2R9UA

Crystal structure of lamprey variable lymphocyte receptor 2913 ectodomain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
HHSAGCPSQCSCDQTLVNCQNIRLASVPAGIPTDKQRLWLNNNQITKLEPGVFDHLVNLQQLYFNSNKLTAIPTGVFDKLTQLTQLDLNDNHLKSIPRGAFDNLKSLTHIYLYNNPWDCECRDIMYLRNWVADHTSIVMRWDGKAVNDPDSAKCAGTNTPVRAVTEASTSPSKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor
publication title Crystal Structure of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain.
rcsb
source organism Petromyzon marinus
molecule tags Immune system
total genus 52
structure length 174
sequence length 174
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2r9uA00
4C2AB 1G9UA 4QBZA 3OGLB 4RWTC 2Q4GW 3WPBA 2Y5QA 3ZYNA 2RA8A 3E6JA 2OMZA 2UZYA 4RCWA 5GMGA 5B0NA 4PQ8A 4M7EC 3DZEA 4EZGA 1OZNA 4Q62A 2WQUA 1QYYA 2WFHA 4R5CA 3RGXA 1D0BA 3KJ4A 4KT1A 4LSXC 4L3FA 4R07A 2ID5A 3RW6A 2Z64A 3P72A 1O6TA 2Z66A 3W3NA 1OOKG 3W3KA 4R6GA 2Z62A 2V9SA 1M9LA 1PGVA 5AWAA 4CILA 3E4GA 3WPIA 4UFRA 3WPGA 5GMFA 3WN4A 4U08A 4R08A 4GT6A 1LTXA 4KNGA 4ECOA 4FMZA 4MN8B 2Z63A 1M10B 3ZYJA 3ZYIA 1A4YA 5GS0A 2O6QA 2ASSB 5IJDA 2UZXA 3PMHG 2WQXA 3C6PB 4BSSA 1H6UA 2CA6A 1SQ0B 4R58A 4FDWA 1KOOA 5AWCA 5LFNA 2V9TB 1FQVA 4ARRA 1Z7XW 3CVRA 3RIZA 4QXEA 4R0AA 4HQ1A 1YRGA 3VQ2A 4LI1A 3UN9A 2Z82A 5GMHA 3WPFA 4AW4A 2FT3A 1U0ND 4P91A 4GLPA 3RFSA 3ZYOA 4R09A 3WPEA 5GS2B 1OTMA 3C6NB 4CC4A 1FS2A 5D3IA 4C2BB 5B0TA 2XOTA 1KOHA 3FXIA 3RGZA 4TZHA 3RFJA 2OMWA 1ZIWA 3G3BA 4NKGA 4Z94G 4U09A 1JL5A 1K5GC 4P8SA 2JE1A 1WWLA 4FHOA 3UL9A 4XOSA 2JQDA 1XEUA 1IO0A 1H6TA 4CNMA 3REZA 1XCDA 3M18A 3UL7A 4Z64C 5AWDA 4AY9X 2OMUA 1OTNA 1P8VA 4J0MA 5GQRK 4PSJA 5B4PA 2ELLA 4LSAA 2O6SA 1XKUA 5HZLB 4FD0A 2A0ZA 3O53A 3ULVA 4CNCA 4BSUA 4PEQB 1GWBA 4WYKA 2OMVA 1DS9A 4LXRA 4U06A 3M19A 4LI2A 4WP6A 1OTOA 3UL8A 3ULUA 1W8AA 4V2CA 4ECNA 2BNHA 2WQWA 4ARNA 3OGMB 3W3JA 4FS7A 4R6AA 4PKIG 4G8AA 4QC0A 2Z81A 3C6OB 4J4LA 3CIGA 3JB9j 4Q3GA 4YEBB 2R9UA 3ULAA 1O6SA 4M7EA 2IFGA 3WPCA 3E3ZA 4Z79A 3G06A 1M0ZA 3G3AA 2XWTC 2JE0A 3OJAB 4Z8GA 1P9AG 1FO1A 3O6NA 2Z7XA 4LSXA 4LXSA 2P1MB 1A9NA 2OMYA 4I6JB 1OGQA 1O6VA 4K17A 4CC4C 4OQTA 5AZ5A 5IJCA 3OJAA 4U7LA 4V2DA 4NKHA 3BZ5A 3WPDA 2RR6A 3G39A 3VQ1A 3W3LA 3GOZA 4XSQA 2O6RA 5IYXC 1XWDC 3OGKB 4L3AA 3E2JA 2WQVA 3SB4A 2BEXA 4V2EA 4R5DA 3RFEA 4FCGA 4KXFB 2ASTB 5A5CA 4MQWX 4R6JA 2OMTA 2V70A 3G04C 5FTTB 5CMPA 4H09A 2P1PB 3CIYA 4LSCA 1XECA 3RW7A 2OMXA 3TSRE 3W3MA 1M9SA 2P1QB 4R6FA 4PERA 2Z65A 1DCEA 3W3GA 1P8TA 4CP6A 4BV4R 3WPHA 5HDHA 4Q3IA 5CMNA 4BSRA 1K5DC 2P1NB 4XGOA 5IJBA 1FT8A 1DFJI 2Z7XB 5AWBA 3RJ0A 4Z61C 4RCAB 4Y61B 3A79B 2P1OB 4IM6A 4B8CD
chains in the Genus database with same CATH superfamily
4C2AB 1G9UA 4QBZA 3OGLB 4RWTC 2Q4GW 3WPBA 2Y5QA 3ZYNA 2RA8A 3E6JA 2OMZA 2UZYA 4RCWA 5GMGA 5B0NA 4PQ8A 4M7EC 3DZEA 4EZGA 1OZNA 4Q62A 2WQUA 1QYYA 2WFHA 4R5CA 3RGXA 1D0BA 3KJ4A 4KT1A 4LSXC 4L3FA 4R07A 2ID5A 3RW6A 2Z64A 3P72A 1O6TA 2Z66A 3W3NA 1OOKG 3W3KA 4R6GA 2Z62A 2V9SA 1M9LA 1PGVA 5AWAA 4CILA 3E4GA 3WPIA 4UFRA 3WPGA 5GMFA 3WN4A 4U08A 4R08A 4GT6A 1LTXA 4KNGA 4ECOA 4FMZA 4MN8B 2Z63A 1M10B 3ZYJA 3ZYIA 1A4YA 5GS0A 2O6QA 2ASSB 5IJDA 2UZXA 3PMHG 2WQXA 3C6PB 4BSSA 1H6UA 2CA6A 1SQ0B 4R58A 4FDWA 1KOOA 5AWCA 5LFNA 2V9TB 1FQVA 4ARRA 1Z7XW 3CVRA 3RIZA 4QXEA 4R0AA 4HQ1A 1YRGA 3VQ2A 4LI1A 3UN9A 2Z82A 5GMHA 3WPFA 4AW4A 2FT3A 1U0ND 4P91A 4GLPA 3RFSA 3ZYOA 4R09A 3WPEA 5GS2B 1OTMA 3C6NB 4CC4A 1FS2A 5D3IA 4C2BB 5B0TA 2XOTA 1KOHA 3FXIA 3RGZA 4TZHA 3RFJA 2OMWA 1ZIWA 3G3BA 4NKGA 4Z94G 4U09A 1JL5A 1K5GC 4P8SA 2JE1A 1WWLA 4FHOA 3UL9A 4XOSA 2JQDA 1XEUA 1IO0A 1H6TA 4CNMA 3REZA 1XCDA 3M18A 3UL7A 4Z64C 5AWDA 4AY9X 2OMUA 1OTNA 1P8VA 4J0MA 5GQRK 4PSJA 5B4PA 2ELLA 4LSAA 2O6SA 1XKUA 5HZLB 4FD0A 2A0ZA 3O53A 3ULVA 4CNCA 4BSUA 4PEQB 1GWBA 4WYKA 2OMVA 1DS9A 4LXRA 4U06A 3M19A 4LI2A 4WP6A 1OTOA 3UL8A 3ULUA 1W8AA 4V2CA 4ECNA 2BNHA 2WQWA 4ARNA 3OGMB 3W3JA 4FS7A 4R6AA 4PKIG 4G8AA 4NZTM 4QC0A 2Z81A 3C6OB 4J4LA 3CIGA 3JB9j 4Q3GA 4YEBB 2R9UA 3ULAA 1O6SA 4M7EA 2IFGA 3WPCA 3E3ZA 4Z79A 3G06A 1M0ZA 3G3AA 2XWTC 2JE0A 3OJAB 4Z8GA 1P9AG 1FO1A 3O6NA 2Z7XA 4LSXA 4LXSA 2P1MB 1A9NA 2OMYA 4I6JB 1OGQA 1O6VA 4K17A 4CC4C 4OQTA 5AZ5A 5IJCA 3OJAA 4U7LA 4V2DA 4NKHA 3BZ5A 3WPDA 2RR6A 3G39A 3VQ1A 3W3LA 3GOZA 4XSQA 2O6RA 5IYXC 1XWDC 3OGKB 4L3AA 3E2JA 2WQVA 3SB4A 2BEXA 4V2EA 4R5DA 3RFEA 4FCGA 4KXFB 2ASTB 5A5CA 4MQWX 4R6JA 2OMTA 2V70A 3G04C 5FTTB 5CMPA 4NZRM 4H09A 2P1PB 3CIYA 4LSCA 1XECA 3RW7A 2OMXA 3TSRE 3W3MA 1M9SA 2P1QB 4R6FA 4PERA 2Z65A 1DCEA 3W3GA 1P8TA 4CP6A 4BV4R 3WPHA 5HDHA 4Q3IA 5CMNA 4BSRA 1K5DC 2P1NB 4XGOA 5IJBA 1FT8A 1DFJI 2Z7XB 5AWBA 3RJ0A 4Z61C 4RCAB 4Y61B 3A79B 2P1OB 4IM6A 4B8CD
chains in the Genus database with same CATH topology
4C2AB 1G9UA 4QBZA 3OGLB 4RWTC 2Q4GW 3WPBA 2Y5QA 3ZYNA 2RA8A 3E6JA 2OMZA 2UZYA 4RCWA 5GMGA 5B0NA 4PQ8A 4M7EC 3DZEA 4EZGA 1OZNA 4Q62A 2WQUA 1QYYA 2WFHA 4R5CA 3RGXA 1D0BA 3KJ4A 4KT1A 4LSXC 4L3FA 4R07A 2ID5A 3RW6A 2Z64A 3P72A 1O6TA 2Z66A 3W3NA 1OOKG 3W3KA 4R6GA 2Z62A 2V9SA 1M9LA 1PGVA 5AWAA 4CILA 3E4GA 3WPIA 4UFRA 3WPGA 5GMFA 3WN4A 4U08A 4R08A 4GT6A 1LTXA 4KNGA 4ECOA 4FMZA 4MN8B 2Z63A 1M10B 3ZYJA 3ZYIA 1A4YA 5GS0A 2O6QA 2ASSB 5IJDA 2UZXA 3PMHG 2WQXA 3C6PB 4BSSA 1H6UA 2CA6A 1SQ0B 4R58A 4FDWA 1KOOA 5AWCA 5LFNA 2V9TB 1FQVA 4ARRA 1Z7XW 3CVRA 3RIZA 4QXEA 4R0AA 4HQ1A 1YRGA 3VQ2A 4LI1A 3UN9A 2Z82A 5GMHA 3WPFA 4AW4A 2FT3A 1U0ND 4P91A 4GLPA 3RFSA 3ZYOA 4R09A 3WPEA 5GS2B 1OTMA 3C6NB 4CC4A 1FS2A 5D3IA 4C2BB 5B0TA 2XOTA 1KOHA 3FXIA 3RGZA 4TZHA 3RFJA 2OMWA 1ZIWA 3G3BA 4NKGA 4Z94G 4U09A 1JL5A 1K5GC 4P8SA 2JE1A 1WWLA 4FHOA 3UL9A 4XOSA 2JQDA 1XEUA 1IO0A 1H6TA 4CNMA 3REZA 1XCDA 3M18A 3UL7A 4Z64C 5AWDA 4AY9X 2OMUA 1OTNA 1P8VA 4J0MA 5GQRK 4PSJA 5B4PA 2ELLA 4LSAA 2O6SA 1XKUA 5HZLB 4FD0A 2A0ZA 3O53A 3ULVA 4CNCA 4BSUA 4PEQB 1GWBA 4WYKA 2OMVA 1DS9A 4LXRA 4U06A 3M19A 4LI2A 4WP6A 1OTOA 3UL8A 3ULUA 1W8AA 4V2CA 4ECNA 2BNHA 2WQWA 4ARNA 3OGMB 3W3JA 4FS7A 4R6AA 4PKIG 4G8AA 4QC0A 2Z81A 3C6OB 4J4LA 3CIGA 3JB9j 4Q3GA 4YEBB 2R9UA 3ULAA 1O6SA 4M7EA 2IFGA 3WPCA 3E3ZA 4Z79A 3G06A 1M0ZA 3G3AA 2XWTC 2JE0A 3OJAB 4Z8GA 1P9AG 1FO1A 3O6NA 2Z7XA 4LSXA 4LXSA 2P1MB 1A9NA 2OMYA 4I6JB 1OGQA 1O6VA 4K17A 4CC4C 4OQTA 5AZ5A 5IJCA 3OJAA 4U7LA 4V2DA 4NKHA 3BZ5A 3WPDA 2RR6A 3G39A 3VQ1A 3W3LA 3GOZA 4XSQA 2O6RA 5IYXC 1XWDC 3OGKB 4L3AA 3E2JA 2WQVA 3SB4A 2BEXA 4V2EA 4R5DA 3RFEA 4FCGA 4KXFB 2ASTB 5A5CA 4MQWX 4R6JA 2OMTA 2V70A 3G04C 5FTTB 5CMPA 4H09A 2P1PB 3CIYA 4LSCA 1XECA 3RW7A 2OMXA 3TSRE 3W3MA 1M9SA 2P1QB 4R6FA 4PERA 2Z65A 1DCEA 3W3GA 1P8TA 4CP6A 4BV4R 3WPHA 5HDHA 4Q3IA 5CMNA 4BSRA 1K5DC 2P1NB 4XGOA 5IJBA 1FT8A 1DFJI 2Z7XB 5AWBA 3RJ0A 4Z61C 4RCAB 4Y61B 3A79B 2P1OB 4IM6A 4B8CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2A B;  1G9U A;  4QBZ A;  3OGL B;  4RWT C;  2Q4G W;  3WPB A;  2Y5Q A;  3ZYN A;  2RA8 A;  3E6J A;  2OMZ A;  2UZY A;  4RCW A;  5GMG A;  5B0N A;  4PQ8 A;  4M7E C;  3DZE A;  4EZG A;  1OZN A;  4Q62 A;  2WQU A;  1QYY A;  2WFH A;  4R5C A;  3RGX A;  1D0B A;  3KJ4 A;  4KT1 A;  4LSX C;  4L3F A;  4R07 A;  2ID5 A;  3RW6 A;  2Z64 A;  3P72 A;  1O6T A;  2Z66 A;  3W3N A;  1OOK G;  3W3K A;  4R6G A;  2Z62 A;  2V9S A;  1M9L A;  1PGV A;  5AWA A;  4CIL A;  3E4G A;  3WPI A;  4UFR A;  3WPG A;  5GMF A;  3WN4 A;  4U08 A;  4R08 A;  4GT6 A;  1LTX A;  4KNG A;  4ECO A;  4FMZ A;  4MN8 B;  2Z63 A;  1M10 B;  3ZYJ A;  3ZYI A;  1A4Y A;  5GS0 A;  2O6Q A;  2ASS B;  5IJD A;  2UZX A;  3PMH G;  2WQX A;  3C6P B;  4BSS A;  1H6U A;  2CA6 A;  1SQ0 B;  4R58 A;  4FDW A;  1KOO A;  5AWC A;  5LFN A;  2V9T B;  1FQV A;  4ARR A;  1Z7X W;  3CVR A;  3RIZ A;  4QXE A;  4R0A A;  4HQ1 A;  1YRG A;  3VQ2 A;  4LI1 A;  3UN9 A;  2Z82 A;  5GMH A;  3WPF A;  4AW4 A;  2FT3 A;  1U0N D;  4P91 A;  4GLP A;  3RFS A;  3ZYO A;  4R09 A;  3WPE A;  5GS2 B;  1OTM A;  3C6N B;  4CC4 A;  1FS2 A;  5D3I A;  4C2B B;  5B0T A;  2XOT A;  1KOH A;  3FXI A;  3RGZ A;  4TZH A;  3RFJ A;  2OMW A;  1ZIW A;  3G3B A;  4NKG A;  4Z94 G;  4U09 A;  1JL5 A;  1K5G C;  4P8S A;  2JE1 A;  1WWL A;  4FHO A;  3UL9 A;  4XOS A;  2JQD A;  1XEU A;  1IO0 A;  1H6T A;  4CNM A;  3REZ A;  1XCD A;  3M18 A;  3UL7 A;  4Z64 C;  5AWD A;  4AY9 X;  2OMU A;  1OTN A;  1P8V A;  4J0M A;  5GQR K;  4PSJ A;  5B4P A;  2ELL A;  4LSA A;  2O6S A;  1XKU A;  5HZL B;  4FD0 A;  2A0Z A;  3O53 A;  3ULV A;  4CNC A;  4BSU A;  4PEQ B;  1GWB A;  4WYK A;  2OMV A;  1DS9 A;  4LXR A;  4U06 A;  3M19 A;  4LI2 A;  4WP6 A;  1OTO A;  3UL8 A;  3ULU A;  1W8A A;  4V2C A;  4ECN A;  2BNH A;  2WQW A;  4ARN A;  3OGM B;  3W3J A;  4FS7 A;  4R6A A;  4PKI G;  4G8A A;  4QC0 A;  2Z81 A;  3C6O B;  4J4L A;  3CIG A;  3JB9 j;  4Q3G A;  4YEB B;  2R9U A;  3ULA A;  1O6S A;  4M7E A;  2IFG A;  3WPC A;  3E3Z A;  4Z79 A;  3G06 A;  1M0Z A;  3G3A A;  2XWT C;  2JE0 A;  3OJA B;  4Z8G A;  1P9A G;  1FO1 A;  3O6N A;  2Z7X A;  4LSX A;  4LXS A;  2P1M B;  1A9N A;  2OMY A;  4I6J B;  1OGQ A;  1O6V A;  4K17 A;  4CC4 C;  4OQT A;  5AZ5 A;  5IJC A;  3OJA A;  4U7L A;  4V2D A;  4NKH A;  3BZ5 A;  3WPD A;  2RR6 A;  3G39 A;  3VQ1 A;  3W3L A;  3GOZ A;  4XSQ A;  2O6R A;  5IYX C;  1XWD C;  3OGK B;  4L3A A;  3E2J A;  2WQV A;  3SB4 A;  2BEX A;  4V2E A;  4R5D A;  3RFE A;  4FCG A;  4KXF B;  2AST B;  5A5C A;  4MQW X;  4R6J A;  2OMT A;  2V70 A;  3G04 C;  5FTT B;  5CMP A;  4H09 A;  2P1P B;  3CIY A;  4LSC A;  1XEC A;  3RW7 A;  2OMX A;  3TSR E;  3W3M A;  1M9S A;  2P1Q B;  4R6F A;  4PER A;  2Z65 A;  1DCE A;  3W3G A;  1P8T A;  4CP6 A;  4BV4 R;  3WPH A;  5HDH A;  4Q3I A;  5CMN A;  4BSR A;  1K5D C;  2P1N B;  4XGO A;  5IJB A;  1FT8 A;  1DFJ I;  2Z7X B;  5AWB A;  3RJ0 A;  4Z61 C;  4RCA B;  4Y61 B;  3A79 B;  2P1O B;  4IM6 A;  4B8C D; 
#chains in the Genus database with same CATH topology
 4C2A B;  1G9U A;  4QBZ A;  3OGL B;  4RWT C;  2Q4G W;  3WPB A;  2Y5Q A;  3ZYN A;  2RA8 A;  3E6J A;  2OMZ A;  2UZY A;  4RCW A;  5GMG A;  5B0N A;  4PQ8 A;  4M7E C;  3DZE A;  4EZG A;  1OZN A;  4Q62 A;  2WQU A;  1QYY A;  2WFH A;  4R5C A;  3RGX A;  1D0B A;  3KJ4 A;  4KT1 A;  4LSX C;  4L3F A;  4R07 A;  2ID5 A;  3RW6 A;  2Z64 A;  3P72 A;  1O6T A;  2Z66 A;  3W3N A;  1OOK G;  3W3K A;  4R6G A;  2Z62 A;  2V9S A;  1M9L A;  1PGV A;  5AWA A;  4CIL A;  3E4G A;  3WPI A;  4UFR A;  3WPG A;  5GMF A;  3WN4 A;  4U08 A;  4R08 A;  4GT6 A;  1LTX A;  4KNG A;  4ECO A;  4FMZ A;  4MN8 B;  2Z63 A;  1M10 B;  3ZYJ A;  3ZYI A;  1A4Y A;  5GS0 A;  2O6Q A;  2ASS B;  5IJD A;  2UZX A;  3PMH G;  2WQX A;  3C6P B;  4BSS A;  1H6U A;  2CA6 A;  1SQ0 B;  4R58 A;  4FDW A;  1KOO A;  5AWC A;  5LFN A;  2V9T B;  1FQV A;  4ARR A;  1Z7X W;  3CVR A;  3RIZ A;  4QXE A;  4R0A A;  4HQ1 A;  1YRG A;  3VQ2 A;  4LI1 A;  3UN9 A;  2Z82 A;  5GMH A;  3WPF A;  4AW4 A;  2FT3 A;  1U0N D;  4P91 A;  4GLP A;  3RFS A;  3ZYO A;  4R09 A;  3WPE A;  5GS2 B;  1OTM A;  3C6N B;  4CC4 A;  1FS2 A;  5D3I A;  4C2B B;  5B0T A;  2XOT A;  1KOH A;  3FXI A;  3RGZ A;  4TZH A;  3RFJ A;  2OMW A;  1ZIW A;  3G3B A;  4NKG A;  4Z94 G;  4U09 A;  1JL5 A;  1K5G C;  4P8S A;  2JE1 A;  1WWL A;  4FHO A;  3UL9 A;  4XOS A;  2JQD A;  1XEU A;  1IO0 A;  1H6T A;  4CNM A;  3REZ A;  1XCD A;  3M18 A;  3UL7 A;  4Z64 C;  5AWD A;  4AY9 X;  2OMU A;  1OTN A;  1P8V A;  4J0M A;  5GQR K;  4PSJ A;  5B4P A;  2ELL A;  4LSA A;  2O6S A;  1XKU A;  5HZL B;  4FD0 A;  2A0Z A;  3O53 A;  3ULV A;  4CNC A;  4BSU A;  4PEQ B;  1GWB A;  4WYK A;  2OMV A;  1DS9 A;  4LXR A;  4U06 A;  3M19 A;  4LI2 A;  4WP6 A;  1OTO A;  3UL8 A;  3ULU A;  1W8A A;  4V2C A;  4ECN A;  2BNH A;  2WQW A;  4ARN A;  3OGM B;  3W3J A;  4FS7 A;  4R6A A;  4PKI G;  4G8A A;  4NZT M;  4QC0 A;  2Z81 A;  3C6O B;  4J4L A;  3CIG A;  3JB9 j;  4Q3G A;  4YEB B;  2R9U A;  3ULA A;  1O6S A;  4M7E A;  2IFG A;  3WPC A;  3E3Z A;  4Z79 A;  3G06 A;  1M0Z A;  3G3A A;  2XWT C;  2JE0 A;  3OJA B;  4Z8G A;  1P9A G;  1FO1 A;  3O6N A;  2Z7X A;  4LSX A;  4LXS A;  2P1M B;  1A9N A;  2OMY A;  4I6J B;  1OGQ A;  1O6V A;  4K17 A;  4CC4 C;  4OQT A;  5AZ5 A;  5IJC A;  3OJA A;  4U7L A;  4V2D A;  4NKH A;  3BZ5 A;  3WPD A;  2RR6 A;  3G39 A;  3VQ1 A;  3W3L A;  3GOZ A;  4XSQ A;  2O6R A;  5IYX C;  1XWD C;  3OGK B;  4L3A A;  3E2J A;  2WQV A;  3SB4 A;  2BEX A;  4V2E A;  4R5D A;  3RFE A;  4FCG A;  4KXF B;  2AST B;  5A5C A;  4MQW X;  4R6J A;  2OMT A;  2V70 A;  3G04 C;  5FTT B;  5CMP A;  4NZR M;  4H09 A;  2P1P B;  3CIY A;  4LSC A;  1XEC A;  3RW7 A;  2OMX A;  3TSR E;  3W3M A;  1M9S A;  2P1Q B;  4R6F A;  4PER A;  2Z65 A;  1DCE A;  3W3G A;  1P8T A;  4CP6 A;  4BV4 R;  3WPH A;  5HDH A;  4Q3I A;  5CMN A;  4BSR A;  1K5D C;  2P1N B;  4XGO A;  5IJB A;  1FT8 A;  1DFJ I;  2Z7X B;  5AWB A;  3RJ0 A;  4Z61 C;  4RCA B;  4Y61 B;  3A79 B;  2P1O B;  4IM6 A;  4B8C D; 
#chains in the Genus database with same CATH homology
 4C2A B;  1G9U A;  4QBZ A;  3OGL B;  4RWT C;  2Q4G W;  3WPB A;  2Y5Q A;  3ZYN A;  2RA8 A;  3E6J A;  2OMZ A;  2UZY A;  4RCW A;  5GMG A;  5B0N A;  4PQ8 A;  4M7E C;  3DZE A;  4EZG A;  1OZN A;  4Q62 A;  2WQU A;  1QYY A;  2WFH A;  4R5C A;  3RGX A;  1D0B A;  3KJ4 A;  4KT1 A;  4LSX C;  4L3F A;  4R07 A;  2ID5 A;  3RW6 A;  2Z64 A;  3P72 A;  1O6T A;  2Z66 A;  3W3N A;  1OOK G;  3W3K A;  4R6G A;  2Z62 A;  2V9S A;  1M9L A;  1PGV A;  5AWA A;  4CIL A;  3E4G A;  3WPI A;  4UFR A;  3WPG A;  5GMF A;  3WN4 A;  4U08 A;  4R08 A;  4GT6 A;  1LTX A;  4KNG A;  4ECO A;  4FMZ A;  4MN8 B;  2Z63 A;  1M10 B;  3ZYJ A;  3ZYI A;  1A4Y A;  5GS0 A;  2O6Q A;  2ASS B;  5IJD A;  2UZX A;  3PMH G;  2WQX A;  3C6P B;  4BSS A;  1H6U A;  2CA6 A;  1SQ0 B;  4R58 A;  4FDW A;  1KOO A;  5AWC A;  5LFN A;  2V9T B;  1FQV A;  4ARR A;  1Z7X W;  3CVR A;  3RIZ A;  4QXE A;  4R0A A;  4HQ1 A;  1YRG A;  3VQ2 A;  4LI1 A;  3UN9 A;  2Z82 A;  5GMH A;  3WPF A;  4AW4 A;  2FT3 A;  1U0N D;  4P91 A;  4GLP A;  3RFS A;  3ZYO A;  4R09 A;  3WPE A;  5GS2 B;  1OTM A;  3C6N B;  4CC4 A;  1FS2 A;  5D3I A;  4C2B B;  5B0T A;  2XOT A;  1KOH A;  3FXI A;  3RGZ A;  4TZH A;  3RFJ A;  2OMW A;  1ZIW A;  3G3B A;  4NKG A;  4Z94 G;  4U09 A;  1JL5 A;  1K5G C;  4P8S A;  2JE1 A;  1WWL A;  4FHO A;  3UL9 A;  4XOS A;  2JQD A;  1XEU A;  1IO0 A;  1H6T A;  4CNM A;  3REZ A;  1XCD A;  3M18 A;  3UL7 A;  4Z64 C;  5AWD A;  4AY9 X;  2OMU A;  1OTN A;  1P8V A;  4J0M A;  5GQR K;  4PSJ A;  5B4P A;  2ELL A;  4LSA A;  2O6S A;  1XKU A;  5HZL B;  4FD0 A;  2A0Z A;  3O53 A;  3ULV A;  4CNC A;  4BSU A;  4PEQ B;  1GWB A;  4WYK A;  2OMV A;  1DS9 A;  4LXR A;  4U06 A;  3M19 A;  4LI2 A;  4WP6 A;  1OTO A;  3UL8 A;  3ULU A;  1W8A A;  4V2C A;  4ECN A;  2BNH A;  2WQW A;  4ARN A;  3OGM B;  3W3J A;  4FS7 A;  4R6A A;  4PKI G;  4G8A A;  4QC0 A;  2Z81 A;  3C6O B;  4J4L A;  3CIG A;  3JB9 j;  4Q3G A;  4YEB B;  2R9U A;  3ULA A;  1O6S A;  4M7E A;  2IFG A;  3WPC A;  3E3Z A;  4Z79 A;  3G06 A;  1M0Z A;  3G3A A;  2XWT C;  2JE0 A;  3OJA B;  4Z8G A;  1P9A G;  1FO1 A;  3O6N A;  2Z7X A;  4LSX A;  4LXS A;  2P1M B;  1A9N A;  2OMY A;  4I6J B;  1OGQ A;  1O6V A;  4K17 A;  4CC4 C;  4OQT A;  5AZ5 A;  5IJC A;  3OJA A;  4U7L A;  4V2D A;  4NKH A;  3BZ5 A;  3WPD A;  2RR6 A;  3G39 A;  3VQ1 A;  3W3L A;  3GOZ A;  4XSQ A;  2O6R A;  5IYX C;  1XWD C;  3OGK B;  4L3A A;  3E2J A;  2WQV A;  3SB4 A;  2BEX A;  4V2E A;  4R5D A;  3RFE A;  4FCG A;  4KXF B;  2AST B;  5A5C A;  4MQW X;  4R6J A;  2OMT A;  2V70 A;  3G04 C;  5FTT B;  5CMP A;  4H09 A;  2P1P B;  3CIY A;  4LSC A;  1XEC A;  3RW7 A;  2OMX A;  3TSR E;  3W3M A;  1M9S A;  2P1Q B;  4R6F A;  4PER A;  2Z65 A;  1DCE A;  3W3G A;  1P8T A;  4CP6 A;  4BV4 R;  3WPH A;  5HDH A;  4Q3I A;  5CMN A;  4BSR A;  1K5D C;  2P1N B;  4XGO A;  5IJB A;  1FT8 A;  1DFJ I;  2Z7X B;  5AWB A;  3RJ0 A;  4Z61 C;  4RCA B;  4Y61 B;  3A79 B;  2P1O B;  4IM6 A;  4B8C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...