I9W A;  5L3F A;  2ZXW C;  2CK3 G;  2XAS A;  1SES A;  4TSF G;  3P30 A;  4J9Y B;  2AHZ A;  3RBZ A;  4OXS A;  4MVS A;  4WFA V;  1SET A;  2KB1 A;  2X6B A;  3AEI A;  2EIK B;  3E86 A;  1EZJ A;  2DWD C;  1HWY A;  4MTX A;  3SJQ C;  3G4S V;  1RM1 C;  1V55 B;  3OR6 C;  3X2Q C;  1GM8 A;  2QE7 G;  1OCZ B;  3E83 A;  3QO5 A;  3W7X A;  2LFS A;  1OCC C;  2ITC C;  1ARO P;  1OCR B;  3I56 V;  3E8B A;  4UVA A;  4PDL A;  5LHH A;  4ASU G;  1BHA A;  3F7V C;  2HG5 C;  2B5U A;  3WG7 C;  5B3S B;  2EIN C;  3CCU V;  3JYC A;  2DQ0 A;  2Y69 C;  2HVK C;  1AI6 A;  5B1A C;  1BMF G;  3ABT A;  1AI7 A;  2WLL A;  1FXK B;  5B1O A;  1JQ0 A;  1Q7Y W;  1R3I C;  2XAG A;  4JTC B;  1NKD A;  2DQ3 A;  1GK9 A;  1CEZ A;  3LNM B;  3CCJ V;  3SYC A;  3K3W A;  2W6J G;  1OCC B;  3QNE A;  3STZ C;  1TUE B;  1NJI W;  2V7Q G;  2H94 A;  4LP8 A;  5B1A B;  4KP4 A;  4FIP C;  4U7N A;  3CMA V;  4PA4 A;  4JYB A;  3FYE B;  3WG7 B;  1MSW D;  3CPW U;  1F4M A;  1YTF B;  1AI4 A;  4TWK A;  3JD4 A;  3RVZ A;  1KP2 A;  3CCQ V;  2GHY A;  3K9A A;  2EIM B;  3CME V;  1ORQ C;  1NBM G;  1F4N A;  3LDE A;  2W0F C;  1V54 C;  1KQS U;  1IXM A;  3FB5 C;  1ENV A;  1G8M A;  3CP1 A;  2XND G;  4P9P A;  1QLN A;  1K8A W;  3A0R A;  4JAU A;  3OGC C;  3GB7 C;  2PI4 A;  2ITD C;  1MOF A;  2EZP A;  4P9O A;  2WLI B;  2FTK A;  3TK1 A;  2JEU A;  3OE7 G;  3E8H A;  4JTD B;  1KEC A;  2B1I A;  2P6J A;  3FYI B;  4JYC A;  2M7W A;  4TT3 G;  1K34 A;  1Q86 W;  4R8C A;  3ZRW A;  1VQ5 V;  2X0L A;  1GMG A;  1K5Q A;  1OCO B;  1QLE C;  1R3K C;  2R9R B;  3K04 A;  5LGU A;  1S76 D;  4N23 A;  2HJF C;  5L3D A;  3ZMT A;  1PD3 A;  2IJI A;  5KA6 A;  4X8A A;  1QCE A;  1VQL V;  1K4D C;  3RVY A;  4JF3 A;  2WLK A;  1L1F A;  2XAJ A;  2JIZ G;  1RM1 B;  2OCC B;  3P32 A;  2X6C A;  2WSS G;  3KG2 A;  3CCV V;  3NXS A;  1K97 A;  1S0V A;  3ML0 A;  2Q68 A;  3IFX A;  5IYC O;  4R7C A;  2A0L A;  4WFH A;  1NH2 D;  1B6Q A;  1OCR C;  3K03 A;  3OUS A;  4LBE C;  3LDD A;  1SER A;  1P7B A;  3B8M A;  1GM9 A;  1GKF A;  2IJH A;  1KC8 W;  1M56 C;  3CCE V;  3CCL V;  2OCC C;  2C2A A;  2WWW A;  5KA5 A;  5LHI A;  5E1A C;  5EBL C;  1NQT A;  3SPI A;  1ROP A;  2LP7 A;  4CZZ A;  3K0D A;  4UUJ C;  1OZ0 A;  4BW5 A;  1S3J A;  2EIK C;  3ABL C;  3SPH A;  5CA3 A;  2ZXW B;  3OUF A;  3SYA A;  1QVF U;  1K5S A;  1R73 A;  1KKD A;  4KUM A;  2X7R B;  2UXX A;  2A9H A;  2EIL C;  1RPR A;  3RW0 A;  2IU3 A;  2QA4 V;  1S77 D;  2EIJ C;  1V55 C;  2BOC C;  3DGE A;  3E89 A;  4MW3 A;  2EBO A;  4PEL A;  3ABU A;  3CYO A;  3LDC A;  1NR1 A;  1XL4 A;  2EIL B;  3LUT B;  4JTA B;  3G6E V;  4FPP A;  4RUF A;  1R6N A;  3K0G A;  3ABL B;  5B1B B;  5CN0 A;  1JX9 A;  5B3S C;  2K1E A;  2X6A A;  1FFT B;  4MW8 A;  2DYS C;  2IH1 C;  1GTO A;  3T1C A;  1G4Y B;  2EJR A;  3EFF K;  3E35 A;  1FXV A;  1QBZ A;  5DM6 V;  1Y66 A;  2DW4 A;  4GX0 A;  4MVO A;  3ETD A;  4MTO A;  4BIU A;  5B1N A;  1E1Q G;  1DF4 A;  2DYS B;  1ZWI C;  3MD0 A;  4GX1 A;  4LCU C;  2OTJ V;  2WLI A;  2Q6A A;  2EIM C;  4MVR A;  3W7U A;  2DWE C;  5DN6 G;  2HVJ C;  2HKO A;  1THZ A;  3W7T A;  1QVG U;  1K73 W;  3BY6 A;  5EC2 C;  3FKS G;  3F5W C;  4QE7 A;  3UKM A;  2JJ1 G;  1YIJ V;  4RQF A;  2OT5 A;  2WLM A;  3HPL C;  1JJ2 U;  4XDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...